BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3293

Length=1539
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009796944.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    545   0.0      Nicotiana sylvestris
emb|CDP18155.1|  unnamed protein product                                541   0.0      Coffea canephora [robusta coffee]
ref|XP_009609766.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    538   0.0      Nicotiana tomentosiformis
ref|XP_009624648.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    523   1e-180   Nicotiana tomentosiformis
ref|XP_004241817.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    519   3e-179   Solanum lycopersicum
ref|XP_009765731.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    516   8e-178   Nicotiana sylvestris
ref|XP_009624646.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    516   1e-177   Nicotiana tomentosiformis
ref|XP_006353707.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    514   4e-177   
ref|XP_011074916.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    512   3e-176   Sesamum indicum [beniseed]
ref|XP_006351173.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    512   3e-176   Solanum tuberosum [potatoes]
ref|XP_002267287.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    511   6e-176   Vitis vinifera
ref|XP_010665012.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    510   2e-175   Vitis vinifera
ref|XP_004250366.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       509   6e-175   
ref|XP_009765726.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    509   7e-175   Nicotiana sylvestris
ref|XP_011074915.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    507   2e-174   Sesamum indicum [beniseed]
ref|XP_010665011.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    504   4e-173   Vitis vinifera
ref|XP_010665010.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    503   9e-173   Vitis vinifera
ref|XP_002534020.1|  protein-tyrosine phosphatase 1, plants, puta...    501   3e-172   Ricinus communis
ref|XP_007201518.1|  hypothetical protein PRUPE_ppa015486mg             500   1e-171   
ref|XP_010094850.1|  Tyrosine-protein phosphatase non-receptor ty...    500   2e-171   
ref|XP_011097280.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    498   7e-171   Sesamum indicum [beniseed]
ref|XP_006473220.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    496   5e-170   Citrus sinensis [apfelsine]
ref|XP_006351174.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    495   1e-169   
ref|XP_010063788.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       494   2e-169   Eucalyptus grandis [rose gum]
ref|XP_006376320.1|  TYROSINE PHOSPHATASE 1 family protein              494   3e-169   Populus trichocarpa [western balsam poplar]
ref|XP_011097272.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    494   4e-169   Sesamum indicum [beniseed]
ref|XP_009375252.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    496   5e-169   Pyrus x bretschneideri [bai li]
ref|XP_006434638.1|  hypothetical protein CICLE_v10001727mg             493   6e-169   Citrus clementina [clementine]
gb|KDO83952.1|  hypothetical protein CISIN_1g019277mg                   492   2e-168   Citrus sinensis [apfelsine]
ref|XP_012081085.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    491   6e-168   Jatropha curcas
ref|XP_010521123.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       490   8e-168   Tarenaya hassleriana [spider flower]
ref|XP_008365849.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    490   1e-167   
ref|XP_008381997.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    489   2e-167   
ref|XP_004290440.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    488   5e-167   Fragaria vesca subsp. vesca
ref|XP_011458440.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    488   5e-167   Fragaria vesca subsp. vesca
ref|XP_010256308.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       488   9e-167   Nelumbo nucifera [Indian lotus]
gb|EYU23943.1|  hypothetical protein MIMGU_mgv1a010376mg                484   8e-166   Erythranthe guttata [common monkey flower]
ref|XP_008237328.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    485   1e-165   Prunus mume [ume]
ref|XP_011038164.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       484   2e-165   Populus euphratica
ref|XP_008237326.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    485   3e-165   
ref|XP_009348840.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    483   5e-165   Pyrus x bretschneideri [bai li]
ref|XP_010428033.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       479   2e-163   Camelina sativa [gold-of-pleasure]
ref|XP_010471199.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    478   5e-163   Camelina sativa [gold-of-pleasure]
ref|XP_009339078.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    478   6e-163   Pyrus x bretschneideri [bai li]
ref|XP_010415897.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    477   7e-163   Camelina sativa [gold-of-pleasure]
ref|XP_012081087.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    477   1e-162   Jatropha curcas
ref|XP_002887394.1|  hypothetical protein ARALYDRAFT_339406             476   4e-162   Arabidopsis lyrata subsp. lyrata
gb|KHG30608.1|  Tyrosine-protein phosphatase non-receptor type 20       474   3e-161   Gossypium arboreum [tree cotton]
ref|XP_007020249.1|  Tyrosine phosphatase 1 isoform 1                   473   6e-161   
gb|AAT35563.1|  protein tyrosine phosphatase                            469   1e-159   Phaseolus vulgaris [French bean]
emb|CDX72837.1|  BnaC06g32850D                                          469   2e-159   
ref|XP_009105847.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       469   3e-159   Brassica rapa
gb|KJB35872.1|  hypothetical protein B456_006G131400                    469   3e-159   Gossypium raimondii
gb|KJB35871.1|  hypothetical protein B456_006G131400                    468   5e-159   Gossypium raimondii
emb|CDX96354.1|  BnaA07g29650D                                          466   3e-158   
gb|KDO83953.1|  hypothetical protein CISIN_1g019277mg                   464   1e-157   Citrus sinensis [apfelsine]
ref|XP_006390734.1|  hypothetical protein EUTSA_v10018624mg             466   3e-157   
gb|KDO83951.1|  hypothetical protein CISIN_1g019277mg                   459   2e-155   Citrus sinensis [apfelsine]
ref|XP_004496384.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    457   1e-154   
emb|CAJ77612.1|  protein tyrosine phosphatase                           455   3e-154   Fagus sylvatica
ref|NP_001237920.1|  tyrosine phosphatase 1                             455   5e-154   Glycine max [soybeans]
ref|XP_010674811.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       455   5e-154   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006588511.1|  PREDICTED: tyrosine phosphatase 1 isoform X1       454   1e-153   Glycine max [soybeans]
ref|NP_177331.1|  tyrosine phosphatase 1                                453   3e-153   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008237327.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    453   5e-153   Prunus mume [ume]
ref|XP_008454599.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    452   6e-153   Cucumis melo [Oriental melon]
gb|AAC68859.1|  protein tyrosine phosphatase 1                          450   4e-152   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003556188.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    449   9e-152   Glycine max [soybeans]
gb|EYU22866.1|  hypothetical protein MIMGU_mgv1a009565mg                446   1e-150   Erythranthe guttata [common monkey flower]
gb|KEH43589.1|  tyrosine phosphatase                                    442   8e-149   Medicago truncatula
ref|XP_007020250.1|  Tyrosine phosphatase 1 isoform 2                   441   1e-148   
ref|XP_008461477.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    443   1e-148   Cucumis melo [Oriental melon]
gb|KJB35865.1|  hypothetical protein B456_006G131400                    439   4e-148   Gossypium raimondii
gb|KHN00785.1|  Tyrosine-protein phosphatase non-receptor type 20       439   8e-148   Glycine soja [wild soybean]
ref|XP_009624649.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    436   6e-147   Nicotiana tomentosiformis
ref|XP_004139702.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       435   2e-145   Cucumis sativus [cucumbers]
ref|XP_007143629.1|  hypothetical protein PHAVU_007G087900g             433   2e-145   Phaseolus vulgaris [French bean]
ref|XP_009624650.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    429   3e-144   Nicotiana tomentosiformis
ref|XP_009765732.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    427   2e-143   Nicotiana sylvestris
ref|XP_006606202.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    425   2e-142   Glycine max [soybeans]
ref|XP_011629159.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    423   2e-141   Amborella trichopoda
ref|XP_011629160.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    422   4e-141   
ref|XP_011629158.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    420   4e-140   Amborella trichopoda
ref|XP_006829464.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    419   1e-139   
ref|XP_011629157.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    416   1e-138   Amborella trichopoda
ref|XP_010930782.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       412   4e-137   Elaeis guineensis
gb|KEH43588.1|  tyrosine phosphatase                                    410   1e-136   Medicago truncatula
ref|XP_011629156.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    411   2e-136   
emb|CAA06615.1|  protein tyrosine phosphatase                           408   8e-136   Pisum sativum [garden pea]
ref|XP_010674720.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    407   2e-135   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008781548.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    406   1e-134   Phoenix dactylifera
ref|XP_009404327.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    400   2e-132   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACY78390.1|  protein tyrosine phosphatase 1                          397   4e-131   Phalaenopsis amabilis
ref|XP_009390761.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    392   2e-129   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB35867.1|  hypothetical protein B456_006G131400                    387   1e-128   Gossypium raimondii
gb|KDO83955.1|  hypothetical protein CISIN_1g019277mg                   377   1e-124   Citrus sinensis [apfelsine]
gb|KJB35868.1|  hypothetical protein B456_006G131400                    376   1e-123   Gossypium raimondii
ref|XP_008381998.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    373   6e-123   
gb|KCW71045.1|  hypothetical protein EUGRSUZ_F04145                     371   9e-122   Eucalyptus grandis [rose gum]
ref|XP_009390760.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    367   2e-119   
ref|XP_008781549.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    362   2e-118   Phoenix dactylifera
gb|ABK26026.1|  unknown                                                 362   2e-117   Picea sitchensis
ref|XP_008381013.1|  PREDICTED: LOW QUALITY PROTEIN: protein-tyro...    354   2e-115   
ref|XP_007020251.1|  Tyrosine phosphatase 1 isoform 3                   350   9e-114   
gb|KJB35866.1|  hypothetical protein B456_006G131400                    348   3e-113   Gossypium raimondii
gb|KJB35870.1|  hypothetical protein B456_006G131400                    347   8e-113   Gossypium raimondii
ref|XP_006606203.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    338   5e-109   Glycine max [soybeans]
ref|XP_004299356.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    341   5e-109   Fragaria vesca subsp. vesca
ref|NP_974127.1|  tyrosine phosphatase 1                                336   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008454604.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    333   2e-107   
ref|XP_007227330.1|  hypothetical protein PRUPE_ppa016082mg             335   5e-107   
ref|XP_008461478.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    325   2e-103   Cucumis melo [Oriental melon]
ref|XP_008358192.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    325   1e-102   
gb|AAG52227.1|AC021665_10  protein tyrosine phosphatase, 5'-parti...    281   1e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010237888.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    283   2e-85    
dbj|BAJ94079.1|  predicted protein                                      280   4e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ98480.1|  predicted protein                                      280   5e-85    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB35864.1|  hypothetical protein B456_006G131400                    270   1e-83    Gossypium raimondii
gb|EPS61126.1|  hypothetical protein M569_13673                         268   3e-83    Genlisea aurea
dbj|BAK00963.1|  predicted protein                                      274   5e-83    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT13080.1|  Tyrosine-protein phosphatase non-receptor type 20       266   4e-81    
ref|XP_002442903.1|  hypothetical protein SORBIDRAFT_08g004710          268   5e-81    Sorghum bicolor [broomcorn]
ref|XP_010239266.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    273   3e-80    
ref|XP_006301380.1|  hypothetical protein CARUB_v10021792mg             266   9e-80    
ref|XP_008454605.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    257   3e-78    
ref|NP_001149088.1|  receptor-type tyrosine-protein phosphatase S       256   2e-76    Zea mays [maize]
ref|XP_008461479.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    253   1e-75    Cucumis melo [Oriental melon]
ref|XP_002326005.2|  hypothetical protein POPTR_0019s11590g             248   5e-75    
gb|ACF86150.1|  unknown                                                 249   6e-74    Zea mays [maize]
gb|KGN44430.1|  hypothetical protein Csa_7G290530                       248   1e-73    Cucumis sativus [cucumbers]
ref|XP_010238660.1|  PREDICTED: protein-tyrosine-phosphatase PTP1       245   2e-73    Brachypodium distachyon [annual false brome]
ref|XP_001774836.1|  predicted protein                                  244   4e-73    
ref|XP_009363145.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    249   9e-73    
ref|XP_006662779.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    244   1e-72    Oryza brachyantha
ref|XP_002450425.1|  hypothetical protein SORBIDRAFT_05g005210          250   3e-72    
ref|XP_004977238.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    242   4e-72    Setaria italica
ref|XP_002966338.1|  hypothetical protein SELMODRAFT_66231              243   4e-72    
ref|NP_001066289.1|  Os12g0174800                                       243   6e-72    
ref|XP_002978222.1|  hypothetical protein SELMODRAFT_56201              242   7e-72    
ref|XP_006345138.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    237   2e-71    Solanum tuberosum [potatoes]
gb|EAY82439.1|  hypothetical protein OsI_37652                          240   9e-71    Oryza sativa Indica Group [Indian rice]
ref|XP_006664386.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    238   3e-70    
ref|XP_004978856.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    234   5e-69    
ref|XP_004978858.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    234   8e-69    
ref|XP_006662780.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    228   3e-67    Oryza brachyantha
gb|AAX96301.1|  Protein-tyrosine phosphatase                            228   5e-67    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001751306.1|  predicted protein                                  230   8e-66    
gb|EMS67302.1|  Tyrosine-protein phosphatase Lar-like protein           226   3e-65    Triticum urartu
gb|KCW71046.1|  hypothetical protein EUGRSUZ_F04145                     221   2e-64    Eucalyptus grandis [rose gum]
gb|EEC67788.1|  hypothetical protein OsI_35345                          223   3e-64    Oryza sativa Indica Group [Indian rice]
gb|EMT05398.1|  Tyrosine-protein phosphatase Lar-like protein           214   1e-61    
gb|EEE51752.1|  hypothetical protein OsJ_33184                          209   9e-59    Oryza sativa Japonica Group [Japonica rice]
gb|KGN44428.1|  hypothetical protein Csa_7G290510                       192   1e-54    Cucumis sativus [cucumbers]
ref|XP_001696901.1|  protein tyrosine phosphatase 3                     187   2e-51    Chlamydomonas reinhardtii
ref|NP_001169094.1|  uncharacterized protein LOC100382937               178   6e-49    
gb|EPS63074.1|  hypothetical protein M569_11713                         176   7e-49    Genlisea aurea
ref|XP_005644093.1|  hypothetical protein COCSUDRAFT_67695              183   8e-49    Coccomyxa subellipsoidea C-169
ref|XP_002953490.1|  hypothetical protein VOLCADRAFT_82191              182   3e-48    Volvox carteri f. nagariensis
ref|XP_006345139.1|  PREDICTED: protein-tyrosine-phosphatase PTP1...    175   3e-48    
dbj|GAM18917.1|  hypothetical protein SAMD00019534_020920               176   1e-45    Acytostelium subglobosum LB1
ref|XP_004356068.1|  protein-tyrosine phosphatase 1                     174   4e-45    Cavenderia fasciculata
ref|XP_009888039.1|  PREDICTED: receptor-type tyrosine-protein ph...    180   8e-45    Charadrius vociferus
ref|XP_010133273.1|  PREDICTED: receptor-type tyrosine-protein ph...    176   9e-45    Buceros rhinoceros silvestris
gb|EFA76454.1|  protein-tyrosine phosphatase 1                          174   2e-44    Heterostelium album PN500
ref|XP_009645647.1|  PREDICTED: receptor-type tyrosine-protein ph...    177   3e-44    Egretta garzetta
ref|XP_010019842.1|  PREDICTED: receptor-type tyrosine-protein ph...    174   7e-44    Nestor notabilis
gb|KFP49996.1|  Receptor-type tyrosine-protein phosphatase kappa        169   9e-44    Cathartes aura
gb|KGL97037.1|  Receptor-type tyrosine-protein phosphatase kappa        169   9e-44    Charadrius vociferus
gb|KFP04251.1|  Receptor-type tyrosine-protein phosphatase kappa        169   1e-43    Calypte anna
ref|XP_007260074.1|  PREDICTED: receptor-type tyrosine-protein ph...    172   1e-43    
gb|KFV53676.1|  Receptor-type tyrosine-protein phosphatase kappa        169   1e-43    Gavia stellata
ref|XP_784869.2|  PREDICTED: receptor-type tyrosine-protein phosp...    169   2e-43    Strongylocentrotus purpuratus [purple urchin]
ref|XP_009923016.1|  PREDICTED: receptor-type tyrosine-protein ph...    173   2e-43    Haliaeetus albicilla
ref|XP_010568166.1|  PREDICTED: receptor-type tyrosine-protein ph...    173   2e-43    Haliaeetus leucocephalus
gb|KFO89010.1|  Receptor-type tyrosine-protein phosphatase kappa        168   2e-43    Buceros rhinoceros silvestris
ref|XP_008119911.1|  PREDICTED: receptor-type tyrosine-protein ph...    176   3e-43    
dbj|GAM20689.1|  hypothetical protein SAMD00019534_038640               169   3e-43    Acytostelium subglobosum LB1
ref|XP_004358810.1|  protein tyrosine phosphatase                       166   4e-43    Cavenderia fasciculata
gb|KFQ55990.1|  Receptor-type tyrosine-protein phosphatase kappa        167   7e-43    Nestor notabilis
ref|XP_008641244.1|  PREDICTED: receptor-type tyrosine-protein ph...    171   7e-43    
ref|XP_009894702.1|  PREDICTED: receptor-type tyrosine-protein ph...    171   9e-43    Picoides pubescens
ref|XP_009955762.1|  PREDICTED: receptor-type tyrosine-protein ph...    171   9e-43    Leptosomus discolor
ref|XP_011407047.1|  PREDICTED: receptor-type tyrosine-protein ph...    171   1e-42    
pdb|1NWL|A  Chain A, Crystal Structure Of The Ptp1b Complexed Wit...    165   1e-42    Homo sapiens [man]
ref|XP_009483938.1|  PREDICTED: receptor-type tyrosine-protein ph...    171   1e-42    Pelecanus crispus
gb|KFV69414.1|  Tyrosine-protein phosphatase non-receptor type 1        167   1e-42    Picoides pubescens
pdb|1BZH|A  Chain A, Cyclic Peptide Inhibitor Of Human Ptp1b            164   1e-42    Homo sapiens [man]
pdb|1ECV|A  Chain A, Crystal Structure Of Protein Tyrosine Phosph...    164   1e-42    Homo sapiens [man]
ref|XP_008496426.1|  PREDICTED: receptor-type tyrosine-protein ph...    173   1e-42    Calypte anna
ref|XP_009977801.1|  PREDICTED: receptor-type tyrosine-protein ph...    171   1e-42    Tauraco erythrolophus
gb|KFQ52922.1|  Receptor-type tyrosine-protein phosphatase kappa        166   1e-42    Pelecanus crispus
gb|KFQ68023.1|  Receptor-type tyrosine-protein phosphatase kappa        166   1e-42    Phaethon lepturus
gb|KFW71638.1|  Receptor-type tyrosine-protein phosphatase kappa        166   1e-42    Pygoscelis adeliae
ref|XP_006629971.1|  PREDICTED: tyrosine-protein phosphatase non-...    171   1e-42    Lepisosteus oculatus
ref|XP_002611110.1|  hypothetical protein BRAFLDRAFT_206217             170   2e-42    Branchiostoma floridae
ref|XP_011599120.1|  PREDICTED: receptor-type tyrosine-protein ph...    171   2e-42    Aquila chrysaetos canadensis
ref|XP_002155297.2|  PREDICTED: receptor-type tyrosine-protein ph...    171   2e-42    
gb|KFV12427.1|  Receptor-type tyrosine-protein phosphatase kappa        166   2e-42    Pterocles gutturalis
pdb|1BZC|A  Chain A, Human Ptp1b Catalytic Domain Complexed With Tpi    164   2e-42    Homo sapiens [man]
ref|XP_009683697.1|  PREDICTED: receptor-type tyrosine-protein ph...    170   2e-42    Struthio camelus australis
ref|XP_001635917.1|  predicted protein                                  169   2e-42    Nematostella vectensis
ref|XP_002127301.1|  PREDICTED: receptor-type tyrosine-protein ph...    172   2e-42    Ciona intestinalis [sea vase]
pdb|3QCL|A  Chain A, Human Receptor Protein Tyrosine Phosphatase ...    164   3e-42    Homo sapiens [man]
ref|XP_005524932.1|  PREDICTED: tyrosine-protein phosphatase non-...    167   3e-42    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_002948414.1|  hypothetical protein VOLCADRAFT_45223              162   3e-42    Volvox carteri f. nagariensis
pdb|1L8G|A  Chain A, Crystal Structure Of Ptp1b Complexed With 7-...    164   3e-42    Homo sapiens [man]
ref|XP_003463711.1|  PREDICTED: tyrosine-protein phosphatase non-...    167   3e-42    Cavia porcellus [guinea pig]
gb|KFQ83372.1|  Receptor-type tyrosine-protein phosphatase kappa        165   3e-42    Phoenicopterus ruber ruber
pdb|2H4V|A  Chain A, Crystal Structure Of The Human Tyrosine Rece...    164   3e-42    Homo sapiens [man]
gb|KFM13528.1|  Receptor-type tyrosine-protein phosphatase kappa        165   3e-42    Aptenodytes forsteri
ref|XP_005235887.1|  PREDICTED: receptor-type tyrosine-protein ph...    169   3e-42    
ref|XP_011670232.1|  PREDICTED: tyrosine-protein phosphatase non-...    169   3e-42    Strongylocentrotus purpuratus [purple urchin]
dbj|BAD02404.1|  protein tyrosine phosphatase e                         169   4e-42    Oryzias latipes [Japanese rice fish]
ref|XP_011206340.1|  PREDICTED: tyrosine-protein phosphatase non-...    168   4e-42    
gb|KFP94960.1|  Receptor-type tyrosine-protein phosphatase kappa        165   4e-42    Haliaeetus albicilla
pdb|1G7F|A  Chain A, Human Ptp1b Catalytic Domain Complexed With ...    163   4e-42    Homo sapiens [man]
pdb|1G7G|A  Chain A, Human Ptp1b Catalytic Domain Complexes With ...    163   4e-42    Homo sapiens [man]
pdb|2NT7|A  Chain A, Crystal Structure Of Ptp1b-inhibitor Complex       163   4e-42    Homo sapiens [man]
pdb|3QCB|A  Chain A, Human Receptor Protein Tyrosine Phosphatase ...    163   4e-42    Homo sapiens [man]
pdb|1BZJ|A  Chain A, Human Ptp1b Complexed With Tpicooh                 163   4e-42    Homo sapiens [man]
ref|XP_011670231.1|  PREDICTED: tyrosine-protein phosphatase non-...    169   5e-42    Strongylocentrotus purpuratus [purple urchin]
pdb|1C86|A  Chain A, Crystal Structure Of Protein Tyrosine Phosph...    163   5e-42    Homo sapiens [man]
gb|KFV86644.1|  Receptor-type tyrosine-protein phosphatase kappa        165   5e-42    Struthio camelus australis
pdb|2CM2|A  Chain A, Structure Of Protein Tyrosine Phosphatase 1b...    163   5e-42    Homo sapiens [man]
pdb|2AZR|A  Chain A, Crystal Structure Of Ptp1b With Bicyclic Thi...    163   5e-42    Homo sapiens [man]
pdb|2PBN|A  Chain A, Crystal Structure Of The Human Tyrosine Rece...    163   5e-42    Homo sapiens [man]
ref|NP_001098558.1|  protein tyrosine phosphatase e                     169   5e-42    Oryzias latipes [Japanese rice fish]
pdb|3SME|A  Chain A, Structure Of Ptp1b Inactivated By H2o2BICARB...    163   5e-42    Homo sapiens [man]
pdb|3QCM|A  Chain A, Human Receptor Protein Tyrosine Phosphatase ...    163   6e-42    Homo sapiens [man]
ref|XP_007905141.1|  PREDICTED: tyrosine-protein phosphatase non-...    168   6e-42    Callorhinchus milii [Australian ghost shark]
gb|EMP25998.1|  Tyrosine-protein phosphatase non-receptor type 11       168   7e-42    Chelonia mydas [green seaturtle]
pdb|1NL9|A  Chain A, Potent, Selective Protein Tyrosine Phosphata...    163   7e-42    Homo sapiens [man]
ref|XP_010393398.1|  PREDICTED: receptor-type tyrosine-protein ph...    169   7e-42    
ref|XP_009466664.1|  PREDICTED: receptor-type tyrosine-protein ph...    171   7e-42    Nipponia nippon
ref|XP_007905142.1|  PREDICTED: tyrosine-protein phosphatase non-...    168   7e-42    Callorhinchus milii [Australian ghost shark]
gb|KFZ69517.1|  Receptor-type tyrosine-protein phosphatase kappa        164   7e-42    Podiceps cristatus
pdb|2CMA|A  Chain A, Structural Basis For Inhibition Of Protein T...    163   8e-42    Homo sapiens [man]
emb|CAQ14262.1|  protein tyrosine phosphatase 1b                        166   8e-42    Danio rerio [leopard danio]
dbj|BAC06424.1|  protein tyrosine phosphatase e                         165   8e-42    Oryzias latipes [Japanese rice fish]
ref|XP_007070311.1|  PREDICTED: tyrosine-protein phosphatase non-...    168   9e-42    
ref|XP_005508139.1|  PREDICTED: receptor-type tyrosine-protein ph...    168   9e-42    Columba livia [carrier pigeon]
ref|NP_570999.1|  tyrosine-protein phosphatase non-receptor type 1      166   9e-42    
emb|CAC33882.1|  receptor protein tyrosine phosphatase                  171   9e-42    Geodia cydonium
ref|XP_007905140.1|  PREDICTED: tyrosine-protein phosphatase non-...    168   9e-42    Callorhinchus milii [Australian ghost shark]
gb|AAH54648.1|  Protein tyrosine phosphatase 1b                         165   9e-42    Danio rerio [leopard danio]
ref|XP_005412662.1|  PREDICTED: tyrosine-protein phosphatase non-...    164   9e-42    Chinchilla lanigera
ref|XP_005412666.1|  PREDICTED: tyrosine-protein phosphatase non-...    164   1e-41    Chinchilla lanigera
gb|KFQ00833.1|  Receptor-type tyrosine-protein phosphatase kappa        164   1e-41    Leptosomus discolor
ref|XP_011206337.1|  PREDICTED: tyrosine-protein phosphatase non-...    168   1e-41    
emb|CDJ85585.1|  Protein-tyrosine phosphatase domain containing p...    166   1e-41    Haemonchus contortus [red stomach worm]
gb|KFP22977.1|  Receptor-type tyrosine-protein phosphatase kappa        164   1e-41    Egretta garzetta
pir||JC8052  protein tyrosine phosphatase epsilon - Japanese medaka     168   1e-41 
ref|XP_002186948.2|  PREDICTED: tyrosine-protein phosphatase non-...    165   1e-41    Taeniopygia guttata
ref|XP_005074487.1|  PREDICTED: tyrosine-protein phosphatase non-...    165   1e-41    Mesocricetus auratus [Syrian golden hamster]
ref|XP_011206339.1|  PREDICTED: tyrosine-protein phosphatase non-...    167   1e-41    
gb|KFU90432.1|  Tyrosine-protein phosphatase non-receptor type 1        165   1e-41    Chaetura pelagica
ref|XP_011206336.1|  PREDICTED: tyrosine-protein phosphatase non-...    167   1e-41    
ref|XP_005392372.1|  PREDICTED: tyrosine-protein phosphatase non-...    165   1e-41    Chinchilla lanigera
ref|NP_001017121.2|  tyrosine-protein phosphatase non-receptor ty...    165   1e-41    Xenopus tropicalis [western clawed frog]
ref|XP_005392371.1|  PREDICTED: tyrosine-protein phosphatase non-...    165   1e-41    Chinchilla lanigera
pdb|4BJO|A  Chain A, Nitrate In The Active Site Of Ptp1b Is A Put...    163   1e-41    Homo sapiens [man]
ref|XP_010567952.1|  PREDICTED: tyrosine-protein phosphatase non-...    165   1e-41    Haliaeetus leucocephalus
gb|AAH49294.1|  Ptp1b protein                                           165   1e-41    Danio rerio [leopard danio]
ref|XP_010300360.1|  PREDICTED: receptor-type tyrosine-protein ph...    167   1e-41    Balearica regulorum gibbericeps
ref|XP_011206335.1|  PREDICTED: tyrosine-protein phosphatase non-...    167   2e-41    Bactrocera dorsalis [papaya fruit fly]
ref|XP_008320617.1|  PREDICTED: receptor-type tyrosine-protein ph...    167   2e-41    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_011576974.1|  PREDICTED: tyrosine-protein phosphatase non-...    166   2e-41    Aquila chrysaetos canadensis
ref|XP_003389752.1|  PREDICTED: receptor-type tyrosine-protein ph...    168   2e-41    
gb|KFV10733.1|  Receptor-type tyrosine-protein phosphatase kappa        163   2e-41    Tauraco erythrolophus
pdb|4I8N|A  Chain A, Crystal Structure Of Protein Tyrosine Phosph...    163   2e-41    Homo sapiens [man]
gb|KFO74561.1|  Tyrosine-protein phosphatase non-receptor type 1        164   2e-41    Cuculus canorus
ref|XP_005412656.1|  PREDICTED: tyrosine-protein phosphatase non-...    163   2e-41    Chinchilla lanigera
ref|XP_969316.1|  PREDICTED: tyrosine-protein phosphatase non-rec...    165   2e-41    Tribolium castaneum [rust-red flour beetle]
gb|ERE91225.1|  tyrosine-protein phosphatase non-receptor type 20...    164   2e-41    Cricetulus griseus [Chinese hamsters]
pdb|4QAP|A  Chain A, The Second Sphere Residue T263 Is Important ...    161   2e-41    Homo sapiens [man]
gb|KFQ22381.1|  Tyrosine-protein phosphatase non-receptor type 1        164   2e-41    Merops nubicus
ref|XP_011206334.1|  PREDICTED: tyrosine-protein phosphatase non-...    167   2e-41    Bactrocera dorsalis [papaya fruit fly]
gb|EMC84301.1|  Receptor-type tyrosine-protein phosphatase mu           163   2e-41    
gb|AAA91186.1|  protein tyrosine phosphatase                            162   2e-41    Gallus gallus [bantam]
ref|XP_006518793.1|  PREDICTED: tyrosine-protein phosphatase non-...    159   2e-41    
gb|KFR10104.1|  Tyrosine-protein phosphatase non-receptor type 1        164   2e-41    
gb|EAW75624.1|  protein tyrosine phosphatase, non-receptor type 1...    162   2e-41    
ref|XP_008190655.1|  PREDICTED: tyrosine-protein phosphatase non-...    165   2e-41    
gb|KFV05275.1|  Tyrosine-protein phosphatase non-receptor type 1        164   2e-41    
gb|KFQ97324.1|  Tyrosine-protein phosphatase non-receptor type 1        164   2e-41    
ref|XP_005755424.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   2e-41    
gb|KFV64222.1|  Receptor-type tyrosine-protein phosphatase kappa        162   3e-41    
ref|NP_001073618.1|  tyrosine-protein phosphatase non-receptor ty...    164   3e-41    
ref|NP_990206.1|  tyrosine-protein phosphatase non-receptor type 1      164   3e-41    
gb|KFQ30331.1|  Tyrosine-protein phosphatase non-receptor type 1        164   3e-41    
ref|XP_004910940.1|  PREDICTED: tyrosine-protein phosphatase non-...    166   3e-41    
ref|XP_008833383.1|  PREDICTED: tyrosine-protein phosphatase non-...    164   3e-41    
ref|XP_009874004.1|  PREDICTED: receptor-type tyrosine-protein ph...    167   3e-41    
ref|NP_001116928.1|  tyrosine-protein phosphatase non-receptor ty...    166   3e-41    
gb|KFO53350.1|  Tyrosine-protein phosphatase non-receptor type 1        163   3e-41    
gb|KFP83774.1|  Receptor-type tyrosine-protein phosphatase kappa        162   3e-41    
ref|XP_011292290.1|  PREDICTED: tyrosine-protein phosphatase non-...    166   4e-41    
ref|XP_004636095.1|  PREDICTED: tyrosine-protein phosphatase non-...    164   4e-41    
ref|XP_005362909.1|  PREDICTED: tyrosine-protein phosphatase non-...    164   4e-41    
ref|XP_007663860.1|  PREDICTED: LOW QUALITY PROTEIN: tyrosine-pro...    166   4e-41    
ref|XP_005324638.1|  PREDICTED: tyrosine-protein phosphatase non-...    164   4e-41    
gb|KFQ04694.1|  Tyrosine-protein phosphatase non-receptor type 1        163   4e-41    
gb|EOB08070.1|  Tyrosine-protein phosphatase non-receptor type 1        163   4e-41    
ref|XP_006141335.1|  PREDICTED: tyrosine-protein phosphatase non-...    164   4e-41    
gb|KFW85771.1|  Tyrosine-protein phosphatase non-receptor type 1        163   4e-41    
pdb|2FJM|A  Chain A, The Structure Of Phosphotyrosine Phosphatase...    160   4e-41    
gb|KFP25392.1|  Tyrosine-protein phosphatase non-receptor type 1        163   4e-41    
ref|XP_006921972.1|  PREDICTED: tyrosine-protein phosphatase non-...    163   5e-41    
gb|KFP78938.1|  Receptor-type tyrosine-protein phosphatase kappa        162   5e-41    
gb|KFQ80304.1|  Tyrosine-protein phosphatase non-receptor type 1        163   5e-41    
gb|KFV43730.1|  Tyrosine-protein phosphatase non-receptor type 1        163   5e-41    
gb|KFV14256.1|  Tyrosine-protein phosphatase non-receptor type 1        163   5e-41    
ref|XP_011482437.1|  PREDICTED: protein tyrosine phosphatase e is...    166   5e-41    
ref|XP_006992687.1|  PREDICTED: tyrosine-protein phosphatase non-...    163   5e-41    
gb|AAI48298.1|  PTPRS protein                                           163   5e-41    
gb|KFP63549.1|  Tyrosine-protein phosphatase non-receptor type 1        163   5e-41    
gb|KGL99927.1|  Tyrosine-protein phosphatase non-receptor type 1        163   5e-41    
gb|KHN75199.1|  Tyrosine-protein phosphatase Lar-like                   169   5e-41    
ref|XP_010289310.1|  PREDICTED: receptor-type tyrosine-protein ph...    166   5e-41    
gb|KFP04107.1|  Tyrosine-protein phosphatase non-receptor type 1        163   5e-41    
ref|XP_005010510.1|  PREDICTED: tyrosine-protein phosphatase non-...    163   5e-41    
ref|XP_010619567.1|  PREDICTED: receptor-type tyrosine-protein ph...    166   5e-41    
ref|XP_010864089.1|  PREDICTED: LOW QUALITY PROTEIN: tyrosine-pro...    167   5e-41    
ref|XP_004899067.1|  PREDICTED: receptor-type tyrosine-protein ph...    165   6e-41    
ref|XP_011183364.1|  PREDICTED: tyrosine-protein phosphatase non-...    166   6e-41    
ref|XP_006235701.1|  PREDICTED: tyrosine-protein phosphatase non-...    163   6e-41    
ref|XP_004062408.1|  PREDICTED: tyrosine-protein phosphatase non-...    163   6e-41    
pdb|1PTV|A  Chain A, Crystal Structure Of Protein Tyrosine Phosph...    160   6e-41    
dbj|BAE42421.1|  unnamed protein product                                160   6e-41    
pdb|1PTU|A  Chain A, Crystal Structure Of Protein Tyrosine Phosph...    160   6e-41    
ref|XP_010783884.1|  PREDICTED: receptor-type tyrosine-protein ph...    166   6e-41    
ref|XP_008312334.1|  PREDICTED: receptor-type tyrosine-protein ph...    166   6e-41    
ref|XP_003904667.1|  PREDICTED: tyrosine-protein phosphatase non-...    163   6e-41    
dbj|BAE25813.1|  unnamed protein product                                166   6e-41    
ref|XP_010382142.1|  PREDICTED: tyrosine-protein phosphatase non-...    163   6e-41    
ref|XP_003787742.1|  PREDICTED: tyrosine-protein phosphatase non-...    163   7e-41    
ref|XP_008012429.1|  PREDICTED: tyrosine-protein phosphatase non-...    163   7e-41    
ref|XP_010775115.1|  PREDICTED: receptor-type tyrosine-protein ph...    160   7e-41    
ref|NP_036769.1|  tyrosine-protein phosphatase non-receptor type 1      163   7e-41    
gb|EAW75625.1|  protein tyrosine phosphatase, non-receptor type 1...    163   7e-41    
ref|XP_011183363.1|  PREDICTED: tyrosine-protein phosphatase non-...    166   7e-41    
ref|XP_004875540.1|  PREDICTED: receptor-type tyrosine-protein ph...    165   7e-41    
gb|AAP36363.1|  Homo sapiens protein tyrosine phosphatase, non-re...    163   7e-41    
gb|KFW74527.1|  Tyrosine-protein phosphatase non-receptor type 1        162   7e-41    
gb|ABG89396.1|  protein tyrosine phosphatases epsilon variant 2         166   7e-41    
ref|XP_006518020.1|  PREDICTED: receptor-type tyrosine-protein ph...    166   7e-41    
ref|XP_011784209.1|  PREDICTED: tyrosine-protein phosphatase non-...    163   7e-41    
ref|XP_011721170.1|  PREDICTED: tyrosine-protein phosphatase non-...    163   7e-41    
ref|NP_002818.1|  tyrosine-protein phosphatase non-receptor type ...    163   7e-41    
gb|EHH65248.1|  Tyrosine-protein phosphatase non-receptor type 1        163   7e-41    
ref|NP_001245122.1|  tyrosine-protein phosphatase non-receptor ty...    163   7e-41    
gb|KFW03512.1|  Tyrosine-protein phosphatase non-receptor type 1        162   7e-41    
gb|KFP42439.1|  Tyrosine-protein phosphatase non-receptor type 1        162   7e-41    
dbj|BAE34987.1|  unnamed protein product                                165   8e-41    
gb|KFQ15238.1|  Tyrosine-protein phosphatase non-receptor type 1        162   8e-41    
gb|KFO87202.1|  Tyrosine-protein phosphatase non-receptor type 1        162   8e-41    
ref|XP_007638291.1|  PREDICTED: tyrosine-protein phosphatase non-...    163   8e-41    
ref|XP_002747713.1|  PREDICTED: tyrosine-protein phosphatase non-...    163   8e-41    
ref|XP_008312333.1|  PREDICTED: receptor-type tyrosine-protein ph...    166   8e-41    
gb|AAX36968.1|  protein tyrosine phosphatase non-receptor type 1        163   8e-41    
gb|KFV93111.1|  Tyrosine-protein phosphatase non-receptor type 1        162   8e-41    
ref|XP_010135959.1|  PREDICTED: receptor-type tyrosine-protein ph...    165   8e-41    
gb|KFW69018.1|  Tyrosine-protein phosphatase non-receptor type 1        162   8e-41    
ref|NP_001125254.1|  tyrosine-protein phosphatase non-receptor ty...    163   8e-41    
dbj|BAE41325.1|  unnamed protein product                                165   8e-41    
gb|EFX90292.1|  hypothetical protein DAPPUDRAFT_309832                  166   8e-41    
pdb|1G1F|A  Chain A, Crystal Structure Of Protein Tyrosine Phosph...    159   8e-41    
ref|XP_007545405.1|  PREDICTED: receptor-type tyrosine-protein ph...    165   8e-41    
gb|KFM04032.1|  Tyrosine-protein phosphatase non-receptor type 1        162   8e-41    
ref|XP_007185361.1|  PREDICTED: tyrosine-protein phosphatase non-...    162   8e-41    
gb|KFV51982.1|  Tyrosine-protein phosphatase non-receptor type 1        162   9e-41    
ref|XP_009501055.1|  PREDICTED: receptor-type tyrosine-protein ph...    165   9e-41    
gb|KFP57187.1|  Tyrosine-protein phosphatase non-receptor type 1        162   9e-41    
ref|XP_010764793.1|  PREDICTED: receptor-type tyrosine-protein ph...    165   9e-41    
ref|XP_003932618.1|  PREDICTED: tyrosine-protein phosphatase non-...    162   9e-41    
ref|XP_002935509.1|  PREDICTED: tyrosine-protein phosphatase non-...    166   9e-41    
gb|KFP21420.1|  Tyrosine-protein phosphatase non-receptor type 1        162   9e-41    
gb|KFQ52878.1|  Tyrosine-protein phosphatase non-receptor type 1        162   9e-41    
ref|XP_004527149.1|  PREDICTED: tyrosine-protein phosphatase non-...    166   9e-41    
pdb|3SR9|A  Chain A, Crystal Structure Of Mouse Ptpsigma                165   9e-41    
pdb|2F6F|A  Chain A, The Structure Of The S295f Mutant Of Human P...    159   9e-41    
ref|XP_010764792.1|  PREDICTED: receptor-type tyrosine-protein ph...    165   9e-41    
ref|XP_010283509.1|  PREDICTED: receptor-type tyrosine-protein ph...    165   1e-40    
gb|KFQ89389.1|  Tyrosine-protein phosphatase non-receptor type 1        162   1e-40    
ref|XP_007229157.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   1e-40    
pdb|1Q6J|A  Chain A, The Structure Of Phosphotyrosine Phosphatase...    159   1e-40    
ref|XP_007185360.1|  PREDICTED: tyrosine-protein phosphatase non-...    162   1e-40    
ref|XP_007545404.1|  PREDICTED: receptor-type tyrosine-protein ph...    165   1e-40    
ref|XP_007545400.1|  PREDICTED: receptor-type tyrosine-protein ph...    165   1e-40    
ref|XP_007446443.1|  PREDICTED: tyrosine-protein phosphatase non-...    162   1e-40    
gb|ABG89395.1|  protein tyrosine phosphatases epsilon variant 1         165   1e-40    
gb|KFZ61772.1|  Tyrosine-protein phosphatase non-receptor type 1        162   1e-40    
dbj|BAA95199.1|  ryPTPN6c                                               160   1e-40    
ref|XP_003224035.2|  PREDICTED: tyrosine-protein phosphatase non-...    164   1e-40    
pdb|3A5K|A  Chain A, Crystal Structure Of Protein-Tyrosine Phosph...    159   1e-40    
gb|AAH43621.1|  MGC52584 protein                                        165   1e-40    
gb|KFP87160.1|  Tyrosine-protein phosphatase non-receptor type 1        162   1e-40    
ref|XP_009945194.1|  PREDICTED: receptor-type tyrosine-protein ph...    165   1e-40    
ref|XP_007446442.1|  PREDICTED: tyrosine-protein phosphatase non-...    162   1e-40    
ref|XP_007128093.1|  PREDICTED: tyrosine-protein phosphatase non-...    162   1e-40    
ref|XP_010186434.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   1e-40    
gb|KFZ58868.1|  Tyrosine-protein phosphatase non-receptor type 1        162   1e-40    
gb|AAI08491.1|  MGC52584 protein                                        165   1e-40    
ref|XP_004282947.1|  PREDICTED: tyrosine-protein phosphatase non-...    162   1e-40    
ref|XP_004527148.1|  PREDICTED: tyrosine-protein phosphatase non-...    166   1e-40    
ref|XP_010764790.1|  PREDICTED: receptor-type tyrosine-protein ph...    165   1e-40    
ref|XP_010616527.1|  PREDICTED: tyrosine-protein phosphatase non-...    162   1e-40    
ref|XP_010764791.1|  PREDICTED: receptor-type tyrosine-protein ph...    165   1e-40    
ref|XP_008427552.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   1e-40    
emb|CAF98398.1|  unnamed protein product                                164   1e-40    
ref|XP_010764788.1|  PREDICTED: receptor-type tyrosine-protein ph...    165   2e-40    
pdb|1EEN|A  Chain A, Crystal Structure Of Protein Tyrosine Phosph...    159   2e-40    
pdb|1AAX|A  Chain A, Crystal Structure Of Protein Tyrosine Phosph...    159   2e-40    
ref|XP_005514092.1|  PREDICTED: tyrosine-protein phosphatase non-...    161   2e-40    
gb|KFO66094.1|  Receptor-type tyrosine-protein phosphatase kappa        160   2e-40    
gb|KFO12948.1|  Tyrosine-protein phosphatase non-receptor type 1        161   2e-40    
ref|XP_010616526.1|  PREDICTED: tyrosine-protein phosphatase non-...    162   2e-40    
ref|XP_002071035.1|  GK25577                                            166   2e-40    
ref|XP_005060501.1|  PREDICTED: receptor-type tyrosine-protein ph...    166   2e-40    
ref|XP_010127610.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   2e-40    
ref|XP_010764789.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   2e-40    
ref|XP_006881696.1|  PREDICTED: tyrosine-protein phosphatase non-...    162   2e-40    
ref|XP_009996764.1|  PREDICTED: receptor-type tyrosine-protein ph...    166   2e-40    
gb|KFU90242.1|  Receptor-type tyrosine-protein phosphatase kappa        160   2e-40    
ref|XP_009575077.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   2e-40    
ref|XP_010299749.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   2e-40    
pdb|1GFY|A  Chain A, Residue 259 Is A Key Determinant Of Substrat...    158   2e-40    
pdb|1OEO|X  Chain X, Ptp1b With The Catalytic Cysteine Oxidized T...    159   2e-40    
pdb|3QKP|A  Chain A, Protein Tyrosine Phosphatase 1b - Apo W179f ...    159   2e-40    
ref|XP_010742249.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   2e-40    
ref|XP_003961193.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   2e-40    
ref|XP_004585956.1|  PREDICTED: tyrosine-protein phosphatase non-...    161   2e-40    
ref|XP_004318619.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   2e-40    
pdb|2HY3|A  Chain A, Crystal Structure Of The Human Tyrosine Rece...    159   2e-40    
gb|KFV62485.1|  Tyrosine-protein phosphatase non-receptor type 2        158   2e-40    
ref|XP_003964025.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   2e-40    
ref|XP_011614009.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   2e-40    
pdb|3EU0|A  Chain A, Crystal Structure Of The S-Nitrosylated Cys2...    159   2e-40    
ref|XP_010866967.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   2e-40    
gb|KFB43636.1|  AGAP001109-PA-like protein                              164   2e-40    
ref|XP_009692869.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   2e-40    
gb|EPQ07764.1|  Tyrosine-protein phosphatase non-receptor type 1        162   2e-40    
ref|XP_004561226.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   2e-40    
pdb|3ZV2|A  Chain A, Human Protein-Tyrosine Phosphatase 1b C215a,...    159   3e-40    
ref|XP_011613948.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   3e-40    
ref|XP_010742242.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   3e-40    
ref|XP_003961192.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   3e-40    
gb|KHJ75838.1|  Protein-tyrosine phosphatase                            158   3e-40    
ref|XP_010007465.1|  PREDICTED: receptor-type tyrosine-protein ph...    165   3e-40    
ref|XP_004561225.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   3e-40    
gb|ERE88887.1|  receptor-type tyrosine-protein phosphatase gamma-...    164   3e-40    
ref|XP_011613860.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   3e-40    
ref|XP_003737869.1|  PREDICTED: tyrosine-protein phosphatase non-...    161   3e-40    
ref|XP_008427549.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   3e-40    
ref|XP_008435334.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   3e-40    
ref|XP_008427551.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   3e-40    
ref|XP_007475800.1|  PREDICTED: tyrosine-protein phosphatase non-...    161   3e-40    
ref|XP_001965505.1|  GF22421                                            166   3e-40    
ref|XP_007562463.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   3e-40    
ref|XP_008139399.1|  PREDICTED: tyrosine-protein phosphatase non-...    161   3e-40    
gb|KFO04813.1|  Receptor-type tyrosine-protein phosphatase kappa        159   3e-40    
pdb|2FH7|A  Chain A, Crystal Structure Of The Phosphatase Domains...    163   3e-40    
ref|XP_004883642.1|  PREDICTED: tyrosine-protein phosphatase non-...    161   3e-40    
ref|XP_009476507.1|  PREDICTED: receptor-type tyrosine-protein ph...    163   3e-40    
gb|KFV86044.1|  Tyrosine-protein phosphatase non-receptor type 1        160   3e-40    
ref|XP_011486570.1|  PREDICTED: receptor-type tyrosine-protein ph...    163   3e-40    
ref|XP_005794710.1|  PREDICTED: receptor-type tyrosine-protein ph...    163   3e-40    
ref|XP_009944215.1|  PREDICTED: receptor-type tyrosine-protein ph...    163   3e-40    
ref|XP_010736225.1|  PREDICTED: receptor-type tyrosine-protein ph...    163   3e-40    
ref|NP_033004.1|  tyrosine-protein phosphatase non-receptor type 20     161   3e-40    
ref|XP_003441817.1|  PREDICTED: receptor-type tyrosine-protein ph...    163   3e-40    
ref|XP_004561224.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   4e-40    
ref|XP_010754510.1|  PREDICTED: receptor-type tyrosine-protein ph...    159   4e-40    
ref|XP_004858115.1|  PREDICTED: tyrosine-protein phosphatase non-...    161   4e-40    
ref|XP_005471474.1|  PREDICTED: receptor-type tyrosine-protein ph...    163   4e-40    
ref|XP_010866960.1|  PREDICTED: receptor-type tyrosine-protein ph...    164   4e-40    
ref|XP_010200048.1|  PREDICTED: receptor-type tyrosine-protein ph...    163   4e-40    
ref|XP_008435333.1|  PREDICTED: receptor-type tyrosine-protein ph...    163   4e-40    
gb|EHB02263.1|  Tyrosine-protein phosphatase non-receptor type 1        161   4e-40    
ref|XP_009871093.1|  PREDICTED: receptor-type tyrosine-protein ph...    163   4e-40    
ref|XP_007562462.1|  PREDICTED: receptor-type tyrosine-protein ph...    163   4e-40    
ref|XP_006783786.1|  PREDICTED: receptor-type tyrosine-protein ph...    163   4e-40    
ref|XP_010124025.1|  PREDICTED: receptor-type tyrosine-protein ph...    162   4e-40    
ref|XP_007533194.1|  PREDICTED: tyrosine-protein phosphatase non-...    160   4e-40    
ref|XP_004551587.1|  PREDICTED: receptor-type tyrosine-protein ph...    163   4e-40    
ref|XP_010284764.1|  PREDICTED: receptor-type tyrosine-protein ph...    162   4e-40    
ref|XP_008475306.1|  PREDICTED: tyrosine-protein phosphatase non-...    160   4e-40    
gb|KFW63346.1|  Tyrosine-protein phosphatase non-receptor type 2        157   4e-40    
emb|CDQ60516.1|  unnamed protein product                                163   4e-40    
ref|XP_005488472.1|  PREDICTED: LOW QUALITY PROTEIN: receptor-typ...    167   4e-40    
ref|XP_007546895.1|  PREDICTED: tyrosine-protein phosphatase non-...    162   4e-40    
ref|XP_005474301.1|  PREDICTED: receptor-type tyrosine-protein ph...    163   4e-40    
ref|XP_004746264.1|  PREDICTED: tyrosine-protein phosphatase non-...    160   4e-40    
ref|XP_004561223.1|  PREDICTED: receptor-type tyrosine-protein ph...    163   4e-40    
ref|XP_007546861.1|  PREDICTED: tyrosine-protein phosphatase non-...    162   4e-40    
ref|XP_010866953.1|  PREDICTED: receptor-type tyrosine-protein ph...    163   4e-40    
ref|XP_006758854.1|  PREDICTED: tyrosine-protein phosphatase non-...    160   4e-40    
ref|XP_534455.3|  PREDICTED: tyrosine-protein phosphatase non-rec...    160   4e-40    
ref|XP_002740569.2|  PREDICTED: tyrosine-protein phosphatase non-...    163   4e-40    
ref|XP_005727504.1|  PREDICTED: receptor-type tyrosine-protein ph...    163   4e-40    



>ref|XP_009796944.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Nicotiana 
sylvestris]
Length=337

 Score =   545 bits (1405),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 254/324 (78%), Positives = 289/324 (89%), Gaps = 0/324 (0%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             +PFDF  DS P R+VLS DQ RYC EALKV K+KRF APEKIRQEF  LQA RMRAS+M+
Sbjct  14    KPFDFCDDSVPKRVVLSPDQQRYCLEALKVFKDKRFSAPEKIRQEFMILQATRMRASEMK  73

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIA  569
             +RC VALDS+NISKNRYTDVLPFD+NRVVL+PCKDYR SA GYINAS I +SE++S+FIA
Sbjct  74    TRCSVALDSVNISKNRYTDVLPFDNNRVVLDPCKDYRPSASGYINASFIKISENLSQFIA  133

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP TFEDFWEM+IQ+RCP IVMLT+LVDNYKTVKCGDYFQA+ G R FGNICI TK
Sbjct  134   TQGPLPLTFEDFWEMIIQHRCPVIVMLTQLVDNYKTVKCGDYFQADGGPRRFGNICIVTK  193

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             WIKT+ TSLILRCLEV++ ES+EPPL VLH QY +WPDHGVPKDTLA REI+K+  ++PP
Sbjct  194   WIKTSQTSLILRCLEVNHIESKEPPLCVLHIQYPDWPDHGVPKDTLAVREILKQTSSVPP  253

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             SLGPIVVHCSAGIGRTGTYCAIHNTIQRI++GDMSALDLVNTIT+FRSQRIGMVQT+EQY
Sbjct  254   SLGPIVVHCSAGIGRTGTYCAIHNTIQRIMVGDMSALDLVNTITVFRSQRIGMVQTMEQY  313

Query  1110  LFCYDAIIEELEDIIKESTGQPSS  1181
             LFCYDAII+ELED+I ++  + SS
Sbjct  314   LFCYDAIIDELEDLISDTNAEESS  337



>emb|CDP18155.1| unnamed protein product [Coffea canephora]
Length=345

 Score =   541 bits (1395),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 253/322 (79%), Positives = 282/322 (88%), Gaps = 0/322 (0%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             FDFS DS+P + VLS D+LRY SEAL+  K+K F++P+ IRQEF TLQA RM  SDM SR
Sbjct  23    FDFSPDSEPAKFVLSPDELRYSSEALQSFKDKLFKSPQTIRQEFLTLQAKRMSRSDMMSR  82

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQ  575
             C VA DS+N  KNRY+DVLPFDSNRVVLNPCKDYR SARGYINAS I  S+ VSRFIATQ
Sbjct  83    CTVAFDSVNRDKNRYSDVLPFDSNRVVLNPCKDYRPSARGYINASFIETSDKVSRFIATQ  142

Query  576   GPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWI  755
             G LP+TFEDFWEM++QN CP IVMLTRLVDNYK +KCGDYFQAEDG REFGNICI TKWI
Sbjct  143   GALPHTFEDFWEMILQNHCPVIVMLTRLVDNYKMMKCGDYFQAEDGPREFGNICIVTKWI  202

Query  756   KTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSL  935
             KTT +SL+LRCLEV YKESEEPPL+VLH QY EWPDHGVP+DTLA REI+KRL+ +PPSL
Sbjct  203   KTTGSSLVLRCLEVKYKESEEPPLNVLHIQYPEWPDHGVPRDTLAVREILKRLYDVPPSL  262

Query  936   GPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLF  1115
             GPIVVHCSAGIGRTGTYC I NTIQRIL+GDMSALDLV TIT+FRSQRIGMVQTLEQYLF
Sbjct  263   GPIVVHCSAGIGRTGTYCTIQNTIQRILVGDMSALDLVKTITLFRSQRIGMVQTLEQYLF  322

Query  1116  CYDAIIEELEDIIKESTGQPSS  1181
             CYDAI++ELED+I +S+GQ SS
Sbjct  323   CYDAIVDELEDLISDSSGQRSS  344



>ref|XP_009609766.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Nicotiana 
tomentosiformis]
Length=337

 Score =   538 bits (1387),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 251/322 (78%), Positives = 286/322 (89%), Gaps = 0/322 (0%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             FDFS DS P R+VLS DQ R C EALKV K+KRF APEKIRQEF  LQA RMRAS+M+SR
Sbjct  16    FDFSDDSVPKRVVLSPDQQRCCLEALKVFKDKRFSAPEKIRQEFMILQATRMRASEMKSR  75

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQ  575
             C VALDS+NISKNRYTDVLPFD+NRVVL+PCKDYR SA GYINAS I +SE+VS+FIATQ
Sbjct  76    CSVALDSVNISKNRYTDVLPFDNNRVVLDPCKDYRPSASGYINASFIKISENVSQFIATQ  135

Query  576   GPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWI  755
             GPLP+TFEDFWEM+I + CP IVMLT+LVDNYKTVKCGDYFQA+ G R FGNICI TKWI
Sbjct  136   GPLPHTFEDFWEMIILHHCPVIVMLTQLVDNYKTVKCGDYFQADGGPRRFGNICIVTKWI  195

Query  756   KTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSL  935
             KT+ TSLILRCLEV++ ES+EPPL VLH QY +WPDHGVPKDTLA REI+K+  ++PPSL
Sbjct  196   KTSQTSLILRCLEVNHIESKEPPLCVLHIQYPDWPDHGVPKDTLAVREILKQTSSVPPSL  255

Query  936   GPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLF  1115
             GPIVVHCSAGIGRTGTYCAIHNTIQ+I++GDMSALDL+NTIT+FRSQRIGMVQT+EQYLF
Sbjct  256   GPIVVHCSAGIGRTGTYCAIHNTIQKIMVGDMSALDLINTITVFRSQRIGMVQTMEQYLF  315

Query  1116  CYDAIIEELEDIIKESTGQPSS  1181
             CYDAII+ELED+I ++  + SS
Sbjct  316   CYDAIIDELEDLISDTNAEESS  337



>ref|XP_009624648.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Nicotiana tomentosiformis]
Length=350

 Score =   523 bits (1348),  Expect = 1e-180, Method: Compositional matrix adjust.
 Identities = 245/321 (76%), Positives = 274/321 (85%), Gaps = 0/321 (0%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             +P DFS DS P R+VLS DQ  YC EAL   KEKR  +P KI  EF  LQ NR++AS+M+
Sbjct  27    KPLDFSADSVPKRIVLSPDQRSYCLEALTAFKEKRCHSPGKIDSEFSALQKNRLKASEMK  86

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIA  569
             SRC VALDS NISKNRYTDVLPFD++RVVL+PCKDYR SARGYINAS +++SE VSRFIA
Sbjct  87    SRCSVALDSTNISKNRYTDVLPFDNSRVVLDPCKDYRPSARGYINASFVSISERVSRFIA  146

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+TFEDFWEM+IQNRCP IVMLTRLVDNYKTVKCGDYFQAEDG R FGNIC+ TK
Sbjct  147   TQGPLPHTFEDFWEMIIQNRCPVIVMLTRLVDNYKTVKCGDYFQAEDGPRTFGNICVVTK  206

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
              IKT+DTSLILR LEV+Y ESEEPP  VLH QY EWPDHGVP+DTLA REI+ R H +P 
Sbjct  207   CIKTSDTSLILRNLEVNYIESEEPPSHVLHIQYPEWPDHGVPEDTLAVREILNRTHDVPL  266

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             SLGPIVVHCSAGIGRTGTYC IHNTIQRIL GDMSALD+VNT+ IFRSQRIGMVQT++QY
Sbjct  267   SLGPIVVHCSAGIGRTGTYCTIHNTIQRILGGDMSALDIVNTVAIFRSQRIGMVQTMDQY  326

Query  1110  LFCYDAIIEELEDIIKESTGQ  1172
             LFCYDAII+ELE +I +  G+
Sbjct  327   LFCYDAIIDELEHLISDDNGE  347



>ref|XP_004241817.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Solanum lycopersicum]
 ref|XP_010322753.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Solanum lycopersicum]
Length=328

 Score =   519 bits (1336),  Expect = 3e-179, Method: Compositional matrix adjust.
 Identities = 249/318 (78%), Positives = 276/318 (87%), Gaps = 6/318 (2%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             +PFDFS DS P R+VLSSDQ RYC E LKV K+KRF APEKIRQEF TLQA RMRAS+M+
Sbjct  16    KPFDFSDDSVPKRVVLSSDQQRYCLEVLKVFKDKRFSAPEKIRQEFMTLQATRMRASEMK  75

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIA  569
             SRC +AL+S NISKNRYTDVLPFD+NRVVL+P       ARGYINAS I +SE VS+FIA
Sbjct  76    SRCSMALNSANISKNRYTDVLPFDNNRVVLDP------PARGYINASFIKISEDVSQFIA  129

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPL +TFEDFWEM+IQ+RCP IVMLT+L DNYK VKCGDYFQA+ G R FGNICI TK
Sbjct  130   TQGPLQHTFEDFWEMIIQHRCPVIVMLTQLFDNYKIVKCGDYFQADGGPRRFGNICIVTK  189

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             WIKTT TSLILRCLEV+Y ES EPPL VLH QY +WPDHGVPKDTLA REI+K+  ++PP
Sbjct  190   WIKTTQTSLILRCLEVNYIESTEPPLCVLHIQYPDWPDHGVPKDTLAVREILKQTFSVPP  249

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             SLGPIVVHCSAGIGRTGTYCAIHNTIQRIL GD SALDLVNTITIFRSQRIGMVQT+EQY
Sbjct  250   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILGGDKSALDLVNTITIFRSQRIGMVQTMEQY  309

Query  1110  LFCYDAIIEELEDIIKES  1163
             LFCYDA+I+ELED+I +S
Sbjct  310   LFCYDAVIDELEDLISDS  327



>ref|XP_009765731.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Nicotiana sylvestris]
Length=350

 Score =   516 bits (1329),  Expect = 8e-178, Method: Compositional matrix adjust.
 Identities = 241/319 (76%), Positives = 272/319 (85%), Gaps = 0/319 (0%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
              DFS DS P R+VLS DQ  YC EAL   K+KR+ +P KI  EF  LQ NR++AS+M+SR
Sbjct  29    LDFSADSVPKRIVLSPDQRSYCLEALTAFKDKRYHSPGKIDSEFSALQKNRLKASEMKSR  88

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQ  575
             C VALDS NISKNRYTDVLPFD++RVVL+PCKDYR SARGYINAS +++SE VSRFIATQ
Sbjct  89    CSVALDSTNISKNRYTDVLPFDNSRVVLDPCKDYRPSARGYINASFVSISERVSRFIATQ  148

Query  576   GPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWI  755
             GPLP+TFEDFWEM+IQNRCP IVMLTRLVDNYK VKCGDYFQAEDG R FGNIC+ TK I
Sbjct  149   GPLPHTFEDFWEMIIQNRCPVIVMLTRLVDNYKMVKCGDYFQAEDGPRTFGNICVVTKCI  208

Query  756   KTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSL  935
             KT+ TSLILR LEV+Y ESEEPPL VLH QY EWPDHGVP+DTLA REI+ R + +P SL
Sbjct  209   KTSHTSLILRNLEVNYIESEEPPLHVLHIQYPEWPDHGVPEDTLAVREILNRTYDVPLSL  268

Query  936   GPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLF  1115
             GPIVVHCSAGIGRTGTYC IHNTIQRIL GDMSALD+VNT+ IFRSQRIGMVQT++QYLF
Sbjct  269   GPIVVHCSAGIGRTGTYCTIHNTIQRILGGDMSALDIVNTVAIFRSQRIGMVQTMDQYLF  328

Query  1116  CYDAIIEELEDIIKESTGQ  1172
             CYDAII+ELE +I +  G+
Sbjct  329   CYDAIIDELEHLISDDNGE  347



>ref|XP_009624646.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009624647.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Nicotiana tomentosiformis]
Length=358

 Score =   516 bits (1329),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 245/329 (74%), Positives = 274/329 (83%), Gaps = 8/329 (2%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             +P DFS DS P R+VLS DQ  YC EAL   KEKR  +P KI  EF  LQ NR++AS+M+
Sbjct  27    KPLDFSADSVPKRIVLSPDQRSYCLEALTAFKEKRCHSPGKIDSEFSALQKNRLKASEMK  86

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIA  569
             SRC VALDS NISKNRYTDVLPFD++RVVL+PCKDYR SARGYINAS +++SE VSRFIA
Sbjct  87    SRCSVALDSTNISKNRYTDVLPFDNSRVVLDPCKDYRPSARGYINASFVSISERVSRFIA  146

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYK--------TVKCGDYFQAEDGVREF  725
             TQGPLP+TFEDFWEM+IQNRCP IVMLTRLVDNYK        TVKCGDYFQAEDG R F
Sbjct  147   TQGPLPHTFEDFWEMIIQNRCPVIVMLTRLVDNYKVFNCLDNQTVKCGDYFQAEDGPRTF  206

Query  726   GNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIV  905
             GNIC+ TK IKT+DTSLILR LEV+Y ESEEPP  VLH QY EWPDHGVP+DTLA REI+
Sbjct  207   GNICVVTKCIKTSDTSLILRNLEVNYIESEEPPSHVLHIQYPEWPDHGVPEDTLAVREIL  266

Query  906   KRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIG  1085
              R H +P SLGPIVVHCSAGIGRTGTYC IHNTIQRIL GDMSALD+VNT+ IFRSQRIG
Sbjct  267   NRTHDVPLSLGPIVVHCSAGIGRTGTYCTIHNTIQRILGGDMSALDIVNTVAIFRSQRIG  326

Query  1086  MVQTLEQYLFCYDAIIEELEDIIKESTGQ  1172
             MVQT++QYLFCYDAII+ELE +I +  G+
Sbjct  327   MVQTMDQYLFCYDAIIDELEHLISDDNGE  355



>ref|XP_006353707.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Solanum tuberosum]
Length=355

 Score =   514 bits (1325),  Expect = 4e-177, Method: Compositional matrix adjust.
 Identities = 248/316 (78%), Positives = 275/316 (87%), Gaps = 6/316 (2%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             FDFS DS P R+VLSSDQ R C EALKV K+KRF APE IRQEF TLQA RMRAS+M+SR
Sbjct  45    FDFSDDSVPKRVVLSSDQQRCCLEALKVFKDKRFSAPENIRQEFMTLQATRMRASEMKSR  104

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQ  575
             C +AL+S NISKNRYTDVLPFD+NRVVL+P       ARGYINAS I +SE VS+FIATQ
Sbjct  105   CSMALNSTNISKNRYTDVLPFDNNRVVLDP------PARGYINASFIKISEDVSQFIATQ  158

Query  576   GPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWI  755
             GPL +TFEDFWEM+IQ+RCP IVMLT+L DNYK VKCGDYFQA+ G R FGNICI TKWI
Sbjct  159   GPLQHTFEDFWEMIIQHRCPVIVMLTQLFDNYKIVKCGDYFQADGGPRRFGNICIVTKWI  218

Query  756   KTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSL  935
             KTT TSLILRCLEV+Y ES+EPPL VLH QY +WPDHGVPKDTLA REI+K+  ++PPSL
Sbjct  219   KTTQTSLILRCLEVNYIESKEPPLCVLHIQYPDWPDHGVPKDTLAVREILKQTFSVPPSL  278

Query  936   GPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLF  1115
             GPIVVHCSAGIGRTGTYCAIHNTIQRIL+GD SALDLVNTITIFRSQRIGMVQT+EQYLF
Sbjct  279   GPIVVHCSAGIGRTGTYCAIHNTIQRILVGDKSALDLVNTITIFRSQRIGMVQTMEQYLF  338

Query  1116  CYDAIIEELEDIIKES  1163
             CYDAII+ELED+I +S
Sbjct  339   CYDAIIDELEDLISDS  354



>ref|XP_011074916.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Sesamum indicum]
Length=345

 Score =   512 bits (1318),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 243/315 (77%), Positives = 270/315 (86%), Gaps = 0/315 (0%)
 Frame = +3

Query  225   SYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLV  404
             S+DS   RL LS DQLR+CSEAL+  K ++  +P+ IRQEF TLQANR RASDM +RC V
Sbjct  26    SFDSTMQRLPLSVDQLRHCSEALECFKARKCNSPQTIRQEFQTLQANRTRASDMINRCTV  85

Query  405   ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
             ALDS+N SKNRYTDVLPFD NRV+L  C DYR SARGYINAS +T SE VSRFIATQGPL
Sbjct  86    ALDSLNYSKNRYTDVLPFDDNRVILKQCTDYRSSARGYINASFVTTSESVSRFIATQGPL  145

Query  585   PNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTT  764
              +T EDFWEM+IQ  CP IVMLTRLVDNY+TVKC DYFQAEDG R+FGNICI+TKWI+T 
Sbjct  146   SHTSEDFWEMIIQYHCPVIVMLTRLVDNYRTVKCVDYFQAEDGPRDFGNICISTKWIQTA  205

Query  765   DTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPI  944
             D SLILRCLEV YKESEEPPLSVLH QY EWPDHGVPK+TLA REI KR+  +PPSLGPI
Sbjct  206   DNSLILRCLEVKYKESEEPPLSVLHVQYPEWPDHGVPKNTLAVREIFKRIAGVPPSLGPI  265

Query  945   VVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYD  1124
             VVHCSAGIGRTGTYCAIH+TIQRIL+GDM+ALDLVNTIT FRSQRIGMVQTL+QYLFCYD
Sbjct  266   VVHCSAGIGRTGTYCAIHDTIQRILIGDMTALDLVNTITTFRSQRIGMVQTLDQYLFCYD  325

Query  1125  AIIEELEDIIKESTG  1169
             AII+ELE +I +S  
Sbjct  326   AIIDELESLILDSNS  340



>ref|XP_006351173.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Solanum tuberosum]
Length=349

 Score =   512 bits (1318),  Expect = 3e-176, Method: Compositional matrix adjust.
 Identities = 240/323 (74%), Positives = 276/323 (85%), Gaps = 1/323 (0%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             +P DFS DS P R+VLS DQ  +C EALK  KEK+  +P+KI  EF TLQ NR++AS+M+
Sbjct  27    KPLDFSADSVPQRIVLSPDQRSHCLEALKAFKEKKCHSPDKIDSEFSTLQENRLKASEMK  86

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIA  569
             SRCLVALDS NISKNRYTDV+PFD+NRVVL+PCKDYR SA+GYINAS I +SE VS+F+A
Sbjct  87    SRCLVALDSTNISKNRYTDVIPFDNNRVVLDPCKDYRPSAKGYINASFIEISEGVSQFVA  146

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPL +TFEDFWEM+IQ RCP IVMLTRLVDNYK VKCGDYFQAEDG R FGNICI TK
Sbjct  147   TQGPLAHTFEDFWEMIIQQRCPVIVMLTRLVDNYKMVKCGDYFQAEDGPRTFGNICIVTK  206

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             +I T+D SL+LR LEV+Y ESEEPPL VLH QY EWPDHGVP+DTLA REI++R + +P 
Sbjct  207   YI-TSDASLVLRTLEVNYIESEEPPLCVLHIQYPEWPDHGVPRDTLAVREILRRTYNVPL  265

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             SLGPIVVHCSAGIGRTGTYC IHNTIQRIL GDMSALD+V+T+ IFRSQRIGMVQT +QY
Sbjct  266   SLGPIVVHCSAGIGRTGTYCTIHNTIQRILGGDMSALDIVDTVAIFRSQRIGMVQTKDQY  325

Query  1110  LFCYDAIIEELEDIIKESTGQPS  1178
             LFCYDAII+ELED+I +  G+ S
Sbjct  326   LFCYDAIIDELEDLISDDNGEKS  348



>ref|XP_002267287.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X4 [Vitis 
vinifera]
Length=339

 Score =   511 bits (1316),  Expect = 6e-176, Method: Compositional matrix adjust.
 Identities = 246/317 (78%), Positives = 273/317 (86%), Gaps = 4/317 (1%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             +PFDFS DS PPRL L+ DQ ++CSEAL+  K+K  Q PEKIRQEF  LQANRMR S+M 
Sbjct  17    KPFDFSPDS-PPRLSLTPDQFKHCSEALRFFKDK-LQMPEKIRQEFAFLQANRMRPSEMM  74

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRF  563
               C VALDS+N+SKNRYTDVLPFD  RVVLN CKDYR SARGYINAS I  S  E +SRF
Sbjct  75    RSCTVALDSVNLSKNRYTDVLPFDKTRVVLNSCKDYRPSARGYINASFIETSSTESISRF  134

Query  564   IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICIT  743
             IATQGPLP+T+EDFWEMVIQ  CP IVMLTRLVDNYKTVKCGDYFQAEDG REFGNI I 
Sbjct  135   IATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKTVKCGDYFQAEDGPREFGNIFIV  194

Query  744   TKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTL  923
             TKWIKTT+TSL+LR LEV+YKESEEP LSVLH QY EWPDHGVP+DT A RE++KR+  +
Sbjct  195   TKWIKTTETSLVLRHLEVNYKESEEPSLSVLHIQYPEWPDHGVPRDTCAVREMLKRMCHV  254

Query  924   PPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLE  1103
              PSLGPIVVHCSAGIGRTGTYC IHNTIQRIL+GDMSALDLVNTIT FRSQRIGMVQT+E
Sbjct  255   LPSLGPIVVHCSAGIGRTGTYCTIHNTIQRILIGDMSALDLVNTITTFRSQRIGMVQTME  314

Query  1104  QYLFCYDAIIEELEDII  1154
             Q+LFCY+AI++ELED+I
Sbjct  315   QFLFCYNAIVDELEDLI  331



>ref|XP_010665012.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X3 [Vitis 
vinifera]
 emb|CBI18544.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   510 bits (1313),  Expect = 2e-175, Method: Compositional matrix adjust.
 Identities = 246/317 (78%), Positives = 273/317 (86%), Gaps = 4/317 (1%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             +PFDFS DS PPRL L+ DQ ++CSEAL+  K+K  Q PEKIRQEF  LQANRMR S+M 
Sbjct  17    KPFDFSPDS-PPRLSLTPDQFKHCSEALRFFKDK-LQMPEKIRQEFAFLQANRMRPSEMM  74

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRF  563
               C VALDS+N+SKNRYTDVLPFD  RVVLN CKDYR SARGYINAS I  S  E +SRF
Sbjct  75    RSCTVALDSVNLSKNRYTDVLPFDKTRVVLNSCKDYRPSARGYINASFIETSSTESISRF  134

Query  564   IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICIT  743
             IATQGPLP+T+EDFWEMVIQ  CP IVMLTRLVDNYKTVKCGDYFQAEDG REFGNI I 
Sbjct  135   IATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKTVKCGDYFQAEDGPREFGNIFIV  194

Query  744   TKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTL  923
             TKWIKTT+TSL+LR LEV+YKESEEP LSVLH QY EWPDHGVP+DT A RE++KR+  +
Sbjct  195   TKWIKTTETSLVLRHLEVNYKESEEPSLSVLHIQYPEWPDHGVPRDTCAVREMLKRMCHV  254

Query  924   PPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLE  1103
              PSLGPIVVHCSAGIGRTGTYC IHNTIQRIL+GDMSALDLVNTIT FRSQRIGMVQT+E
Sbjct  255   LPSLGPIVVHCSAGIGRTGTYCTIHNTIQRILIGDMSALDLVNTITTFRSQRIGMVQTME  314

Query  1104  QYLFCYDAIIEELEDII  1154
             Q+LFCY+AI++ELED+I
Sbjct  315   QFLFCYNAIVDELEDLI  331



>ref|XP_004250366.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Solanum lycopersicum]
Length=349

 Score =   509 bits (1310),  Expect = 6e-175, Method: Compositional matrix adjust.
 Identities = 239/319 (75%), Positives = 272/319 (85%), Gaps = 1/319 (0%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
              DFS DS   R+VLS DQ  +C EALK  K+KR  +P+KI  EF TLQ NR++AS+M+SR
Sbjct  29    LDFSADSVLQRIVLSPDQRSHCLEALKAFKQKRCHSPDKIASEFSTLQENRLKASEMKSR  88

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQ  575
             CLVALDS NISKNRYTDV+PFD+NRVVL+PCKDYR SA+GYINAS I +SE VSRF+ATQ
Sbjct  89    CLVALDSTNISKNRYTDVIPFDNNRVVLDPCKDYRPSAKGYINASFIEISEGVSRFVATQ  148

Query  576   GPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWI  755
             GPL +TFEDFWEM+IQ RCP IVMLTRLVDNYK VKCGDYFQAEDG R FGNICI TK++
Sbjct  149   GPLAHTFEDFWEMIIQQRCPVIVMLTRLVDNYKMVKCGDYFQAEDGPRTFGNICIVTKYM  208

Query  756   KTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSL  935
              T+D SL+LR LEV+Y ESEEPPL VLH QY EWPDHGVP+DTLA REI+KR + LP  L
Sbjct  209   -TSDASLVLRTLEVNYIESEEPPLCVLHIQYPEWPDHGVPRDTLAVREILKRTYNLPLGL  267

Query  936   GPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLF  1115
             GPIVVHCSAGIGRTGTYC IHNTIQRIL GDMSALD+VNT+ IFRSQRIGMVQT++QYLF
Sbjct  268   GPIVVHCSAGIGRTGTYCTIHNTIQRILGGDMSALDIVNTVAIFRSQRIGMVQTMDQYLF  327

Query  1116  CYDAIIEELEDIIKESTGQ  1172
             CYDAII+ELED+I +  G+
Sbjct  328   CYDAIIDELEDLISDDNGE  346



>ref|XP_009765726.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009765727.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009765728.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009765729.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Nicotiana sylvestris]
Length=358

 Score =   509 bits (1311),  Expect = 7e-175, Method: Compositional matrix adjust.
 Identities = 241/327 (74%), Positives = 272/327 (83%), Gaps = 8/327 (2%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
              DFS DS P R+VLS DQ  YC EAL   K+KR+ +P KI  EF  LQ NR++AS+M+SR
Sbjct  29    LDFSADSVPKRIVLSPDQRSYCLEALTAFKDKRYHSPGKIDSEFSALQKNRLKASEMKSR  88

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQ  575
             C VALDS NISKNRYTDVLPFD++RVVL+PCKDYR SARGYINAS +++SE VSRFIATQ
Sbjct  89    CSVALDSTNISKNRYTDVLPFDNSRVVLDPCKDYRPSARGYINASFVSISERVSRFIATQ  148

Query  576   GPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKT--------VKCGDYFQAEDGVREFGN  731
             GPLP+TFEDFWEM+IQNRCP IVMLTRLVDNYK         VKCGDYFQAEDG R FGN
Sbjct  149   GPLPHTFEDFWEMIIQNRCPVIVMLTRLVDNYKVFNCLDNQMVKCGDYFQAEDGPRTFGN  208

Query  732   ICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKR  911
             IC+ TK IKT+ TSLILR LEV+Y ESEEPPL VLH QY EWPDHGVP+DTLA REI+ R
Sbjct  209   ICVVTKCIKTSHTSLILRNLEVNYIESEEPPLHVLHIQYPEWPDHGVPEDTLAVREILNR  268

Query  912   LHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMV  1091
              + +P SLGPIVVHCSAGIGRTGTYC IHNTIQRIL GDMSALD+VNT+ IFRSQRIGMV
Sbjct  269   TYDVPLSLGPIVVHCSAGIGRTGTYCTIHNTIQRILGGDMSALDIVNTVAIFRSQRIGMV  328

Query  1092  QTLEQYLFCYDAIIEELEDIIKESTGQ  1172
             QT++QYLFCYDAII+ELE +I +  G+
Sbjct  329   QTMDQYLFCYDAIIDELEHLISDDNGE  355



>ref|XP_011074915.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Sesamum indicum]
Length=346

 Score =   507 bits (1306),  Expect = 2e-174, Method: Compositional matrix adjust.
 Identities = 243/316 (77%), Positives = 270/316 (85%), Gaps = 1/316 (0%)
 Frame = +3

Query  225   SYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLV  404
             S+DS   RL LS DQLR+CSEAL+  K ++  +P+ IRQEF TLQANR RASDM +RC V
Sbjct  26    SFDSTMQRLPLSVDQLRHCSEALECFKARKCNSPQTIRQEFQTLQANRTRASDMINRCTV  85

Query  405   ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
             ALDS+N SKNRYTDVLPFD NRV+L  C DYR SARGYINAS +T SE VSRFIATQGPL
Sbjct  86    ALDSLNYSKNRYTDVLPFDDNRVILKQCTDYRSSARGYINASFVTTSESVSRFIATQGPL  145

Query  585   PNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTT  764
              +T EDFWEM+IQ  CP IVMLTRLVDNY+TVKC DYFQAEDG R+FGNICI+TKWI+T 
Sbjct  146   SHTSEDFWEMIIQYHCPVIVMLTRLVDNYRTVKCVDYFQAEDGPRDFGNICISTKWIQTA  205

Query  765   DTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPI  944
             D SLILRCLEV YKESEEPPLSVLH QY EWPDHGVPK+TLA REI KR+  +PPSLGPI
Sbjct  206   DNSLILRCLEVKYKESEEPPLSVLHVQYPEWPDHGVPKNTLAVREIFKRIAGVPPSLGPI  265

Query  945   VVHC-SAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCY  1121
             VVHC SAGIGRTGTYCAIH+TIQRIL+GDM+ALDLVNTIT FRSQRIGMVQTL+QYLFCY
Sbjct  266   VVHCSSAGIGRTGTYCAIHDTIQRILIGDMTALDLVNTITTFRSQRIGMVQTLDQYLFCY  325

Query  1122  DAIIEELEDIIKESTG  1169
             DAII+ELE +I +S  
Sbjct  326   DAIIDELESLILDSNS  341



>ref|XP_010665011.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X2 [Vitis 
vinifera]
Length=347

 Score =   504 bits (1298),  Expect = 4e-173, Method: Compositional matrix adjust.
 Identities = 246/325 (76%), Positives = 273/325 (84%), Gaps = 12/325 (4%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             +PFDFS DS PPRL L+ DQ ++CSEAL+  K+K  Q PEKIRQEF  LQANRMR S+M 
Sbjct  17    KPFDFSPDS-PPRLSLTPDQFKHCSEALRFFKDK-LQMPEKIRQEFAFLQANRMRPSEMM  74

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRF  563
               C VALDS+N+SKNRYTDVLPFD  RVVLN CKDYR SARGYINAS I  S  E +SRF
Sbjct  75    RSCTVALDSVNLSKNRYTDVLPFDKTRVVLNSCKDYRPSARGYINASFIETSSTESISRF  134

Query  564   IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYK--------TVKCGDYFQAEDGVR  719
             IATQGPLP+T+EDFWEMVIQ  CP IVMLTRLVDNYK        TVKCGDYFQAEDG R
Sbjct  135   IATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKVLHNLKFKTVKCGDYFQAEDGPR  194

Query  720   EFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATRE  899
             EFGNI I TKWIKTT+TSL+LR LEV+YKESEEP LSVLH QY EWPDHGVP+DT A RE
Sbjct  195   EFGNIFIVTKWIKTTETSLVLRHLEVNYKESEEPSLSVLHIQYPEWPDHGVPRDTCAVRE  254

Query  900   IVKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQR  1079
             ++KR+  + PSLGPIVVHCSAGIGRTGTYC IHNTIQRIL+GDMSALDLVNTIT FRSQR
Sbjct  255   MLKRMCHVLPSLGPIVVHCSAGIGRTGTYCTIHNTIQRILIGDMSALDLVNTITTFRSQR  314

Query  1080  IGMVQTLEQYLFCYDAIIEELEDII  1154
             IGMVQT+EQ+LFCY+AI++ELED+I
Sbjct  315   IGMVQTMEQFLFCYNAIVDELEDLI  339



>ref|XP_010665010.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X1 [Vitis 
vinifera]
Length=350

 Score =   503 bits (1296),  Expect = 9e-173, Method: Compositional matrix adjust.
 Identities = 246/325 (76%), Positives = 273/325 (84%), Gaps = 12/325 (4%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             +PFDFS DS PPRL L+ DQ ++CSEAL+  K+K  Q PEKIRQEF  LQANRMR S+M 
Sbjct  17    KPFDFSPDS-PPRLSLTPDQFKHCSEALRFFKDK-LQMPEKIRQEFAFLQANRMRPSEMM  74

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRF  563
               C VALDS+N+SKNRYTDVLPFD  RVVLN CKDYR SARGYINAS I  S  E +SRF
Sbjct  75    RSCTVALDSVNLSKNRYTDVLPFDKTRVVLNSCKDYRPSARGYINASFIETSSTESISRF  134

Query  564   IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYK--------TVKCGDYFQAEDGVR  719
             IATQGPLP+T+EDFWEMVIQ  CP IVMLTRLVDNYK        TVKCGDYFQAEDG R
Sbjct  135   IATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKVLHNLKFKTVKCGDYFQAEDGPR  194

Query  720   EFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATRE  899
             EFGNI I TKWIKTT+TSL+LR LEV+YKESEEP LSVLH QY EWPDHGVP+DT A RE
Sbjct  195   EFGNIFIVTKWIKTTETSLVLRHLEVNYKESEEPSLSVLHIQYPEWPDHGVPRDTCAVRE  254

Query  900   IVKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQR  1079
             ++KR+  + PSLGPIVVHCSAGIGRTGTYC IHNTIQRIL+GDMSALDLVNTIT FRSQR
Sbjct  255   MLKRMCHVLPSLGPIVVHCSAGIGRTGTYCTIHNTIQRILIGDMSALDLVNTITTFRSQR  314

Query  1080  IGMVQTLEQYLFCYDAIIEELEDII  1154
             IGMVQT+EQ+LFCY+AI++ELED+I
Sbjct  315   IGMVQTMEQFLFCYNAIVDELEDLI  339



>ref|XP_002534020.1| protein-tyrosine phosphatase 1, plants, putative [Ricinus communis]
 gb|EEF28361.1| protein-tyrosine phosphatase 1, plants, putative [Ricinus communis]
Length=332

 Score =   501 bits (1290),  Expect = 3e-172, Method: Compositional matrix adjust.
 Identities = 237/316 (75%), Positives = 266/316 (84%), Gaps = 4/316 (1%)
 Frame = +3

Query  213   PFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
             PF FS DS PPRL L+SDQL YCSEAL+ LK K  ++P+ I QEF  LQA+R+  S +  
Sbjct  12    PFQFSSDSAPPRLSLTSDQLNYCSEALQFLKHK-LRSPDIITQEFARLQASRLTPSQVAR  70

Query  393   RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFI  566
              C VALD +N SKNRY DV+PFD NRVVLNPCKDYR SA+GYINAS IT S  E++SRFI
Sbjct  71    SCKVALDGVNTSKNRYLDVIPFDENRVVLNPCKDYRSSAKGYINASFITTSSSENISRFI  130

Query  567   ATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITT  746
             ATQGPLP+T+EDFWEMVIQ  CP IVMLTRLVDNYK VKCGDYFQAEDG R  GNICI T
Sbjct  131   ATQGPLPHTYEDFWEMVIQCHCPVIVMLTRLVDNYKIVKCGDYFQAEDGPRHVGNICIET  190

Query  747   KWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLP  926
             KW+ TTDTS+ILR LEV  K+SEEPP+SVLH QY EWPDHGVPKDTLA REI KR+H +P
Sbjct  191   KWMTTTDTSIILRSLEVG-KDSEEPPMSVLHIQYPEWPDHGVPKDTLAVREIFKRIHQMP  249

Query  927   PSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQ  1106
             P+LGPIVVHCSAGIGRTGTYCAIHNTIQRIL+GDMSALDL NT+ IFRSQR+GMVQT++Q
Sbjct  250   PNLGPIVVHCSAGIGRTGTYCAIHNTIQRILVGDMSALDLANTVAIFRSQRVGMVQTMDQ  309

Query  1107  YLFCYDAIIEELEDII  1154
             Y FCY AII+ELED+I
Sbjct  310   YFFCYKAIIDELEDLI  325



>ref|XP_007201518.1| hypothetical protein PRUPE_ppa015486mg, partial [Prunus persica]
 gb|EMJ02717.1| hypothetical protein PRUPE_ppa015486mg, partial [Prunus persica]
Length=335

 Score =   500 bits (1287),  Expect = 1e-171, Method: Compositional matrix adjust.
 Identities = 232/315 (74%), Positives = 270/315 (86%), Gaps = 3/315 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
              DFS DS P RLVL+ DQ +YCS+ALK  K+K  Q  + I QEF  LQA R+ +SDM+  
Sbjct  16    LDFSADSPPLRLVLTPDQYKYCSQALKFFKDK-LQTSDHIHQEFAQLQAKRITSSDMKRS  74

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
             C VALDS+N+SKNRYTDVLPFD+NRVVLN CKDYR SARGYINASLI+   SE +SRFIA
Sbjct  75    CTVALDSVNLSKNRYTDVLPFDTNRVVLNSCKDYRPSARGYINASLISTGSSESISRFIA  134

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+T+EDFWEMV++ RCP ++MLTRLVDNYK VKCGDYFQAE+G REFGNICI TK
Sbjct  135   TQGPLPHTYEDFWEMVLEQRCPVVIMLTRLVDNYKMVKCGDYFQAENGPREFGNICIATK  194

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             W++TT+TSL LR LEV+YKESEEPP+SVLH QY EWPDHGVP+D +A REI+KRL+ +PP
Sbjct  195   WLRTTETSLELRLLEVNYKESEEPPMSVLHIQYPEWPDHGVPEDRIAVREILKRLYEVPP  254

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             +LGPIVVHCSAGIGRTGTYC IHNT+QRIL GDMSALDLV+T+T FRSQRIGMVQT EQY
Sbjct  255   NLGPIVVHCSAGIGRTGTYCTIHNTVQRILAGDMSALDLVDTVTTFRSQRIGMVQTREQY  314

Query  1110  LFCYDAIIEELEDII  1154
              FCY AI++ELED++
Sbjct  315   FFCYSAIVDELEDLV  329



>ref|XP_010094850.1| Tyrosine-protein phosphatase non-receptor type 20 [Morus notabilis]
 gb|EXB57379.1| Tyrosine-protein phosphatase non-receptor type 20 [Morus notabilis]
Length=357

 Score =   500 bits (1288),  Expect = 2e-171, Method: Compositional matrix adjust.
 Identities = 240/329 (73%), Positives = 272/329 (83%), Gaps = 4/329 (1%)
 Frame = +3

Query  219   DFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRC  398
             +FS DS PPRL L+ DQL++CSEAL   KEK  ++P +I QEFG LQANR+  S+MR  C
Sbjct  13    NFSPDS-PPRLALTPDQLKHCSEALGFFKEK-LRSPHQINQEFGLLQANRITPSEMRRNC  70

Query  399   LVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIAT  572
              VALDS+N+SKNRYTDVLPFD  RVVLN CKDYR SARGYINAS ITVS  E VS FIAT
Sbjct  71    TVALDSVNLSKNRYTDVLPFDQTRVVLNSCKDYRPSARGYINASFITVSSSESVSHFIAT  130

Query  573   QGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKW  752
             QGPLP+T+EDFWEMVIQ +CP +VMLTRLVDNY+ VKCGDYFQAEDG REFGNIC  TKW
Sbjct  131   QGPLPHTYEDFWEMVIQYQCPVVVMLTRLVDNYRMVKCGDYFQAEDGPREFGNICTNTKW  190

Query  753   IKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPS  932
               TT+TSL+LR LEV+YKESEEPP+SVLH QY EWPDHGVP DT+A REI KR+H +PP+
Sbjct  191   ASTTNTSLVLRHLEVNYKESEEPPMSVLHIQYPEWPDHGVPGDTIAVREIFKRIHRVPPN  250

Query  933   LGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYL  1112
             +GP+VVHCSAGIGRTGTYC IHNTIQRIL GD SALDL  TIT+FRSQRIGMVQTLEQY 
Sbjct  251   IGPVVVHCSAGIGRTGTYCTIHNTIQRILAGDTSALDLAKTITMFRSQRIGMVQTLEQYH  310

Query  1113  FCYDAIIEELEDIIKESTGQPSS*SIETT  1199
             FCY AI++ELED+I    G+ SS  +  T
Sbjct  311   FCYLAIVDELEDLISGPNGENSSTVVHIT  339



>ref|XP_011097280.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Sesamum indicum]
Length=340

 Score =   498 bits (1282),  Expect = 7e-171, Method: Compositional matrix adjust.
 Identities = 236/324 (73%), Positives = 263/324 (81%), Gaps = 0/324 (0%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             + FD S  S P R +LS DQLR+C EALKV K KRF +P+ I  EF  L+A RM A +MR
Sbjct  16    KSFDLSAVSSPKRWLLSEDQLRHCYEALKVFKGKRFGSPQTIHHEFQILEARRMEALEMR  75

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIA  569
             SRC VAL+S++  KNRYTDVLPFD NRV+L   KDY+ SA GYINAS +  SE VSRFIA
Sbjct  76    SRCTVALNSVHQRKNRYTDVLPFDDNRVILKQHKDYKPSAMGYINASFVMTSESVSRFIA  135

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLPNT EDFWEMV+Q  CPAI+MLTRLVD    VKCGDYFQAEDG REFGNICITTK
Sbjct  136   TQGPLPNTSEDFWEMVLQYHCPAIIMLTRLVDGTYAVKCGDYFQAEDGPREFGNICITTK  195

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             WI+TTDTSLILRCLEV  KES+  PLSVLH QY EWPDHGVPKDT+A REI KR+  +PP
Sbjct  196   WIQTTDTSLILRCLEVKNKESDVSPLSVLHIQYPEWPDHGVPKDTVAVREIFKRVSAIPP  255

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             SLGPIVVHCSAGIGRTGTYC IHNTIQR+L+GDM+ALDLV TIT FRSQRIGMVQT+EQY
Sbjct  256   SLGPIVVHCSAGIGRTGTYCLIHNTIQRVLIGDMTALDLVTTITTFRSQRIGMVQTMEQY  315

Query  1110  LFCYDAIIEELEDIIKESTGQPSS  1181
             LFCYDAI++ELED+I  S     S
Sbjct  316   LFCYDAIVDELEDLISVSNSHGGS  339



>ref|XP_006473220.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Citrus sinensis]
Length=343

 Score =   496 bits (1277),  Expect = 5e-170, Method: Compositional matrix adjust.
 Identities = 228/317 (72%), Positives = 267/317 (84%), Gaps = 2/317 (1%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             +PF+FS    PPR+ L++DQ  +CSEAL   KEK      +I QEF  LQA+R++ S+M 
Sbjct  16    KPFEFSAVDFPPRISLTADQYNHCSEALSFFKEKLQNKSREISQEFARLQASRIKPSEMA  75

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRF  563
               C VALD +N+SKNRYTD+LPFD NRVVL  CKDYR +ARGYINASLI+ S  E VS+F
Sbjct  76    RGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQF  135

Query  564   IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICIT  743
             IATQGPLP+T+EDFWEMVIQ  CP IVMLTRLVDNYK VKCGDYFQAEDG REFGNICI 
Sbjct  136   IATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQAEDGPREFGNICIV  195

Query  744   TKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTL  923
             TKWIKTT+T+L+LR LEV+YKESEEPP+SVLH QY EWPDHGVP+DTLA REI+KR++ L
Sbjct  196   TKWIKTTETALVLRNLEVNYKESEEPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYNL  255

Query  924   PPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLE  1103
             PP+ GPIVVHCSAGIGRTG YC IHNT+QRIL+GDMSALDL NT+ +FRSQRIGMVQT+E
Sbjct  256   PPNFGPIVVHCSAGIGRTGAYCTIHNTVQRILVGDMSALDLANTVKVFRSQRIGMVQTME  315

Query  1104  QYLFCYDAIIEELEDII  1154
             QY+FC+ AI++ELED+I
Sbjct  316   QYIFCHQAIVDELEDLI  332



>ref|XP_006351174.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Solanum tuberosum]
Length=344

 Score =   495 bits (1275),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 235/323 (73%), Positives = 271/323 (84%), Gaps = 6/323 (2%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             +P DFS DS P R+VLS DQ  +C EALK  KEK+  +P+KI  EF TLQ NR++AS+M+
Sbjct  27    KPLDFSADSVPQRIVLSPDQRSHCLEALKAFKEKKCHSPDKIDSEFSTLQENRLKASEMK  86

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIA  569
             SRCLVALDS NISKNRYTDV+PFD+NRVVL+PCKDYR SA+GYINAS I +SE VS+F+A
Sbjct  87    SRCLVALDSTNISKNRYTDVIPFDNNRVVLDPCKDYRPSAKGYINASFIEISEGVSQFVA  146

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPL +TFEDFWEM+IQ RCP IVMLTRLVDNYK VKCGDYFQAEDG R FGNICI TK
Sbjct  147   TQGPLAHTFEDFWEMIIQQRCPVIVMLTRLVDNYKMVKCGDYFQAEDGPRTFGNICIVTK  206

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             +I T+D SL+LR LEV+Y ESEEPPL VLH QY EWPDHGVP+DTLA REI++R + +P 
Sbjct  207   YI-TSDASLVLRTLEVNYIESEEPPLCVLHIQYPEWPDHGVPRDTLAVREILRRTYNVPL  265

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             SLGPIVVHC     RTGTYC IHNTIQRIL GDMSALD+V+T+ IFRSQRIGMVQT +QY
Sbjct  266   SLGPIVVHC-----RTGTYCTIHNTIQRILGGDMSALDIVDTVAIFRSQRIGMVQTKDQY  320

Query  1110  LFCYDAIIEELEDIIKESTGQPS  1178
             LFCYDAII+ELED+I +  G+ S
Sbjct  321   LFCYDAIIDELEDLISDDNGEKS  343



>ref|XP_010063788.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Eucalyptus grandis]
 ref|XP_010063789.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Eucalyptus grandis]
 ref|XP_010063790.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Eucalyptus grandis]
 ref|XP_010063791.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Eucalyptus grandis]
 gb|KCW71044.1| hypothetical protein EUGRSUZ_F04145 [Eucalyptus grandis]
Length=340

 Score =   494 bits (1273),  Expect = 2e-169, Method: Compositional matrix adjust.
 Identities = 235/323 (73%), Positives = 274/323 (85%), Gaps = 12/323 (4%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
              DFS D  PP+  LS DQ R+C+EAL+ LKEK  Q P++++QEFG LQANR+R S+M   
Sbjct  19    LDFSPDP-PPKPALSPDQRRFCAEALRALKEK-LQMPDRMKQEFGRLQANRIRPSEMVRS  76

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIA  569
             C VALD +N SKNRYTDV+P+D  RVVLNPCKDYR +A+GYINAS IT S  E+VSRFIA
Sbjct  77    CTVALDDVNSSKNRYTDVVPYDKTRVVLNPCKDYRPAAKGYINASFITASSSENVSRFIA  136

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKT--------VKCGDYFQAEDGVREF  725
             TQGPLP+T+EDFWEM++Q+RCPAIVMLTRLVD+YKT        VKCGDYFQAEDG R+F
Sbjct  137   TQGPLPHTYEDFWEMILQHRCPAIVMLTRLVDSYKTFNSAGVEMVKCGDYFQAEDGPRDF  196

Query  726   GNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIV  905
             GNICI+TKWIK TDTSL+LR LEV+YKE+EEPP+SVLH  Y +WPDHGVP DT+A REI 
Sbjct  197   GNICISTKWIKNTDTSLVLRHLEVNYKETEEPPMSVLHILYPDWPDHGVPADTIAVREIF  256

Query  906   KRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIG  1085
             KR + + PSLGPIVVHCSAGIGRTGTYC IHNT+QRIL+GDMS+LDLVNTITIFRSQRIG
Sbjct  257   KRTNEISPSLGPIVVHCSAGIGRTGTYCTIHNTVQRILVGDMSSLDLVNTITIFRSQRIG  316

Query  1086  MVQTLEQYLFCYDAIIEELEDII  1154
             MVQTLEQY+FCY AI++ELED+I
Sbjct  317   MVQTLEQYVFCYQAIVDELEDLI  339



>ref|XP_006376320.1| TYROSINE PHOSPHATASE 1 family protein [Populus trichocarpa]
 gb|ERP54117.1| TYROSINE PHOSPHATASE 1 family protein [Populus trichocarpa]
Length=339

 Score =   494 bits (1272),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 230/317 (73%), Positives = 270/317 (85%), Gaps = 4/317 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             F+FS D  PP++ LS+DQ ++CSEAL   KEK F+ P++I QEF  LQA+R+  S M   
Sbjct  22    FEFSPDP-PPKISLSTDQYQHCSEALHFFKEK-FRTPKRIAQEFAHLQASRITPSQMARS  79

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIA  569
             C VALD +N++KNRY DV+PFD NRVVLNPCKDYR SARGYINASLIT S  +++S+FIA
Sbjct  80    CKVALDGVNVNKNRYLDVVPFDQNRVVLNPCKDYRPSARGYINASLITTSSSDNISQFIA  139

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+TFEDFWEM+IQ+ CP IVMLTRLVDNYKTVKCGDYFQAEDG R+FGNI I TK
Sbjct  140   TQGPLPHTFEDFWEMIIQHHCPVIVMLTRLVDNYKTVKCGDYFQAEDGPRDFGNISIVTK  199

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             WIKTTDTSL+LR L+V YKE+EE P++VLH QY EWPDHGVP+DT+  REI KR++ +PP
Sbjct  200   WIKTTDTSLLLRNLKVGYKEAEEQPMNVLHIQYPEWPDHGVPEDTIVVREIFKRVYNVPP  259

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             SLGPIVVHCSAGIGRTGTYC IHNT+QRIL+GDMSALD+ NT+T FRSQRIGMVQT+EQY
Sbjct  260   SLGPIVVHCSAGIGRTGTYCTIHNTVQRILVGDMSALDIANTVTTFRSQRIGMVQTMEQY  319

Query  1110  LFCYDAIIEELEDIIKE  1160
              FCY+AII ELED+I E
Sbjct  320   FFCYEAIIHELEDLISE  336



>ref|XP_011097272.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Sesamum indicum]
Length=341

 Score =   494 bits (1271),  Expect = 4e-169, Method: Compositional matrix adjust.
 Identities = 236/325 (73%), Positives = 263/325 (81%), Gaps = 1/325 (0%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             + FD S  S P R +LS DQLR+C EALKV K KRF +P+ I  EF  L+A RM A +MR
Sbjct  16    KSFDLSAVSSPKRWLLSEDQLRHCYEALKVFKGKRFGSPQTIHHEFQILEARRMEALEMR  75

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIA  569
             SRC VAL+S++  KNRYTDVLPFD NRV+L   KDY+ SA GYINAS +  SE VSRFIA
Sbjct  76    SRCTVALNSVHQRKNRYTDVLPFDDNRVILKQHKDYKPSAMGYINASFVMTSESVSRFIA  135

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLPNT EDFWEMV+Q  CPAI+MLTRLVD    VKCGDYFQAEDG REFGNICITTK
Sbjct  136   TQGPLPNTSEDFWEMVLQYHCPAIIMLTRLVDGTYAVKCGDYFQAEDGPREFGNICITTK  195

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             WI+TTDTSLILRCLEV  KES+  PLSVLH QY EWPDHGVPKDT+A REI KR+  +PP
Sbjct  196   WIQTTDTSLILRCLEVKNKESDVSPLSVLHIQYPEWPDHGVPKDTVAVREIFKRVSAIPP  255

Query  930   SLGPIVVHC-SAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQ  1106
             SLGPIVVHC SAGIGRTGTYC IHNTIQR+L+GDM+ALDLV TIT FRSQRIGMVQT+EQ
Sbjct  256   SLGPIVVHCSSAGIGRTGTYCLIHNTIQRVLIGDMTALDLVTTITTFRSQRIGMVQTMEQ  315

Query  1107  YLFCYDAIIEELEDIIKESTGQPSS  1181
             YLFCYDAI++ELED+I  S     S
Sbjct  316   YLFCYDAIVDELEDLISVSNSHGGS  340



>ref|XP_009375252.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009375253.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009348386.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009348387.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
Length=390

 Score =   496 bits (1276),  Expect = 5e-169, Method: Compositional matrix adjust.
 Identities = 227/321 (71%), Positives = 272/321 (85%), Gaps = 3/321 (1%)
 Frame = +3

Query  225   SYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLV  404
             S DS PP+L L+ DQ +YCS+ALK+ KEK  Q P+ I QEF  LQA R+  ++M+  C V
Sbjct  70    SADSPPPKLALTPDQYKYCSQALKLFKEK-LQMPDHINQEFAQLQAKRITLAEMKRNCTV  128

Query  405   ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLI--TVSEHVSRFIATQG  578
             ALDS+N SKNRYTDV+PFD NRVVLN CKDYR SARGYINASLI  + S+ +SRFIATQG
Sbjct  129   ALDSVNSSKNRYTDVVPFDKNRVVLNSCKDYRPSARGYINASLIATSASKSISRFIATQG  188

Query  579   PLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIK  758
             PLP+T+EDFWEMV++ RCP ++MLTRLVD Y  VKCGDYFQAEDG REFGNICI+TKW++
Sbjct  189   PLPHTYEDFWEMVLEQRCPVVIMLTRLVDCYTMVKCGDYFQAEDGPREFGNICISTKWLR  248

Query  759   TTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLG  938
             TTDTSL+LR LEV+YKESEEPP+SVLHFQY EWPDHGVPK+T   REI+KR++ +PP+LG
Sbjct  249   TTDTSLVLRLLEVNYKESEEPPMSVLHFQYPEWPDHGVPKNTFVVREILKRIYQVPPNLG  308

Query  939   PIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFC  1118
             PIVVHCSAGIGRTGTYC IHN +QRIL GDMSAL+LV+TIT FRSQRIGMVQTLEQY+FC
Sbjct  309   PIVVHCSAGIGRTGTYCTIHNAVQRILAGDMSALNLVDTITTFRSQRIGMVQTLEQYIFC  368

Query  1119  YDAIIEELEDIIKESTGQPSS  1181
             Y AI++ELE+++ +   + +S
Sbjct  369   YSAIVDELEELMSDLNSEMNS  389



>ref|XP_006434638.1| hypothetical protein CICLE_v10001727mg [Citrus clementina]
 gb|ESR47878.1| hypothetical protein CICLE_v10001727mg [Citrus clementina]
Length=343

 Score =   493 bits (1270),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 228/317 (72%), Positives = 267/317 (84%), Gaps = 2/317 (1%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             +PF+FS    PPR+ L++DQ  +CSEAL   KEK     ++I QEF  LQA+R++ S+M 
Sbjct  16    KPFEFSAVDFPPRISLTADQYNHCSEALSFFKEKLQNKSQEISQEFARLQASRIKPSEMA  75

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRF  563
               C VALD +N+SKNRYTD+LPFD NRVVL  CKDYR +ARGYINASLI+ S  E VS+F
Sbjct  76    RGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQF  135

Query  564   IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICIT  743
             IATQGPLP+T+EDFWEMVIQ  CP IVMLTRLVDNYK VKCGDYFQAEDG REFGNI I 
Sbjct  136   IATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQAEDGPREFGNIGIL  195

Query  744   TKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTL  923
             TKWIKTT+T+L+LR LEV+YKESEEPP+SVLH QY EWPDHGVP+DTLA REI+KR++ L
Sbjct  196   TKWIKTTETALVLRNLEVNYKESEEPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYNL  255

Query  924   PPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLE  1103
             PP+ GPIVVHCSAGIGRTG YC IHNT+QRIL+GDMSALDL NTI +FRSQRIGMVQT+E
Sbjct  256   PPNFGPIVVHCSAGIGRTGAYCTIHNTVQRILVGDMSALDLANTIKVFRSQRIGMVQTME  315

Query  1104  QYLFCYDAIIEELEDII  1154
             QY+FC+ AI++ELED+I
Sbjct  316   QYIFCHQAIVDELEDLI  332



>gb|KDO83952.1| hypothetical protein CISIN_1g019277mg [Citrus sinensis]
Length=343

 Score =   492 bits (1267),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 227/317 (72%), Positives = 266/317 (84%), Gaps = 2/317 (1%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             +PF+FS    PPR+ L++DQ  +CSEAL   KEK      +I QEF  LQA+R++ S+M 
Sbjct  16    KPFEFSAVDFPPRISLTADQYNHCSEALSFFKEKLQNKSREISQEFARLQASRIKPSEMA  75

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRF  563
               C VALD +N+SKNRYTD+LPFD NRVVL  CKDYR +ARGYINASLI+ S  E VS+F
Sbjct  76    RGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQF  135

Query  564   IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICIT  743
             IATQGPLP+T+EDFWEMVIQ  CP IVMLTRLVDNYK VKCGDYFQAEDG REFGNI I 
Sbjct  136   IATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQAEDGPREFGNIGIV  195

Query  744   TKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTL  923
             TKWIKTT+T+L+LR LEV+YKESEEPP+SVLH QY EWPDHGVP+DTLA REI+KR++ L
Sbjct  196   TKWIKTTETALVLRNLEVNYKESEEPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYNL  255

Query  924   PPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLE  1103
             PP+ GPIVVHCSAGIGRTG YC IHNT+QRIL+GDMSALDL NT+ +FRSQRIGMVQT+E
Sbjct  256   PPNFGPIVVHCSAGIGRTGAYCTIHNTVQRILVGDMSALDLANTVKVFRSQRIGMVQTME  315

Query  1104  QYLFCYDAIIEELEDII  1154
             QY+FC+ AI++ELED+I
Sbjct  316   QYIFCHQAIVDELEDLI  332



>ref|XP_012081085.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X1 [Jatropha 
curcas]
 ref|XP_012081086.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X1 [Jatropha 
curcas]
 gb|KDP30279.1| hypothetical protein JCGZ_17149 [Jatropha curcas]
Length=339

 Score =   491 bits (1263),  Expect = 6e-168, Method: Compositional matrix adjust.
 Identities = 228/315 (72%), Positives = 266/315 (84%), Gaps = 4/315 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             F+FS DS PP+L LS+DQ +YCS AL+  KEK  Q P++I QEF  LQ  R   S M   
Sbjct  22    FEFSSDS-PPKLSLSTDQHKYCSRALQFFKEK-LQTPDRITQEFAHLQTTRTTPSQMARS  79

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIA  569
             C VALD++N+SKNRY DVLPFD NRVVLNPCKDYR SA+GYINASLIT S  E++SRFIA
Sbjct  80    CKVALDNVNVSKNRYMDVLPFDQNRVVLNPCKDYRASAQGYINASLITTSSSENISRFIA  139

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+TFEDFWEM+IQ+ CP IVMLTRLVDNYK VKCGDYFQ+EDG R+FGNI + +K
Sbjct  140   TQGPLPHTFEDFWEMIIQHHCPVIVMLTRLVDNYKIVKCGDYFQSEDGPRDFGNISLVSK  199

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             W++TTDTSL+LR LEV YKESEE P+SVLH QY EWPDHGVPKDT+A REI+KR+  +PP
Sbjct  200   WVRTTDTSLVLRNLEVGYKESEELPMSVLHIQYPEWPDHGVPKDTVAVREILKRVFQVPP  259

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             +LGP+VVHCSAGIGRTGTYC IHNTIQRIL+GDMSALD+ NT+  FRSQR+GMVQT++QY
Sbjct  260   NLGPVVVHCSAGIGRTGTYCTIHNTIQRILVGDMSALDIANTVATFRSQRVGMVQTMDQY  319

Query  1110  LFCYDAIIEELEDII  1154
              FCY AII+ELED+I
Sbjct  320   FFCYKAIIDELEDLI  334



>ref|XP_010521123.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Tarenaya hassleriana]
 ref|XP_010521124.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Tarenaya hassleriana]
 ref|XP_010521125.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Tarenaya hassleriana]
 ref|XP_010521126.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Tarenaya hassleriana]
Length=340

 Score =   490 bits (1262),  Expect = 8e-168, Method: Compositional matrix adjust.
 Identities = 230/325 (71%), Positives = 271/325 (83%), Gaps = 4/325 (1%)
 Frame = +3

Query  216   FDFS-YDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
             FDFS     PPRL L+SDQ+++CSEAL+   +K  + PE I +EF  LQANR+R+S+M+ 
Sbjct  17    FDFSSVYVPPPRLSLTSDQVKHCSEALRFFTDK-LRDPESIAREFAQLQANRIRSSEMQQ  75

Query  393   RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLI--TVSEHVSRFI  566
              C VA++ +N  KNRY DV+PFD+NRVVLNPCKDYR SARGY+NAS I  + SE +S+FI
Sbjct  76    SCTVAMNGVNFDKNRYKDVVPFDNNRVVLNPCKDYRSSARGYVNASFIRASSSESISQFI  135

Query  567   ATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITT  746
             ATQGPLP+T EDFWEMV+Q  CP IVMLTRLVDNYKTVKCGDYFQAEDG REFGN+CI T
Sbjct  136   ATQGPLPHTMEDFWEMVVQQHCPVIVMLTRLVDNYKTVKCGDYFQAEDGPREFGNLCIVT  195

Query  747   KWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLP  926
             KWIK+TDTSLILR LEV+YK+SE+P LSVLH QY EWPDHGVP+DTLA REI+KRL+ +P
Sbjct  196   KWIKSTDTSLILRNLEVNYKDSEDPALSVLHIQYPEWPDHGVPRDTLAVREILKRLYQVP  255

Query  927   PSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQ  1106
             PS+GPIVVHCSAGIGRTGTYCAIHNTIQRIL GDMSA D+  T+ IFRSQRIGMVQT++Q
Sbjct  256   PSIGPIVVHCSAGIGRTGTYCAIHNTIQRILAGDMSATDIGKTVAIFRSQRIGMVQTMDQ  315

Query  1107  YLFCYDAIIEELEDIIKESTGQPSS  1181
             Y FCY AI++ELED+  E+    SS
Sbjct  316   YFFCYRAIVDELEDLTAEARSGRSS  340



>ref|XP_008365849.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Malus domestica]
Length=339

 Score =   490 bits (1261),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 225/321 (70%), Positives = 269/321 (84%), Gaps = 3/321 (1%)
 Frame = +3

Query  225   SYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLV  404
             S D+ PP+L L+ DQ +YCS+ALK+ KEK  Q P+ I+QEF  LQA R+  S+M+  C V
Sbjct  19    SADAPPPKLALTPDQYKYCSQALKLFKEK-LQMPDHIKQEFAQLQAKRITLSEMKRNCTV  77

Query  405   ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIATQG  578
             ALDS+N  KNRYTDV+PFD NRVVLN CKDYR SARGYINASLI  S  E +SRFIATQG
Sbjct  78    ALDSVNSGKNRYTDVVPFDKNRVVLNSCKDYRPSARGYINASLIATSSSESISRFIATQG  137

Query  579   PLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIK  758
             PLP+T+EDFWEMV++ RCP ++MLTRLVD Y  VKCGDYFQAEDG REFGNICI+TKW++
Sbjct  138   PLPHTYEDFWEMVLEQRCPVVIMLTRLVDCYTMVKCGDYFQAEDGPREFGNICISTKWLR  197

Query  759   TTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLG  938
             TTDTSL+LR LEV+ KESEEPP+SVLH QY EWPDHGVPK+T   REI+KR++ +PP+LG
Sbjct  198   TTDTSLVLRLLEVNXKESEEPPMSVLHIQYPEWPDHGVPKNTFVVREILKRIYQVPPNLG  257

Query  939   PIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFC  1118
             PIVVHCSAGIGRTGTYC+IHN +QRIL GDMSAL+LV+TIT FRSQRIGMVQTLEQY+FC
Sbjct  258   PIVVHCSAGIGRTGTYCSIHNAVQRILAGDMSALNLVDTITTFRSQRIGMVQTLEQYIFC  317

Query  1119  YDAIIEELEDIIKESTGQPSS  1181
             Y AI++ELE+++     + +S
Sbjct  318   YSAIVDELEELMSNLNSETNS  338



>ref|XP_008381997.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Malus domestica]
Length=339

 Score =   489 bits (1260),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 225/321 (70%), Positives = 268/321 (83%), Gaps = 3/321 (1%)
 Frame = +3

Query  225   SYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLV  404
             S D+ PP+L L+ DQ +YCS+ALK+ KEK  Q P+ I+QEF  LQA R+  S+M+  C V
Sbjct  19    SADAPPPKLALTPDQYKYCSQALKLFKEK-LQMPDHIKQEFAQLQAKRITLSEMKRNCTV  77

Query  405   ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIATQG  578
             ALDS+N  KNRYTDV+PFD NRVVLN CKDYR SARGYINASLI  S  E +SRFIATQG
Sbjct  78    ALDSVNSGKNRYTDVVPFDKNRVVLNSCKDYRPSARGYINASLIATSSSESISRFIATQG  137

Query  579   PLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIK  758
             PLP+T+EDFWEMV++ RCP ++MLTRLVD Y  VKCGDYFQAEDG REFGNICI+TKW++
Sbjct  138   PLPHTYEDFWEMVLEQRCPVVIMLTRLVDCYTMVKCGDYFQAEDGPREFGNICISTKWLR  197

Query  759   TTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLG  938
             TTDTSL+LR LEV+ KESEEPP+SVLH QY EWPDHGVPK+T   REI+KR++ +PP+LG
Sbjct  198   TTDTSLVLRLLEVNXKESEEPPMSVLHIQYPEWPDHGVPKNTFVVREILKRIYQVPPNLG  257

Query  939   PIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFC  1118
             PIVVHCSAGIGRTGTYC IHN +QRIL GDMSAL+LV+TIT FRSQRIGMVQTLEQY+FC
Sbjct  258   PIVVHCSAGIGRTGTYCXIHNAVQRILAGDMSALNLVDTITTFRSQRIGMVQTLEQYIFC  317

Query  1119  YDAIIEELEDIIKESTGQPSS  1181
             Y AI++ELE+++     + +S
Sbjct  318   YSAIVDELEELMSNLNSETNS  338



>ref|XP_004290440.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=331

 Score =   488 bits (1256),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 230/326 (71%), Positives = 267/326 (82%), Gaps = 4/326 (1%)
 Frame = +3

Query  210   QPF-DFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDM  386
             +PF  FS DS PPRL LS DQ  YCS+ALK LK+K  Q P +I QEF  LQ  R+ AS+M
Sbjct  4     KPFPSFSADSPPPRLTLSPDQYNYCSQALKFLKDK-LQMPHQINQEFALLQGKRITASEM  62

Query  387   RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSR  560
             +  C VALDS+N+SKNRYTDVLPFD NRVVLN CKDYR  ARGYINAS I+   S ++SR
Sbjct  63    KRSCTVALDSVNVSKNRYTDVLPFDQNRVVLNSCKDYRPEARGYINASFISACSSGNISR  122

Query  561   FIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICI  740
             FIATQGPLP+T+EDFWEMV++NRCP +VMLTRLVD ++ VKCGDYFQAEDG REFGNI +
Sbjct  123   FIATQGPLPHTYEDFWEMVLENRCPVVVMLTRLVDYHRMVKCGDYFQAEDGPREFGNITL  182

Query  741   TTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHT  920
             +TKWI+TT  S+ LR LEV+ KESEEPP+SVLH QY EWPDHGVP DT+A REI+K ++ 
Sbjct  183   STKWIRTTGNSIALRLLEVNSKESEEPPISVLHIQYPEWPDHGVPTDTIAVREILKTIYQ  242

Query  921   LPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTL  1100
             +PP LGP+VVHCSAGIGRTGTYC IHNTIQRIL GDMSALDL NTIT FR++RIGMVQTL
Sbjct  243   VPPDLGPVVVHCSAGIGRTGTYCTIHNTIQRILSGDMSALDLANTITTFRTERIGMVQTL  302

Query  1101  EQYLFCYDAIIEELEDIIKESTGQPS  1178
             EQY FCY AII+ELED++    G+ S
Sbjct  303   EQYFFCYSAIIDELEDLMANLNGERS  328



>ref|XP_011458440.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=331

 Score =   488 bits (1256),  Expect = 5e-167, Method: Compositional matrix adjust.
 Identities = 230/326 (71%), Positives = 267/326 (82%), Gaps = 4/326 (1%)
 Frame = +3

Query  210   QPF-DFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDM  386
             +PF  FS DS PPRL LS DQ  YCS+ALK LK+K  Q P +I QEF  LQ  R+ AS+M
Sbjct  4     KPFPSFSADSPPPRLTLSPDQYNYCSQALKFLKDK-LQMPHQINQEFALLQGKRITASEM  62

Query  387   RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSR  560
             +  C VALDS+N+SKNRYTDVLPFD NRVVLN CKDYR  ARGYINAS I+   S ++SR
Sbjct  63    KRSCTVALDSVNVSKNRYTDVLPFDQNRVVLNSCKDYRPEARGYINASFISACSSGNISR  122

Query  561   FIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICI  740
             FIATQGPLP+T+EDFWEMV++NRCP +VMLTRLVD ++ VKCGDYFQAEDG REFGNI +
Sbjct  123   FIATQGPLPHTYEDFWEMVLENRCPVVVMLTRLVDYHRMVKCGDYFQAEDGPREFGNITL  182

Query  741   TTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHT  920
             +TKWI+TT  S+ LR LEV+ KESEEPP+SVLH QY EWPDHGVP DT+A REI+K ++ 
Sbjct  183   STKWIRTTGNSIALRLLEVNSKESEEPPISVLHIQYPEWPDHGVPTDTIAVREILKTIYQ  242

Query  921   LPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTL  1100
             +PP LGP+VVHCSAGIGRTGTYC IHNTIQRIL GDMSALDL NTIT FR++RIGMVQTL
Sbjct  243   VPPDLGPVVVHCSAGIGRTGTYCTIHNTIQRILSGDMSALDLANTITTFRTERIGMVQTL  302

Query  1101  EQYLFCYDAIIEELEDIIKESTGQPS  1178
             EQY FCY AII+ELED++    G+ S
Sbjct  303   EQYFFCYSAIIDELEDLMANLNGERS  328



>ref|XP_010256308.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Nelumbo nucifera]
Length=344

 Score =   488 bits (1256),  Expect = 9e-167, Method: Compositional matrix adjust.
 Identities = 234/323 (72%), Positives = 268/323 (83%), Gaps = 4/323 (1%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             +PF+FS D  PPRL LS +QL+YCSEA+  LKEK  + PE ++QEF  LQA R+R  DM 
Sbjct  24    KPFEFSSDP-PPRLSLSPEQLQYCSEAITRLKEK-LRVPELLKQEFDRLQATRIRKYDMM  81

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRF  563
             + C VAL+  N  KNRY DVLPFD NRVVL P +D     R YINAS IT S  E++SRF
Sbjct  82    NSCKVALEYTNKEKNRYLDVLPFDQNRVVLKPSEDSISLGRDYINASFITTSSSENLSRF  141

Query  564   IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICIT  743
             IATQGPLP+TFEDFWEMVIQ RCP IVMLTRLVDNYK VKCGDYFQAEDG REFGNICI 
Sbjct  142   IATQGPLPHTFEDFWEMVIQYRCPVIVMLTRLVDNYKMVKCGDYFQAEDGPREFGNICIV  201

Query  744   TKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTL  923
             ++WI TTD SL+LR LEV+YKESE+PPLSVLH QY EWPDHGVP+DTLA REI+KR++ +
Sbjct  202   SRWITTTDNSLVLRNLEVNYKESEDPPLSVLHIQYPEWPDHGVPRDTLAVREILKRIYHV  261

Query  924   PPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLE  1103
             PP+LGPI VHCSAGIGRTGTYC IHN IQRIL+GDMSALDLVNTITIFRSQR+GMVQTLE
Sbjct  262   PPNLGPIAVHCSAGIGRTGTYCTIHNAIQRILIGDMSALDLVNTITIFRSQRVGMVQTLE  321

Query  1104  QYLFCYDAIIEELEDIIKESTGQ  1172
             Q+LFCYDAI++ELE+++ ES  Q
Sbjct  322   QFLFCYDAILDELEELVSESNHQ  344



>gb|EYU23943.1| hypothetical protein MIMGU_mgv1a010376mg [Erythranthe guttata]
Length=314

 Score =   484 bits (1246),  Expect = 8e-166, Method: Compositional matrix adjust.
 Identities = 227/310 (73%), Positives = 258/310 (83%), Gaps = 0/310 (0%)
 Frame = +3

Query  243   PRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSIN  422
             P + LS DQLR CSEAL+  K ++  +P+ I QEF TLQANRM A +MR+RC VAL S N
Sbjct  2     PMVRLSGDQLRRCSEALECFKSQKVNSPQTIHQEFQTLQANRMGALNMRNRCAVALSSFN  61

Query  423   ISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFED  602
              SKNRYTDVLPFD NRV+LN   DYR SA+GYINAS +  SE+VS FIATQGPL +T ED
Sbjct  62    YSKNRYTDVLPFDENRVILNQSSDYRPSAKGYINASFVKNSENVSGFIATQGPLTHTSED  121

Query  603   FWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLIL  782
             FWEM+IQ RCP I+MLTRL+DNY T KC DYFQAEDG REFGNICI TKWI+TTD SL+L
Sbjct  122   FWEMIIQYRCPVIIMLTRLIDNYHTEKCVDYFQAEDGPREFGNICIATKWIQTTDNSLVL  181

Query  783   RCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVHCSA  962
             RCLEV+YKESEE PLSVLH QY EWPDHGVPKDT A REI KR+  +P SLGPIVVHCSA
Sbjct  182   RCLEVNYKESEELPLSVLHIQYPEWPDHGVPKDTRAVREIFKRISHVPRSLGPIVVHCSA  241

Query  963   GIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEEL  1142
             GIGRTGTYC IHNTIQR+L GDM+ALDLVNT++ FRSQRIGMVQTLEQY+FCYDAI++EL
Sbjct  242   GIGRTGTYCVIHNTIQRVLTGDMTALDLVNTVSTFRSQRIGMVQTLEQYIFCYDAIVDEL  301

Query  1143  EDIIKESTGQ  1172
             E++I +S  Q
Sbjct  302   ENLISDSNNQ  311



>ref|XP_008237328.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X3 [Prunus 
mume]
Length=336

 Score =   485 bits (1248),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 227/317 (72%), Positives = 269/317 (85%), Gaps = 3/317 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
              DFS DS P RLVL+ DQ +YCS+ALK  K+K  Q  + I QEF  LQA R+ +SDM+  
Sbjct  16    LDFSADSPPLRLVLTPDQYKYCSQALKFFKDK-LQTSDHIHQEFDQLQAKRITSSDMKRS  74

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVS--RFIA  569
             C VALDS+N+SKNRYTDVLPFD+NRVVLN CKDYR SARGYINAS I+ S   S  RF+A
Sbjct  75    CTVALDSVNLSKNRYTDVLPFDTNRVVLNSCKDYRPSARGYINASFISTSSSESISRFVA  134

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+T+EDFWEMV++ RCP ++MLTRLVDNY+ VKCGDYFQAEDG REFGNIC+ TK
Sbjct  135   TQGPLPHTYEDFWEMVLEQRCPVVIMLTRLVDNYRMVKCGDYFQAEDGPREFGNICLATK  194

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             W++TT+TSL LR LE +YKESEEPP+SVLH QY EWPDHGVP+D++A REI+KRL+ +PP
Sbjct  195   WLRTTETSLELRLLEANYKESEEPPMSVLHIQYPEWPDHGVPEDSIAVREILKRLYQVPP  254

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             +LGPIVVHCSAGIGRTGTYC IHNT+QRIL GDMSALD+V+T+T FRSQRIGMVQTLEQY
Sbjct  255   NLGPIVVHCSAGIGRTGTYCTIHNTVQRILAGDMSALDVVDTVTTFRSQRIGMVQTLEQY  314

Query  1110  LFCYDAIIEELEDIIKE  1160
              FCY AI++ELED++ +
Sbjct  315   FFCYSAIVDELEDLVSD  331



>ref|XP_011038164.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Populus euphratica]
Length=337

 Score =   484 bits (1246),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 228/317 (72%), Positives = 266/317 (84%), Gaps = 4/317 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             F+FS D  PPR+ LS DQ ++CSEAL   KEK  + PE+I QEF  LQA+R+  S M   
Sbjct  22    FEFSPDP-PPRISLSDDQYQHCSEALHFFKEK-LRTPERIAQEFAHLQASRITPSQMARS  79

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLIT--VSEHVSRFIA  569
             C VALD +N++KNRY DV+PFD  RVVLNPCKDYR SARGYINASLIT   S+++SRFIA
Sbjct  80    CKVALDGVNVNKNRYLDVVPFDQYRVVLNPCKDYRPSARGYINASLITNSSSDNISRFIA  139

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+T+EDFWEM+IQ+ CP IVMLTRLVDNYK VKCGDYFQAEDG R FGNI I TK
Sbjct  140   TQGPLPHTYEDFWEMIIQHHCPVIVMLTRLVDNYKIVKCGDYFQAEDGPRGFGNISIVTK  199

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             WIKTTDTSL+LR L+V YKE+EE P++VLH QY EWPDHGVP+DT+  REI KR++ +PP
Sbjct  200   WIKTTDTSLLLRNLKVGYKEAEEQPMNVLHIQYPEWPDHGVPEDTIVVREIFKRVYHVPP  259

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             SLGPIVVHCSAGIGRTGTYC IHNT+QRIL+GDMSALD+ NT+  FRSQRIGMVQT+EQY
Sbjct  260   SLGPIVVHCSAGIGRTGTYCTIHNTVQRILVGDMSALDIANTVATFRSQRIGMVQTMEQY  319

Query  1110  LFCYDAIIEELEDIIKE  1160
             +FCY+AII+ELED+I E
Sbjct  320   IFCYEAIIDELEDLISE  336



>ref|XP_008237326.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X1 [Prunus 
mume]
Length=368

 Score =   485 bits (1248),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 227/317 (72%), Positives = 269/317 (85%), Gaps = 3/317 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
              DFS DS P RLVL+ DQ +YCS+ALK  K+K  Q  + I QEF  LQA R+ +SDM+  
Sbjct  16    LDFSADSPPLRLVLTPDQYKYCSQALKFFKDK-LQTSDHIHQEFDQLQAKRITSSDMKRS  74

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVS--RFIA  569
             C VALDS+N+SKNRYTDVLPFD+NRVVLN CKDYR SARGYINAS I+ S   S  RF+A
Sbjct  75    CTVALDSVNLSKNRYTDVLPFDTNRVVLNSCKDYRPSARGYINASFISTSSSESISRFVA  134

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+T+EDFWEMV++ RCP ++MLTRLVDNY+ VKCGDYFQAEDG REFGNIC+ TK
Sbjct  135   TQGPLPHTYEDFWEMVLEQRCPVVIMLTRLVDNYRMVKCGDYFQAEDGPREFGNICLATK  194

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             W++TT+TSL LR LE +YKESEEPP+SVLH QY EWPDHGVP+D++A REI+KRL+ +PP
Sbjct  195   WLRTTETSLELRLLEANYKESEEPPMSVLHIQYPEWPDHGVPEDSIAVREILKRLYQVPP  254

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             +LGPIVVHCSAGIGRTGTYC IHNT+QRIL GDMSALD+V+T+T FRSQRIGMVQTLEQY
Sbjct  255   NLGPIVVHCSAGIGRTGTYCTIHNTVQRILAGDMSALDVVDTVTTFRSQRIGMVQTLEQY  314

Query  1110  LFCYDAIIEELEDIIKE  1160
              FCY AI++ELED++ +
Sbjct  315   FFCYSAIVDELEDLVSD  331



>ref|XP_009348840.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009348841.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009348842.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
Length=339

 Score =   483 bits (1244),  Expect = 5e-165, Method: Compositional matrix adjust.
 Identities = 229/324 (71%), Positives = 270/324 (83%), Gaps = 3/324 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
              + S DS PP+L L+ DQ +YCS+ALK+ KEK  Q  + I QEF  LQA RM +S+M+  
Sbjct  16    LNVSADSPPPKLALTPDQYKYCSQALKLFKEK-LQMRDHINQEFAQLQAKRMTSSEMKRN  74

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVS--RFIA  569
             C VALD++N SKNRYTDV+PFD NRVVLN  KDYR SARGYINASLIT S   S  +FIA
Sbjct  75    CTVALDNVNSSKNRYTDVVPFDKNRVVLNSSKDYRPSARGYINASLITTSSSESISQFIA  134

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+T+EDFWEMV++ RCP ++MLTRL+D Y  VKCGDY+QAEDG REFGNICI+TK
Sbjct  135   TQGPLPHTYEDFWEMVLEQRCPVVIMLTRLIDCYTMVKCGDYYQAEDGPREFGNICISTK  194

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             W++TTDTSL+LR LEV+ KESEEPP+SVLH QY EWPDHGVP +T+A REI+KRL+ +PP
Sbjct  195   WLRTTDTSLVLRLLEVNNKESEEPPISVLHIQYPEWPDHGVPNNTIAVREILKRLYNMPP  254

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             +LGPIVVHCSAGIGRTGTYC IHNT+QRIL GDMSALDLV+TIT FRSQRIGMVQTLEQY
Sbjct  255   NLGPIVVHCSAGIGRTGTYCTIHNTVQRILAGDMSALDLVDTITTFRSQRIGMVQTLEQY  314

Query  1110  LFCYDAIIEELEDIIKESTGQPSS  1181
              FCY AI++ELED+I +  G+ SS
Sbjct  315   FFCYSAIVDELEDLISDLNGETSS  338



>ref|XP_010428033.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Camelina sativa]
Length=342

 Score =   479 bits (1233),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 223/325 (69%), Positives = 263/325 (81%), Gaps = 4/325 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLV-LSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
             FDFS    PP ++ LS DQL YC +AL V +EK  + P+ I  EF  LQANR+R ++M  
Sbjct  19    FDFSSADSPPSILSLSPDQLNYCRQALGVFREK-IENPDSIAHEFANLQANRLRPTEMLL  77

Query  393   RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFI  566
              C +A++++NI KNRY DV+PFD+NR+VLNPCKDYR SA GY+NASLI  S  E +S+FI
Sbjct  78    SCTLAMNNVNIEKNRYRDVVPFDNNRIVLNPCKDYRSSAEGYVNASLIKTSDSESISQFI  137

Query  567   ATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITT  746
             ATQGPLP+T EDFWEMVIQ+ CP IVMLTRLVDNYKTVKCGDYFQA DG REFGNI + T
Sbjct  138   ATQGPLPHTMEDFWEMVIQHHCPIIVMLTRLVDNYKTVKCGDYFQAGDGPREFGNISVMT  197

Query  747   KWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLP  926
             KWIKTTDTSL+LR LEV YKE+E+ P+SVLH QY EWPDHGVPKDT+A REI+KRL+ +P
Sbjct  198   KWIKTTDTSLMLRNLEVKYKETEDQPMSVLHIQYPEWPDHGVPKDTVAVREILKRLYQVP  257

Query  927   PSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQ  1106
             PS GPI+VHCSAGIGRTGTYCAIHNTIQR+L GDMSALDL  T+  FRSQRIGMVQT++Q
Sbjct  258   PSAGPIIVHCSAGIGRTGTYCAIHNTIQRVLAGDMSALDLAKTVAKFRSQRIGMVQTMDQ  317

Query  1107  YLFCYDAIIEELEDIIKESTGQPSS  1181
             Y FCY AI++ELED+   +    SS
Sbjct  318   YFFCYTAIVDELEDLTGGTNAGTSS  342



>ref|XP_010471199.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Camelina sativa]
 ref|XP_010471200.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Camelina sativa]
Length=337

 Score =   478 bits (1230),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 223/325 (69%), Positives = 263/325 (81%), Gaps = 4/325 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLV-LSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
             F+FS    PP ++ LS DQL YC +AL V +EK  + P+ I  EF  LQANR+R ++M  
Sbjct  14    FNFSSADSPPSILSLSPDQLNYCRQALGVFREK-IENPDSIAHEFANLQANRLRPTEMLL  72

Query  393   RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFI  566
              C +A++++NI KNRY DV+PFD+NR+VLNPCKDYR SA GY+NASLI  S  E +S+FI
Sbjct  73    SCTLAMNNVNIEKNRYRDVVPFDNNRIVLNPCKDYRSSAEGYVNASLIKTSDSESISQFI  132

Query  567   ATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITT  746
             ATQGPLP+T EDFWEMVIQ+ CP IVMLTRLVDNYKTVKCGDYFQA DG REFGNI + T
Sbjct  133   ATQGPLPHTMEDFWEMVIQHHCPIIVMLTRLVDNYKTVKCGDYFQAADGPREFGNISVMT  192

Query  747   KWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLP  926
             KWIKTTDTSL+LR LEV YKE+E+ P+SVLH QY EWPDHGVPKDT+A REI+KRL+ +P
Sbjct  193   KWIKTTDTSLMLRNLEVKYKETEDQPMSVLHIQYPEWPDHGVPKDTVAVREILKRLYQVP  252

Query  927   PSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQ  1106
             PS GPI+VHCSAGIGRTGTYCAIHNTIQRIL GDMSALDL  T+  FRSQRIGMVQT++Q
Sbjct  253   PSAGPIIVHCSAGIGRTGTYCAIHNTIQRILAGDMSALDLAKTVATFRSQRIGMVQTMDQ  312

Query  1107  YLFCYDAIIEELEDIIKESTGQPSS  1181
             Y FCY AI++ELED+   +    SS
Sbjct  313   YFFCYTAIVDELEDLTGGTNAGTSS  337



>ref|XP_009339078.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009339079.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
 ref|XP_009339080.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
Length=339

 Score =   478 bits (1230),  Expect = 6e-163, Method: Compositional matrix adjust.
 Identities = 227/324 (70%), Positives = 268/324 (83%), Gaps = 3/324 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
              + S DS PP+L L+ DQ +YCS+ALK+ K K  Q  + I QEF  LQA RM +S+ +  
Sbjct  16    LNVSADSPPPKLALTPDQYKYCSQALKLFKGK-LQMRDHINQEFAQLQAKRMTSSERKRN  74

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVS--RFIA  569
             C VALD++N SKNRYTDV+PFD NRVVLN  KDYR SARGYINASLIT S   S  +FIA
Sbjct  75    CTVALDNVNSSKNRYTDVVPFDKNRVVLNSSKDYRPSARGYINASLITTSSSESISQFIA  134

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+T+EDFWEMV++ RCP ++MLTRL+D Y  VKCGDY+QAEDG REFGNICI+TK
Sbjct  135   TQGPLPHTYEDFWEMVLEQRCPVVIMLTRLIDCYTMVKCGDYYQAEDGPREFGNICISTK  194

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             W++TTDTSL+LR LEV+ KESEEPP+SVLH QY EWPDHGVP +T+A REI+KRL+ +PP
Sbjct  195   WLRTTDTSLVLRLLEVNNKESEEPPMSVLHIQYPEWPDHGVPNNTIAVREILKRLYNMPP  254

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             +LGPIVVHCSAGIGRTGTYC IHNT+QRIL GDMSALDLV+TIT FRSQRIGMVQTLEQY
Sbjct  255   NLGPIVVHCSAGIGRTGTYCTIHNTVQRILAGDMSALDLVDTITTFRSQRIGMVQTLEQY  314

Query  1110  LFCYDAIIEELEDIIKESTGQPSS  1181
              FCY AI++ELED+I +  G+ SS
Sbjct  315   FFCYSAIVDELEDLISDLNGETSS  338



>ref|XP_010415897.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Camelina sativa]
 ref|XP_010415898.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Camelina sativa]
Length=328

 Score =   477 bits (1228),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 223/315 (71%), Positives = 261/315 (83%), Gaps = 4/315 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLV-LSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
             FDFS    PP ++ LS DQL YC +AL V +EK  Q P+ I  EF  LQANR+R ++M  
Sbjct  14    FDFSSADSPPSILSLSPDQLNYCRQALGVFREK-IQNPDSIAHEFANLQANRLRPTEMLL  72

Query  393   RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFI  566
              C +A++++NI KNRY DV+PFD+NR+VLNPCKD R SA GY+NASLI  S  E +S+FI
Sbjct  73    SCTLAMNNVNIEKNRYRDVVPFDNNRIVLNPCKDDRSSAEGYVNASLIKTSDSESISQFI  132

Query  567   ATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITT  746
             ATQGPLP+T EDFWEMVIQ+ CP IVMLTRLVDNYKTVKCGDYFQA DG REFGNI + T
Sbjct  133   ATQGPLPHTMEDFWEMVIQHHCPIIVMLTRLVDNYKTVKCGDYFQAGDGPREFGNISVMT  192

Query  747   KWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLP  926
             KWIKTTDTSL+LR LEV YKE+E+ P+SVLH QY EWPDHGVPKDT+A REI+KRL+ +P
Sbjct  193   KWIKTTDTSLMLRNLEVKYKETEDQPMSVLHIQYPEWPDHGVPKDTVAVREILKRLYQVP  252

Query  927   PSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQ  1106
             PS+GPI+VHCSAGIGRTGTYCAIHNTIQRIL GDMSALDL  T+  FRSQRIGMVQT++Q
Sbjct  253   PSVGPIIVHCSAGIGRTGTYCAIHNTIQRILAGDMSALDLAKTVATFRSQRIGMVQTMDQ  312

Query  1107  YLFCYDAIIEELEDI  1151
             YLFCY AI++ELED+
Sbjct  313   YLFCYTAIVDELEDL  327



>ref|XP_012081087.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X2 [Jatropha 
curcas]
Length=334

 Score =   477 bits (1227),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 224/315 (71%), Positives = 262/315 (83%), Gaps = 9/315 (3%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             F+FS DS PP+L LS+DQ +YCS AL+  KEK  Q P++I QEF  LQ  R   S M   
Sbjct  22    FEFSSDS-PPKLSLSTDQHKYCSRALQFFKEK-LQTPDRITQEFAHLQTTRTTPSQMARS  79

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIA  569
             C VALD++N+SKNRY DVLPFD NRVVLNPCKDYR SA+GYINASLIT S  E++SRFIA
Sbjct  80    CKVALDNVNVSKNRYMDVLPFDQNRVVLNPCKDYRASAQGYINASLITTSSSENISRFIA  139

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+TFEDFWEM+IQ+ CP IVMLTRLVDNYK VKCGDYFQ+EDG R+FGNI + +K
Sbjct  140   TQGPLPHTFEDFWEMIIQHHCPVIVMLTRLVDNYKIVKCGDYFQSEDGPRDFGNISLVSK  199

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             W++TTDTSL+LR LE     SEE P+SVLH QY EWPDHGVPKDT+A REI+KR+  +PP
Sbjct  200   WVRTTDTSLVLRNLE-----SEELPMSVLHIQYPEWPDHGVPKDTVAVREILKRVFQVPP  254

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             +LGP+VVHCSAGIGRTGTYC IHNTIQRIL+GDMSALD+ NT+  FRSQR+GMVQT++QY
Sbjct  255   NLGPVVVHCSAGIGRTGTYCTIHNTIQRILVGDMSALDIANTVATFRSQRVGMVQTMDQY  314

Query  1110  LFCYDAIIEELEDII  1154
              FCY AII+ELED+I
Sbjct  315   FFCYKAIIDELEDLI  329



>ref|XP_002887394.1| hypothetical protein ARALYDRAFT_339406 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63653.1| hypothetical protein ARALYDRAFT_339406 [Arabidopsis lyrata subsp. 
lyrata]
Length=342

 Score =   476 bits (1225),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 224/325 (69%), Positives = 264/325 (81%), Gaps = 4/325 (1%)
 Frame = +3

Query  216   FDFS-YDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
             FDFS  D+ P +L LS DQL +C +AL V + K  Q P+ I  EF  LQANRM  S+M  
Sbjct  19    FDFSSADAPPSKLSLSPDQLNHCHQALGVFRGK-IQDPDSIAHEFAGLQANRMWPSEMLL  77

Query  393   RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFI  566
                VA++S+NI KNRY+DV+PFD NR+VLNPCKDYR SA+GY+NASLI  S  E +S+FI
Sbjct  78    NSTVAMNSVNIEKNRYSDVVPFDKNRIVLNPCKDYRSSAKGYVNASLIKTSDSESISQFI  137

Query  567   ATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITT  746
             ATQGPLP+T EDFWEMVIQ  CP IVMLTRLVDN +TVKCGDYFQAEDG REFGNI +TT
Sbjct  138   ATQGPLPHTMEDFWEMVIQQHCPIIVMLTRLVDNNRTVKCGDYFQAEDGSREFGNISVTT  197

Query  747   KWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLP  926
             KWIK+T+TSL+LR LEV+YKE+E+ P+SVLH QY EWPDHGVP+DT+A REI+KRL+ +P
Sbjct  198   KWIKSTETSLMLRNLEVNYKETEDRPMSVLHIQYPEWPDHGVPRDTVAVREILKRLYQVP  257

Query  927   PSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQ  1106
             PSLGPI+VHCSAGIGRTGTYCAIHNTIQRIL GDMSALDL  T+ IFRSQRIGMVQT++Q
Sbjct  258   PSLGPIIVHCSAGIGRTGTYCAIHNTIQRILAGDMSALDLAKTVAIFRSQRIGMVQTMDQ  317

Query  1107  YLFCYDAIIEELEDIIKESTGQPSS  1181
             Y FCY  I++ELED+   +    SS
Sbjct  318   YFFCYTTIVDELEDLTAGTDAGTSS  342



>gb|KHG30608.1| Tyrosine-protein phosphatase non-receptor type 20 [Gossypium 
arboreum]
Length=345

 Score =   474 bits (1220),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 220/324 (68%), Positives = 271/324 (84%), Gaps = 4/324 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             F FS D  PP++ L+ DQ  YCSEALK+  +K  Q P++I +EF  LQANR+  S+M  R
Sbjct  22    FVFSADP-PPKISLTPDQFNYCSEALKLFSQKP-QMPDEINREFSHLQANRITPSEMMRR  79

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIA  569
             C V  +  N+ KNRY+DV+PFD+NRVVLN CKDYR +A+GYINAS +T S  E++S+FIA
Sbjct  80    CTVGFNGANLDKNRYSDVIPFDTNRVVLNSCKDYRPTAKGYINASFVTTSSSENISKFIA  139

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+T+EDFWEMVIQ  CP IVMLTRLVDNYKTVKCGDYFQAE+G R+FGNICI TK
Sbjct  140   TQGPLPHTYEDFWEMVIQCHCPVIVMLTRLVDNYKTVKCGDYFQAENGPRQFGNICIDTK  199

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             WI+ T+TSL++R LEV+YKESE+PPLSVLH QY EWPDHGVP DTLA REI+KR+  +P 
Sbjct  200   WIQETETSLLIRNLEVNYKESEDPPLSVLHIQYPEWPDHGVPTDTLAVREILKRVLQVPV  259

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             ++GPI+VHCSAGIGRTGTYCAIHNT+QRIL+GDMSALDL NTI++FRSQRIGMVQT++QY
Sbjct  260   NIGPILVHCSAGIGRTGTYCAIHNTVQRILIGDMSALDLANTISMFRSQRIGMVQTMDQY  319

Query  1110  LFCYDAIIEELEDIIKESTGQPSS  1181
              FCY AI++EL+++I + + + SS
Sbjct  320   FFCYKAIVDELKELISDFSSEHSS  343



>ref|XP_007020249.1| Tyrosine phosphatase 1 isoform 1 [Theobroma cacao]
 gb|EOY17474.1| Tyrosine phosphatase 1 isoform 1 [Theobroma cacao]
Length=343

 Score =   473 bits (1217),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 221/324 (68%), Positives = 265/324 (82%), Gaps = 4/324 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             F FS D  PPR+ L+  Q  YCS ALK+  EK    P +I +EF  LQANR+R S+M   
Sbjct  20    FVFSAD-YPPRVSLTPSQFNYCSRALKLFSEKLLM-PHEITREFARLQANRIRPSEMARS  77

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIA  569
             C V L+S+N+ KNRY+DV+PFD NRVVLN CKDYR +A+GYINAS +T S  E++S+FIA
Sbjct  78    CTVGLNSVNLDKNRYSDVVPFDKNRVVLNSCKDYRPAAKGYINASFVTTSSSENISQFIA  137

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGP+P+T+EDFWEMVIQ  CP IVMLTRLVDNYK VKCGDYFQ E G R+ GNICI TK
Sbjct  138   TQGPIPHTYEDFWEMVIQRHCPVIVMLTRLVDNYKVVKCGDYFQVEGGPRQCGNICIDTK  197

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             WI+ TDTSL+LR LEV+Y ESE+PP+SVLH QY EWPDHGVP DTLA REI+KR+  +PP
Sbjct  198   WIQATDTSLLLRSLEVNYSESEDPPVSVLHIQYPEWPDHGVPVDTLAVREILKRVLKVPP  257

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             +LGPIVVHCSAGIGRTGTYCAIHNTIQRIL+GDMSALDL NT++ FRSQRIGMVQT++QY
Sbjct  258   NLGPIVVHCSAGIGRTGTYCAIHNTIQRILVGDMSALDLANTVSTFRSQRIGMVQTMDQY  317

Query  1110  LFCYDAIIEELEDIIKESTGQPSS  1181
             +FCY AI++EL+D++ E + + SS
Sbjct  318   IFCYKAIVDELKDLVSEFSSEYSS  341



>gb|AAT35563.1| protein tyrosine phosphatase [Phaseolus vulgaris]
Length=333

 Score =   469 bits (1207),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 215/317 (68%), Positives = 266/317 (84%), Gaps = 4/317 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             F+FS D+  P + L++DQ+ +C++AL +LKEK   AP  I +EF  LQANR+  S+MR R
Sbjct  18    FNFSPDNPSP-ITLTADQVSHCAQALNLLKEK-LHAPHTITREFAHLQANRITPSEMRRR  75

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIA  569
             C VALD++N+SKNRYTDVLPFDSNRV L    DYR +A+GYINASL++ S   +VS+F+A
Sbjct  76    CTVALDAVNLSKNRYTDVLPFDSNRVALKSSTDYRPAAQGYINASLVSTSSPGNVSQFVA  135

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+T+EDFWEM+IQ  CPAI+MLTRLVDNYK VKCGDYFQAEDG RE GNI +  K
Sbjct  136   TQGPLPHTYEDFWEMIIQYHCPAIIMLTRLVDNYKMVKCGDYFQAEDGPREVGNISVIGK  195

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             W+ TT+TSL+LR LEV+++E E+ P+SVLH QY EWPDHGVPKDTLA REI+KRL+ LPP
Sbjct  196   WVNTTETSLVLRLLEVNHREVEDAPISVLHIQYPEWPDHGVPKDTLAVREILKRLYHLPP  255

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             +LGPIVVHCSAGIGRTGTYC IHNTIQRIL GDMSA+D+ NT+++FR+QRIGMVQT +QY
Sbjct  256   NLGPIVVHCSAGIGRTGTYCTIHNTIQRILAGDMSAVDIANTVSVFRAQRIGMVQTQDQY  315

Query  1110  LFCYDAIIEELEDIIKE  1160
             +FCY AII+ELED++ +
Sbjct  316   IFCYKAIIDELEDLVSQ  332



>emb|CDX72837.1| BnaC06g32850D [Brassica napus]
Length=337

 Score =   469 bits (1207),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 228/328 (70%), Positives = 262/328 (80%), Gaps = 7/328 (2%)
 Frame = +3

Query  216   FDFS-YDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
             FDFS  DS  P+L LS DQL YC +ALK+ +EK    P+ I +EF  LQANRM ASDM  
Sbjct  11    FDFSSADSPLPKLSLSPDQLSYCHQALKIFREK-ISDPDSIAREFANLQANRMLASDMLR  69

Query  393   RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSR----  560
                VA++S+N  KNRYTDV+PFD+NRVVLNPCKD R SA GY+NASLI  S   S     
Sbjct  70    SSTVAINSVNFEKNRYTDVVPFDNNRVVLNPCKDSRSSADGYVNASLIKTSSSSSESVSE  129

Query  561   FIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICI  740
             FIATQGPLP+T EDFWEMVIQ  CP IVMLTRLVDNYKTVKCGDYF AED  REFGNI +
Sbjct  130   FIATQGPLPHTIEDFWEMVIQQHCPVIVMLTRLVDNYKTVKCGDYFPAEDKPREFGNISV  189

Query  741   TTKWIKTTDTSLILRCLEVSYKESE-EPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLH  917
              TKW+KTTDTSL+LR LEVS+KE+E + P+SVLH QYAEWPDHGVPKDT+A REI+KRL+
Sbjct  190   KTKWVKTTDTSLVLRNLEVSHKETEDQQPMSVLHIQYAEWPDHGVPKDTVAAREILKRLY  249

Query  918   TLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQT  1097
              +PPSLGPI+VHCSAGIGRTGTYCAIHNTIQRIL+GDMSALDL  T+T FR QRIGMVQT
Sbjct  250   QVPPSLGPIIVHCSAGIGRTGTYCAIHNTIQRILVGDMSALDLAKTVTTFRRQRIGMVQT  309

Query  1098  LEQYLFCYDAIIEELEDIIKESTGQPSS  1181
             ++QY FCY+AI++EL D+   +    SS
Sbjct  310   MDQYFFCYNAIVDELGDLTAGTNAGTSS  337



>ref|XP_009105847.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Brassica rapa]
Length=343

 Score =   469 bits (1206),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 224/329 (68%), Positives = 263/329 (80%), Gaps = 8/329 (2%)
 Frame = +3

Query  216   FDFS-YDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
             FDFS  DS PP+L LS DQL YC +ALK+L+EK    P+ I +EF  LQANRM ASDM  
Sbjct  16    FDFSSADSPPPKLSLSPDQLSYCHQALKILREK-ISDPDSIAREFANLQANRMLASDMLR  74

Query  393   RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSR----  560
                VA++S+N  KNRYTDV+PFD+NRVVLNPCKD R SA GY+NASLI  +   +     
Sbjct  75    SSTVAINSVNYEKNRYTDVVPFDNNRVVLNPCKDSRSSADGYVNASLIKTTSSSASESVS  134

Query  561   -FIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNIC  737
              FIATQGPLP+T EDFWEMVIQ  CP IVMLTRLVDNYKTVKCGDYF AED  REFGNI 
Sbjct  135   EFIATQGPLPHTIEDFWEMVIQQHCPVIVMLTRLVDNYKTVKCGDYFPAEDKPREFGNIS  194

Query  738   ITTKWIKTTDTSLILRCLEVSYKESE-EPPLSVLHFQYAEWPDHGVPKDTLATREIVKRL  914
             + TKW+KTTDT+L+LR LEV++KE+E + P+SVLH QYAEWPDHGVPKDT+A R I+KRL
Sbjct  195   VKTKWVKTTDTALLLRNLEVNHKETEDQQPMSVLHIQYAEWPDHGVPKDTVAARGILKRL  254

Query  915   HTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQ  1094
             + +PPSLGPI+VHCSAGIGRTGTYCAIHNTIQRIL+GDMSALDL  T+T+FR QR GMVQ
Sbjct  255   YQVPPSLGPIIVHCSAGIGRTGTYCAIHNTIQRILVGDMSALDLAKTVTMFRRQRNGMVQ  314

Query  1095  TLEQYLFCYDAIIEELEDIIKESTGQPSS  1181
             T++QY FCY+AI++EL D+   +    SS
Sbjct  315   TMDQYFFCYNAIVDELGDLTAGTNAGTSS  343



>gb|KJB35872.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=345

 Score =   469 bits (1206),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 218/324 (67%), Positives = 269/324 (83%), Gaps = 4/324 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             F FS D  PP++ L+ DQ  YCSEALK+  +K  Q P++I +EF  LQANR+  S+M  R
Sbjct  22    FVFSADP-PPKISLTPDQFNYCSEALKLFSQK-LQMPDEINREFSHLQANRITPSEMMRR  79

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIA  569
             C V  +  N+ KNRY+DV+PFD+NRVVL  CKDYR +A+GYINAS +T S  E++S+FIA
Sbjct  80    CTVGFNGANLDKNRYSDVIPFDTNRVVLYSCKDYRPAAKGYINASFVTTSSSENISKFIA  139

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+T+EDFWEMVIQ  CP IVMLTRLVDNYKTVKCGDYFQAE+  R+FGNICI TK
Sbjct  140   TQGPLPHTYEDFWEMVIQCHCPVIVMLTRLVDNYKTVKCGDYFQAENVPRQFGNICIDTK  199

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             WI+ T+TSL++R LEV+YKESE+PPLSVLH QY EWPDHGVP DTLA REI+KR+  +P 
Sbjct  200   WIQETETSLLIRNLEVNYKESEDPPLSVLHIQYPEWPDHGVPTDTLAVREILKRVLQVPV  259

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             ++GPI+VHCSAGIGRTGTYCAIHNT+QRIL+GDMSALDL NTI++FRSQRIGMVQT++QY
Sbjct  260   NIGPILVHCSAGIGRTGTYCAIHNTVQRILIGDMSALDLANTISMFRSQRIGMVQTMDQY  319

Query  1110  LFCYDAIIEELEDIIKESTGQPSS  1181
              FCY AI++EL+++I + + + SS
Sbjct  320   FFCYKAIVDELKELISDFSSEHSS  343



>gb|KJB35871.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=350

 Score =   468 bits (1205),  Expect = 5e-159, Method: Compositional matrix adjust.
 Identities = 218/324 (67%), Positives = 269/324 (83%), Gaps = 4/324 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             F FS D  PP++ L+ DQ  YCSEALK+  +K  Q P++I +EF  LQANR+  S+M  R
Sbjct  22    FVFSADP-PPKISLTPDQFNYCSEALKLFSQK-LQMPDEINREFSHLQANRITPSEMMRR  79

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIA  569
             C V  +  N+ KNRY+DV+PFD+NRVVL  CKDYR +A+GYINAS +T S  E++S+FIA
Sbjct  80    CTVGFNGANLDKNRYSDVIPFDTNRVVLYSCKDYRPAAKGYINASFVTTSSSENISKFIA  139

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+T+EDFWEMVIQ  CP IVMLTRLVDNYKTVKCGDYFQAE+  R+FGNICI TK
Sbjct  140   TQGPLPHTYEDFWEMVIQCHCPVIVMLTRLVDNYKTVKCGDYFQAENVPRQFGNICIDTK  199

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             WI+ T+TSL++R LEV+YKESE+PPLSVLH QY EWPDHGVP DTLA REI+KR+  +P 
Sbjct  200   WIQETETSLLIRNLEVNYKESEDPPLSVLHIQYPEWPDHGVPTDTLAVREILKRVLQVPV  259

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             ++GPI+VHCSAGIGRTGTYCAIHNT+QRIL+GDMSALDL NTI++FRSQRIGMVQT++QY
Sbjct  260   NIGPILVHCSAGIGRTGTYCAIHNTVQRILIGDMSALDLANTISMFRSQRIGMVQTMDQY  319

Query  1110  LFCYDAIIEELEDIIKESTGQPSS  1181
              FCY AI++EL+++I + + + SS
Sbjct  320   FFCYKAIVDELKELISDFSSEHSS  343



>emb|CDX96354.1| BnaA07g29650D [Brassica napus]
Length=343

 Score =   466 bits (1200),  Expect = 3e-158, Method: Compositional matrix adjust.
 Identities = 222/329 (67%), Positives = 262/329 (80%), Gaps = 8/329 (2%)
 Frame = +3

Query  216   FDFS-YDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
             FDFS  DS PP+L LS DQL YC +ALK+L+EK    P+ I +EF  LQANRM ASDM  
Sbjct  16    FDFSSADSPPPKLSLSPDQLSYCHQALKILREK-ISDPDSIAREFANLQANRMLASDMLR  74

Query  393   RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSR----  560
                VA++S+N  KNRYTDV+PFD+NRV+LNPCKD R SA GY+NASLI  +   +     
Sbjct  75    SSTVAINSVNYEKNRYTDVVPFDNNRVILNPCKDSRSSADGYVNASLIKTTSSSASESVS  134

Query  561   -FIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNIC  737
              FIATQGPLP+T EDFWEMVIQ  CP IVMLTRLVDNYKTVKCGDYF AED  REFGNI 
Sbjct  135   EFIATQGPLPHTIEDFWEMVIQQHCPVIVMLTRLVDNYKTVKCGDYFPAEDKPREFGNIS  194

Query  738   ITTKWIKTTDTSLILRCLEVSYKESE-EPPLSVLHFQYAEWPDHGVPKDTLATREIVKRL  914
             + TKW+KTTD +L+LR LEV++KE+E + P+SVLH QYAEWPDHGVPKDT+A R I+KRL
Sbjct  195   VKTKWVKTTDAALLLRNLEVNHKETEDQQPMSVLHIQYAEWPDHGVPKDTVAARGILKRL  254

Query  915   HTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQ  1094
             + +PPSLGPI+VHCSAGIGRTGTYCAIHNTIQRIL+GDMSALDL  T+T+FR QR GMVQ
Sbjct  255   YQVPPSLGPIIVHCSAGIGRTGTYCAIHNTIQRILVGDMSALDLAKTVTMFRRQRNGMVQ  314

Query  1095  TLEQYLFCYDAIIEELEDIIKESTGQPSS  1181
             T++QY FCY+AI++EL D+   +    SS
Sbjct  315   TMDQYFFCYNAIVDELGDLTAGTNAGTSS  343



>gb|KDO83953.1| hypothetical protein CISIN_1g019277mg [Citrus sinensis]
 gb|KDO83954.1| hypothetical protein CISIN_1g019277mg [Citrus sinensis]
Length=339

 Score =   464 bits (1195),  Expect = 1e-157, Method: Compositional matrix adjust.
 Identities = 216/310 (70%), Positives = 253/310 (82%), Gaps = 2/310 (1%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             +PF+FS    PPR+ L++DQ  +CSEAL   KEK      +I QEF  LQA+R++ S+M 
Sbjct  16    KPFEFSAVDFPPRISLTADQYNHCSEALSFFKEKLQNKSREISQEFARLQASRIKPSEMA  75

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRF  563
               C VALD +N+SKNRYTD+LPFD NRVVL  CKDYR +ARGYINASLI+ S  E VS+F
Sbjct  76    RGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQF  135

Query  564   IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICIT  743
             IATQGPLP+T+EDFWEMVIQ  CP IVMLTRLVDNYK VKCGDYFQAEDG REFGNI I 
Sbjct  136   IATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQAEDGPREFGNIGIV  195

Query  744   TKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTL  923
             TKWIKTT+T+L+LR LEV+YKESEEPP+SVLH QY EWPDHGVP+DTLA REI+KR++ L
Sbjct  196   TKWIKTTETALVLRNLEVNYKESEEPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYNL  255

Query  924   PPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLE  1103
             PP+ GPIVVHCSAGIGRTG YC IHNT+QRIL+GDMSALDL NT+ +FRSQRIGMVQT+ 
Sbjct  256   PPNFGPIVVHCSAGIGRTGAYCTIHNTVQRILVGDMSALDLANTVKVFRSQRIGMVQTMV  315

Query  1104  QYLFCYDAII  1133
                F   +++
Sbjct  316   LSSFLVQSLV  325



>ref|XP_006390734.1| hypothetical protein EUTSA_v10018624mg [Eutrema salsugineum]
 gb|ESQ28020.1| hypothetical protein EUTSA_v10018624mg [Eutrema salsugineum]
Length=414

 Score =   466 bits (1200),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 221/326 (68%), Positives = 260/326 (80%), Gaps = 5/326 (2%)
 Frame = +3

Query  216   FDFS-YDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
             FDFS  DS P +L LS DQL YC +AL + ++K     + I +EF  LQANR+  S+M+ 
Sbjct  90    FDFSSADSPPSKLSLSPDQLSYCHKALGIFRDKILDR-DSIAREFANLQANRLWPSEMQL  148

Query  393   RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSR---F  563
             RC VA++S+N  KNRYTDV+PFD NRV+LNPCKDYR  A+GY+NAS I  S        F
Sbjct  149   RCTVAMNSVNSEKNRYTDVVPFDKNRVLLNPCKDYRSPAKGYVNASFIKTSSSSESVSEF  208

Query  564   IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICIT  743
             IATQGPLPNT EDFWEMVIQ  CP IVMLTRLVDNYKTVKCGDYFQAED  REFG+I + 
Sbjct  209   IATQGPLPNTMEDFWEMVIQQHCPIIVMLTRLVDNYKTVKCGDYFQAEDRPREFGSISVM  268

Query  744   TKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTL  923
             TKW+KTTDTSL+LR LEV+YKE+E+ P+SVLH QY EWPDHGVPKDT+A R+I+KRL+ +
Sbjct  269   TKWVKTTDTSLMLRNLEVNYKETEDQPMSVLHIQYPEWPDHGVPKDTVAVRDILKRLYQV  328

Query  924   PPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLE  1103
             PPSLGPI+VHCSAGIGRTGTYCAIHNTIQRIL GDMSALDL  T+  FRSQRIGMVQT++
Sbjct  329   PPSLGPIIVHCSAGIGRTGTYCAIHNTIQRILAGDMSALDLAKTVATFRSQRIGMVQTMD  388

Query  1104  QYLFCYDAIIEELEDIIKESTGQPSS  1181
             QY FCY+AI++ELED+   +    SS
Sbjct  389   QYFFCYNAIVDELEDLTVGTNAGTSS  414



>gb|KDO83951.1| hypothetical protein CISIN_1g019277mg [Citrus sinensis]
Length=330

 Score =   459 bits (1180),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 216/317 (68%), Positives = 253/317 (80%), Gaps = 15/317 (5%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             +PF+FS    PPR+ L++DQ  +CSEAL   KEK      +I QEF  LQA+R++ S+M 
Sbjct  16    KPFEFSAVDFPPRISLTADQYNHCSEALSFFKEKLQNKSREISQEFARLQASRIKPSEMA  75

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRF  563
               C VALD +N+SKNRYTD+LPFD NRVVL  CKDYR +ARGYINASLI+ S  E VS+F
Sbjct  76    RGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQF  135

Query  564   IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICIT  743
             IATQGPLP+T+EDFWEMVIQ  CP IVMLTRLVDNYK VKCGDYFQAEDG REFGNI I 
Sbjct  136   IATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQAEDGPREFGNIGIV  195

Query  744   TKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTL  923
             TKWIKTT+T+L+LR LEV+YKESEEPP+SVLH QY EWPDHGVP+DTLA REI+KR++ L
Sbjct  196   TKWIKTTETALVLRNLEVNYKESEEPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYNL  255

Query  924   PPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLE  1103
             PP+ GPIVVHCSAGIGRTG YC IHNT+QRIL+GDMSALDL NT+              E
Sbjct  256   PPNFGPIVVHCSAGIGRTGAYCTIHNTVQRILVGDMSALDLANTVK-------------E  302

Query  1104  QYLFCYDAIIEELEDII  1154
             QY+FC+ AI++ELED+I
Sbjct  303   QYIFCHQAIVDELEDLI  319



>ref|XP_004496384.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Cicer arietinum]
 ref|XP_004496385.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Cicer arietinum]
Length=331

 Score =   457 bits (1175),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 217/309 (70%), Positives = 256/309 (83%), Gaps = 4/309 (1%)
 Frame = +3

Query  240   PPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSI  419
             P R+ L+SDQ+++C+EAL +LK+KR + P  I QEF  LQANR+  S+M  RC VAL+S+
Sbjct  24    PTRISLTSDQVKHCTEALALLKDKR-RNPHTISQEFLHLQANRITPSEMTRRCSVALNSV  82

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIATQGPLPNT  593
             NISKNRYTDVLPFD NRVVLN   DYR +A GYINAS I+ S    VS F+ATQGPLP+T
Sbjct  83    NISKNRYTDVLPFDKNRVVLNSSSDYRSAALGYINASFISTSSPGTVSEFLATQGPLPHT  142

Query  594   FEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTS  773
             +EDFWEM+IQ  CPAIVMLTRLVDNYK +KCGDYFQAED  RE GNI +T KW KTT+TS
Sbjct  143   YEDFWEMIIQYHCPAIVMLTRLVDNYK-MKCGDYFQAEDRPRELGNISLTCKWAKTTETS  201

Query  774   LILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVH  953
             L+LR  EV+++E E  PLSVLH QY EWPDHGVP DTLA REI+KRL+ LPP+LGPIVVH
Sbjct  202   LVLRHFEVNHREVENAPLSVLHIQYPEWPDHGVPNDTLAVREILKRLYHLPPNLGPIVVH  261

Query  954   CSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAII  1133
             CSAGIGRTGTYC IHNTIQRIL GDMSA+D+ NTI++FRSQRIGMVQT +QY+FCY AII
Sbjct  262   CSAGIGRTGTYCTIHNTIQRILAGDMSAVDIANTISVFRSQRIGMVQTQDQYIFCYQAII  321

Query  1134  EELEDIIKE  1160
             +ELED++ +
Sbjct  322   DELEDLVSQ  330



>emb|CAJ77612.1| protein tyrosine phosphatase [Fagus sylvatica]
Length=330

 Score =   455 bits (1171),  Expect = 3e-154, Method: Compositional matrix adjust.
 Identities = 224/322 (70%), Positives = 261/322 (81%), Gaps = 6/322 (2%)
 Frame = +3

Query  222   FSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCL  401
             FS DS PPRL L+ DQ+++CSEAL    +K  Q P  + QEF  LQANR+  S+MR  C 
Sbjct  12    FSPDS-PPRLPLTPDQVQHCSEALTFFIDK-LQMPHILNQEFAHLQANRITPSEMRRSCT  69

Query  402   VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVS--RFIATQ  575
             VA D++N++KNRYTDV+PFD NRVVLN CKDYR +A+GYINAS IT S   S  +FIATQ
Sbjct  70    VAFDNVNMNKNRYTDVVPFDKNRVVLNSCKDYRPAAKGYINASFITTSSSESISQFIATQ  129

Query  576   GPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWI  755
             GPLP T+EDFWEMV+QNRCP +VMLTRLVD  K VKCGDYFQAEDG RE GNI I TKWI
Sbjct  130   GPLPQTYEDFWEMVMQNRCPVVVMLTRLVD--KMVKCGDYFQAEDGPREIGNIHIVTKWI  187

Query  756   KTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSL  935
             KT DTSL+LR LEV YKESEE P+SVLH QY EWPDHGVP DT+A REI+KR + +PP+L
Sbjct  188   KTIDTSLVLRHLEVKYKESEEEPMSVLHIQYPEWPDHGVPNDTVAVREILKRTYHVPPNL  247

Query  936   GPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLF  1115
             GP+VVHCSAGIGRTGTYC IHNTIQRIL GDMSAL+LVNTI++FRSQRIGMVQT +Q+ F
Sbjct  248   GPVVVHCSAGIGRTGTYCTIHNTIQRILAGDMSALNLVNTISMFRSQRIGMVQTPDQFRF  307

Query  1116  CYDAIIEELEDIIKESTGQPSS  1181
             C+ AII+ELED+I +   + SS
Sbjct  308   CFKAIIDELEDLISDFNTERSS  329



>ref|NP_001237920.1| tyrosine phosphatase 1 [Glycine max]
 emb|CAA06975.1| tyrosine phosphatase 1 [Glycine max]
 gb|KHN17072.1| Tyrosine-protein phosphatase non-receptor type 6 [Glycine soja]
Length=338

 Score =   455 bits (1171),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 214/321 (67%), Positives = 257/321 (80%), Gaps = 4/321 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             F+FS D+ P R+ L+SDQ+ +C++AL +LKEK   AP  I QEF  LQANR+  S+MR R
Sbjct  20    FNFSPDN-PSRITLTSDQVNHCTQALNILKEK-LHAPNVITQEFAHLQANRITPSEMRRR  77

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIA  569
             C VA D +N+ KNRYTDVLPFD NRVVL    DYR  A+GYINASL++ S   +VS+FIA
Sbjct  78    CTVAYDDVNLRKNRYTDVLPFDKNRVVLKSSTDYRPEAQGYINASLVSTSSAGNVSQFIA  137

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPL +T+EDFWEM+IQ  CPAI+MLTRLVDNYK  KCGDYFQAED  RE GNI I  K
Sbjct  138   TQGPLQHTYEDFWEMIIQYHCPAIIMLTRLVDNYKMAKCGDYFQAEDRPREVGNISIIGK  197

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             W  TT+TSL+LR LEV+++E E+ PLSVLH QY EWPDHGVPKDT A REI+KRL+ LPP
Sbjct  198   WENTTETSLVLRHLEVNHREVEDAPLSVLHIQYPEWPDHGVPKDTFAVREILKRLYHLPP  257

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             + GPIVVHCSAGIGRTGTYC IHNTIQRI+ GDMSA+D+  TI +FRSQRIGMVQT +QY
Sbjct  258   NFGPIVVHCSAGIGRTGTYCTIHNTIQRIVAGDMSAVDIAKTIAMFRSQRIGMVQTQDQY  317

Query  1110  LFCYDAIIEELEDIIKESTGQ  1172
             +FCY+AII+ELED++ +   +
Sbjct  318   IFCYNAIIDELEDLVSQQQSE  338



>ref|XP_010674811.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010674859.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Beta vulgaris subsp. 
vulgaris]
Length=340

 Score =   455 bits (1171),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 215/322 (67%), Positives = 261/322 (81%), Gaps = 4/322 (1%)
 Frame = +3

Query  219   DFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRC  398
             DF  +S  P   LSSDQ  YCS AL+ LK+K  + P+ IR+EF +LQ  R+++SDM   C
Sbjct  22    DFPENS--PHFSLSSDQFNYCSRALQSLKQK-LENPQLIRREFDSLQEKRIKSSDMMRLC  78

Query  399   LVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV-SEHVSRFIATQ  575
              VALD +N++KNRYTDV+PFDS RVVL  CKDYR SA+GYINAS+I   +++ ++FIATQ
Sbjct  79    TVALDPVNLNKNRYTDVIPFDSTRVVLISCKDYRPSAKGYINASIIKAPAQNAAQFIATQ  138

Query  576   GPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWI  755
             GPL +TFEDFWEMV+QNRCPAIVMLTRLVDNYKT+KCGDYFQAEDG REFG+I I TKWI
Sbjct  139   GPLSHTFEDFWEMVLQNRCPAIVMLTRLVDNYKTLKCGDYFQAEDGPREFGDISIVTKWI  198

Query  756   KTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSL  935
             KTT +SL+LR LEV+  ESEE PLSVLH QY EWPDHGVPK++LA REIV R + LPP +
Sbjct  199   KTTGSSLVLRHLEVTKAESEEAPLSVLHIQYPEWPDHGVPKNSLAVREIVSRTYHLPPGV  258

Query  936   GPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLF  1115
             GPIVVHCSAGIGRTGTYC IH++IQRIL GDMSALD  +T+ +FRSQR+GMVQTL+QY F
Sbjct  259   GPIVVHCSAGIGRTGTYCTIHDSIQRILAGDMSALDFASTVHVFRSQRVGMVQTLDQYYF  318

Query  1116  CYDAIIEELEDIIKESTGQPSS  1181
             CY  +++ELE++I     + S+
Sbjct  319   CYKTVVDELEELISRYNPEKSA  340



>ref|XP_006588511.1| PREDICTED: tyrosine phosphatase 1 isoform X1 [Glycine max]
Length=336

 Score =   454 bits (1168),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 214/317 (68%), Positives = 256/317 (81%), Gaps = 4/317 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             F+FS D+ P R+ L+SDQ+ +C++AL +LKEK   AP  I QEF  LQANR+  S+MR R
Sbjct  20    FNFSPDN-PSRITLTSDQVNHCTQALNILKEK-LHAPNVITQEFAHLQANRITPSEMRRR  77

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIA  569
             C VA D +N+ KNRYTDVLPFD NRVVL    DYR  A+GYINASL++ S   +VS+FIA
Sbjct  78    CTVAYDDVNLRKNRYTDVLPFDKNRVVLKSSTDYRPEAQGYINASLVSTSSAGNVSQFIA  137

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPL +T+EDFWEM+IQ  CPAI+MLTRLVDNYK  KCGDYFQAED  RE GNI I  K
Sbjct  138   TQGPLQHTYEDFWEMIIQYHCPAIIMLTRLVDNYKMTKCGDYFQAEDRPREVGNISIIGK  197

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             W  TT+TSL+LR LEV+++E E+ PLSVLH QY EWPDHGVPKDT A REI+KRL+ LPP
Sbjct  198   WENTTETSLVLRHLEVNHREVEDAPLSVLHIQYPEWPDHGVPKDTFAVREILKRLYHLPP  257

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             + GPIVVHCSAGIGRTGTYC IHNTIQRI+ GDMSA+D+  TI +FRSQRIGMVQT +QY
Sbjct  258   NFGPIVVHCSAGIGRTGTYCTIHNTIQRIVAGDMSAVDIAKTIAMFRSQRIGMVQTQDQY  317

Query  1110  LFCYDAIIEELEDIIKE  1160
             +FCY+AII+ELED++ +
Sbjct  318   IFCYNAIIDELEDLVSQ  334



>ref|NP_177331.1| tyrosine phosphatase 1 [Arabidopsis thaliana]
 ref|NP_001031266.1| tyrosine phosphatase 1 [Arabidopsis thaliana]
 sp|O82656.1|PTP1_ARATH RecName: Full=Protein-tyrosine-phosphatase PTP1; AltName: Full=Protein 
tyrosine phosphatase 1; Short=AtPTP1 [Arabidopsis 
thaliana]
 gb|AAF43239.1|AC012654_23 Strong similarity to the tyrosine phosphatase from Arabidopsis 
thaliana gb|AJ006309. EST gb|AA042465 comes from this gene 
[Arabidopsis thaliana]
 emb|CAA06978.1| protein tyrosine phosphatase [Arabidopsis thaliana]
 gb|AAL49899.1| putative protein tyrosine phosphatase [Arabidopsis thaliana]
 gb|AAM51315.1| putative protein tyrosine phosphatase [Arabidopsis thaliana]
 gb|AEE35242.1| tyrosine phosphatase 1 [Arabidopsis thaliana]
 gb|AEE35243.1| tyrosine phosphatase 1 [Arabidopsis thaliana]
Length=340

 Score =   453 bits (1166),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 222/325 (68%), Positives = 262/325 (81%), Gaps = 6/325 (2%)
 Frame = +3

Query  216   FDFS-YDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
             FD S  DS P +L LSSDQL +C +AL V + K  Q P+ I  EF  LQANRM  S++  
Sbjct  19    FDLSSADSPPSKLSLSSDQLNHCHQALGVFRGK-IQNPDSIAHEFTGLQANRMWPSELLL  77

Query  393   RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH--VSRFI  566
                VA++S+N+ KNRY+DV+PFD NR+VLNPCKD   SA+GY+NASLI  SE   +S+FI
Sbjct  78    NSTVAMNSVNVEKNRYSDVVPFDKNRIVLNPCKD--SSAKGYVNASLIKTSESESISQFI  135

Query  567   ATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITT  746
             ATQGPLP+T EDFWEMVIQ  CP IVMLTRLVDN +TVKCGDYFQ EDG REFGNI +TT
Sbjct  136   ATQGPLPHTMEDFWEMVIQQHCPIIVMLTRLVDNNRTVKCGDYFQDEDGPREFGNISLTT  195

Query  747   KWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLP  926
             KWIKTTDTSL+LR LEV+YKE+E+ P+SVLH QY EWPDHGVPKDT+A REI+KRL+ +P
Sbjct  196   KWIKTTDTSLMLRNLEVNYKETEDQPMSVLHIQYPEWPDHGVPKDTVAVREILKRLYQVP  255

Query  927   PSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQ  1106
             PSLGPI+VHCSAGIGRTGTYCAIHNTIQRIL GDMSALDL  T+ +FR QRIGMVQT++Q
Sbjct  256   PSLGPIIVHCSAGIGRTGTYCAIHNTIQRILAGDMSALDLAKTVALFRKQRIGMVQTMDQ  315

Query  1107  YLFCYDAIIEELEDIIKESTGQPSS  1181
             Y FCY+AI++ELED+   +    SS
Sbjct  316   YFFCYNAIVDELEDLTAGTNAGTSS  340



>ref|XP_008237327.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X2 [Prunus 
mume]
Length=346

 Score =   453 bits (1165),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 215/297 (72%), Positives = 252/297 (85%), Gaps = 3/297 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
              DFS DS P RLVL+ DQ +YCS+ALK  K+K  Q  + I QEF  LQA R+ +SDM+  
Sbjct  16    LDFSADSPPLRLVLTPDQYKYCSQALKFFKDK-LQTSDHIHQEFDQLQAKRITSSDMKRS  74

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVS--RFIA  569
             C VALDS+N+SKNRYTDVLPFD+NRVVLN CKDYR SARGYINAS I+ S   S  RF+A
Sbjct  75    CTVALDSVNLSKNRYTDVLPFDTNRVVLNSCKDYRPSARGYINASFISTSSSESISRFVA  134

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+T+EDFWEMV++ RCP ++MLTRLVDNY+ VKCGDYFQAEDG REFGNIC+ TK
Sbjct  135   TQGPLPHTYEDFWEMVLEQRCPVVIMLTRLVDNYRMVKCGDYFQAEDGPREFGNICLATK  194

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             W++TT+TSL LR LE +YKESEEPP+SVLH QY EWPDHGVP+D++A REI+KRL+ +PP
Sbjct  195   WLRTTETSLELRLLEANYKESEEPPMSVLHIQYPEWPDHGVPEDSIAVREILKRLYQVPP  254

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTL  1100
             +LGPIVVHCSAGIGRTGTYC IHNT+QRIL GDMSALD+V+T+T FRSQRIGMVQTL
Sbjct  255   NLGPIVVHCSAGIGRTGTYCTIHNTVQRILAGDMSALDVVDTVTTFRSQRIGMVQTL  311



>ref|XP_008454599.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Cucumis melo]
 ref|XP_008454600.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Cucumis melo]
 ref|XP_008454601.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Cucumis melo]
 ref|XP_008454603.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Cucumis melo]
Length=333

 Score =   452 bits (1163),  Expect = 6e-153, Method: Compositional matrix adjust.
 Identities = 222/320 (69%), Positives = 262/320 (82%), Gaps = 5/320 (2%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
              PF FS DS PP L L+  Q++ CS+AL+   + R Q P+ I QEF  LQA R+ ASDMR
Sbjct  16    NPFIFSPDS-PPTLALTPHQIKLCSQALEAFTD-RLQKPDVINQEFARLQAKRITASDMR  73

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSR--F  563
               C VALD++N++KNRY DVLPFD  RVVL+ CKDYR SARGYINAS I+ S   S   F
Sbjct  74    RSCSVALDNVNVNKNRYMDVLPFDETRVVLDSCKDYRPSARGYINASFISTSSSKSLSKF  133

Query  564   IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICIT  743
             IATQGPLP+T+EDFWEMV Q +CPAI+MLTRLVDNYK VKCGDYFQAEDG R+FGN+ + 
Sbjct  134   IATQGPLPHTYEDFWEMVFQYKCPAILMLTRLVDNYKMVKCGDYFQAEDGPRDFGNLIVV  193

Query  744   TKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTL  923
             +KWIK++++SLILR LEV++KESEE  ++VLH QY EWPDHGVP DTLA RE++KRL+ L
Sbjct  194   SKWIKSSNSSLILRHLEVNHKESEES-VAVLHIQYPEWPDHGVPNDTLAVREMLKRLYHL  252

Query  924   PPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLE  1103
             PP LGPIVVHCSAGIGRTGTYCAIHNTIQRIL+GDMSALDLV+TI+ FRSQRIGMVQTL+
Sbjct  253   PPDLGPIVVHCSAGIGRTGTYCAIHNTIQRILIGDMSALDLVSTISSFRSQRIGMVQTLD  312

Query  1104  QYLFCYDAIIEELEDIIKES  1163
             QY FCY  I++ELED+I  S
Sbjct  313   QYFFCYRTIVDELEDLIAVS  332



>gb|AAC68859.1| protein tyrosine phosphatase 1 [Arabidopsis thaliana]
Length=340

 Score =   450 bits (1158),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 221/325 (68%), Positives = 261/325 (80%), Gaps = 6/325 (2%)
 Frame = +3

Query  216   FDFS-YDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
             FD S  DS P +L LSSDQL +C +AL V + K  Q P+ I  EF  LQANRM  S++  
Sbjct  19    FDLSSADSPPSKLSLSSDQLNHCHQALGVFRGK-IQNPDSIAHEFTGLQANRMWPSELLL  77

Query  393   RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH--VSRFI  566
                VA++S+N+ KNRY+DV+PFD NR+VLNPCKD   SA+GY+NASLI  SE   +S+FI
Sbjct  78    NSTVAMNSVNVEKNRYSDVVPFDKNRIVLNPCKD--SSAKGYVNASLIKTSESESISQFI  135

Query  567   ATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITT  746
             ATQGPLP+T E FWEMVIQ  CP IVMLTRLVDN +TVKCGDYFQ EDG REFGNI +TT
Sbjct  136   ATQGPLPHTMEAFWEMVIQQHCPIIVMLTRLVDNNRTVKCGDYFQDEDGPREFGNISLTT  195

Query  747   KWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLP  926
             KWIKTTDTSL+LR LEV+YKE+E+ P+SVLH QY EWPDHGVPKDT+A REI+KRL+ +P
Sbjct  196   KWIKTTDTSLMLRNLEVNYKETEDQPMSVLHIQYPEWPDHGVPKDTVAVREILKRLYQVP  255

Query  927   PSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQ  1106
             PSLGPI+VHCSAGIGRTGTYCAIHNTIQRIL GDMSALDL  T+ +FR QRIGMVQT++Q
Sbjct  256   PSLGPIIVHCSAGIGRTGTYCAIHNTIQRILAGDMSALDLAKTVALFRKQRIGMVQTMDQ  315

Query  1107  YLFCYDAIIEELEDIIKESTGQPSS  1181
             Y FCY+AI++ELED+   +    SS
Sbjct  316   YFFCYNAIVDELEDLTAGTNAGTSS  340



>ref|XP_003556188.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Glycine max]
 ref|XP_006606201.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Glycine max]
Length=338

 Score =   449 bits (1156),  Expect = 9e-152, Method: Compositional matrix adjust.
 Identities = 214/317 (68%), Positives = 256/317 (81%), Gaps = 4/317 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             F+FS D+ P R++L+SDQ+ +C++AL +LKEK    P  I QEF  LQANR+  S+MR R
Sbjct  22    FNFSPDN-PSRIILTSDQVNHCTQALNLLKEK-LHDPHVITQEFAHLQANRITPSEMRRR  79

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIA  569
             C VA D++N+SKNRYTDVLPF+ NRVVL    DYR  A+GYINASLI+ S   +VS FIA
Sbjct  80    CTVAYDAVNLSKNRYTDVLPFNKNRVVLKSSTDYRPEAQGYINASLISTSSAGNVSHFIA  139

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+T EDFWEM+ Q  CP I+MLTRLVDNYK VKC DYFQAEDG RE GNI I  K
Sbjct  140   TQGPLPHTCEDFWEMITQYHCPVIIMLTRLVDNYKMVKCVDYFQAEDGPREVGNISIIGK  199

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             W  TT+TSL+LR LEV+++E ++ PLSVLH QY EWPDHGVPKDTLA REI+KRL+ LP 
Sbjct  200   WENTTETSLVLRHLEVNHREVDDAPLSVLHIQYPEWPDHGVPKDTLAVREILKRLYHLPS  259

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             +LGPIVVHCSAGIGRTG YC IHNTIQRIL GDMSA+ + NTI +FRSQRIGMVQT +QY
Sbjct  260   NLGPIVVHCSAGIGRTGAYCTIHNTIQRILAGDMSAVRIANTIAMFRSQRIGMVQTQDQY  319

Query  1110  LFCYDAIIEELEDIIKE  1160
             +FCY+AII+ELED++ +
Sbjct  320   IFCYNAIIDELEDLVSQ  336



>gb|EYU22866.1| hypothetical protein MIMGU_mgv1a009565mg [Erythranthe guttata]
Length=338

 Score =   446 bits (1148),  Expect = 1e-150, Method: Compositional matrix adjust.
 Identities = 216/317 (68%), Positives = 249/317 (79%), Gaps = 2/317 (1%)
 Frame = +3

Query  222   FSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCL  401
             FS  +   R  LS DQLR CSEALK  ++K   +P+ I  EF  L+ +RM+A D RS C 
Sbjct  23    FSAVTTTQRRALSEDQLRSCSEALKFFQQK-LSSPQSIHHEFQILE-DRMKAFDARSSCT  80

Query  402   VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGP  581
             VALDS+N SKNRY +V+P+D+NRV+LN  KDYR S  GYINAS +  SE VS+FIATQGP
Sbjct  81    VALDSVNSSKNRYDNVIPYDNNRVILNQHKDYRPSPTGYINASFVKASEGVSQFIATQGP  140

Query  582   LPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKT  761
             LP+T EDFWEMV+Q  CPAIVMLTRLV+N  TVKCGDYFQAEDG REFGN+ IT KWI+T
Sbjct  141   LPHTAEDFWEMVMQYHCPAIVMLTRLVENNHTVKCGDYFQAEDGAREFGNVRITVKWIQT  200

Query  762   TDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGP  941
             T+TSLILRCLEV  K S E P SVLH QY EWPD+GVPKDT+A REI KRL   P  LGP
Sbjct  201   TETSLILRCLEVKNKGSNEAPCSVLHIQYTEWPDYGVPKDTVAVREIFKRLSAGPQCLGP  260

Query  942   IVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCY  1121
             IVVHCSAGIGRTGTYC IHNTIQR+L GDMSALDLVNT+T FRSQR+GMVQTLEQY FC+
Sbjct  261   IVVHCSAGIGRTGTYCLIHNTIQRVLNGDMSALDLVNTVTTFRSQRLGMVQTLEQYQFCH  320

Query  1122  DAIIEELEDIIKESTGQ  1172
              AI +EL+++I +S   
Sbjct  321   KAIADELQNLISDSKAH  337



>gb|KEH43589.1| tyrosine phosphatase [Medicago truncatula]
Length=331

 Score =   442 bits (1136),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 207/309 (67%), Positives = 252/309 (82%), Gaps = 3/309 (1%)
 Frame = +3

Query  240   PPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSI  419
             P R+ L+SDQ+ +C++AL +LK K  + P+ I QEF  LQANR+  S+   RC VAL+S+
Sbjct  23    PSRIPLTSDQVNHCTKALALLKNK-LRNPDTILQEFLHLQANRITLSESTRRCNVALNSV  81

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH--VSRFIATQGPLPNT  593
             NI+KNRY DV+PFD NRVVLN   DYR  + GYINAS I  S    VS FIATQGPLP+T
Sbjct  82    NINKNRYKDVIPFDKNRVVLNSSSDYRSESLGYINASFILTSSTGTVSEFIATQGPLPHT  141

Query  594   FEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTS  773
             +EDFWEM++Q  CPAIVMLT+LVDNYK VKCGDYFQ+ED  REFGNI +  KW KTT+TS
Sbjct  142   YEDFWEMIMQYNCPAIVMLTKLVDNYKMVKCGDYFQSEDRPREFGNISLACKWTKTTETS  201

Query  774   LILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVH  953
             L+LR LEV++KE E+ PLSV H QY EWPDHGVP DTLA REI+KRL+ LPP+LGPIVVH
Sbjct  202   LVLRHLEVNHKEVEDTPLSVFHIQYPEWPDHGVPNDTLAVREILKRLYHLPPNLGPIVVH  261

Query  954   CSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAII  1133
             CSAGIGRTGTYC IH+TIQRIL GD+SA+D+ NT+++FRSQRIGMVQT +QY+FCY+AII
Sbjct  262   CSAGIGRTGTYCTIHSTIQRILAGDISAIDIANTVSVFRSQRIGMVQTQDQYIFCYEAII  321

Query  1134  EELEDIIKE  1160
             +ELED++ +
Sbjct  322   DELEDLVSQ  330



>ref|XP_007020250.1| Tyrosine phosphatase 1 isoform 2 [Theobroma cacao]
 gb|EOY17475.1| Tyrosine phosphatase 1 isoform 2 [Theobroma cacao]
Length=340

 Score =   441 bits (1135),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 211/310 (68%), Positives = 248/310 (80%), Gaps = 7/310 (2%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             F FS D  PPR+ L+  Q  YCS ALK+  EK    P +I +EF  LQANR+R S+M   
Sbjct  20    FVFSAD-YPPRVSLTPSQFNYCSRALKLFSEKLLM-PHEITREFARLQANRIRPSEMARS  77

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIA  569
             C V L+S+N+ KNRY+DV+PFD NRVVLN CKDYR +A+GYINAS +T S  E++S+FIA
Sbjct  78    CTVGLNSVNLDKNRYSDVVPFDKNRVVLNSCKDYRPAAKGYINASFVTTSSSENISQFIA  137

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGP+P+T+EDFWEMVIQ  CP IVMLTRLVDNYK VKCGDYFQ E G R+ GNICI TK
Sbjct  138   TQGPIPHTYEDFWEMVIQRHCPVIVMLTRLVDNYKVVKCGDYFQVEGGPRQCGNICIDTK  197

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             WI+ TDTSL+LR LEV+Y ESE+PP+SVLH QY EWPDHGVP DTLA REI+KR+  +PP
Sbjct  198   WIQATDTSLLLRSLEVNYSESEDPPVSVLHIQYPEWPDHGVPVDTLAVREILKRVLKVPP  257

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             +LGPIVVHCSAGIGRTGTYCAIHNTIQRIL+GDMSALDL NT++ FRSQRIGMVQT+   
Sbjct  258   NLGPIVVHCSAGIGRTGTYCAIHNTIQRILVGDMSALDLANTVSTFRSQRIGMVQTM---  314

Query  1110  LFCYDAIIEE  1139
             L  Y   ++E
Sbjct  315   LLGYSEFLKE  324



>ref|XP_008461477.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Cucumis melo]
Length=388

 Score =   443 bits (1140),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 218/316 (69%), Positives = 257/316 (81%), Gaps = 5/316 (2%)
 Frame = +3

Query  222   FSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCL  401
             FS DS PP L L   Q++ CS+AL+   +K  Q P+ I QEF  LQA R+ ASDMR  C 
Sbjct  75    FSPDS-PPTLALKPHQIKLCSQALEAFTDK-LQKPDVINQEFARLQAKRITASDMRRSCS  132

Query  402   VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSR--FIATQ  575
             VALD++N++KNRY DVLPFD  RVVL+ CKDYR S RGYINAS I+ S   S   FIATQ
Sbjct  133   VALDNVNVNKNRYMDVLPFDETRVVLDSCKDYRPSVRGYINASFISTSSSKSLSKFIATQ  192

Query  576   GPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWI  755
             GPLP+T+EDFWEMV Q +CPAI+MLTRLVDNYK VKCGDYFQAEDG R+FGN+ + +KWI
Sbjct  193   GPLPHTYEDFWEMVFQYKCPAILMLTRLVDNYKMVKCGDYFQAEDGPRDFGNLIVVSKWI  252

Query  756   KTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSL  935
             K++++SLILR LEV++KESEE  ++VLH QY EWPDHGVP DTLA RE++KRL+ LPP L
Sbjct  253   KSSNSSLILRHLEVNHKESEES-VAVLHIQYPEWPDHGVPNDTLAVREMLKRLYHLPPDL  311

Query  936   GPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLF  1115
             G IVVHCSAGIGRTGTYCAIHNTIQRIL+GDMSALDLV+TI+ FRSQRIGMVQTL+QY F
Sbjct  312   GRIVVHCSAGIGRTGTYCAIHNTIQRILIGDMSALDLVSTISSFRSQRIGMVQTLDQYFF  371

Query  1116  CYDAIIEELEDIIKES  1163
             CY  I++ELED+I  S
Sbjct  372   CYRTIVDELEDLIAVS  387



>gb|KJB35865.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=323

 Score =   439 bits (1130),  Expect = 4e-148, Method: Compositional matrix adjust.
 Identities = 206/297 (69%), Positives = 248/297 (84%), Gaps = 4/297 (1%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             F FS D  PP++ L+ DQ  YCSEALK+  +K  Q P++I +EF  LQANR+  S+M  R
Sbjct  22    FVFSADP-PPKISLTPDQFNYCSEALKLFSQK-LQMPDEINREFSHLQANRITPSEMMRR  79

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIA  569
             C V  +  N+ KNRY+DV+PFD+NRVVL  CKDYR +A+GYINAS +T S  E++S+FIA
Sbjct  80    CTVGFNGANLDKNRYSDVIPFDTNRVVLYSCKDYRPAAKGYINASFVTTSSSENISKFIA  139

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+T+EDFWEMVIQ  CP IVMLTRLVDNYKTVKCGDYFQAE+  R+FGNICI TK
Sbjct  140   TQGPLPHTYEDFWEMVIQCHCPVIVMLTRLVDNYKTVKCGDYFQAENVPRQFGNICIDTK  199

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             WI+ T+TSL++R LEV+YKESE+PPLSVLH QY EWPDHGVP DTLA REI+KR+  +P 
Sbjct  200   WIQETETSLLIRNLEVNYKESEDPPLSVLHIQYPEWPDHGVPTDTLAVREILKRVLQVPV  259

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTL  1100
             ++GPI+VHCSAGIGRTGTYCAIHNT+QRIL+GDMSALDL NTI++FRSQRIGMVQT+
Sbjct  260   NIGPILVHCSAGIGRTGTYCAIHNTVQRILIGDMSALDLANTISMFRSQRIGMVQTM  316



>gb|KHN00785.1| Tyrosine-protein phosphatase non-receptor type 20 [Glycine soja]
Length=333

 Score =   439 bits (1129),  Expect = 8e-148, Method: Compositional matrix adjust.
 Identities = 212/317 (67%), Positives = 252/317 (79%), Gaps = 9/317 (3%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             F+FS D+ P R++L+SDQ+ +C++AL +LKEK    P  I QEF  LQANR+  S+MR R
Sbjct  22    FNFSPDN-PSRIILTSDQVNHCTQALNLLKEK-LHDPHVITQEFAHLQANRITPSEMRRR  79

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIA  569
             C VA D++N+SKNRY+DVLPF+ NRVVL    DYR  A+GYINASL++ S   +VS FIA
Sbjct  80    CTVAYDAVNLSKNRYSDVLPFNKNRVVLKSSTDYRPEAQGYINASLVSTSSAGNVSHFIA  139

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+T EDFWEM+ Q  CP I+MLTRLVDNYK VKC DYFQAEDG RE GNI I  K
Sbjct  140   TQGPLPHTCEDFWEMITQYHCPVIIMLTRLVDNYKMVKCVDYFQAEDGPREVGNISIIGK  199

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             W  TT+TSL+LR LEV     E+ PLSVLH QY EWPDHGVPKDTLA REI+KRL+ LP 
Sbjct  200   WENTTETSLVLRHLEV-----EDAPLSVLHIQYPEWPDHGVPKDTLAVREILKRLYHLPS  254

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             +LGPIVVHCSAGIGRTG YC IHNTIQRIL GDMSA+ + NTI +FRSQRIGMVQT +QY
Sbjct  255   NLGPIVVHCSAGIGRTGAYCTIHNTIQRILAGDMSAVRIANTIAMFRSQRIGMVQTQDQY  314

Query  1110  LFCYDAIIEELEDIIKE  1160
             +FCY+AII+ELED++ +
Sbjct  315   IFCYNAIIDELEDLVSQ  331



>ref|XP_009624649.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X3 
[Nicotiana tomentosiformis]
Length=313

 Score =   436 bits (1121),  Expect = 6e-147, Method: Compositional matrix adjust.
 Identities = 211/321 (66%), Positives = 238/321 (74%), Gaps = 37/321 (12%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             +P DFS DS P R+VLS DQ  YC EAL   KEKR  +P KI  EF  LQ NR++AS+M+
Sbjct  27    KPLDFSADSVPKRIVLSPDQRSYCLEALTAFKEKRCHSPGKIDSEFSALQKNRLKASEMK  86

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIA  569
             SRC VALDS NISKNRYTDVLPFD++RVVL+PCKDYR SARGYINAS +++SE VSRFIA
Sbjct  87    SRCSVALDSTNISKNRYTDVLPFDNSRVVLDPCKDYRPSARGYINASFVSISERVSRFIA  146

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+TFEDFWEM+IQNRCP IVMLTRLVDNYK   C D                   
Sbjct  147   TQGPLPHTFEDFWEMIIQNRCPVIVMLTRLVDNYKVFNCLD-------------------  187

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
                                +SEEPP  VLH QY EWPDHGVP+DTLA REI+ R H +P 
Sbjct  188   ------------------NQSEEPPSHVLHIQYPEWPDHGVPEDTLAVREILNRTHDVPL  229

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             SLGPIVVHCSAGIGRTGTYC IHNTIQRIL GDMSALD+VNT+ IFRSQRIGMVQT++QY
Sbjct  230   SLGPIVVHCSAGIGRTGTYCTIHNTIQRILGGDMSALDIVNTVAIFRSQRIGMVQTMDQY  289

Query  1110  LFCYDAIIEELEDIIKESTGQ  1172
             LFCYDAII+ELE +I +  G+
Sbjct  290   LFCYDAIIDELEHLISDDNGE  310



>ref|XP_004139702.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Cucumis sativus]
 ref|XP_011659094.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Cucumis sativus]
 ref|XP_011659095.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Cucumis sativus]
Length=377

 Score =   435 bits (1118),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 216/315 (69%), Positives = 255/315 (81%), Gaps = 5/315 (2%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             F FS DS PP L+L+  Q++ CS+AL+   +K  Q P+ I QEF  LQA R+ AS M  R
Sbjct  62    FIFSPDS-PPTLLLTPHQIKLCSQALEAFTDK-LQKPDVINQEFARLQAKRITASGMGRR  119

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSR--FIA  569
             C VALD +N+ KNRY DVLPFD  RVVL+ CKDYR SARGYINAS I+ S   S   FIA
Sbjct  120   CSVALDKVNVYKNRYMDVLPFDETRVVLDSCKDYRPSARGYINASFISTSSSKSLSKFIA  179

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+T+EDFWEMV Q +CPAI+MLTRLVDNYK  KCGDYFQAEDG R+FGN+ + +K
Sbjct  180   TQGPLPHTYEDFWEMVFQYKCPAILMLTRLVDNYKIDKCGDYFQAEDGPRDFGNLIVVSK  239

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             WIK++++SLILR LEV +KESEE  ++VLH QY +W DHGVP DTLA RE++KRL+ LPP
Sbjct  240   WIKSSNSSLILRHLEVIHKESEES-VAVLHIQYPQWSDHGVPNDTLAVREMLKRLYHLPP  298

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
              LGPIVVHCSAGIGRTGTYCAIHNTIQRIL+GDMSALDLV+TI+ FRSQRIGMVQTL+QY
Sbjct  299   DLGPIVVHCSAGIGRTGTYCAIHNTIQRILIGDMSALDLVSTISSFRSQRIGMVQTLDQY  358

Query  1110  LFCYDAIIEELEDII  1154
              FCY  I++ELED+I
Sbjct  359   FFCYRTIVDELEDLI  373



>ref|XP_007143629.1| hypothetical protein PHAVU_007G087900g [Phaseolus vulgaris]
 gb|ESW15623.1| hypothetical protein PHAVU_007G087900g [Phaseolus vulgaris]
Length=343

 Score =   433 bits (1114),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 196/288 (68%), Positives = 241/288 (84%), Gaps = 4/288 (1%)
 Frame = +3

Query  309   KRFQAPEKIRQE--FGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLN  482
             K ++ P  +  +   G ++ANR+  S+MR RC VALD++N+SKNRYTDVLPFDSNRV L 
Sbjct  55    KEWKTPRDLTLDNVIGNIEANRITPSEMRRRCTVALDAVNLSKNRYTDVLPFDSNRVALK  114

Query  483   PCKDYRQSARGYINASLITVSE--HVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTR  656
                DYR +A+GYINASL++ S   +VS+F+ATQGPLP+T+EDFWEM+IQ  CPAI+MLTR
Sbjct  115   SSTDYRPAAQGYINASLVSTSSPGNVSQFVATQGPLPHTYEDFWEMIIQYHCPAIIMLTR  174

Query  657   LVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVL  836
             LVDNYK VKCGDYFQAEDG RE GNI +  KW+ TT+TSL+LR LEV+++E E+ P+SVL
Sbjct  175   LVDNYKMVKCGDYFQAEDGPREVGNISVIGKWVNTTETSLVLRLLEVNHREVEDAPISVL  234

Query  837   HFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRI  1016
             H QY EWPDHGVPKDTLA REI+KRL+ LPP+LGPIVVHCSAGIGRTGTYC IHNTIQRI
Sbjct  235   HIQYPEWPDHGVPKDTLAVREILKRLYHLPPNLGPIVVHCSAGIGRTGTYCTIHNTIQRI  294

Query  1017  LLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKE  1160
             L GDMSA+D+ NT+ +FR+QRIGMVQT +QY+FCY AII+ELED++ +
Sbjct  295   LAGDMSAVDIANTVAVFRAQRIGMVQTQDQYIFCYKAIIDELEDLVSQ  342



>ref|XP_009624650.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X4 
[Nicotiana tomentosiformis]
Length=305

 Score =   429 bits (1102),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 209/321 (65%), Positives = 235/321 (73%), Gaps = 45/321 (14%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             +P DFS DS P R+VLS DQ  YC EAL   KEKR  +P KI  EF  LQ NR++AS+M+
Sbjct  27    KPLDFSADSVPKRIVLSPDQRSYCLEALTAFKEKRCHSPGKIDSEFSALQKNRLKASEMK  86

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIA  569
             SRC VALDS NISKNRYTDVLPFD++RVVL+PCKDYR SARGYINAS +++SE VSRFIA
Sbjct  87    SRCSVALDSTNISKNRYTDVLPFDNSRVVLDPCKDYRPSARGYINASFVSISERVSRFIA  146

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+TFEDFWEM+IQNRCP IVMLTRLVDNYK                         
Sbjct  147   TQGPLPHTFEDFWEMIIQNRCPVIVMLTRLVDNYK-------------------------  181

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
                                 SEEPP  VLH QY EWPDHGVP+DTLA REI+ R H +P 
Sbjct  182   --------------------SEEPPSHVLHIQYPEWPDHGVPEDTLAVREILNRTHDVPL  221

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             SLGPIVVHCSAGIGRTGTYC IHNTIQRIL GDMSALD+VNT+ IFRSQRIGMVQT++QY
Sbjct  222   SLGPIVVHCSAGIGRTGTYCTIHNTIQRILGGDMSALDIVNTVAIFRSQRIGMVQTMDQY  281

Query  1110  LFCYDAIIEELEDIIKESTGQ  1172
             LFCYDAII+ELE +I +  G+
Sbjct  282   LFCYDAIIDELEHLISDDNGE  302



>ref|XP_009765732.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X3 
[Nicotiana sylvestris]
Length=305

 Score =   427 bits (1097),  Expect = 2e-143, Method: Compositional matrix adjust.
 Identities = 207/319 (65%), Positives = 235/319 (74%), Gaps = 45/319 (14%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
              DFS DS P R+VLS DQ  YC EAL   K+KR+ +P KI  EF  LQ NR++AS+M+SR
Sbjct  29    LDFSADSVPKRIVLSPDQRSYCLEALTAFKDKRYHSPGKIDSEFSALQKNRLKASEMKSR  88

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQ  575
             C VALDS NISKNRYTDVLPFD++RVVL+PCKDYR SARGYINAS +++SE VSRFIATQ
Sbjct  89    CSVALDSTNISKNRYTDVLPFDNSRVVLDPCKDYRPSARGYINASFVSISERVSRFIATQ  148

Query  576   GPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWI  755
             GPLP+TFEDFWEM+IQNRCP IVMLTRLVDNYK                           
Sbjct  149   GPLPHTFEDFWEMIIQNRCPVIVMLTRLVDNYK---------------------------  181

Query  756   KTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSL  935
                               SEEPPL VLH QY EWPDHGVP+DTLA REI+ R + +P SL
Sbjct  182   ------------------SEEPPLHVLHIQYPEWPDHGVPEDTLAVREILNRTYDVPLSL  223

Query  936   GPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLF  1115
             GPIVVHCSAGIGRTGTYC IHNTIQRIL GDMSALD+VNT+ IFRSQRIGMVQT++QYLF
Sbjct  224   GPIVVHCSAGIGRTGTYCTIHNTIQRILGGDMSALDIVNTVAIFRSQRIGMVQTMDQYLF  283

Query  1116  CYDAIIEELEDIIKESTGQ  1172
             CYDAII+ELE +I +  G+
Sbjct  284   CYDAIIDELEHLISDDNGE  302



>ref|XP_006606202.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X3 
[Glycine max]
Length=326

 Score =   425 bits (1093),  Expect = 2e-142, Method: Compositional matrix adjust.
 Identities = 207/317 (65%), Positives = 247/317 (78%), Gaps = 16/317 (5%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             F+FS D+ P R++L+SDQ+ +C++AL +LKEK    P  I QEF  LQANR+  S+MR R
Sbjct  22    FNFSPDN-PSRIILTSDQVNHCTQALNLLKEK-LHDPHVITQEFAHLQANRITPSEMRRR  79

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIA  569
             C VA D++N+SKNRYTDVLPF+ NRVVL    DYR  A+GYINASLI+ S   +VS FIA
Sbjct  80    CTVAYDAVNLSKNRYTDVLPFNKNRVVLKSSTDYRPEAQGYINASLISTSSAGNVSHFIA  139

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+T EDFWEM+ Q  CP I+MLTRLVDNYK VKC DYFQAEDG RE GNI I  K
Sbjct  140   TQGPLPHTCEDFWEMITQYHCPVIIMLTRLVDNYKMVKCVDYFQAEDGPREVGNISIIGK  199

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             W  TT+TSL+LR LEV+++E            Y EWPDHGVPKDTLA REI+KRL+ LP 
Sbjct  200   WENTTETSLVLRHLEVNHRE------------YPEWPDHGVPKDTLAVREILKRLYHLPS  247

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             +LGPIVVHCSAGIGRTG YC IHNTIQRIL GDMSA+ + NTI +FRSQRIGMVQT +QY
Sbjct  248   NLGPIVVHCSAGIGRTGAYCTIHNTIQRILAGDMSAVRIANTIAMFRSQRIGMVQTQDQY  307

Query  1110  LFCYDAIIEELEDIIKE  1160
             +FCY+AII+ELED++ +
Sbjct  308   IFCYNAIIDELEDLVSQ  324



>ref|XP_011629159.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X5 [Amborella 
trichopoda]
Length=344

 Score =   423 bits (1088),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 202/319 (63%), Positives = 244/319 (76%), Gaps = 3/319 (1%)
 Frame = +3

Query  222   FSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCL  401
             F   + PP L L  DQLR+CSE L +LK K+ Q P K+ QEF  LQANR+R SDM  RC 
Sbjct  27    FMAYADPPSLTLLPDQLRHCSEGLALLK-KKIQTPFKLNQEFDALQANRLRKSDMLRRCQ  85

Query  402   VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIATQ  575
             VAL   N +KNRY DVLPFD +RVVLN  ++ + S  GYINAS +T +  E + +FIATQ
Sbjct  86    VALQEANANKNRYGDVLPFDDSRVVLNQNRNNKSSGSGYINASFVTNTSCERLPQFIATQ  145

Query  576   GPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWI  755
             GPLP TFEDFWEMVIQ  CP IVMLTRL+DNYK VKCGDYFQA+ G REFG +C+TTK +
Sbjct  146   GPLPETFEDFWEMVIQFHCPVIVMLTRLIDNYKMVKCGDYFQADKGSREFGKVCVTTKCM  205

Query  756   KTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSL  935
             KT+D SL+LRC+EV +KE +E    VLH QYAEWPDHGVP+DT + REI+KRL+ + P L
Sbjct  206   KTSDNSLVLRCMEVKHKELDEISHQVLHIQYAEWPDHGVPEDTTSVREILKRLYHIAPQL  265

Query  936   GPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLF  1115
             GP +VHCSAGIGRTG +C I++TIQRIL+GDMSA+DL  TI+ FR +RIGMVQT EQ+LF
Sbjct  266   GPFIVHCSAGIGRTGAFCTIYHTIQRILVGDMSAVDLHVTISNFRDERIGMVQTREQFLF  325

Query  1116  CYDAIIEELEDIIKESTGQ  1172
             CY  I++ELED+I  S  Q
Sbjct  326   CYSVIMDELEDLISGSGEQ  344



>ref|XP_011629160.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X6 [Amborella 
trichopoda]
Length=344

 Score =   422 bits (1086),  Expect = 4e-141, Method: Compositional matrix adjust.
 Identities = 201/312 (64%), Positives = 242/312 (78%), Gaps = 3/312 (1%)
 Frame = +3

Query  243   PRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSIN  422
             P L L  DQLR+CSEAL +LK K+ Q P K+ QEF  LQANR+R SDM  RC VAL   N
Sbjct  34    PSLTLLPDQLRHCSEALALLK-KKIQTPFKLNQEFDALQANRLRKSDMLRRCQVALQEAN  92

Query  423   ISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIATQGPLPNTF  596
              +KNRY DVLPFD +RVVLN  ++ + S  GYINAS +T +  E + +FIATQGPLP TF
Sbjct  93    ANKNRYGDVLPFDDSRVVLNQNRNNKSSGSGYINASFVTNTSCERLPQFIATQGPLPETF  152

Query  597   EDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSL  776
             EDFWEMVIQ  CP IVMLTRL+DNYK VKCGDYFQA+ G REFG +C+TTK +KT+D SL
Sbjct  153   EDFWEMVIQFHCPVIVMLTRLIDNYKMVKCGDYFQADKGSREFGKVCVTTKCMKTSDNSL  212

Query  777   ILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVHC  956
             +LRC+EV +KE +E    VLH QYAEWPDHGVP+DT + REI+KRL+ + P LGP +VHC
Sbjct  213   VLRCMEVKHKELDEISHQVLHIQYAEWPDHGVPEDTTSVREILKRLYHIAPQLGPFIVHC  272

Query  957   SAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIE  1136
             SAGIGRTG +C I++TIQRIL+GDMSA+DL  TI+ FR +RIGMVQT EQ+LFCY  I++
Sbjct  273   SAGIGRTGAFCTIYHTIQRILVGDMSAVDLHVTISNFRDERIGMVQTREQFLFCYSVIMD  332

Query  1137  ELEDIIKESTGQ  1172
             ELED+I  S  Q
Sbjct  333   ELEDLISGSGEQ  344



>ref|XP_011629158.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X3 [Amborella 
trichopoda]
Length=345

 Score =   420 bits (1080),  Expect = 4e-140, Method: Compositional matrix adjust.
 Identities = 202/320 (63%), Positives = 244/320 (76%), Gaps = 4/320 (1%)
 Frame = +3

Query  222   FSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCL  401
             F   + PP L L  DQLR+CSE L +LK K+ Q P K+ QEF  LQANR+R SDM  RC 
Sbjct  27    FMAYADPPSLTLLPDQLRHCSEGLALLK-KKIQTPFKLNQEFDALQANRLRKSDMLRRCQ  85

Query  402   VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIATQ  575
             VAL   N +KNRY DVLPFD +RVVLN  ++ + S  GYINAS +T +  E + +FIATQ
Sbjct  86    VALQEANANKNRYGDVLPFDDSRVVLNQNRNNKSSGSGYINASFVTNTSCERLPQFIATQ  145

Query  576   GPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWI  755
             GPLP TFEDFWEMVIQ  CP IVMLTRL+DNYK VKCGDYFQA+ G REFG +C+TTK +
Sbjct  146   GPLPETFEDFWEMVIQFHCPVIVMLTRLIDNYKMVKCGDYFQADKGSREFGKVCVTTKCM  205

Query  756   KTTDTSLILRCLEVSYKES-EEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPS  932
             KT+D SL+LRC+EV +KE  +E    VLH QYAEWPDHGVP+DT + REI+KRL+ + P 
Sbjct  206   KTSDNSLVLRCMEVKHKEQLDEISHQVLHIQYAEWPDHGVPEDTTSVREILKRLYHIAPQ  265

Query  933   LGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYL  1112
             LGP +VHCSAGIGRTG +C I++TIQRIL+GDMSA+DL  TI+ FR +RIGMVQT EQ+L
Sbjct  266   LGPFIVHCSAGIGRTGAFCTIYHTIQRILVGDMSAVDLHVTISNFRDERIGMVQTREQFL  325

Query  1113  FCYDAIIEELEDIIKESTGQ  1172
             FCY  I++ELED+I  S  Q
Sbjct  326   FCYSVIMDELEDLISGSGEQ  345



>ref|XP_006829464.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X4 [Amborella 
trichopoda]
 gb|ERM96880.1| hypothetical protein AMTR_s00247p00015290 [Amborella trichopoda]
Length=345

 Score =   419 bits (1076),  Expect = 1e-139, Method: Compositional matrix adjust.
 Identities = 201/313 (64%), Positives = 242/313 (77%), Gaps = 4/313 (1%)
 Frame = +3

Query  243   PRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSIN  422
             P L L  DQLR+CSEAL +LK K+ Q P K+ QEF  LQANR+R SDM  RC VAL   N
Sbjct  34    PSLTLLPDQLRHCSEALALLK-KKIQTPFKLNQEFDALQANRLRKSDMLRRCQVALQEAN  92

Query  423   ISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIATQGPLPNTF  596
              +KNRY DVLPFD +RVVLN  ++ + S  GYINAS +T +  E + +FIATQGPLP TF
Sbjct  93    ANKNRYGDVLPFDDSRVVLNQNRNNKSSGSGYINASFVTNTSCERLPQFIATQGPLPETF  152

Query  597   EDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSL  776
             EDFWEMVIQ  CP IVMLTRL+DNYK VKCGDYFQA+ G REFG +C+TTK +KT+D SL
Sbjct  153   EDFWEMVIQFHCPVIVMLTRLIDNYKMVKCGDYFQADKGSREFGKVCVTTKCMKTSDNSL  212

Query  777   ILRCLEVSYKES-EEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVH  953
             +LRC+EV +KE  +E    VLH QYAEWPDHGVP+DT + REI+KRL+ + P LGP +VH
Sbjct  213   VLRCMEVKHKEQLDEISHQVLHIQYAEWPDHGVPEDTTSVREILKRLYHIAPQLGPFIVH  272

Query  954   CSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAII  1133
             CSAGIGRTG +C I++TIQRIL+GDMSA+DL  TI+ FR +RIGMVQT EQ+LFCY  I+
Sbjct  273   CSAGIGRTGAFCTIYHTIQRILVGDMSAVDLHVTISNFRDERIGMVQTREQFLFCYSVIM  332

Query  1134  EELEDIIKESTGQ  1172
             +ELED+I  S  Q
Sbjct  333   DELEDLISGSGEQ  345



>ref|XP_011629157.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X2 [Amborella 
trichopoda]
Length=352

 Score =   416 bits (1070),  Expect = 1e-138, Method: Compositional matrix adjust.
 Identities = 202/327 (62%), Positives = 244/327 (75%), Gaps = 11/327 (3%)
 Frame = +3

Query  222   FSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCL  401
             F   + PP L L  DQLR+CSE L +LK K+ Q P K+ QEF  LQANR+R SDM  RC 
Sbjct  27    FMAYADPPSLTLLPDQLRHCSEGLALLK-KKIQTPFKLNQEFDALQANRLRKSDMLRRCQ  85

Query  402   VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIATQ  575
             VAL   N +KNRY DVLPFD +RVVLN  ++ + S  GYINAS +T +  E + +FIATQ
Sbjct  86    VALQEANANKNRYGDVLPFDDSRVVLNQNRNNKSSGSGYINASFVTNTSCERLPQFIATQ  145

Query  576   GPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKT--------VKCGDYFQAEDGVREFGN  731
             GPLP TFEDFWEMVIQ  CP IVMLTRL+DNYK         VKCGDYFQA+ G REFG 
Sbjct  146   GPLPETFEDFWEMVIQFHCPVIVMLTRLIDNYKVLHCVRFKMVKCGDYFQADKGSREFGK  205

Query  732   ICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKR  911
             +C+TTK +KT+D SL+LRC+EV +KE +E    VLH QYAEWPDHGVP+DT + REI+KR
Sbjct  206   VCVTTKCMKTSDNSLVLRCMEVKHKELDEISHQVLHIQYAEWPDHGVPEDTTSVREILKR  265

Query  912   LHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMV  1091
             L+ + P LGP +VHCSAGIGRTG +C I++TIQRIL+GDMSA+DL  TI+ FR +RIGMV
Sbjct  266   LYHIAPQLGPFIVHCSAGIGRTGAFCTIYHTIQRILVGDMSAVDLHVTISNFRDERIGMV  325

Query  1092  QTLEQYLFCYDAIIEELEDIIKESTGQ  1172
             QT EQ+LFCY  I++ELED+I  S  Q
Sbjct  326   QTREQFLFCYSVIMDELEDLISGSGEQ  352



>ref|XP_010930782.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Elaeis guineensis]
Length=347

 Score =   412 bits (1059),  Expect = 4e-137, Method: Compositional matrix adjust.
 Identities = 202/322 (63%), Positives = 241/322 (75%), Gaps = 6/322 (2%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
              PFD S D  PP LVLS DQL+YCSEAL   K K+ + P KI QEF  LQ  R+   +M 
Sbjct  28    NPFDLSSDPPPP-LVLSRDQLKYCSEALAFFK-KKLKNPAKISQEFDRLQEMRLSKDEMV  85

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRF  563
              RC VAL   N++KNRY DVLPFD  RVVLN  +D +     YINAS + ++    VSRF
Sbjct  86    GRCGVALQDANLNKNRYIDVLPFDDTRVVLNSSRDNKSLGNDYINASFVKIASGGRVSRF  145

Query  564   IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVK-CGDYFQAEDGVREFGNICI  740
             IATQGPLP TFEDFWEM+IQ RCP IVMLT LVDN K +K C DYFQ+E+G+REFG   I
Sbjct  146   IATQGPLPETFEDFWEMIIQYRCPVIVMLT-LVDNPKMMKKCADYFQSENGLREFGKTSI  204

Query  741   TTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHT  920
              TK    + +SL+LRCLEV +KES+E    VLH QY EWPDHGVP DT + REI+KR++ 
Sbjct  205   FTKSAIISKSSLVLRCLEVKHKESKESARPVLHIQYPEWPDHGVPDDTASVREILKRIYH  264

Query  921   LPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTL  1100
             +PP LGPIVVHCSAGIGRTGTYCAIHNTIQRIL+GD+S+LDLV T+  FRSQRIGMVQT+
Sbjct  265   VPPDLGPIVVHCSAGIGRTGTYCAIHNTIQRILIGDISSLDLVKTVADFRSQRIGMVQTM  324

Query  1101  EQYLFCYDAIIEELEDIIKEST  1166
             EQ+ FCY AI++ELE+++ +S 
Sbjct  325   EQFFFCYAAIVDELEELVLKSN  346



>gb|KEH43588.1| tyrosine phosphatase [Medicago truncatula]
Length=321

 Score =   410 bits (1054),  Expect = 1e-136, Method: Compositional matrix adjust.
 Identities = 195/288 (68%), Positives = 233/288 (81%), Gaps = 3/288 (1%)
 Frame = +3

Query  240   PPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSI  419
             P R+ L+SDQ+ +C++AL +LK K  + P+ I QEF  LQANR+  S+   RC VAL+S+
Sbjct  23    PSRIPLTSDQVNHCTKALALLKNK-LRNPDTILQEFLHLQANRITLSESTRRCNVALNSV  81

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH--VSRFIATQGPLPNT  593
             NI+KNRY DV+PFD NRVVLN   DYR  + GYINAS I  S    VS FIATQGPLP+T
Sbjct  82    NINKNRYKDVIPFDKNRVVLNSSSDYRSESLGYINASFILTSSTGTVSEFIATQGPLPHT  141

Query  594   FEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTS  773
             +EDFWEM++Q  CPAIVMLT+LVDNYK VKCGDYFQ+ED  REFGNI +  KW KTT+TS
Sbjct  142   YEDFWEMIMQYNCPAIVMLTKLVDNYKMVKCGDYFQSEDRPREFGNISLACKWTKTTETS  201

Query  774   LILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVH  953
             L+LR LEV++KE E+ PLSV H QY EWPDHGVP DTLA REI+KRL+ LPP+LGPIVVH
Sbjct  202   LVLRHLEVNHKEVEDTPLSVFHIQYPEWPDHGVPNDTLAVREILKRLYHLPPNLGPIVVH  261

Query  954   CSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQT  1097
             CSAGIGRTGTYC IH+TIQRIL GD+SA+D+ NT+++FRSQRIGMVQT
Sbjct  262   CSAGIGRTGTYCTIHSTIQRILAGDISAIDIANTVSVFRSQRIGMVQT  309



>ref|XP_011629156.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X1 [Amborella 
trichopoda]
Length=353

 Score =   411 bits (1056),  Expect = 2e-136, Method: Compositional matrix adjust.
 Identities = 201/321 (63%), Positives = 242/321 (75%), Gaps = 12/321 (4%)
 Frame = +3

Query  243   PRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSIN  422
             P L L  DQLR+CSEAL +LK K+ Q P K+ QEF  LQANR+R SDM  RC VAL   N
Sbjct  34    PSLTLLPDQLRHCSEALALLK-KKIQTPFKLNQEFDALQANRLRKSDMLRRCQVALQEAN  92

Query  423   ISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIATQGPLPNTF  596
              +KNRY DVLPFD +RVVLN  ++ + S  GYINAS +T +  E + +FIATQGPLP TF
Sbjct  93    ANKNRYGDVLPFDDSRVVLNQNRNNKSSGSGYINASFVTNTSCERLPQFIATQGPLPETF  152

Query  597   EDFWEMVIQNRCPAIVMLTRLVDNYKT--------VKCGDYFQAEDGVREFGNICITTKW  752
             EDFWEMVIQ  CP IVMLTRL+DNYK         VKCGDYFQA+ G REFG +C+TTK 
Sbjct  153   EDFWEMVIQFHCPVIVMLTRLIDNYKVLHCVRFKMVKCGDYFQADKGSREFGKVCVTTKC  212

Query  753   IKTTDTSLILRCLEVSYKES-EEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
             +KT+D SL+LRC+EV +KE  +E    VLH QYAEWPDHGVP+DT + REI+KRL+ + P
Sbjct  213   MKTSDNSLVLRCMEVKHKEQLDEISHQVLHIQYAEWPDHGVPEDTTSVREILKRLYHIAP  272

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
              LGP +VHCSAGIGRTG +C I++TIQRIL+GDMSA+DL  TI+ FR +RIGMVQT EQ+
Sbjct  273   QLGPFIVHCSAGIGRTGAFCTIYHTIQRILVGDMSAVDLHVTISNFRDERIGMVQTREQF  332

Query  1110  LFCYDAIIEELEDIIKESTGQ  1172
             LFCY  I++ELED+I  S  Q
Sbjct  333   LFCYSVIMDELEDLISGSGEQ  353



>emb|CAA06615.1| protein tyrosine phosphatase [Pisum sativum]
Length=332

 Score =   408 bits (1049),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 207/309 (67%), Positives = 248/309 (80%), Gaps = 3/309 (1%)
 Frame = +3

Query  240   PPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSI  419
             P R+ L+SDQ+++C+EAL +LK K    P  + Q+F  LQ+NR+  S+   +C VAL+S 
Sbjct  24    PSRIPLTSDQIKHCTEALALLKNKL-LNPHTVSQKFFHLQSNRITLSETTKKCHVALNSA  82

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH--VSRFIATQGPLPNT  593
             N+SKNRY+DV+PFD NRVVL    DYR  A GYINAS I+ S    VS FIATQGP+P+T
Sbjct  83    NLSKNRYSDVIPFDKNRVVLKSSSDYRSEALGYINASKISTSSPGIVSEFIATQGPMPHT  142

Query  594   FEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTS  773
             FEDFWEM+IQ  CPAIVMLT LVDNYKTVKCGDYFQ+ED  REFGNI +T KW KTT TS
Sbjct  143   FEDFWEMMIQYHCPAIVMLTGLVDNYKTVKCGDYFQSEDRPREFGNISLTCKWTKTTKTS  202

Query  774   LILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVH  953
             L+LR LEV+ KE E+ PLSV H QY EWPDHGVP +TLA R I KRL+ LPP+LGPIVVH
Sbjct  203   LVLRHLEVNRKEVEDTPLSVFHIQYPEWPDHGVPNNTLAVRAIWKRLYHLPPNLGPIVVH  262

Query  954   CSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAII  1133
             CSAGIGRTGTYC IHNTIQRIL GDMSA+D+ NT+++FRSQRIGMVQT +QY+FCY+AII
Sbjct  263   CSAGIGRTGTYCTIHNTIQRILAGDMSAIDIANTVSVFRSQRIGMVQTQDQYIFCYEAII  322

Query  1134  EELEDIIKE  1160
             +ELED++ +
Sbjct  323   DELEDLVSQ  331



>ref|XP_010674720.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Beta vulgaris 
subsp. vulgaris]
Length=325

 Score =   407 bits (1047),  Expect = 2e-135, Method: Compositional matrix adjust.
 Identities = 197/319 (62%), Positives = 244/319 (76%), Gaps = 15/319 (5%)
 Frame = +3

Query  243   PRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR----SRCLVAL  410
             P+L LSSDQ+++C  AL  L  K  ++   I+ EF TL+A  M+ SD+     + C VA+
Sbjct  16    PQLSLSSDQMQHCHHALDYLILK-CESSNLIQHEFETLEAKSMKESDVERLKTTICTVAI  74

Query  411   DSINISKNRYTDVLPFDSN-RVVLNPCKDYRQSARGYINASLITV-SEHVSRFIATQGPL  584
             D +N+ KNRY +VLP+D+N RV+L P        R YINAS +   +++ ++FIATQGPL
Sbjct  75    DDVNLDKNRYPNVLPYDNNNRVILAP--------RDYINASFVKAPAQNAAQFIATQGPL  126

Query  585   PNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTT  764
             P+TFEDFWEMV+QNRCP IVMLTRLVDN KT+KCGDYFQAEDG REFGNI + TKWIKTT
Sbjct  127   PHTFEDFWEMVLQNRCPVIVMLTRLVDNNKTLKCGDYFQAEDGPREFGNISVVTKWIKTT  186

Query  765   DTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPI  944
              +SL+LR LEV+  ESEE PLSVLH QY EWPDHGVPKD+LA REIV R + LPP +GPI
Sbjct  187   GSSLVLRHLEVTKAESEEAPLSVLHIQYPEWPDHGVPKDSLAVREIVSRTYHLPPDVGPI  246

Query  945   VVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYD  1124
             VVHCSAGIGRTGTYC IH++IQRIL GDMSALD  NT+ +FR QR+GMVQTL+QY FCY 
Sbjct  247   VVHCSAGIGRTGTYCIIHDSIQRILAGDMSALDFANTVHVFRPQRVGMVQTLDQYYFCYK  306

Query  1125  AIIEELEDIIKESTGQPSS  1181
              +++ELE++I     + S+
Sbjct  307   TVVDELEELISRYNPEKSA  325



>ref|XP_008781548.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X1 [Phoenix 
dactylifera]
Length=347

 Score =   406 bits (1043),  Expect = 1e-134, Method: Compositional matrix adjust.
 Identities = 201/321 (63%), Positives = 241/321 (75%), Gaps = 6/321 (2%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
              P D S D  PP L+LS DQL++CSEAL   K K+ + P KI QEF  LQ  R+   +M 
Sbjct  28    NPSDLSSDPPPP-LILSRDQLKHCSEALAFFK-KKLKNPAKISQEFDRLQEMRLTKDEMV  85

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRF  563
              RC VA    N+SKNRY DVLPFD  RVVLN     + S   YINAS +T+  S  VSRF
Sbjct  86    RRCRVAFQDANLSKNRYIDVLPFDDTRVVLNSSSGSKSSGNDYINASFVTIASSGRVSRF  145

Query  564   IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVK-CGDYFQAEDGVREFGNICI  740
             IATQGPLP+TFEDFWEM+IQ RCP IVMLT LVDN K +K C DYFQ+E+G+REFG   +
Sbjct  146   IATQGPLPDTFEDFWEMIIQYRCPVIVMLT-LVDNPKMMKKCADYFQSENGLREFGKTSV  204

Query  741   TTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHT  920
              TK  + + +SL+LRCLEV +KESEE  L VLH QY EWPDHGVP DT + REI+KR++ 
Sbjct  205   FTKSTRISKSSLVLRCLEVKHKESEELALPVLHIQYPEWPDHGVPGDTSSVREILKRMYH  264

Query  921   LPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTL  1100
             +PP LGPIVVHCSAGIGRTGTYC IHNTIQRIL+GDMS+LDL+ T+  FRSQRIGMVQT+
Sbjct  265   VPPDLGPIVVHCSAGIGRTGTYCTIHNTIQRILIGDMSSLDLLKTVADFRSQRIGMVQTM  324

Query  1101  EQYLFCYDAIIEELEDIIKES  1163
             EQ+ FCY AI++ELE+++ +S
Sbjct  325   EQFFFCYAAIVDELEELVLKS  345



>ref|XP_009404327.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Musa acuminata 
subsp. malaccensis]
Length=335

 Score =   400 bits (1027),  Expect = 2e-132, Method: Compositional matrix adjust.
 Identities = 193/312 (62%), Positives = 239/312 (77%), Gaps = 5/312 (2%)
 Frame = +3

Query  240   PPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSI  419
             PP L  S +QL+YCSEAL   KEK  + P +I QEF  LQ  R    ++  +C VAL   
Sbjct  25    PPPLRPSGEQLKYCSEALDFFKEK-LRTPTRIAQEFHRLQEMRPTMDEIVRKCSVALRDA  83

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIATQGPLPNT  593
             N+ KNRYTD+LPFD+NR+VLN  +D       YINASLI ++  E VS+FIATQGPLP T
Sbjct  84    NLDKNRYTDILPFDNNRIVLNSTRDSTSLRNNYINASLIGLASGEKVSQFIATQGPLPET  143

Query  594   FEDFWEMVIQNRCPAIVMLTRLVDNYKTV-KCGDYFQAEDGVREFGNICITTKWIKTTDT  770
             FEDFWEMV + RCPAIVMLTR VDN++ + KC +YFQA++G+REFG I I TK+ +T+D+
Sbjct  144   FEDFWEMVFEYRCPAIVMLTR-VDNHRMMRKCANYFQAQNGLREFGKISIETKYTRTSDS  202

Query  771   SLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVV  950
             SL+LR LEV +KE  +P LSVLH QY EWPDHGVP+DT + REI +  H LPP +GPIVV
Sbjct  203   SLVLRRLEVKHKELVKPALSVLHIQYPEWPDHGVPEDTASVREIFEMTHHLPPEIGPIVV  262

Query  951   HCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAI  1130
             HCSAGIGRTGTYC IHNT+QR+L+GDMS+LDL  TI+ FRSQR+GMVQT+EQY FCYDAI
Sbjct  263   HCSAGIGRTGTYCTIHNTLQRVLIGDMSSLDLKKTISEFRSQRLGMVQTMEQYFFCYDAI  322

Query  1131  IEELEDIIKEST  1166
             ++ELE+++  S 
Sbjct  323   VDELEELLSRSA  334



>gb|ACY78390.1| protein tyrosine phosphatase 1 [Phalaenopsis amabilis]
Length=346

 Score =   397 bits (1019),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 187/311 (60%), Positives = 235/311 (76%), Gaps = 3/311 (1%)
 Frame = +3

Query  240   PPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSI  419
             PP + LS DQL+ CSEAL + K K    P KI QEF  +Q  R+R  D+  +C VAL + 
Sbjct  36    PPPICLSPDQLKQCSEALAIFKRKLL-TPGKIAQEFDRIQDMRVRKLDVLRKCRVALHAD  94

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIATQGPLPNT  593
             N++KNRY DV+P+DS+RVVLN  ++   S  GYINAS IT   SE +SRFIATQGPLP+T
Sbjct  95    NLAKNRYADVIPYDSSRVVLNLTEEDNHSNGGYINASFITAGFSEKLSRFIATQGPLPDT  154

Query  594   FEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTS  773
             FEDFWEMVIQ RCPAIVMLT + +  K  KC DYF  E+  REFGNI ++ KW + +++S
Sbjct  155   FEDFWEMVIQYRCPAIVMLTAVDNPKKMKKCADYFHVENATREFGNIILSNKWTQKSESS  214

Query  774   LILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVH  953
             LILRCLEV  KES+E  ++VLH  Y +WPDHGVP+DT+  REI+KR H  P +LGPI+VH
Sbjct  215   LILRCLEVKKKESQESSMTVLHIHYPDWPDHGVPQDTVFVREILKRTHHFPANLGPIIVH  274

Query  954   CSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAII  1133
             CSAGIGRTGTYC IHNTIQR+L+GDMS+LDL  T+  FRSQR+GMVQTLEQ+ FCY A++
Sbjct  275   CSAGIGRTGTYCVIHNTIQRVLIGDMSSLDLAKTVLDFRSQRMGMVQTLEQFKFCYVAVV  334

Query  1134  EELEDIIKEST  1166
             +ELE ++ ++ 
Sbjct  335   DELEGLVSKAN  345



>ref|XP_009390761.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=336

 Score =   392 bits (1007),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 194/321 (60%), Positives = 234/321 (73%), Gaps = 6/321 (2%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
              P D   D  PP L LS +Q   CSEAL   K +R + P KI Q F  LQ  R+   +M 
Sbjct  17    NPGDLCSDPPPP-LRLSREQHELCSEALAFFK-RRLRTPAKIAQAFDRLQEMRLTKDEMM  74

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRF  563
              +C VAL   N+ KNRY DVLPFD+NR++L+  K    SA GYINAS I +   E VSRF
Sbjct  75    RKCSVALRDANLVKNRYMDVLPFDNNRIILDSTKGNTSSANGYINASFIGIGTGEKVSRF  134

Query  564   IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTV-KCGDYFQAEDGVREFGNICI  740
             IATQGPLP T  DFWEMV Q+RCP IVMLT LVDN K + KC DYFQA+DG+R FG I +
Sbjct  135   IATQGPLPETSGDFWEMVFQHRCPVIVMLT-LVDNPKMMRKCADYFQADDGLRGFGKISV  193

Query  741   TTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHT  920
              TK+ +   +SL+LRCLEV +KE  +P L VLH QY EWPDHGVP DT + REI+KR++ 
Sbjct  194   ETKYTRICASSLVLRCLEVKHKELVKPTLPVLHIQYPEWPDHGVPADTASVREILKRIYH  253

Query  921   LPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTL  1100
             +PPS+GPIVVHCSAGIGRTG YC IHNTIQR+L+GDMS+LDLV T+  FRSQRIGMVQT+
Sbjct  254   VPPSIGPIVVHCSAGIGRTGAYCTIHNTIQRVLVGDMSSLDLVRTVAEFRSQRIGMVQTV  313

Query  1101  EQYLFCYDAIIEELEDIIKES  1163
             EQY FCY AI++ELE+++ +S
Sbjct  314   EQYFFCYAAIVDELEELVSKS  334



>gb|KJB35867.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=249

 Score =   387 bits (993),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 177/247 (72%), Positives = 216/247 (87%), Gaps = 2/247 (1%)
 Frame = +3

Query  447   VLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIATQGPLPNTFEDFWEMVI  620
             ++  D+NRVVL  CKDYR +A+GYINAS +T S  E++S+FIATQGPLP+T+EDFWEMVI
Sbjct  1     MVSVDTNRVVLYSCKDYRPAAKGYINASFVTTSSSENISKFIATQGPLPHTYEDFWEMVI  60

Query  621   QNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVS  800
             Q  CP IVMLTRLVDNYKTVKCGDYFQAE+  R+FGNICI TKWI+ T+TSL++R LEV+
Sbjct  61    QCHCPVIVMLTRLVDNYKTVKCGDYFQAENVPRQFGNICIDTKWIQETETSLLIRNLEVN  120

Query  801   YKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVHCSAGIGRTG  980
             YKESE+PPLSVLH QY EWPDHGVP DTLA REI+KR+  +P ++GPI+VHCSAGIGRTG
Sbjct  121   YKESEDPPLSVLHIQYPEWPDHGVPTDTLAVREILKRVLQVPVNIGPILVHCSAGIGRTG  180

Query  981   TYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKE  1160
             TYCAIHNT+QRIL+GDMSALDL NTI++FRSQRIGMVQT++QY FCY AI++EL+++I +
Sbjct  181   TYCAIHNTVQRILIGDMSALDLANTISMFRSQRIGMVQTMDQYFFCYKAIVDELKELISD  240

Query  1161  STGQPSS  1181
              + + SS
Sbjct  241   FSSEHSS  247



>gb|KDO83955.1| hypothetical protein CISIN_1g019277mg [Citrus sinensis]
Length=278

 Score =   377 bits (969),  Expect = 1e-124, Method: Compositional matrix adjust.
 Identities = 179/267 (67%), Positives = 211/267 (79%), Gaps = 6/267 (2%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             +PF+FS    PPR+ L++DQ  +CSEAL   KEK      +I QEF  LQA+R++ S+M 
Sbjct  16    KPFEFSAVDFPPRISLTADQYNHCSEALSFFKEKLQNKSREISQEFARLQASRIKPSEMA  75

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRF  563
               C VALD +N+SKNRYTD+LPFD NRVVL  CKDYR +ARGYINASLI+ S  E VS+F
Sbjct  76    RGCTVALDGVNLSKNRYTDILPFDKNRVVLKQCKDYRPAARGYINASLISTSSSEKVSQF  135

Query  564   IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICIT  743
             IATQGPLP+T+EDFWEMVIQ  CP IVMLTRLVDNYK VKCGDYFQAEDG REFGNI I 
Sbjct  136   IATQGPLPHTYEDFWEMVIQYHCPVIVMLTRLVDNYKMVKCGDYFQAEDGPREFGNIGIV  195

Query  744   TKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTL  923
             TKWIKTT+T+L+LR LEV+YKESEEPP+SVLH QY EWPDHGVP+DTLA REI+KR++ L
Sbjct  196   TKWIKTTETALVLRNLEVNYKESEEPPMSVLHIQYPEWPDHGVPRDTLAVREILKRIYNL  255

Query  924   PPSLGPIVVHCSAGIGRTGTYCAIHNT  1004
             PP+ GPIVVHC         +C +HN+
Sbjct  256   PPNFGPIVVHCRYW----ENWCILHNS  278



>gb|KJB35868.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=300

 Score =   376 bits (966),  Expect = 1e-123, Method: Compositional matrix adjust.
 Identities = 185/324 (57%), Positives = 229/324 (71%), Gaps = 49/324 (15%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             F FS D  PP++ L+ DQ  YCSEALK+  +K  Q P++I +EF  LQANR+  S+M  R
Sbjct  22    FVFSADP-PPKISLTPDQFNYCSEALKLFSQK-LQMPDEINREFSHLQANRITPSEMMRR  79

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIA  569
             C V  +  N+ KNRY+DV+PFD+NRVVL  CKDYR +A+GYINAS +T S  E++S+FIA
Sbjct  80    CTVGFNGANLDKNRYSDVIPFDTNRVVLYSCKDYRPAAKGYINASFVTTSSSENISKFIA  139

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLP+T+EDFWEMVIQ  CP IVMLTRLVDNYK                         
Sbjct  140   TQGPLPHTYEDFWEMVIQCHCPVIVMLTRLVDNYK-------------------------  174

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
                                 SE+PPLSVLH QY EWPDHGVP DTLA REI+KR+  +P 
Sbjct  175   --------------------SEDPPLSVLHIQYPEWPDHGVPTDTLAVREILKRVLQVPV  214

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
             ++GPI+VHCSAGIGRTGTYCAIHNT+QRIL+GDMSALDL NTI++FRSQRIGMVQT++QY
Sbjct  215   NIGPILVHCSAGIGRTGTYCAIHNTVQRILIGDMSALDLANTISMFRSQRIGMVQTMDQY  274

Query  1110  LFCYDAIIEELEDIIKESTGQPSS  1181
              FCY AI++EL+++I + + + SS
Sbjct  275   FFCYKAIVDELKELISDFSSEHSS  298



>ref|XP_008381998.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Malus domestica]
Length=275

 Score =   373 bits (958),  Expect = 6e-123, Method: Compositional matrix adjust.
 Identities = 172/246 (70%), Positives = 204/246 (83%), Gaps = 3/246 (1%)
 Frame = +3

Query  225  SYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLV  404
            S D+ PP+L L+ DQ +YCS+ALK+ KEK  Q P+ I+QEF  LQA R+  S+M+  C V
Sbjct  19   SADAPPPKLALTPDQYKYCSQALKLFKEK-LQMPDHIKQEFAQLQAKRITLSEMKRNCTV  77

Query  405  ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIATQG  578
            ALDS+N  KNRYTDV+PFD NRVVLN CKDYR SARGYINASLI  S  E +SRFIATQG
Sbjct  78   ALDSVNSGKNRYTDVVPFDKNRVVLNSCKDYRPSARGYINASLIATSSSESISRFIATQG  137

Query  579  PLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIK  758
            PLP+T+EDFWEMV++ RCP ++MLTRLVD Y  VKCGDYFQAEDG REFGNICI+TKW++
Sbjct  138  PLPHTYEDFWEMVLEQRCPVVIMLTRLVDCYTMVKCGDYFQAEDGPREFGNICISTKWLR  197

Query  759  TTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLG  938
            TTDTSL+LR LEV+ KESEEPP+SVLH QY EWPDHGVPK+T   REI+KR++ +PP+LG
Sbjct  198  TTDTSLVLRLLEVNXKESEEPPMSVLHIQYPEWPDHGVPKNTFVVREILKRIYQVPPNLG  257

Query  939  PIVVHC  956
            PIVVHC
Sbjct  258  PIVVHC  263



>gb|KCW71045.1| hypothetical protein EUGRSUZ_F04145 [Eucalyptus grandis]
Length=296

 Score =   371 bits (952),  Expect = 9e-122, Method: Compositional matrix adjust.
 Identities = 182/275 (66%), Positives = 214/275 (78%), Gaps = 18/275 (7%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             DFS D  PP+  LS DQ R+C+EAL+ LKEK  Q P++++QEFG LQANR+R S+M   
Sbjct  19   LDFSPDP-PPKPALSPDQRRFCAEALRALKEK-LQMPDRMKQEFGRLQANRIRPSEMVRS  76

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIA  569
            C VALD +N SKNRYTDV+P+D  RVVLNPCKDYR +A+GYINAS IT S  E+VSRFIA
Sbjct  77   CTVALDDVNSSKNRYTDVVPYDKTRVVLNPCKDYRPAAKGYINASFITASSSENVSRFIA  136

Query  570  TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKT--------VKCGDYFQAEDGVREF  725
            TQGPLP+T+EDFWEM++Q+RCPAIVMLTRLVD+YKT        VKCGDYFQAEDG R+F
Sbjct  137  TQGPLPHTYEDFWEMILQHRCPAIVMLTRLVDSYKTFNSAGVEMVKCGDYFQAEDGPRDF  196

Query  726  GNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIV  905
            GNICI+TKWIK TDTSL+LR LEV+YKE+EEPP+SVLH  Y +WPDHGVP DT+A REI 
Sbjct  197  GNICISTKWIKNTDTSLVLRHLEVNYKETEEPPMSVLHILYPDWPDHGVPADTIAVREIF  256

Query  906  KRLHTLPPSLGPIVVHC------SAGIGRTGTYCA  992
            KR + + PSLGPIVVHC         I     YCA
Sbjct  257  KRTNEISPSLGPIVVHCRLRHREDWNILHNSQYCA  291



>ref|XP_009390760.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=337

 Score =   367 bits (941),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 187/312 (60%), Positives = 221/312 (71%), Gaps = 11/312 (4%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
              P D   D  PP L LS +Q   CSEAL   K +R + P KI Q F  LQ  R+   +M 
Sbjct  17    NPGDLCSDPPPP-LRLSREQHELCSEALAFFK-RRLRTPAKIAQAFDRLQEMRLTKDEMM  74

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRF  563
              +C VAL   N+ KNRY DVLPFD+NR++L+  K    SA GYINAS I +   E VSRF
Sbjct  75    RKCSVALRDANLVKNRYMDVLPFDNNRIILDSTKGNTSSANGYINASFIGIGTGEKVSRF  134

Query  564   IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTV-KCGDYFQAEDGVREFGNICI  740
             IATQGPLP T  DFWEMV Q+RCP IVMLT LVDN K + KC DYFQA+DG+R FG I +
Sbjct  135   IATQGPLPETSGDFWEMVFQHRCPVIVMLT-LVDNPKMMRKCADYFQADDGLRGFGKISV  193

Query  741   TTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHT  920
              TK+ +   +SL+LRCLEV +KE  +P L VLH QY EWPDHGVP DT + REI+KR++ 
Sbjct  194   ETKYTRICASSLVLRCLEVKHKELVKPTLPVLHIQYPEWPDHGVPADTASVREILKRIYH  253

Query  921   LPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTL  1100
             +PPS+GPIVVHCSAGIGRTG YC IHNTIQR+L+GDMS+LDLV T+  FRSQRIGMVQT+
Sbjct  254   VPPSIGPIVVHCSAGIGRTGAYCTIHNTIQRVLVGDMSSLDLVRTVAEFRSQRIGMVQTV  313

Query  1101  EQY-----LFCY  1121
               Y     LFCY
Sbjct  314   VSYLSFFLLFCY  325



>ref|XP_008781549.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X2 [Phoenix 
dactylifera]
 ref|XP_008781550.1| PREDICTED: protein-tyrosine-phosphatase PTP1 isoform X2 [Phoenix 
dactylifera]
Length=278

 Score =   362 bits (929),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 175/273 (64%), Positives = 211/273 (77%), Gaps = 4/273 (1%)
 Frame = +3

Query  354   LQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASL  533
             L+  R+   +M  RC VA    N+SKNRY DVLPFD  RVVLN     + S   YINAS 
Sbjct  5     LEEMRLTKDEMVRRCRVAFQDANLSKNRYIDVLPFDDTRVVLNSSSGSKSSGNDYINASF  64

Query  534   ITV--SEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVK-CGDYFQA  704
             +T+  S  VSRFIATQGPLP+TFEDFWEM+IQ RCP IVMLT LVDN K +K C DYFQ+
Sbjct  65    VTIASSGRVSRFIATQGPLPDTFEDFWEMIIQYRCPVIVMLT-LVDNPKMMKKCADYFQS  123

Query  705   EDGVREFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDT  884
             E+G+REFG   + TK  + + +SL+LRCLEV +KESEE  L VLH QY EWPDHGVP DT
Sbjct  124   ENGLREFGKTSVFTKSTRISKSSLVLRCLEVKHKESEELALPVLHIQYPEWPDHGVPGDT  183

Query  885   LATREIVKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITI  1064
              + REI+KR++ +PP LGPIVVHCSAGIGRTGTYC IHNTIQRIL+GDMS+LDL+ T+  
Sbjct  184   SSVREILKRMYHVPPDLGPIVVHCSAGIGRTGTYCTIHNTIQRILIGDMSSLDLLKTVAD  243

Query  1065  FRSQRIGMVQTLEQYLFCYDAIIEELEDIIKES  1163
             FRSQRIGMVQT+EQ+ FCY AI++ELE+++ +S
Sbjct  244   FRSQRIGMVQTMEQFFFCYAAIVDELEELVLKS  276



>gb|ABK26026.1| unknown [Picea sitchensis]
Length=358

 Score =   362 bits (929),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 180/305 (59%), Positives = 218/305 (71%), Gaps = 3/305 (1%)
 Frame = +3

Query  246   RLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINI  425
             R+ L+  QL  CSE+L +LK K      K  +EF  LQ  R + S+   R  VA  + NI
Sbjct  49    RVALTPAQLNGCSESLNILK-KMCNIHNKTSKEFEMLQMRRAKGSEFMRRTSVARQNGNI  107

Query  426   SKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLIT--VSEHVSRFIATQGPLPNTFE  599
              KNRY DV+PFD  RVVLN  K    +   YINAS I    SE++ +FIATQGPLP T E
Sbjct  108   YKNRYPDVIPFDDTRVVLNYNKRSPCAGSDYINASYIVNPSSENLPKFIATQGPLPETSE  167

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
             DFW+M+IQ+RCP IVMLTRL+DNYKT+KC DYF AE+  R FG I +T K +K +  S+ 
Sbjct  168   DFWQMIIQHRCPVIVMLTRLIDNYKTLKCADYFPAEEESRIFGRISVTNKSLKISQNSIA  227

Query  780   LRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVHCS  959
             LR LEV Y ESEEPPLSVLH QY +WPDHGVP  T + RE+VKRL+ +PPSLGP VVHCS
Sbjct  228   LRFLEVKYIESEEPPLSVLHLQYPDWPDHGVPNTTESVRELVKRLYLVPPSLGPFVVHCS  287

Query  960   AGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEE  1139
             AGIGRTG +C I +TI RIL GD+SALDL  TI  FR+QRIGMVQT +QY+FCY A++ E
Sbjct  288   AGIGRTGAFCTISHTIHRILEGDVSALDLSTTIRQFRNQRIGMVQTQDQYIFCYAAVVHE  347

Query  1140  LEDII  1154
             LED++
Sbjct  348   LEDLV  352



>ref|XP_008381013.1| PREDICTED: LOW QUALITY PROTEIN: protein-tyrosine-phosphatase 
PTP1 [Malus domestica]
Length=275

 Score =   354 bits (908),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 170/249 (68%), Positives = 200/249 (80%), Gaps = 3/249 (1%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             + S DS PP+L L+ DQ +YCS+ALK+ K K  Q P+ I QEF  LQA RM +S+M   
Sbjct  16   LNVSGDSPPPKLALTPDQYKYCSQALKLFKGK-LQMPDHINQEFAQLQAKRMTSSEMGRN  74

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVS--RFIA  569
            C V LD++N SKNRYTDV+PFD NRVVLN  KDYR SARGYINASLIT S   S  RFIA
Sbjct  75   CTVGLDNVNSSKNRYTDVVPFDKNRVVLNSSKDYRPSARGYINASLITTSSSESISRFIA  134

Query  570  TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
            TQGPLP+T+EDFWEMV++ RCP I+MLTRL+D Y  VKCGDYFQAEDG REFGNIC +TK
Sbjct  135  TQGPLPHTYEDFWEMVLEQRCPVIIMLTRLIDCYTMVKCGDYFQAEDGPREFGNICTSTK  194

Query  750  WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
            W++TTDTSL+LR LEV+ KESEEPP+SVLH QY EWPDHGVP +T+A REI+KRL+ +PP
Sbjct  195  WLRTTDTSLVLRLLEVNNKESEEPPMSVLHLQYPEWPDHGVPNNTIAVREILKRLYNVPP  254

Query  930  SLGPIVVHC  956
            + GPIVVHC
Sbjct  255  NHGPIVVHC  263



>ref|XP_007020251.1| Tyrosine phosphatase 1 isoform 3 [Theobroma cacao]
 gb|EOY17476.1| Tyrosine phosphatase 1 isoform 3 [Theobroma cacao]
Length=278

 Score =   350 bits (897),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 166/249 (67%), Positives = 197/249 (79%), Gaps = 4/249 (2%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F FS D  PPR+ L+  Q  YCS ALK+  EK    P +I +EF  LQANR+R S+M   
Sbjct  20   FVFSAD-YPPRVSLTPSQFNYCSRALKLFSEKLLM-PHEITREFARLQANRIRPSEMARS  77

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIA  569
            C V L+S+N+ KNRY+DV+PFD NRVVLN CKDYR +A+GYINAS +T S  E++S+FIA
Sbjct  78   CTVGLNSVNLDKNRYSDVVPFDKNRVVLNSCKDYRPAAKGYINASFVTTSSSENISQFIA  137

Query  570  TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
            TQGP+P+T+EDFWEMVIQ  CP IVMLTRLVDNYK VKCGDYFQ E G R+ GNICI TK
Sbjct  138  TQGPIPHTYEDFWEMVIQRHCPVIVMLTRLVDNYKVVKCGDYFQVEGGPRQCGNICIDTK  197

Query  750  WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
            WI+ TDTSL+LR LEV+Y ESE+PP+SVLH QY EWPDHGVP DTLA REI+KR+  +PP
Sbjct  198  WIQATDTSLLLRSLEVNYSESEDPPVSVLHIQYPEWPDHGVPVDTLAVREILKRVLKVPP  257

Query  930  SLGPIVVHC  956
            +LGPIVVHC
Sbjct  258  NLGPIVVHC  266



>gb|KJB35866.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
 gb|KJB35869.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=276

 Score =   348 bits (894),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 164/249 (66%), Positives = 201/249 (81%), Gaps = 4/249 (2%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F FS D  PP++ L+ DQ  YCSEALK+  +K  Q P++I +EF  LQANR+  S+M  R
Sbjct  22   FVFSADP-PPKISLTPDQFNYCSEALKLFSQK-LQMPDEINREFSHLQANRITPSEMMRR  79

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIA  569
            C V  +  N+ KNRY+DV+PFD+NRVVL  CKDYR +A+GYINAS +T S  E++S+FIA
Sbjct  80   CTVGFNGANLDKNRYSDVIPFDTNRVVLYSCKDYRPAAKGYINASFVTTSSSENISKFIA  139

Query  570  TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
            TQGPLP+T+EDFWEMVIQ  CP IVMLTRLVDNYKTVKCGDYFQAE+  R+FGNICI TK
Sbjct  140  TQGPLPHTYEDFWEMVIQCHCPVIVMLTRLVDNYKTVKCGDYFQAENVPRQFGNICIDTK  199

Query  750  WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
            WI+ T+TSL++R LEV+YKESE+PPLSVLH QY EWPDHGVP DTLA REI+KR+  +P 
Sbjct  200  WIQETETSLLIRNLEVNYKESEDPPLSVLHIQYPEWPDHGVPTDTLAVREILKRVLQVPV  259

Query  930  SLGPIVVHC  956
            ++GPI+VHC
Sbjct  260  NIGPILVHC  268



>gb|KJB35870.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=280

 Score =   347 bits (891),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 164/249 (66%), Positives = 201/249 (81%), Gaps = 4/249 (2%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F FS D  PP++ L+ DQ  YCSEALK+  +K  Q P++I +EF  LQANR+  S+M  R
Sbjct  22   FVFSADP-PPKISLTPDQFNYCSEALKLFSQK-LQMPDEINREFSHLQANRITPSEMMRR  79

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIA  569
            C V  +  N+ KNRY+DV+PFD+NRVVL  CKDYR +A+GYINAS +T S  E++S+FIA
Sbjct  80   CTVGFNGANLDKNRYSDVIPFDTNRVVLYSCKDYRPAAKGYINASFVTTSSSENISKFIA  139

Query  570  TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
            TQGPLP+T+EDFWEMVIQ  CP IVMLTRLVDNYKTVKCGDYFQAE+  R+FGNICI TK
Sbjct  140  TQGPLPHTYEDFWEMVIQCHCPVIVMLTRLVDNYKTVKCGDYFQAENVPRQFGNICIDTK  199

Query  750  WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
            WI+ T+TSL++R LEV+YKESE+PPLSVLH QY EWPDHGVP DTLA REI+KR+  +P 
Sbjct  200  WIQETETSLLIRNLEVNYKESEDPPLSVLHIQYPEWPDHGVPTDTLAVREILKRVLQVPV  259

Query  930  SLGPIVVHC  956
            ++GPI+VHC
Sbjct  260  NIGPILVHC  268



>ref|XP_006606203.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X4 
[Glycine max]
Length=271

 Score =   338 bits (866),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 164/249 (66%), Positives = 196/249 (79%), Gaps = 4/249 (2%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F+FS D+ P R++L+SDQ+ +C++AL +LKEK    P  I QEF  LQANR+  S+MR R
Sbjct  22   FNFSPDN-PSRIILTSDQVNHCTQALNLLKEK-LHDPHVITQEFAHLQANRITPSEMRRR  79

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIA  569
            C VA D++N+SKNRYTDVLPF+ NRVVL    DYR  A+GYINASLI+ S   +VS FIA
Sbjct  80   CTVAYDAVNLSKNRYTDVLPFNKNRVVLKSSTDYRPEAQGYINASLISTSSAGNVSHFIA  139

Query  570  TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
            TQGPLP+T EDFWEM+ Q  CP I+MLTRLVDNYK VKC DYFQAEDG RE GNI I  K
Sbjct  140  TQGPLPHTCEDFWEMITQYHCPVIIMLTRLVDNYKMVKCVDYFQAEDGPREVGNISIIGK  199

Query  750  WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
            W  TT+TSL+LR LEV+++E ++ PLSVLH QY EWPDHGVPKDTLA REI+KRL+ LP 
Sbjct  200  WENTTETSLVLRHLEVNHREVDDAPLSVLHIQYPEWPDHGVPKDTLAVREILKRLYHLPS  259

Query  930  SLGPIVVHC  956
            +LGPIVVHC
Sbjct  260  NLGPIVVHC  268



>ref|XP_004299356.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Fragaria vesca 
subsp. vesca]
 ref|XP_004299357.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Fragaria vesca 
subsp. vesca]
Length=356

 Score =   341 bits (874),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 185/323 (57%), Positives = 223/323 (69%), Gaps = 24/323 (7%)
 Frame = +3

Query  213   PFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
             P  FS+  + PR+VL+ DQ ++CS+ALKV K+K    P  I +EF  L    +    +  
Sbjct  42    PEYFSFSPRRPRVVLTPDQHKWCSQALKVFKDK-LDKPGLISREFDELYERAV----VEK  96

Query  393   RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARG-YINASLITVSEHVSRFIA  569
              C V L S N  KNRY ++LPFD +RVVL   K    S+ G YINAS +T S   SRFIA
Sbjct  97    SCNVGLSSANWRKNRYDEILPFDESRVVL---KGRSNSSGGDYINASFVTTS--ASRFIA  151

Query  570   TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
             TQGPLPNT+EDFWEMV+Q RCP IVMLTRL     + KCGDYF+AED  R+FGN+CI TK
Sbjct  152   TQGPLPNTYEDFWEMVMQYRCPVIVMLTRL----DSGKCGDYFRAEDE-RDFGNVCIVTK  206

Query  750   WIKTTDTSLILRCLEVSYKE------SEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKR  911
             WI ++++      L +   E      SEEPP+SVLH  Y EWPDHGVP DT   R+I+K 
Sbjct  207   WIGSSESGGSSSSLVLRLLEVRRKAGSEEPPVSVLHIHYPEWPDHGVPADTHDVRDILKG  266

Query  912   L--HTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIG  1085
             L     PP LGPIVVHCSAGIGRTGTYC IH+T++RIL GDMSALDLV TI  FRSQR G
Sbjct  267   LIYQVEPPELGPIVVHCSAGIGRTGTYCTIHDTMKRILSGDMSALDLVGTIATFRSQRDG  326

Query  1086  MVQTLEQYLFCYDAIIEELEDII  1154
             MV+TL+QY FCY AI++ELED+I
Sbjct  327   MVETLKQYQFCYSAIVDELEDLI  349



>ref|NP_974127.1| tyrosine phosphatase 1 [Arabidopsis thaliana]
 gb|AEE35241.1| tyrosine phosphatase 1 [Arabidopsis thaliana]
Length=277

 Score =   336 bits (861),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/233 (68%), Positives = 189/233 (81%), Gaps = 5/233 (2%)
 Frame = +3

Query  264  DQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYT  443
            DQL +C +AL V + K  Q P+ I  EF  LQANRM  S++     VA++S+N+ KNRY+
Sbjct  36   DQLNHCHQALGVFRGK-IQNPDSIAHEFTGLQANRMWPSELLLNSTVAMNSVNVEKNRYS  94

Query  444  DVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH--VSRFIATQGPLPNTFEDFWEMV  617
            DV+PFD NR+VLNPCKD   SA+GY+NASLI  SE   +S+FIATQGPLP+T EDFWEMV
Sbjct  95   DVVPFDKNRIVLNPCKD--SSAKGYVNASLIKTSESESISQFIATQGPLPHTMEDFWEMV  152

Query  618  IQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEV  797
            IQ  CP IVMLTRLVDN +TVKCGDYFQ EDG REFGNI +TTKWIKTTDTSL+LR LEV
Sbjct  153  IQQHCPIIVMLTRLVDNNRTVKCGDYFQDEDGPREFGNISLTTKWIKTTDTSLMLRNLEV  212

Query  798  SYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVHC  956
            +YKE+E+ P+SVLH QY EWPDHGVPKDT+A REI+KRL+ +PPSLGPI+VHC
Sbjct  213  NYKETEDQPMSVLHIQYPEWPDHGVPKDTVAVREILKRLYQVPPSLGPIIVHC  265



>ref|XP_008454604.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Cucumis melo]
Length=275

 Score =   333 bits (855),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/251 (66%), Positives = 199/251 (79%), Gaps = 5/251 (2%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             PF FS DS PP L L+  Q++ CS+AL+   + R Q P+ I QEF  LQA R+ ASDMR
Sbjct  16   NPFIFSPDS-PPTLALTPHQIKLCSQALEAFTD-RLQKPDVINQEFARLQAKRITASDMR  73

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSR--F  563
              C VALD++N++KNRY DVLPFD  RVVL+ CKDYR SARGYINAS I+ S   S   F
Sbjct  74   RSCSVALDNVNVNKNRYMDVLPFDETRVVLDSCKDYRPSARGYINASFISTSSSKSLSKF  133

Query  564  IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICIT  743
            IATQGPLP+T+EDFWEMV Q +CPAI+MLTRLVDNYK VKCGDYFQAEDG R+FGN+ + 
Sbjct  134  IATQGPLPHTYEDFWEMVFQYKCPAILMLTRLVDNYKMVKCGDYFQAEDGPRDFGNLIVV  193

Query  744  TKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTL  923
            +KWIK++++SLILR LEV++KESEE  ++VLH QY EWPDHGVP DTLA RE++KRL+ L
Sbjct  194  SKWIKSSNSSLILRHLEVNHKESEE-SVAVLHIQYPEWPDHGVPNDTLAVREMLKRLYHL  252

Query  924  PPSLGPIVVHC  956
            PP LGPIVVHC
Sbjct  253  PPDLGPIVVHC  263



>ref|XP_007227330.1| hypothetical protein PRUPE_ppa016082mg [Prunus persica]
 gb|EMJ28529.1| hypothetical protein PRUPE_ppa016082mg [Prunus persica]
Length=361

 Score =   335 bits (860),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 183/327 (56%), Positives = 225/327 (69%), Gaps = 40/327 (12%)
 Frame = +3

Query  222   FSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCL  401
              +YD  P RL L+  Q +YCS ALK  K+K  + PE+I+Q++  +               
Sbjct  58    LAYDLPPRRLTLAPHQYKYCSLALKFFKDK-LRMPEQIKQDWDHIA--------------  102

Query  402   VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGP  581
             +AL+++N SKN Y D +  D NRVVLN       +A  YINAS IT     S FIATQGP
Sbjct  103   LALNNVNFSKNHYDDYVALDENRVVLN-----YSAAGDYINASFITSCS--SSFIATQGP  155

Query  582   LPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAE--DGVREFGNICITTKWI  755
             L  TFEDFWEMVIQ RC  +VMLT L DN    KCGDYFQAE  DG REFGNI I TK I
Sbjct  156   LSETFEDFWEMVIQYRCSVVVMLTDLDDN----KCGDYFQAEGDDGHREFGNISIATKSI  211

Query  756   KTTD----TSLILRCLEVSY----KESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKR  911
             ++++     S++LR LEV       +SEE P+SVLH QY +WPDHGVP++T+A REI+KR
Sbjct  212   RSSEFGDGNSVVLRLLEVKKHNEESDSEEAPMSVLHIQYPQWPDHGVPENTIAVREILKR  271

Query  912   -LHTLPPSL---GPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQR  1079
              ++ + P++   GPIVVHCSAG+GRTGTYC IH+T+QRI+ GDMSALDLVNTIT FRSQR
Sbjct  272   AMYQVAPAIPDSGPIVVHCSAGVGRTGTYCTIHDTLQRIISGDMSALDLVNTITRFRSQR  331

Query  1080  IGMVQTLEQYLFCYDAIIEELEDIIKE  1160
              GMVQ  EQY FCYDAII+ELED+I +
Sbjct  332   DGMVQKPEQYCFCYDAIIDELEDLISD  358



>ref|XP_008461478.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Cucumis melo]
Length=330

 Score =   325 bits (834),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 162/247 (66%), Positives = 194/247 (79%), Gaps = 5/247 (2%)
 Frame = +3

Query  222  FSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCL  401
            FS DS PP L L   Q++ CS+AL+   +K  Q P+ I QEF  LQA R+ ASDMR  C 
Sbjct  75   FSPDS-PPTLALKPHQIKLCSQALEAFTDK-LQKPDVINQEFARLQAKRITASDMRRSCS  132

Query  402  VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSR--FIATQ  575
            VALD++N++KNRY DVLPFD  RVVL+ CKDYR S RGYINAS I+ S   S   FIATQ
Sbjct  133  VALDNVNVNKNRYMDVLPFDETRVVLDSCKDYRPSVRGYINASFISTSSSKSLSKFIATQ  192

Query  576  GPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWI  755
            GPLP+T+EDFWEMV Q +CPAI+MLTRLVDNYK VKCGDYFQAEDG R+FGN+ + +KWI
Sbjct  193  GPLPHTYEDFWEMVFQYKCPAILMLTRLVDNYKMVKCGDYFQAEDGPRDFGNLIVVSKWI  252

Query  756  KTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSL  935
            K++++SLILR LEV++KESEE  ++VLH QY EWPDHGVP DTLA RE++KRL+ LPP L
Sbjct  253  KSSNSSLILRHLEVNHKESEE-SVAVLHIQYPEWPDHGVPNDTLAVREMLKRLYHLPPDL  311

Query  936  GPIVVHC  956
            G IVVHC
Sbjct  312  GRIVVHC  318



>ref|XP_008358192.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Malus domestica]
Length=374

 Score =   325 bits (833),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 178/333 (53%), Positives = 213/333 (64%), Gaps = 34/333 (10%)
 Frame = +3

Query  246   RLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINI  425
             R+ L+  Q   C+ ALK  K+K  + PE+I +E+  L A  +  S+   RC VAL+++N 
Sbjct  46    RVALTPQQHENCAFALKFFKDK-LRMPEQINREWDQLDAIYITQSEADKRCTVALNTLNF  104

Query  426   SKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDF  605
              KNRY + + FD NRVVL  C      A  YINAS IT     S FIATQGPL +TFE F
Sbjct  105   CKNRYDEYVAFDENRVVLKSCA---AGAGDYINASFITTPSSSSCFIATQGPLSHTFEAF  161

Query  606   WEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAED----GVREFGNICITTKWIKT----  761
             WEMVIQ RC  IVMLT L DN    KCGDYFQA+D      REFGNIC+ TKWI+     
Sbjct  162   WEMVIQYRCSVIVMLTDLDDN----KCGDYFQABDKDGXSSREFGNICVATKWIRGVGEF  217

Query  762   ---TDTSLILRCLEVSYKESEEPP-----------LSVLHFQYAEWPDHGVPKDTLATRE  899
                   SL+LR LEV    ++E             +SVLH QY +WPDHGVP+DT A R 
Sbjct  218   GDGNSDSLVLRLLEVKKNNNKEQSSDSDSEEPSPPMSVLHIQYPQWPDHGVPEDTFAVRG  277

Query  900   IVKRLHTLP----PSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIF  1067
             I+KR+        P  GPIVVHCSAG+GRTGTYC IH+T+QRIL GD SALDLV TIT F
Sbjct  278   ILKRVMYQEALAIPDCGPIVVHCSAGVGRTGTYCTIHDTLQRILSGDXSALDLVKTITTF  337

Query  1068  RSQRIGMVQTLEQYLFCYDAIIEELEDIIKEST  1166
             RSQR GMVQ  EQY FCYDAII+ELE++I + +
Sbjct  338   RSQRDGMVQKPEQYRFCYDAIIDELEELILDGS  370



>gb|AAG52227.1|AC021665_10 protein tyrosine phosphatase, 5'-partial; 235-1013 [Arabidopsis 
thaliana]
Length=169

 Score =   281 bits (720),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 127/169 (75%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +3

Query  675   TVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAE  854
             TVKCGDYFQ EDG REFGNI +TTKWIKTTDTSL+LR LEV+YKE+E+ P+SVLH QY E
Sbjct  1     TVKCGDYFQDEDGPREFGNISLTTKWIKTTDTSLMLRNLEVNYKETEDQPMSVLHIQYPE  60

Query  855   WPDHGVPKDTLATREIVKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMS  1034
             WPDHGVPKDT+A REI+KRL+ +PPSLGPI+VHCSAGIGRTGTYCAIHNTIQRIL GDMS
Sbjct  61    WPDHGVPKDTVAVREILKRLYQVPPSLGPIIVHCSAGIGRTGTYCAIHNTIQRILAGDMS  120

Query  1035  ALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQPSS  1181
             ALDL  T+ +FR QRIGMVQT++QY FCY+AI++ELED+   +    SS
Sbjct  121   ALDLAKTVALFRKQRIGMVQTMDQYFFCYNAIVDELEDLTAGTNAGTSS  169



>ref|XP_010237888.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like, partial [Brachypodium 
distachyon]
Length=440

 Score =   283 bits (723),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 151/317 (48%), Positives = 202/317 (64%), Gaps = 25/317 (8%)
 Frame = +3

Query  231   DSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCL---  401
             D+ PP   L+ DQ+++C  ALKV  EK+ + P  I QEF  LQ       D+R + L   
Sbjct  137   DAVPPPRTLTRDQVKHCKNALKVF-EKKLKDPAAISQEFRALQ-------DIRKQLLSTQ  188

Query  402   ---VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHV--SRFI  566
                VA +  N  +NRYTDVLPFD  R+ L        ++  YINASLI  ++    ++FI
Sbjct  189   KFTVAQNPANGERNRYTDVLPFDETRIKLQSSTGNETASNDYINASLIKRNDGSDQTKFI  248

Query  567   ATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITT  746
             +TQGPL NTFEDFW+MV +N CP IVMLT+    + +VKC +Y     G   +G   I  
Sbjct  249   STQGPLVNTFEDFWQMVFENSCPVIVMLTK----FDSVKCDEYLPLRKGQGAYGKFNI--  302

Query  747   KWIKTT-DTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTL  923
             K  KT  D  L+LR ++V   ES+    +VLH Q++ WPDHGVP D+   R+I+KRLH++
Sbjct  303   KITKTKHDGQLLLRMVKVHSNESDRV-HTVLHIQHSTWPDHGVPNDSKTVRDILKRLHSV  361

Query  924   PPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLE  1103
             P    PIV HCSAGIGRTG Y  IHNTI+RILLG+ +A+DL  T+  FRSQR GMVQT +
Sbjct  362   P-KEHPIVAHCSAGIGRTGAYITIHNTIERILLGEQTAMDLAETVRNFRSQRPGMVQTED  420

Query  1104  QYLFCYDAIIEELEDII  1154
             Q+ FCY A+++EL+D++
Sbjct  421   QFKFCYHAVVDELKDLV  437



>dbj|BAJ94079.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   280 bits (715),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 198/319 (62%), Gaps = 11/319 (3%)
 Frame = +3

Query  213   PFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
             PFD   D  PP L L+ +Q++ C +AL    E+R +  + +  EF  LQ  R    ++  
Sbjct  67    PFDIEAD--PPPLALTPEQIKLCKDALAHF-ERRSKQLDVLSDEFQLLQGMRTMHPELMK  123

Query  393   RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFI  566
                VA D+ N  KNRY DVLPFD  RV L      + S   YINAS +  +E   V+RFI
Sbjct  124   MSSVACDAANREKNRYIDVLPFDDTRVRLKSSATNQISGNDYINASFVKATEDNSVARFI  183

Query  567   ATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITT  746
             +TQGPL  TFEDFWEM+ +N+CP IVMLT+    + +VKC +Y   ++G   +G   +  
Sbjct  184   STQGPLVRTFEDFWEMICENQCPVIVMLTQ----FDSVKCDEYLPLQNGQGTYGKYNVKI  239

Query  747   KWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLP  926
                      L LR +EV   ES +   SVLH +Y +WPDHGVP +T A R I KRLH +P
Sbjct  240   MKDTRDKQQLCLRDVEVQCNESGKA-HSVLHIEYPDWPDHGVPTNTDAVRHIQKRLHHIP  298

Query  927   PSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQ  1106
                 PIV HCSAGIGRTG Y  IH++I+RILLGD+++ DLV T+  FRSQR GMVQT +Q
Sbjct  299   REH-PIVAHCSAGIGRTGAYITIHSSIERILLGDINSYDLVETVKKFRSQRTGMVQTEQQ  357

Query  1107  YLFCYDAIIEELEDIIKES  1163
             Y+FCY AI +EL+D+++ S
Sbjct  358   YMFCYRAIADELKDLLRSS  376



>dbj|BAJ98480.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=391

 Score =   280 bits (715),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 198/319 (62%), Gaps = 11/319 (3%)
 Frame = +3

Query  213   PFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
             PFD   D  PP L L+ +Q++ C +AL    E+R +  + +  EF  LQ  R    ++  
Sbjct  80    PFDIEAD--PPPLALTPEQIKLCKDALAHF-ERRSKQLDVLSDEFQLLQGMRTMHPELMK  136

Query  393   RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFI  566
                VA D+ N  KNRY DVLPFD  RV L      + S   YINAS +  +E   V+RFI
Sbjct  137   MSSVACDAANREKNRYIDVLPFDDTRVRLKSSATNQISGNDYINASFVKATEDNSVARFI  196

Query  567   ATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITT  746
             +TQGPL  TFEDFWEM+ +N+CP IVMLT+    + +VKC +Y   ++G   +G   +  
Sbjct  197   STQGPLVRTFEDFWEMICENQCPVIVMLTQ----FDSVKCDEYLPLQNGQGTYGKYNVKI  252

Query  747   KWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLP  926
                      L LR +EV   ES +   SVLH +Y +WPDHGVP +T A R I KRLH +P
Sbjct  253   MKDTRDKQQLCLRDVEVQCNESGKA-HSVLHIEYPDWPDHGVPTNTDAVRHIQKRLHHIP  311

Query  927   PSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQ  1106
                 PIV HCSAGIGRTG Y  IH++I+RILLGD+++ DLV T+  FRSQR GMVQT +Q
Sbjct  312   REH-PIVAHCSAGIGRTGAYITIHSSIERILLGDINSYDLVETVKKFRSQRTGMVQTEQQ  370

Query  1107  YLFCYDAIIEELEDIIKES  1163
             Y+FCY AI +EL+D+++ S
Sbjct  371   YMFCYRAIADELKDLLRSS  389



>gb|KJB35864.1| hypothetical protein B456_006G131400 [Gossypium raimondii]
Length=220

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/200 (65%), Positives = 159/200 (80%), Gaps = 4/200 (2%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F FS D  PP++ L+ DQ  YCSEALK+  +K  Q P++I +EF  LQANR+  S+M  R
Sbjct  22   FVFSADP-PPKISLTPDQFNYCSEALKLFSQK-LQMPDEINREFSHLQANRITPSEMMRR  79

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVS--EHVSRFIA  569
            C V  +  N+ KNRY+DV+PFD+NRVVL  CKDYR +A+GYINAS +T S  E++S+FIA
Sbjct  80   CTVGFNGANLDKNRYSDVIPFDTNRVVLYSCKDYRPAAKGYINASFVTTSSSENISKFIA  139

Query  570  TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
            TQGPLP+T+EDFWEMVIQ  CP IVMLTRLVDNYKTVKCGDYFQAE+  R+FGNICI TK
Sbjct  140  TQGPLPHTYEDFWEMVIQCHCPVIVMLTRLVDNYKTVKCGDYFQAENVPRQFGNICIDTK  199

Query  750  WIKTTDTSLILRCLEVSYKE  809
            WI+ T+TSL++R LEV+YKE
Sbjct  200  WIQETETSLLIRNLEVNYKE  219



>gb|EPS61126.1| hypothetical protein M569_13673, partial [Genlisea aurea]
Length=195

 Score =   268 bits (686),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/195 (65%), Positives = 153/195 (78%), Gaps = 0/195 (0%)
 Frame = +3

Query  225  SYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLV  404
            S DS+  R  LS++QLRYC EAL+  K KRF +P+ IR EF  +QANR+ A DM++ C V
Sbjct  1    SLDSELLRPPLSAEQLRYCREALEFYKNKRFNSPQAIRHEFQIMQANRLMAWDMKNLCTV  60

Query  405  ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
            A  + N+SKNRY+D++PFDSNRVVL    DYR SA+GYINAS +  SE V++FIATQGPL
Sbjct  61   ARHNQNLSKNRYSDIVPFDSNRVVLKQSSDYRSSAKGYINASFVKSSESVTQFIATQGPL  120

Query  585  PNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTT  764
            P+T EDFWEM+IQ RCPAIVMLTRLVD+Y+  KC DYFQAE+G R +G ICITTKW+  T
Sbjct  121  PHTCEDFWEMIIQYRCPAIVMLTRLVDSYRAEKCADYFQAENGPRSYGGICITTKWMHKT  180

Query  765  DTSLILRCLEVSYKE  809
             +SLILRCLEV YKE
Sbjct  181  SSSLILRCLEVKYKE  195



>dbj|BAK00963.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=369

 Score =   274 bits (700),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 151/320 (47%), Positives = 204/320 (64%), Gaps = 16/320 (5%)
 Frame = +3

Query  213   PFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
             P D + D  PP  VL+ DQ+++C  ALKV  +K+ + P  I ++FG L A R  +  +  
Sbjct  61    PLDPTAD--PPARVLTPDQVKHCKTALKVF-DKKLKKPAAIFEDFGGLPAIRT-SLQLAQ  116

Query  393   RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFI  566
             +  VA    N  +NRYTDVL FD  R+ L        S+  YINASLI     +H+ +FI
Sbjct  117   KFTVARSPANRERNRYTDVLAFDETRIKLQSSTGSLTSSNDYINASLIKYDDKDHI-KFI  175

Query  567   ATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITT  746
             +TQGPL NTFEDFW+MV +N CP IVMLT+    +  VKC +Y        ++G + I  
Sbjct  176   STQGPLVNTFEDFWQMVFENSCPVIVMLTK----FDIVKCDEYLPLSKSQEDYGRLNI--  229

Query  747   KWIKT-TDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTL  923
             K ++T  D  L LR ++V +KES+    +VLH Q++ WPDHGVP D+   R+I+KRL+ +
Sbjct  230   KIVETRQDGELTLRSVKVQHKESDRV-HTVLHIQHSTWPDHGVPNDSSTVRKILKRLYYV  288

Query  924   PPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLE  1103
                  PIV HCSAGIGRTG Y  IHNT++RIL GD +A +LV T+  FRSQR G+VQT E
Sbjct  289   GKDH-PIVAHCSAGIGRTGAYITIHNTVERILRGDQAATNLVETVGKFRSQRPGIVQTEE  347

Query  1104  QYLFCYDAIIEELEDIIKES  1163
             QY FCY AI++EL+D+I+ S
Sbjct  348   QYKFCYHAIVDELKDLIRNS  367



>gb|EMT13080.1| Tyrosine-protein phosphatase non-receptor type 20 [Aegilops tauschii]
Length=296

 Score =   266 bits (680),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 144/302 (48%), Positives = 194/302 (64%), Gaps = 12/302 (4%)
 Frame = +3

Query  264   DQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYT  443
             DQ+++C  ALKVL +K  + P  I  +F  L A R  +  +  +  VA    N  +NRYT
Sbjct  3     DQVKHCKTALKVL-DKTLKKPAAIFDDFRGLPAIRT-SLQLAQKFTVARSPANRERNRYT  60

Query  444   DVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH-VSRFIATQGPLPNTFEDFWEMVI  620
             DVLPFD  R+ L      + S+  YINASLI   +   ++FI+TQGPL NTFEDFW+MV 
Sbjct  61    DVLPFDETRIKLQSSTGNQTSSNDYINASLIKYDDKDQTKFISTQGPLVNTFEDFWQMVF  120

Query  621   QNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKT-TDTSLILRCLEV  797
             +N CP IVMLT+    +  VKC +Y     G  ++G + I  K ++T  D  L LR ++V
Sbjct  121   ENSCPVIVMLTK----FDIVKCDEYLPLSKGQGDYGRLNI--KIMETRQDGELTLRSVKV  174

Query  798   SYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVHCSAGIGRT  977
              + ES+    +VLH Q++ WPDHGVP D+   R+I+KRL+ +P    P+V HCSAGIGRT
Sbjct  175   QHNESDRVH-TVLHIQHSTWPDHGVPDDSSTVRKILKRLYYIPKE-HPVVAHCSAGIGRT  232

Query  978   GTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIK  1157
             G Y  IHNT++RIL G+ +A +LV T+  FRSQR GMVQT EQY FCY AI +EL+D+I+
Sbjct  233   GAYITIHNTVERILRGEQAATNLVETVGKFRSQRPGMVQTEEQYKFCYHAIADELKDLIR  292

Query  1158  ES  1163
              S
Sbjct  293   NS  294



>ref|XP_002442903.1| hypothetical protein SORBIDRAFT_08g004710 [Sorghum bicolor]
 gb|EES16741.1| hypothetical protein SORBIDRAFT_08g004710 [Sorghum bicolor]
Length=335

 Score =   268 bits (684),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 154/317 (49%), Positives = 195/317 (62%), Gaps = 19/317 (6%)
 Frame = +3

Query  210   QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
              PFD   D  PPR  LS +Q+  CS+AL   ++K  + P+ +  E+  L   R   +   
Sbjct  32    NPFDVDTDP-PPRPELSPEQIGLCSDALARFEDK-GKRPDGLSDEYRKLSGIRHMKT---  86

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH--VSRF  563
                 VA   +N  KNRY DVLPFD  RV L+     R     YINAS I  +E+  V+ F
Sbjct  87    --ISVAHYPVNRGKNRYIDVLPFDDTRVRLSA----RPPNNDYINASFIKATENNRVAPF  140

Query  564   IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICIT  743
             I+TQGPL  TF DFWEMV + +CPAIVMLT+    + ++KC  Y   E G +++GN  I 
Sbjct  141   ISTQGPLVKTFGDFWEMVHEYQCPAIVMLTQ----FDSIKCDKYLPLESGRQKYGNYDIK  196

Query  744   TKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTL  923
                 +T    L LR ++V   ES E   SVLH  Y +WPDHGVP +T A R+I KRLH +
Sbjct  197   ITKTRTDSHHLQLRDVKVQNNESGEV-HSVLHIVYPDWPDHGVPTNTDAVRQIWKRLHHI  255

Query  924   PPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLE  1103
             P +  PIV+HCSAGIGRTG Y  IH TI+RILLGD S+ DLV T+  FRSQR GMVQT E
Sbjct  256   P-TEHPIVIHCSAGIGRTGAYITIHTTIERILLGDKSSYDLVETVKNFRSQRTGMVQTEE  314

Query  1104  QYLFCYDAIIEELEDII  1154
             QY FCY AI +EL+D++
Sbjct  315   QYKFCYQAIADELKDLL  331



>ref|XP_010239266.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Brachypodium 
distachyon]
Length=592

 Score =   273 bits (698),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 148/316 (47%), Positives = 203/316 (64%), Gaps = 11/316 (3%)
 Frame = +3

Query  240   PPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSI  419
             PP  +++ DQ++ C +ALKVL +K+ +    I QEF +L A  +R + +  +  VA    
Sbjct  280   PPPQMITPDQVKRCKKALKVL-DKKLRQRATILQEFRSLPA--IRTALLTQKFSVARSPA  336

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV-SEHVSRFIATQGPLPNTF  596
             N  KN YTDVLPFD  R+ L        +   YINAS   + + + ++FI+TQGPL NTF
Sbjct  337   NREKNCYTDVLPFDETRIRLQSSTGNHTAKNDYINASPTKLDNRNQTKFISTQGPLVNTF  396

Query  597   EDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSL  776
             EDFW+MV +N CP IVM+T+    +  VKC +Y    +G  ++G  CI    I+  D  L
Sbjct  397   EDFWQMVFENCCPVIVMITK----FDNVKCDEYLPLSEGEGDYGRFCIKIMKIRM-DGQL  451

Query  777   ILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLG-PIVVH  953
             +LR L+V   ES+    +VLH QY+EWPDHGVP D+   R+I+KRLH +    G PIVVH
Sbjct  452   VLRSLKVQCNESDRF-TTVLHIQYSEWPDHGVPNDSSVVRKIMKRLHHIKSRRGFPIVVH  510

Query  954   CSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAII  1133
              SAG+GRTG Y  IHNTI+RILLG+  ALD+V T+  FRSQR G+VQT EQ +FCY AI+
Sbjct  511   GSAGLGRTGAYITIHNTIERILLGEQDALDVVETVRKFRSQRAGVVQTEEQLMFCYKAIV  570

Query  1134  EELEDIIKESTGQPSS  1181
             +EL+++++ S    SS
Sbjct  571   DELKELVQNSPVPSSS  586



>ref|XP_006301380.1| hypothetical protein CARUB_v10021792mg, partial [Capsella rubella]
 gb|EOA34278.1| hypothetical protein CARUB_v10021792mg, partial [Capsella rubella]
Length=383

 Score =   266 bits (679),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 139/257 (54%), Positives = 164/257 (64%), Gaps = 54/257 (21%)
 Frame = +3

Query  543   SEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVRE  722
             SE +S+FIATQGPLP+T EDFWEMVIQ+ CP IVMLTRLVDNYKTVKCGDYFQAEDG+RE
Sbjct  117   SESISQFIATQGPLPHTMEDFWEMVIQHHCPVIVMLTRLVDNYKTVKCGDYFQAEDGLRE  176

Query  723   FGNICITTKWIKTTDTSLILRCLEVSYKES----EEPPLSVLHFQYAEWPDHGVPKDTLA  890
             FGNI + TKWIKTTDTSL+LR LEV  KE     +   + +   +++ +        TL 
Sbjct  177   FGNIAVMTKWIKTTDTSLMLRNLEVKNKEVRILYKFTSVYISRIKFSLYGSSMFHTTTLC  236

Query  891   TREIVK----------------------RLHTLPPSLGPIVVHC----------------  956
              R+ +                        L+ +PPSLGPI+VHC                
Sbjct  237   FRQRISPCPFCIFSIQSGLIMEFPGIQWLLYQVPPSLGPIIVHCRYTMHVNERTCRQIVI  296

Query  957   ------------SAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTL  1100
                         SAGIGRTGTYCAIHNTIQRIL GDMSALDL  T+  FRSQRIGMVQT+
Sbjct  297   QRFLREHCFVFLSAGIGRTGTYCAIHNTIQRILAGDMSALDLAKTVATFRSQRIGMVQTM  356

Query  1101  EQYLFCYDAIIEELEDI  1151
             +QY FCY AI++ELED+
Sbjct  357   DQYFFCYTAIVDELEDL  373



>ref|XP_008454605.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X3 
[Cucumis melo]
Length=238

 Score =   257 bits (656),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 158/202 (78%), Gaps = 4/202 (2%)
 Frame = +3

Query  210  QPFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMR  389
             PF FS DS PP L L+  Q++ CS+AL+   + R Q P+ I QEF  LQA R+ ASDMR
Sbjct  16   NPFIFSPDS-PPTLALTPHQIKLCSQALEAFTD-RLQKPDVINQEFARLQAKRITASDMR  73

Query  390  SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSR--F  563
              C VALD++N++KNRY DVLPFD  RVVL+ CKDYR SARGYINAS I+ S   S   F
Sbjct  74   RSCSVALDNVNVNKNRYMDVLPFDETRVVLDSCKDYRPSARGYINASFISTSSSKSLSKF  133

Query  564  IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICIT  743
            IATQGPLP+T+EDFWEMV Q +CPAI+MLTRLVDNYK VKCGDYFQAEDG R+FGN+ + 
Sbjct  134  IATQGPLPHTYEDFWEMVFQYKCPAILMLTRLVDNYKMVKCGDYFQAEDGPRDFGNLIVV  193

Query  744  TKWIKTTDTSLILRCLEVSYKE  809
            +KWIK++++SLILR LEV++KE
Sbjct  194  SKWIKSSNSSLILRHLEVNHKE  215



>ref|NP_001149088.1| receptor-type tyrosine-protein phosphatase S [Zea mays]
 gb|ACG34138.1| receptor-type tyrosine-protein phosphatase S precursor [Zea mays]
Length=351

 Score =   256 bits (655),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 150/316 (47%), Positives = 193/316 (61%), Gaps = 15/316 (5%)
 Frame = +3

Query  213   PFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
             PFD   D  P RL L+ +Q+  C +AL    E + +  + +  EF +L  + +R     S
Sbjct  45    PFDVDTDP-PSRLELTPEQIGLCVDALAHF-EYKGKRRDDLSDEFRSLSVSDIRHMKTIS  102

Query  393   RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH--VSRFI  566
                VA   +N  KNRY DVLPFD+ RV L      R     YINAS I  +E+  V+ FI
Sbjct  103   ---VAHYPVNREKNRYIDVLPFDNTRVQLKSSA--RPPNNDYINASFIKATENNRVATFI  157

Query  567   ATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITT  746
             +TQGPL  TF DFWEMV + +CPAIVMLT    ++ ++KC  Y       R +GN  I  
Sbjct  158   STQGPLVKTFGDFWEMVFEYQCPAIVMLT----HFDSIKCDKYLPPGSERRTYGNYDIKI  213

Query  747   KWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLP  926
                +T    L LR ++V   E+ +   SVLH +Y +WPDHGV  +T A REI KRLH +P
Sbjct  214   TKTRTDSHHLQLRDVKVQNIETGKV-HSVLHIEYPDWPDHGVATNTDAVREIWKRLHHIP  272

Query  927   PSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQ  1106
              +  PIV+HCSAGIGRTGTY  IH TI+RILLGD S+ DL  T+  FRSQR GMVQT EQ
Sbjct  273   -TEHPIVIHCSAGIGRTGTYITIHTTIERILLGDKSSYDLAKTVKNFRSQRPGMVQTEEQ  331

Query  1107  YLFCYDAIIEELEDII  1154
             Y FCY AI++EL+D++
Sbjct  332   YKFCYRAIVDELKDLL  347



>ref|XP_008461479.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X3 
[Cucumis melo]
Length=311

 Score =   253 bits (645),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/198 (64%), Positives = 154/198 (78%), Gaps = 4/198 (2%)
 Frame = +3

Query  222  FSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCL  401
            FS DS PP L L   Q++ CS+AL+   +K  Q P+ I QEF  LQA R+ ASDMR  C 
Sbjct  75   FSPDS-PPTLALKPHQIKLCSQALEAFTDK-LQKPDVINQEFARLQAKRITASDMRRSCS  132

Query  402  VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSR--FIATQ  575
            VALD++N++KNRY DVLPFD  RVVL+ CKDYR S RGYINAS I+ S   S   FIATQ
Sbjct  133  VALDNVNVNKNRYMDVLPFDETRVVLDSCKDYRPSVRGYINASFISTSSSKSLSKFIATQ  192

Query  576  GPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWI  755
            GPLP+T+EDFWEMV Q +CPAI+MLTRLVDNYK VKCGDYFQAEDG R+FGN+ + +KWI
Sbjct  193  GPLPHTYEDFWEMVFQYKCPAILMLTRLVDNYKMVKCGDYFQAEDGPRDFGNLIVVSKWI  252

Query  756  KTTDTSLILRCLEVSYKE  809
            K++++SLILR LEV++KE
Sbjct  253  KSSNSSLILRHLEVNHKE  270



>ref|XP_002326005.2| hypothetical protein POPTR_0019s11590g, partial [Populus trichocarpa]
 gb|EEF00387.2| hypothetical protein POPTR_0019s11590g, partial [Populus trichocarpa]
Length=216

 Score =   248 bits (632),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 130/267 (49%), Positives = 163/267 (61%), Gaps = 54/267 (20%)
 Frame = +3

Query  360   ANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLIT  539
             A+ +  S M   C VA+DS+N++KNRY DV+P          C      +    N     
Sbjct  1     ASEITPSQMARSCKVAVDSVNVNKNRYLDVVP----------CLQELLLSSSSEN-----  45

Query  540   VSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVR  719
                 +SRFIATQGPLP+T+EDFWEM+I + CP IVMLTRLVDNY+TVKCGDYFQAEDG R
Sbjct  46    ----ISRFIATQGPLPHTYEDFWEMIILHHCPVIVMLTRLVDNYETVKCGDYFQAEDGPR  101

Query  720   EFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATRE  899
             +FGNI   TKW+KTTDTSL+LR L+V YKE+EE P+ VLH QY EWPDHGV  +T A RE
Sbjct  102   DFGNISFVTKWVKTTDTSLLLRSLDVGYKEAEESPMCVLHIQYPEWPDHGVSTNTNAVRE  161

Query  900   IVKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQR  1079
             I++R + +PPSLGP++                           +S L L N +       
Sbjct  162   ILRRAYHMPPSLGPVMYS-----------------------SQLSLLTLFNFV-------  191

Query  1080  IGMVQTLEQYLFCYDAIIEELEDIIKE  1160
                    EQ +FCY+AII+ELED+I E
Sbjct  192   -----HWEQNIFCYEAIIDELEDLISE  213



>gb|ACF86150.1| unknown [Zea mays]
 tpg|DAA55534.1| TPA: receptor-type tyrosine-protein phosphatase S [Zea mays]
Length=351

 Score =   249 bits (637),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 148/316 (47%), Positives = 190/316 (60%), Gaps = 15/316 (5%)
 Frame = +3

Query  213   PFDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRS  392
             PFD   D  P R  L+ +Q+  C +AL    E + +  + +  EF +L  + +R     S
Sbjct  45    PFDVDTDP-PSRPELTPEQIGLCVDALAHF-EYKGKRRDDLSDEFRSLSVSDIRHMKTIS  102

Query  393   RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH--VSRFI  566
                VA   +N  KNRY DVLPFD  RV L      R     YINAS I  +E+  V+ FI
Sbjct  103   ---VAHYPVNREKNRYIDVLPFDDTRVQLKSSA--RPPNNDYINASFIKATENNRVATFI  157

Query  567   ATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITT  746
             +TQGPL  TF DFWEMV + +CPAIVMLT    ++ ++KC  Y       R +G+  I  
Sbjct  158   STQGPLVKTFGDFWEMVFEYQCPAIVMLT----HFDSIKCDKYLPLGSERRTYGDYDIKI  213

Query  747   KWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLP  926
                +T    L LR ++V   E+ +   SVLH +Y +WPDHGV  +T A REI KRLH +P
Sbjct  214   TKTRTDSHHLQLRDVKVQNIETGKV-HSVLHIEYPDWPDHGVATNTDAVREIWKRLHHIP  272

Query  927   PSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQ  1106
              +  PIV+HCSAGIGRTGTY  IH TI+RILLGD S+ DL  T+  FRSQR GMVQT EQ
Sbjct  273   -TEHPIVIHCSAGIGRTGTYITIHTTIERILLGDKSSYDLAKTVKNFRSQRPGMVQTEEQ  331

Query  1107  YLFCYDAIIEELEDII  1154
             Y FCY AI +EL+D++
Sbjct  332   YKFCYRAIADELKDLL  347



>gb|KGN44430.1| hypothetical protein Csa_7G290530 [Cucumis sativus]
Length=310

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 153/200 (77%), Gaps = 4/200 (2%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
            F FS DS PP L+L+  Q++ CS+AL+   +K  Q P+ I QEF  LQA R+ AS M  R
Sbjct  62   FIFSPDS-PPTLLLTPHQIKLCSQALEAFTDK-LQKPDVINQEFARLQAKRITASGMGRR  119

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSR--FIA  569
            C VALD +N+ KNRY DVLPFD  RVVL+ CKDYR SARGYINAS I+ S   S   FIA
Sbjct  120  CSVALDKVNVYKNRYMDVLPFDETRVVLDSCKDYRPSARGYINASFISTSSSKSLSKFIA  179

Query  570  TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK  749
            TQGPLP+T+EDFWEMV Q +CPAI+MLTRLVDNYK  KCGDYFQAEDG R+FGN+ + +K
Sbjct  180  TQGPLPHTYEDFWEMVFQYKCPAILMLTRLVDNYKIDKCGDYFQAEDGPRDFGNLIVVSK  239

Query  750  WIKTTDTSLILRCLEVSYKE  809
            WIK++++SLILR LEV +KE
Sbjct  240  WIKSSNSSLILRHLEVIHKE  259



>ref|XP_010238660.1| PREDICTED: protein-tyrosine-phosphatase PTP1 [Brachypodium distachyon]
Length=262

 Score =   245 bits (626),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 137/263 (52%), Positives = 176/263 (67%), Gaps = 14/263 (5%)
 Frame = +3

Query  387   RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSR  560
             R+R  VA D+ N+ KNRY DVLP+D NRV L      + S+  YINAS I  +E    +R
Sbjct  9     RNRFNVACDATNMGKNRYIDVLPYDDNRVRLKLSTS-QISSNDYINASFIKATEDNRSTR  67

Query  561   FIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFG--NI  734
             FI+TQGPL  TFEDFWEMV +N+C  IVMLT+    + +VKC +Y    +G   +G  N+
Sbjct  68    FISTQGPLVKTFEDFWEMVCENQCRVIVMLTQ----FDSVKCDEYLPLLNGQDVYGKYNV  123

Query  735   CITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRL  914
              IT K        L LR ++V   ES++   SVLH +Y +WPDHGVP  T A R+I KRL
Sbjct  124   EITKK---RYCHQLWLRDVKVQCNESDKIH-SVLHIEYPDWPDHGVPTSTDAVRQIRKRL  179

Query  915   HTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQ  1094
             H +     PIVVHCSAGIGRTG Y  IH+TI+RILLGD S+ DLV T+  FRSQR GMVQ
Sbjct  180   HNVREE-HPIVVHCSAGIGRTGAYITIHSTIERILLGDTSSYDLVETVKKFRSQRNGMVQ  238

Query  1095  TLEQYLFCYDAIIEELEDIIKES  1163
             T +QY+FC+ AI++EL+D++K +
Sbjct  239   TEDQYMFCFRAIVDELKDLLKSN  261



>ref|XP_001774836.1| predicted protein [Physcomitrella patens]
 gb|EDQ60377.1| predicted protein [Physcomitrella patens]
Length=272

 Score =   244 bits (624),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 122/260 (47%), Positives = 171/260 (66%), Gaps = 6/260 (2%)
 Frame = +3

Query  390   SRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH--VSRF  563
             S   VA+ S N +KNRY DVLP+D  RV+L+  + Y  +   YINAS +  + H  + R+
Sbjct  8     SSTTVAVMSNNRAKNRYIDVLPYDITRVILDK-RHYDPTCSDYINASFVQDNAHEDLPRY  66

Query  564   IATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKC--GDYF-QAEDGVREFGNI  734
             IATQGPLP+T  DFW MV+Q RCP I+ML  +VD  +  K     YF ++E+    FG+I
Sbjct  67    IATQGPLPSTVSDFWTMVLQQRCPVIIMLVGVVDGDQVSKSKYAHYFPRSENQSETFGHI  126

Query  735   CITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRL  914
              +  K +  +   +  R  EV   +S EPP+++ H++Y EW D+GVP  T +  E+++  
Sbjct  127   VVLNKKMSHSQHGITRRVFEVKDIKSPEPPMTLAHYEYLEWSDYGVPDSTRSVCELIRAS  186

Query  915   HTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQ  1094
               +PPS GP VVHCSAGIGRTGTYC I +T++RI+ GD+ A+D+ NT+  FRSQR GMVQ
Sbjct  187   FCIPPSAGPFVVHCSAGIGRTGTYCTIDHTLRRIMEGDLEAVDIGNTVRNFRSQRHGMVQ  246

Query  1095  TLEQYLFCYDAIIEELEDII  1154
             T +QY FCY+ +I+ELE  +
Sbjct  247   TRDQYRFCYEVVIKELESYV  266



>ref|XP_009363145.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Pyrus x bretschneideri]
Length=428

 Score =   249 bits (635),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 139/274 (51%), Positives = 172/274 (63%), Gaps = 34/274 (12%)
 Frame = +3

Query  246  RLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINI  425
            R+ L+  Q   C+ ALK  K+K  + PE+I +E+  L A  +  S+   RC VAL+++N 
Sbjct  46   RVALTPQQHENCAFALKFFKDK-LRMPEQINREWDQLDAIYITQSEAEKRCTVALNTLNF  104

Query  426  SKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDF  605
             KNRY + + FD NRVVLN C     +A  YINAS I      S FI TQGPL +T E F
Sbjct  105  CKNRYDEYVGFDENRVVLNSC-----TAGDYINASFIATPSSSSCFIVTQGPLSHTLEAF  159

Query  606  WEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAE--DGV--REFGNICITTKWIK-----  758
            WEMVIQNRC  IVMLT L DN    KCGDYFQA+  DGV  R+FGNIC+ TKWI+     
Sbjct  160  WEMVIQNRCSVIVMLTDLDDN----KCGDYFQADDNDGVSSRDFGNICVATKWIRGVGEF  215

Query  759  --TTDTSLILRCLEVSYK---------ESEEPPLSVLHFQYAEWPDHGVPKDTLATREIV  905
                  SL+LR LEV  K         +   PP+SVLH QY +WPDHGVPKDT A R I+
Sbjct  216  GDGNSDSLVLRLLEVKKKINKSSDSNSKEPSPPMSVLHIQYPQWPDHGVPKDTFAVRGIL  275

Query  906  KR-LHTLPPSL---GPIVVHCSAGIGRTGTYCAI  995
            KR ++ +  ++   GPIVVHCSAG+GRTGTYC +
Sbjct  276  KRVMYQVALAISECGPIVVHCSAGVGRTGTYCTV  309



>ref|XP_006662779.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Oryza brachyantha]
Length=289

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/260 (50%), Positives = 173/260 (67%), Gaps = 13/260 (5%)
 Frame = +3

Query  402   VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV---SEHVSRFIAT  572
              AL+  N  KNRY+DV+PFD+ RV L      R S   YINAS I +   ++  ++FI+T
Sbjct  35    AALNPANREKNRYSDVMPFDATRVRLKSSTGDRPSRNDYINASHIKIDSRNKSQTQFIST  94

Query  573   QGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREF-GNICI-TT  746
             QGPL  TFEDFW+MV +N+C  IVMLT+    +   KC  Y   + G   + G + + TT
Sbjct  95    QGPLIKTFEDFWQMVYENQCSVIVMLTK----FDGAKCDGYLPMDKGEEGYYGKLSVKTT  150

Query  747   KWIKTTDTSLILRCLEVSYKESEEPPLS-VLHFQYAEWPDHGVPKDTLATREIVKRLHTL  923
             ++ K  D  L+LR LE+  +++E   +  VLH QY+EWPDHGVP  + + R+I++RL+ +
Sbjct  151   QYRK--DGDLVLRGLELEVQQNESRIVRRVLHIQYSEWPDHGVPYHSASVRQILRRLYDI  208

Query  924   PPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLE  1103
             P    P+V HCSAGIGRTG Y  IHNTI+RIL GDMSALDL  T+T FRSQR GMVQT +
Sbjct  209   PRE-HPVVAHCSAGIGRTGAYITIHNTIERILSGDMSALDLSETVTKFRSQRPGMVQTED  267

Query  1104  QYLFCYDAIIEELEDIIKES  1163
             QY FCY AI++EL D++  S
Sbjct  268   QYKFCYTAIVDELNDLLPNS  287



>ref|XP_002450425.1| hypothetical protein SORBIDRAFT_05g005210 [Sorghum bicolor]
 gb|EES09413.1| hypothetical protein SORBIDRAFT_05g005210 [Sorghum bicolor]
Length=526

 Score =   250 bits (639),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 144/303 (48%), Positives = 189/303 (62%), Gaps = 21/303 (7%)
 Frame = +3

Query  267   QLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTD  446
             ++R+C +ALK L E +   P K+ +EF +L   R      + +  VA    N  +NRYTD
Sbjct  239   EVRHCKKALKAL-ENKLGKPAKLAKEFYSLPDIRTELQSAQ-KFSVARKQENRGRNRYTD  296

Query  447   VLPFDSNRVVLNPCKDYRQSARG--YINASLITVS-EHVSRFIATQGPLPNTFEDFWEMV  617
             VLPFD  RV L       QS+ G  YINAS I ++  ++++FI+TQGPL NT E+FW+MV
Sbjct  297   VLPFDRTRVRL-------QSSTGNDYINASHIEIAGRNLTKFISTQGPLANTIENFWQMV  349

Query  618   IQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICIT-TKWIKTTDTSLILRCLE  794
               N CP IVMLT+    +  +KC +Y     G   FG   I  TK+ K  D  L+LR +E
Sbjct  350   YDNHCPVIVMLTK----FDGLKCDEYLPLSKGEDIFGKFTIKITKFRK--DGQLVLRGVE  403

Query  795   VSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVHCSAGIGR  974
             +   ES+E   S+LH +Y EWPDHGVP  +   R I+KRL+ +P    PIV HCSAGIGR
Sbjct  404   IRRDESDEV-RSLLHIEYPEWPDHGVPNGSADVRRILKRLYHIPREW-PIVAHCSAGIGR  461

Query  975   TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  1154
             TG Y  IHNTI+RIL G+  A+DLV T+  FRSQR GMVQT EQY  C+ AI +EL+D++
Sbjct  462   TGAYITIHNTIERILRGEQEAVDLVETVKKFRSQRPGMVQTEEQYKCCHQAIRDELKDLV  521

Query  1155  KES  1163
               S
Sbjct  522   SSS  524



>ref|XP_004977238.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like [Setaria italica]
Length=259

 Score =   242 bits (617),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 131/256 (51%), Positives = 161/256 (63%), Gaps = 8/256 (3%)
 Frame = +3

Query  384   MRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVS  557
             +  R  VA   +N  KNRY DVLPFD  RV L        S   YINAS I  +E   V+
Sbjct  3     LMKRISVAHYPVNREKNRYIDVLPFDDTRVKLKSTTTSLTSNNDYINASFIKATEDNSVA  62

Query  558   RFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNIC  737
              FI TQGPL NTFEDFWEMV Q +CPAIVM+T+    + +VKC  Y    +G   +G   
Sbjct  63    TFICTQGPLVNTFEDFWEMVYQYQCPAIVMVTQ----FDSVKCDKYLPLHNGRGAYGKYN  118

Query  738   ITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLH  917
             +     +  +  L LR ++V  KES +   SVLH +Y +WPDHGVP +T A R+I KRLH
Sbjct  119   VKIMKKRKDNHQLWLRNVQVQNKESGKVH-SVLHIEYPDWPDHGVPTNTDAVRQIWKRLH  177

Query  918   TLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQT  1097
              +P +  PIVVHCSAGIGRTGTY  IH  I+RILLGD  + D+V T+  FRSQR GMVQT
Sbjct  178   HIP-TEHPIVVHCSAGIGRTGTYITIHTAIERILLGDKRSYDIVKTVKNFRSQRPGMVQT  236

Query  1098  LEQYLFCYDAIIEELE  1145
              +QY FCY  I +EL+
Sbjct  237   EQQYKFCYQVIADELK  252



>ref|XP_002966338.1| hypothetical protein SELMODRAFT_66231, partial [Selaginella moellendorffii]
 gb|EFJ32365.1| hypothetical protein SELMODRAFT_66231, partial [Selaginella moellendorffii]
Length=299

 Score =   243 bits (620),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 129/301 (43%), Positives = 181/301 (60%), Gaps = 7/301 (2%)
 Frame = +3

Query  255   LSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKN  434
             L+  ++  C EA   +  K  + PE I +EF +L+ + +   ++  +   A  +   +K+
Sbjct  4     LTPAEIAACKEAFDAINWK-LETPESIYREFSSLRLSSLPKRELIGKFKAAASNACYNKD  62

Query  435   RYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEM  614
             RY+DVLPFD  RV+L   K   +S   YINA+ +        FIATQGPL  T  DFWEM
Sbjct  63    RYSDVLPFDETRVILRKTK---ESDSDYINANFVESPAFGHSFIATQGPLKTTIADFWEM  119

Query  615   VIQNRCPAIVMLTRLVDNYKTVKCGDYFQ-AEDGVREFGNICITTKWIKTTDTSLILRCL  791
             V+Q RCPAI+MLT LV      KC  YF  A +  + +G + +T K +  +  S+  R  
Sbjct  120   VMQQRCPAIIMLTSLVHG-SLDKCAPYFPPAANEQQVYGRLRVTNKGLGHSSHSITKRVF  178

Query  792   EVSYKE-SEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVHCSAGI  968
             EV   E ++EPPL VLH +Y  WPDHGVP  T   RE+ + + T+P   GPIVVHCSAGI
Sbjct  179   EVQPVELTQEPPLCVLHLEYLHWPDHGVPAYTRPIRELYRCISTIPDDAGPIVVHCSAGI  238

Query  969   GRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELED  1148
             GR+G Y  I  T++RIL GD++A++L +T+   R  R GMVQT  QY F Y A+++EL+D
Sbjct  239   GRSGAYIGIDQTLRRILKGDLTAVNLQDTVMRLRDHRYGMVQTKAQYHFIYAAVLDELQD  298

Query  1149  I  1151
             +
Sbjct  299   L  299



>ref|NP_001066289.1| Os12g0174800 [Oryza sativa Japonica Group]
 gb|ABA96591.1| Protein-tyrosine phosphatase containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|ABA96592.1| Protein-tyrosine phosphatase containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF29308.1| Os12g0174800 [Oryza sativa Japonica Group]
 gb|EAZ19814.1| hypothetical protein OsJ_35396 [Oryza sativa Japonica Group]
 dbj|BAG89053.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97724.1| unnamed protein product [Oryza sativa Japonica Group]
Length=328

 Score =   243 bits (621),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 139/314 (44%), Positives = 187/314 (60%), Gaps = 18/314 (6%)
 Frame = +3

Query  237   QPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANR---MRASDMRSRCLVA  407
             +PP   L+ +Q+  C EAL+   E     PE +  EF  LQ  R   MR+S+       A
Sbjct  27    EPPPPALTPEQVGLCREALEYF-EGMCGRPEAMSDEFRRLQDTRHELMRSSNE------A  79

Query  408   LDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIATQGP  581
              ++ N  KNRY DV+PFD+ RV L      + S+  YINAS I V+E   V++FI+TQGP
Sbjct  80    RNAANREKNRYIDVVPFDTTRVRLKRSTTSQTSSNDYINASFIKVTEDNRVAKFISTQGP  139

Query  582   LPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKT  761
             L  TF+DFWEMV + +CP IVMLT+    + ++KC +Y         +G   +     K 
Sbjct  140   LAKTFDDFWEMVYEYQCPVIVMLTQ----FDSLKCDEYLPLRKQREAYGKYNVKITNAKR  195

Query  762   TDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGP  941
                 L LR + V   ES     SV H +Y +WPDHGVP +T A R+I K L   P    P
Sbjct  196   DSHQLWLRDVMVQCNESSRV-HSVRHIEYPDWPDHGVPTNTDAVRQIRKWLQNTPME-HP  253

Query  942   IVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCY  1121
             IVVHCSAGIGRTG Y  IH+TI+R+LLGD S+  L  T+   R+QR+GMVQT +QY+FCY
Sbjct  254   IVVHCSAGIGRTGAYITIHSTIERLLLGDKSSYHLDETVKTLRTQRVGMVQTEKQYMFCY  313

Query  1122  DAIIEELEDIIKES  1163
              AI +EL+D+++ +
Sbjct  314   RAIADELKDLLESN  327



>ref|XP_002978222.1| hypothetical protein SELMODRAFT_56201, partial [Selaginella moellendorffii]
 gb|EFJ20879.1| hypothetical protein SELMODRAFT_56201, partial [Selaginella moellendorffii]
Length=299

 Score =   242 bits (618),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 129/301 (43%), Positives = 181/301 (60%), Gaps = 7/301 (2%)
 Frame = +3

Query  255   LSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKN  434
             L+  ++  C EA   +  K  + PE I +EF +L+ + +   ++  +   A  +   +K+
Sbjct  4     LTPAEIAACKEAFDAINWK-LERPESIYREFSSLRLSSLPKRELIGKFKAAASNACYNKD  62

Query  435   RYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEM  614
             RY+DVLPFD  RV+L   K   +S   YINA+ +        FIATQGPL  T  DFWEM
Sbjct  63    RYSDVLPFDETRVILRKTK---ESDSDYINANFVESPAFGHSFIATQGPLKTTIADFWEM  119

Query  615   VIQNRCPAIVMLTRLVDNYKTVKCGDYFQ-AEDGVREFGNICITTKWIKTTDTSLILRCL  791
             V+Q RCPAI+MLT LV      KC  YF  A +  + +G + +T K +  +  S+  R  
Sbjct  120   VMQQRCPAIIMLTSLVHG-SLDKCAPYFPPAANEQQVYGRLRVTNKGLGHSSHSITKRVF  178

Query  792   EVSYKE-SEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVHCSAGI  968
             EV   E ++EPPL VLH +Y  WPDHGVP  T   RE+ + + T+P   GPIVVHCSAGI
Sbjct  179   EVQPVELTQEPPLCVLHLEYLHWPDHGVPAYTRPIRELYRCISTIPDDAGPIVVHCSAGI  238

Query  969   GRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELED  1148
             GR+G Y  I  T++RIL GD++A++L +T+   R  R GMVQT  QY F Y A+++EL+D
Sbjct  239   GRSGAYIGIDQTLRRILKGDLTAVNLQDTVMRLRDHRYGMVQTKAQYHFIYAAVLDELQD  298

Query  1149  I  1151
             +
Sbjct  299   L  299



>ref|XP_006345138.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Solanum tuberosum]
Length=187

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 128/151 (85%), Gaps = 6/151 (4%)
 Frame = +3

Query  357  QANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLI  536
            QA RMRAS+M+SRC +AL+S NISKNRYTDVLPFD+NRVVL+P       ARGYINAS I
Sbjct  3    QATRMRASEMKSRCSMALNSTNISKNRYTDVLPFDNNRVVLDP------PARGYINASFI  56

Query  537  TVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGV  716
             +SE VS+FIATQGPL +TFEDFWEM+IQ+RCP IVMLT+L DNYK VKCGDYFQA+ G 
Sbjct  57   KISEDVSQFIATQGPLQHTFEDFWEMIIQHRCPVIVMLTQLFDNYKIVKCGDYFQADGGP  116

Query  717  REFGNICITTKWIKTTDTSLILRCLEVSYKE  809
            R FGNICI TKWIKTT TSLILRCLEV+Y E
Sbjct  117  RRFGNICIVTKWIKTTQTSLILRCLEVNYIE  147



>gb|EAY82439.1| hypothetical protein OsI_37652 [Oryza sativa Indica Group]
Length=328

 Score =   240 bits (613),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 139/311 (45%), Positives = 185/311 (59%), Gaps = 12/311 (4%)
 Frame = +3

Query  237   QPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDS  416
             +PP   L+ +Q+  C EAL+   E     PE +  EF  LQ   MR   MRS    A ++
Sbjct  27    EPPPPALTPEQVGLCREALEYF-EGMCGRPEAMSDEFRRLQD--MRHELMRS-SNEARNA  82

Query  417   INISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSE--HVSRFIATQGPLPN  590
              N  KNRY DV+PFD+ RV L      + S+  YINAS I V+E   V++FI+TQGPL  
Sbjct  83    ANREKNRYIDVVPFDTTRVRLKRSTTSQTSSNDYINASFIKVTEDNRVAKFISTQGPLAK  142

Query  591   TFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDT  770
             TF+DFWEMV + +CP IVMLT+    + ++KC +Y         +G   +     K    
Sbjct  143   TFDDFWEMVYEYQCPVIVMLTQ----FDSLKCDEYLPLRKQREAYGKYNVKITNAKRDSH  198

Query  771   SLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVV  950
              L LR + V   ES     SV H +Y +W DHGVP +T A R+I K L   P    PIVV
Sbjct  199   QLWLRDVMVQCNESSRV-HSVRHIEYPDWSDHGVPTNTDAVRQIRKWLQNTPME-HPIVV  256

Query  951   HCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAI  1130
             HCSAGIGRTG Y  IH+TI+R+LLGD S+  L  T+   R+QR+GMVQT +QY+FCY AI
Sbjct  257   HCSAGIGRTGAYITIHSTIERLLLGDKSSYHLDETVKTLRTQRVGMVQTEKQYMFCYRAI  316

Query  1131  IEELEDIIKES  1163
              +EL+D+++ +
Sbjct  317   ADELKDLLESN  327



>ref|XP_006664386.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like, partial [Oryza 
brachyantha]
Length=284

 Score =   238 bits (606),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 131/292 (45%), Positives = 177/292 (61%), Gaps = 19/292 (7%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCL----VALDSINISKNRYTDVLPFDSNRV  473
             E +   P ++  EF        R  DMR+  L     A D  N  KNRY DV+PFD+ RV
Sbjct  5     EGKCARPGEVSDEFS-------RLPDMRNELLKGSNAARDDANRGKNRYFDVVPFDTTRV  57

Query  474   VLNPCKDYRQSARGYINASLITVSE--HVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVM  647
              L      + S   YINAS I V+E   V++FI+TQGPL  TFEDFWEMV + +CPAIVM
Sbjct  58    RLKQSTSNQSSRNDYINASFINVTEDNRVAKFISTQGPLVQTFEDFWEMVYEYQCPAIVM  117

Query  648   LTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPL  827
             LT+    + ++KC +Y    D  + +GN  +     K     L LR + V   +S +   
Sbjct  118   LTQ----FASLKCDEYLPLTDQCKAYGNYNVKITNAKRDRHRLWLRDVTVQCNKSSKVH-  172

Query  828   SVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTI  1007
             SV H +Y +WPDHGVP +T A R+I K +   P +  PIV HCSAGIGRTG Y  IH+TI
Sbjct  173   SVRHIEYPDWPDHGVPTNTDAVRQIRKWIQNTP-TEHPIVAHCSAGIGRTGAYIIIHSTI  231

Query  1008  QRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKES  1163
             +R+LLGD S+ +L  T+   R+QR+GMVQT +QY+FCY AI +EL+D+++ +
Sbjct  232   ERVLLGDKSSYNLDETVKHLRTQRVGMVQTEQQYMFCYRAIADELKDLLRSN  283



>ref|XP_004978856.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X1 
[Setaria italica]
 ref|XP_004978857.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Setaria italica]
Length=290

 Score =   234 bits (598),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 130/257 (51%), Positives = 166/257 (65%), Gaps = 18/257 (7%)
 Frame = +3

Query  405   ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARG--YINASLI-TVSEHVSRFIATQ  575
             A +++N  +NRYTDVLP D  RV L       QS  G  YINAS I T     ++FI+TQ
Sbjct  46    AREAVNRGRNRYTDVLPIDKTRVRL-------QSPTGNDYINASFINTGGRDQTKFISTQ  98

Query  576   GPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWI  755
             GPL  T EDFW+MV +N CP IVMLT+  D YK  +C +Y     G   FG   I  K +
Sbjct  99    GPLARTIEDFWQMVYENHCPVIVMLTKF-DGYK--QCDEYLPLSKGQGAFGKFNI--KIV  153

Query  756   KT-TDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPS  932
             KT  D  L+LR ++V   ES+    S+LH +++EWPDHGVP ++ A R+I+KRL+ +P  
Sbjct  154   KTRNDGQLVLRVVKVQRDESDSV-HSLLHIEHSEWPDHGVPSNSNAVRQILKRLYHIPRE  212

Query  933   LGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYL  1112
               PIV HCSAGIGRTG Y  IHN I RILLGD  A++L  T+  FRS+R GMVQT EQ+ 
Sbjct  213   H-PIVAHCSAGIGRTGAYITIHNAIDRILLGDQGAVNLAETLKKFRSERPGMVQTEEQFK  271

Query  1113  FCYDAIIEELEDIIKES  1163
             FC+ AI +EL+D+I  S
Sbjct  272   FCHQAIADELKDLISNS  288



>ref|XP_004978858.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X3 
[Setaria italica]
Length=289

 Score =   234 bits (597),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 130/257 (51%), Positives = 165/257 (64%), Gaps = 19/257 (7%)
 Frame = +3

Query  405   ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARG--YINASLI-TVSEHVSRFIATQ  575
             A +++N  +NRYTDVLP D  RV L       QS  G  YINAS I T     ++FI+TQ
Sbjct  46    AREAVNRGRNRYTDVLPIDKTRVRL-------QSPTGNDYINASFINTGGRDQTKFISTQ  98

Query  576   GPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWI  755
             GPL  T EDFW+MV +N CP IVMLT+  D YK   C +Y     G   FG   I  K +
Sbjct  99    GPLARTIEDFWQMVYENHCPVIVMLTKF-DGYK---CDEYLPLSKGQGAFGKFNI--KIV  152

Query  756   KT-TDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPS  932
             KT  D  L+LR ++V   ES+    S+LH +++EWPDHGVP ++ A R+I+KRL+ +P  
Sbjct  153   KTRNDGQLVLRVVKVQRDESDSV-HSLLHIEHSEWPDHGVPSNSNAVRQILKRLYHIPRE  211

Query  933   LGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYL  1112
               PIV HCSAGIGRTG Y  IHN I RILLGD  A++L  T+  FRS+R GMVQT EQ+ 
Sbjct  212   H-PIVAHCSAGIGRTGAYITIHNAIDRILLGDQGAVNLAETLKKFRSERPGMVQTEEQFK  270

Query  1113  FCYDAIIEELEDIIKES  1163
             FC+ AI +EL+D+I  S
Sbjct  271   FCHQAIADELKDLISNS  287



>ref|XP_006662780.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Oryza brachyantha]
Length=239

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/244 (50%), Positives = 162/244 (66%), Gaps = 13/244 (5%)
 Frame = +3

Query  450   LPFDSNRVVLNPCKDYRQSARGYINASLITV---SEHVSRFIATQGPLPNTFEDFWEMVI  620
             +PFD+ RV L      R S   YINAS I +   ++  ++FI+TQGPL  TFEDFW+MV 
Sbjct  1     MPFDATRVRLKSSTGDRPSRNDYINASHIKIDSRNKSQTQFISTQGPLIKTFEDFWQMVY  60

Query  621   QNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREF-GNICI-TTKWIKTTDTSLILRCLE  794
             +N+C  IVMLT+    +   KC  Y   + G   + G + + TT++ K  D  L+LR LE
Sbjct  61    ENQCSVIVMLTK----FDGAKCDGYLPMDKGEEGYYGKLSVKTTQYRK--DGDLVLRGLE  114

Query  795   VSYKESEEPPLS-VLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVHCSAGIG  971
             +  +++E   +  VLH QY+EWPDHGVP  + + R+I++RL+ +P    P+V HCSAGIG
Sbjct  115   LEVQQNESRIVRRVLHIQYSEWPDHGVPYHSASVRQILRRLYDIPRE-HPVVAHCSAGIG  173

Query  972   RTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDI  1151
             RTG Y  IHNTI+RIL GDMSALDL  T+T FRSQR GMVQT +QY FCY AI++EL D+
Sbjct  174   RTGAYITIHNTIERILSGDMSALDLSETVTKFRSQRPGMVQTEDQYKFCYTAIVDELNDL  233

Query  1152  IKES  1163
             +  S
Sbjct  234   LPNS  237



>gb|AAX96301.1| Protein-tyrosine phosphatase [Oryza sativa Japonica Group]
Length=237

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 123/242 (51%), Positives = 152/242 (63%), Gaps = 11/242 (5%)
 Frame = +3

Query  450   LPFDSNRVVLNPCKDYRQSARGYINASLITVSEHV---SRFIATQGPLPNTFEDFWEMVI  620
             +PFD  RV L P      S+  YINASLI   +     ++FI+TQGPL  TF DFW+MV 
Sbjct  1     MPFDETRVRLKPSASDHPSSNEYINASLIETDDQGQSHTKFISTQGPLVKTFGDFWQMVY  60

Query  621   QNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGV-REFGNICITTKWIKTTDTSLILRCLEV  797
             +N+CP IVM+T+    +   KC  Y    +G  R++G   +     K  D  L LR LEV
Sbjct  61    ENQCPVIVMVTK----FDGAKCDRYLPTNEGEERDYGKFSVKITKFKC-DGVLELRGLEV  115

Query  798   SYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVHCSAGIGRT  977
                ES      VLH  Y++WPDHGVP D+   R+I+KRL+ +P    PIV HCSAGIGRT
Sbjct  116   QQNESLTV-RHVLHILYSDWPDHGVPHDSAFVRKILKRLYGIPKE-HPIVAHCSAGIGRT  173

Query  978   GTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIK  1157
             G Y  IHNTI+RILLGDMSALDL  T+  FRSQR GMVQT +QY FCY AI+ EL D++ 
Sbjct  174   GAYITIHNTIERILLGDMSALDLSKTVKKFRSQRPGMVQTEDQYKFCYMAIVSELNDLLS  233

Query  1158  ES  1163
              S
Sbjct  234   NS  235



>ref|XP_001751306.1| predicted protein [Physcomitrella patens]
 gb|EDQ83623.1| predicted protein [Physcomitrella patens]
Length=405

 Score =   230 bits (586),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 126/307 (41%), Positives = 185/307 (60%), Gaps = 14/307 (5%)
 Frame = +3

Query  255   LSSDQLRYCSEALKVLKEKRFQAPE--KIRQEFGTLQANRMRASDMRSRCLVALDSINIS  428
             L+  QLR C +AL VL++K   +    +I QE+  L A  +      +    A+   N +
Sbjct  104   LNPGQLRACKKALSVLRQKVNDSSGFGEIDQEYDALPAEELSDYRAPTEKTAAVLPNNRA  163

Query  429   KNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLIT---VSEHVSRFIATQGPLPNTFE  599
             KNRY +VLP      +L    D++ +    ++    +      ++  FIATQGPL +T  
Sbjct  164   KNRYRNVLP-----CILK--IDFKVALYVVLSGFFFSRDHAYNNLPLFIATQGPLSSTVS  216

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYF-QAEDGVREFGNICITTKWIKTTDTSL  776
             DFW MV+Q RCP IVMLT++VD  +  KC  YF + E+  +  G I +T +    +   +
Sbjct  217   DFWAMVLQQRCPIIVMLTQIVDGDQN-KCAHYFPRDENQTQTHGQITVTNRKTSLSQHGI  275

Query  777   ILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVHC  956
             + R  EV   +  EP L+++H++Y EWPD  VP  T + RE+ + L ++PPS GP VVHC
Sbjct  276   VRRVFEVQDTKFTEPLLTMVHYEYLEWPDFSVPPSTRSVRELTRALSSIPPSAGPFVVHC  335

Query  957   SAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIE  1136
             SAGIGRTGT+C I +T++RIL GD+ A+D+ +T+  FRSQR GMVQT +QY FCY A+ +
Sbjct  336   SAGIGRTGTFCVIDHTLRRILGGDLEAVDIKSTVRNFRSQRDGMVQTRDQYQFCYQAVEK  395

Query  1137  ELEDIIK  1157
             ELED ++
Sbjct  396   ELEDYVR  402



>gb|EMS67302.1| Tyrosine-protein phosphatase Lar-like protein [Triticum urartu]
Length=328

 Score =   226 bits (576),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 140/333 (42%), Positives = 189/333 (57%), Gaps = 44/333 (13%)
 Frame = +3

Query  267   QLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTD  446
             Q+++C  ALKVL +K  + P  I  +F  L A R      + +  VA    N  +NRYTD
Sbjct  4     QVKHCKTALKVLDKKL-KKPAAIFDDFRGLPAIRTSLQSAQ-KFTVARSPANRERNRYTD  61

Query  447   VLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH-VSRFIATQGPLPNTFEDFWEMVIQ  623
             VL FD  R+ L      + S+  YINASLI   +   ++FI+TQGPL NTFEDFW+MV +
Sbjct  62    VLAFDETRIKLQSSTGNQTSSNDYINASLIKYDDKDQTKFISTQGPLVNTFEDFWQMVFE  121

Query  624   NRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKT-TDTSLILRCLEVS  800
             N CP IVMLT+    +  VKC +Y     G  ++G + I  K ++T  D  L LR ++V 
Sbjct  122   NSCPVIVMLTK----FDIVKCDEYLPLSKGQGDYGRLNI--KIMETRQDGELTLRSVKVQ  175

Query  801   YKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVHCSAGIGRTG  980
             + ES+    +VLH Q++ WPDHGVP D+   R+I+KRL+ +     P+V HCSAGIGRTG
Sbjct  176   HNESDRVH-TVLHIQHSTWPDHGVPDDSSTVRKILKRLYYVSKE-HPVVAHCSAGIGRTG  233

Query  981   TYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQT---------------------  1097
              Y  IHNT++RIL G+ +A +L  T+  FRSQR GMVQT                     
Sbjct  234   AYITIHNTVERILRGEQAATNLAETVGKFRSQRPGMVQTEVRLFYLFISVCKSVIGSSQV  293

Query  1098  -----------LEQYLFCYDAIIEELEDIIKES  1163
                         EQY FCY AI +EL+D+I+ S
Sbjct  294   MDLDPQQDDCSREQYKFCYHAIADELKDLIRNS  326



>gb|KCW71046.1| hypothetical protein EUGRSUZ_F04145 [Eucalyptus grandis]
Length=240

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 129/156 (83%), Gaps = 4/156 (3%)
 Frame = +3

Query  216  FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSR  395
             DFS D  PP+  LS DQ R+C+EAL+ LKEK  Q P++++QEFG LQANR+R S+M   
Sbjct  19   LDFSPDP-PPKPALSPDQRRFCAEALRALKEK-LQMPDRMKQEFGRLQANRIRPSEMVRS  76

Query  396  CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIA  569
            C VALD +N SKNRYTDV+P+D  RVVLNPCKDYR +A+GYINAS IT   SE+VSRFIA
Sbjct  77   CTVALDDVNSSKNRYTDVVPYDKTRVVLNPCKDYRPAAKGYINASFITASSSENVSRFIA  136

Query  570  TQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKT  677
            TQGPLP+T+EDFWEM++Q+RCPAIVMLTRLVD+YKT
Sbjct  137  TQGPLPHTYEDFWEMILQHRCPAIVMLTRLVDSYKT  172



>gb|EEC67788.1| hypothetical protein OsI_35345 [Oryza sativa Indica Group]
Length=305

 Score =   223 bits (567),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 122/239 (51%), Positives = 149/239 (62%), Gaps = 11/239 (5%)
 Frame = +3

Query  402   VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHV---SRFIAT  572
              A +  N  KNRY+DV+PFD  RV L P      S+  YINASLI   +     ++FI+T
Sbjct  56    AAQNPANREKNRYSDVMPFDETRVRLKPSASDHPSSNEYINASLIETDDQGQSHTKFIST  115

Query  573   QGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGV-REFGNICITTK  749
             QGPL  TF DFW+MV +N+CP IVM+T+    +   KC  Y    +G  R++G   +   
Sbjct  116   QGPLVKTFGDFWQMVYENQCPVIVMVTK----FDGAKCDRYLPTNEGEERDYGKFSVKIT  171

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP  929
               K  D  L LR LEV   ES      VLH  Y++WPDHGVP D+   R+I+KRL+ +P 
Sbjct  172   KFKC-DGVLELRGLEVQQNESLTV-RHVLHILYSDWPDHGVPHDSAFVRKILKRLYGIPK  229

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQ  1106
                PIV HCSAGIGRTG Y  IHNTI+RILLGDMSALDL  T+  FRSQR GMVQT EQ
Sbjct  230   EH-PIVAHCSAGIGRTGAYITIHNTIERILLGDMSALDLSKTVKKFRSQRPGMVQTEEQ  287



>gb|EMT05398.1| Tyrosine-protein phosphatase Lar-like protein [Aegilops tauschii]
Length=245

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 114/232 (49%), Positives = 146/232 (63%), Gaps = 18/232 (8%)
 Frame = +3

Query  504   SARGYINASLITVSE--HVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKT  677
             S   YINAS +  +E   V+RFI+TQGPL  TFEDFWEMV +N+CP IVMLT+    + +
Sbjct  18    SGNDYINASFVKATEDNSVARFISTQGPLVRTFEDFWEMVCENQCPVIVMLTQ----FDS  73

Query  678   VKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEW  857
             VKC +Y   ++G   +G   +  +          LR +EV   ES +   SVLH +Y +W
Sbjct  74    VKCDEYLPLQNGQGTYGKYNVKIRKDTRDKHQFCLRAVEVQCNESGKVH-SVLHIEYPDW  132

Query  858   PDHGVPKDTLATREIVKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSA  1037
             PDHGVP  T A R+I KRLH +P    PIV HCSAGIGRTG Y  IH++I+RILLGD S+
Sbjct  133   PDHGVPTSTDAVRQIQKRLHHIPRE-HPIVAHCSAGIGRTGAYITIHSSIERILLGDTSS  191

Query  1038  LDLVNTITIFRSQRIGMVQT----------LEQYLFCYDAIIEELEDIIKES  1163
              DLV T+   RSQR GMVQT           +QY+FCY AI +EL+D++  S
Sbjct  192   YDLVETVKKSRSQRTGMVQTEMLYWHIFAFQQQYMFCYRAIADELKDLLSSS  243



>gb|EEE51752.1| hypothetical protein OsJ_33184 [Oryza sativa Japonica Group]
Length=342

 Score =   209 bits (532),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 124/288 (43%), Positives = 156/288 (54%), Gaps = 49/288 (17%)
 Frame = +3

Query  372   RASDMRS-----RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLI  536
             R +D+R+     +   A +  N  KNRY+DV+PFD  RV L P      S+  YINASLI
Sbjct  43    RCADIRTAFQTGKFTAAQNPANREKNRYSDVMPFDETRVRLKPSASDHPSSNEYINASLI  102

Query  537   TVSEHV---SRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAE  707
                +     ++FI+TQGPL  TF DFW+MV +N+CP IVM+T+    +   KC  Y    
Sbjct  103   ETDDQGQSHTKFISTQGPLVKTFGDFWQMVYENQCPVIVMVTK----FDGAKCDRYLPTN  158

Query  708   DG-VREFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLS------------------  830
             +G  R++G   +     K  D  L LR LEV   E      +                  
Sbjct  159   EGEERDYGKFSVKITKFK-CDGVLELRGLEVQQNEHAIGQYTVKFAHDLCSMHSKYSVYD  217

Query  831   ----------------VLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVHCSA  962
                             VLH  Y++WPDHGVP D+   R+I+KRL+ +P    PIV HCSA
Sbjct  218   YDLFAWFPNSILQVRHVLHILYSDWPDHGVPHDSAFVRKILKRLYGIPKE-HPIVAHCSA  276

Query  963   GIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQ  1106
             GIGRTG Y  IHNTI+RILLGDMSALDL  T+  FRSQR GMVQT EQ
Sbjct  277   GIGRTGAYITIHNTIERILLGDMSALDLSKTVKKFRSQRPGMVQTEEQ  324



>gb|KGN44428.1| hypothetical protein Csa_7G290510 [Cucumis sativus]
Length=150

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 104/122 (85%), Gaps = 2/122 (2%)
 Frame = +3

Query  789   LEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVHCSAGI  968
             LE+  K  E   ++VLH QY +W DHGVP DTLA RE++KRL+ LPP LGPIVVHCSAGI
Sbjct  27    LELMLKSEES--VAVLHIQYPQWSDHGVPNDTLAVREMLKRLYHLPPDLGPIVVHCSAGI  84

Query  969   GRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELED  1148
             GRTGTYCAIHNTIQRIL+GDMSALDLV+TI+ FRSQRIGMVQTL+QY FCY  I++ELED
Sbjct  85    GRTGTYCAIHNTIQRILIGDMSALDLVSTISSFRSQRIGMVQTLDQYFFCYRTIVDELED  144

Query  1149  II  1154
             +I
Sbjct  145   LI  146



>ref|XP_001696901.1| protein tyrosine phosphatase 3 [Chlamydomonas reinhardtii]
 gb|EDP00593.1| protein tyrosine phosphatase 3, partial [Chlamydomonas reinhardtii]
Length=271

 Score =   187 bits (476),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 107/277 (39%), Positives = 151/277 (55%), Gaps = 21/277 (8%)
 Frame = +3

Query  363   NRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV  542
             N +   D+      A  + N  KNRY +VLPFD NRV ++      +  + YINASL+  
Sbjct  1     NSLLECDVLETVEAAEHTNNAGKNRYVNVLPFDYNRVKISG-----EDGQDYINASLVQS  55

Query  543   SEHVSR---FIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDG  713
             +   SR   +IA QGPL +T +DFW+MV +N C  ++MLTR V+N   +KC DYF    G
Sbjct  56    APEESRGWCYIAAQGPLASTVDDFWKMVFENNCSILIMLTRTVEN-NHIKCADYFNQRPG  114

Query  714   -VREFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLA  890
                +FG+  +TT  ++     +  R L++           V H+ Y  WPD GVP+ T  
Sbjct  115   ETAKFGSYRVTTTDVQEVSPDITKRTLQLKLYTVSPEVHEVTHYHYHRWPDFGVPESTEP  174

Query  891   TREIVKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGD-----------MSA  1037
              R+++K L+         VVHCSAGIGRTGT  AI   ++R+                +A
Sbjct  175   IRKLIKLLYQTRRERETTVVHCSAGIGRTGTLMAIDVILRRLWAMAEARTVVTAEDVTTA  234

Query  1038  LDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELED  1148
             +DL   +   R QR GMVQTLEQY FCY+A+++E+ED
Sbjct  235   VDLPAVVHTLRRQRKGMVQTLEQYFFCYEALLQEMED  271



>ref|NP_001169094.1| uncharacterized protein LOC100382937 [Zea mays]
 gb|ACN31241.1| unknown [Zea mays]
 gb|ACN31635.1| unknown [Zea mays]
Length=186

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 98/191 (51%), Positives = 122/191 (64%), Gaps = 9/191 (5%)
 Frame = +3

Query  612   MVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICIT-TKWIKTTDTSLILRC  788
             MV +N CP IVMLT+    +  +KC +Y     G   FG   I  TK+ K  D  L+LR 
Sbjct  1     MVYENHCPVIVMLTK----FDGLKCDEYLPLSKGQAVFGKFTIKITKFRK--DGQLLLRG  54

Query  789   LEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVHCSAGI  968
             +E+   ES+E   S+LH +Y EWPDHGVP  +   R I+KRL+ +P    PIV HCSAGI
Sbjct  55    VEIRQDESDEV-RSLLHIEYPEWPDHGVPNSSADVRRILKRLYHIPRER-PIVAHCSAGI  112

Query  969   GRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELED  1148
             GRTG Y  IHNTI+RILLG+  A DLV T+  FRSQR GMVQT EQY  C+ AI +ELED
Sbjct  113   GRTGAYTTIHNTIERILLGEQGAADLVETVKKFRSQRPGMVQTEEQYKCCHHAIRDELED  172

Query  1149  IIKESTGQPSS  1181
             ++  S  +P S
Sbjct  173   LVSSSKIEPLS  183



>gb|EPS63074.1| hypothetical protein M569_11713, partial [Genlisea aurea]
Length=124

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/119 (71%), Positives = 98/119 (82%), Gaps = 2/119 (2%)
 Frame = +3

Query  825   LSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLG-PIVVHCSAGIGRTGTYCAIHN  1001
             LSVLH QY EWPDHGVPKDT A R+I KR   +PP  G PIVVHCSAGIGRTGTYCAIHN
Sbjct  5     LSVLHIQYPEWPDHGVPKDTAAVRDIFKRTSRVPPGCGGPIVVHCSAGIGRTGTYCAIHN  64

Query  1002  TIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQPS  1178
             T++RIL+GD +ALDL +TIT FRSQR+ MV+T EQYL CYDA+I+ELED+I  S  +PS
Sbjct  65    TLERILMGDSTALDLGDTITNFRSQRMRMVETGEQYLLCYDAVIDELEDVIS-SAQRPS  122



>ref|XP_005644093.1| hypothetical protein COCSUDRAFT_67695 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19549.1| hypothetical protein COCSUDRAFT_67695 [Coccomyxa subellipsoidea 
C-169]
Length=360

 Score =   183 bits (464),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 122/320 (38%), Positives = 165/320 (52%), Gaps = 46/320 (14%)
 Frame = +3

Query  288   ALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSN  467
             A ++L +K   + E + +EF  L+  R+  S     C  A    N  +NRYT+VLPFD N
Sbjct  47    AQQILSDKLASSGEAVYREFERLRRGRLPGS-----CQAAQLPANERRNRYTNVLPFDEN  101

Query  468   RVVLN-PCKDYRQSARGYINASLIT--VSEHVS-RFIATQ--------------------  575
             RV LN P  DY       INAS +    SE  +  +IATQ                    
Sbjct  102   RVRLNSPTHDY-------INASSLASPASEAPAWHYIATQARTSLDLHAQQHTPFSFAFF  154

Query  576   --GPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAE--DGVREFGNICIT  743
               GP  +T  DFW+MV ++    +VMLTRL ++    KC +YF  E    V   G   +T
Sbjct  155   TLGPKDSTVGDFWQMVYESNSAVVVMLTRLTESGAMKKCAEYFPDELDQPVTYKGGWTVT  214

Query  744   TKWIKTTDTSLILRCLEVSYKE-SEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHT  920
                ++  D  +  R L V+    +  P   V HF Y  WPDHGVP  T   R+++  +  
Sbjct  215   CVSMREVDCDVRHRDLLVTPPSPTTGPSRRVCHFHYHAWPDHGVPSTTQPLRDLLAAVRG  274

Query  921   L-PPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGD----MSALDLVNTITIFRSQRIG  1085
             L  P+ GP VVHCSAGIGRTGT+CA+   +QR+  GD    +SA +L   +   R QR G
Sbjct  275   LQAPAAGPPVVHCSAGIGRTGTFCAVDVALQRLRSGDYGIAVSAAELKPVVAELRRQRSG  334

Query  1086  MVQTLEQYLFCYDAIIEELE  1145
             MVQT EQYLFCY A+ +E++
Sbjct  335   MVQTAEQYLFCYRAVKDEVD  354



>ref|XP_002953490.1| hypothetical protein VOLCADRAFT_82191 [Volvox carteri f. nagariensis]
 gb|EFJ45463.1| hypothetical protein VOLCADRAFT_82191 [Volvox carteri f. nagariensis]
Length=358

 Score =   182 bits (461),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 116/303 (38%), Positives = 166/303 (55%), Gaps = 33/303 (11%)
 Frame = +3

Query  333   IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
             + QE+ +LQ       D+      A  + N  KNRY +VLPFD NRV ++      +  +
Sbjct  60    LNQEYNSLQD-----CDVLETVEAAEHTNNAGKNRYVNVLPFDYNRVKISG-----EDGQ  109

Query  513   GYINASLITVSEHVSR---FIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVK  683
              YINASL+    + S    +IA QGPL +T +DFW MV +N C  ++MLTR V+N   +K
Sbjct  110   DYINASLVQSGPNESPSWCYIAAQGPLASTVDDFWRMVFENNCSILIMLTRTVEN-NHIK  168

Query  684   CGDYFQAEDG-VREFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWP  860
             C DYF    G   +FG+  +TT  ++     +  R L++S   ++E    V H+ Y  WP
Sbjct  169   CADYFNQRPGETAKFGSYRVTTTDVQEVSPDITKRTLQLSLCTTQEVH-EVTHYHYHRWP  227

Query  861   DHGVPKDTLATREIVKRL--HTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILL----  1022
             D GVP+ T   R +VK L  +    +    VVHCSAGIGRTGT  AI   ++R+      
Sbjct  228   DFGVPESTEPIRRLVKILWQNRTSCTQQTTVVHCSAGIGRTGTLMAIDVILRRLWAMAEQ  287

Query  1023  ------GDMS-ALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQPSS  1181
                    D+S A+DL   +   R QR GMVQT+EQY FCY+A++ E++    E+TG+ S 
Sbjct  288   GLPSGPADVSTAVDLPAVVHSLRRQRKGMVQTMEQYYFCYEAVLHEMQ----EATGRSSR  343

Query  1182  *SI  1190
              S+
Sbjct  344   ESV  346



>ref|XP_006345139.1| PREDICTED: protein-tyrosine-phosphatase PTP1-like isoform X2 
[Solanum tuberosum]
Length=148

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 93/113 (82%), Gaps = 6/113 (5%)
 Frame = +3

Query  471  VVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVML  650
            VVL+P       ARGYINAS I +SE VS+FIATQGPL +TFEDFWEM+IQ+RCP IVML
Sbjct  2    VVLDP------PARGYINASFIKISEDVSQFIATQGPLQHTFEDFWEMIIQHRCPVIVML  55

Query  651  TRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKE  809
            T+L DNYK VKCGDYFQA+ G R FGNICI TKWIKTT TSLILRCLEV+Y E
Sbjct  56   TQLFDNYKIVKCGDYFQADGGPRRFGNICIVTKWIKTTQTSLILRCLEVNYIE  108



>dbj|GAM18917.1| hypothetical protein SAMD00019534_020920 [Acytostelium subglobosum 
LB1]
Length=425

 Score =   176 bits (446),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/253 (38%), Positives = 141/253 (56%), Gaps = 16/253 (6%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N SKNRYT+++P+D+ RV L        S   YINA+ I   EH  ++I TQGPL NTF 
Sbjct  170   NTSKNRYTNIVPWDTTRVKLEKIDGLEGS--DYINANFIAGGEHYKQYICTQGPLQNTFV  227

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICIT-TKWIKTTDTSL  776
             DFW MV +N    +VML++ ++N +  KC  Y+   D + E+    +  T  ++     +
Sbjct  228   DFWRMVWENGSTIVVMLSKELENSRP-KCDRYWSESDRI-EYDQFAVKMTSIVRDLPREI  285

Query  777   ILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPP-------SL  935
             I+R   ++  +  +  + + H+QY  WPDH  P DT   R ++ +++T            
Sbjct  286   IIRTFTLTNSQLNQSRI-ITHYQYEGWPDHNAPNDTEPLRYLMHQINTKQKQSIERDGQR  344

Query  936   GPIVVHCSAGIGRTGTYCAIHNTIQRI---LLGDMSALDLVNTITIFRSQRIGMVQTLEQ  1106
              PIVVHCSAG+GRTGT+C +H  + RI      D    ++ + +   R QR GMVQ LEQ
Sbjct  345   APIVVHCSAGVGRTGTFCTVHIVMSRIDNAAENDRINFNIYSIVDNLRKQRPGMVQQLEQ  404

Query  1107  YLFCYDAIIEELE  1145
             YLFCY  I +EL+
Sbjct  405   YLFCYATIADELK  417



>ref|XP_004356068.1| protein-tyrosine phosphatase 1 [Dictyostelium fasciculatum]
 gb|EGG17584.1| protein-tyrosine phosphatase 1 [Dictyostelium fasciculatum]
Length=400

 Score =   174 bits (441),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 113/294 (38%), Positives = 157/294 (53%), Gaps = 30/294 (10%)
 Frame = +3

Query  312   RFQAPEKIRQEFGTLQA---NRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLN  482
             R    +++++EF TL++   N +  +      +      N SKNRYT++LP D  RV L 
Sbjct  118   RLHTEQRMKEEFMTLESIYHNSIHVT------IEGTQKYNTSKNRYTNILPCDLTRVKLE  171

Query  483   PCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLV  662
                   Q    YINA+ I   E+  ++I TQGPL NT  DFW MV +N    IVML++ +
Sbjct  172   KVNG--QEGSDYINANFID-GEYDRQYICTQGPLQNTIADFWRMVWENESYIIVMLSKEL  228

Query  663   DNYKTVKCGDYFQAEDGVREFGNICITTKWI-KTTDTSLILRCLEVSYKESEEPPLSVLH  839
             +N +  KC  Y+   D V  F   C+  K I +  +  +I R   ++   + E  + + H
Sbjct  229   ENCRP-KCDRYWSETDPVN-FEKFCVKLKEIVRDEEREIITRTFILTNATNNESRI-ITH  285

Query  840   FQYAEWPDHGVPKDTLATR----EIVKRLHTLPPS--LGPIVVHCSAGIGRTGTYCAIHN  1001
             +QY  WPDH  P DT   R     I +  + LP      PIVVHCSAG+GRTGT+C +H 
Sbjct  286   YQYEGWPDHNAPNDTEPLRCLLHLINQNQNDLPEKDQANPIVVHCSAGVGRTGTFCTVHI  345

Query  1002  TIQRILLGDMSALD-----LVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELED  1148
              + RI   D S LD     L + +   R QR GMVQ LEQYLFCY+AI +EL +
Sbjct  346   MMSRI---DNSPLDKVDFNLYSVVNNLRKQRPGMVQQLEQYLFCYEAIEDELRE  396



>ref|XP_009888039.1| PREDICTED: receptor-type tyrosine-protein phosphatase kappa-like 
[Charadrius vociferus]
Length=1030

 Score =   180 bits (456),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 117/306 (38%), Positives = 166/306 (54%), Gaps = 25/306 (8%)
 Frame = +3

Query  285   EALKVLKEKRFQAPEKI-----RQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDV  449
             EALK  K +  +A +       RQ+ G L+  +  +S +   C    +  N SKNRY  +
Sbjct  444   EALKTFKREEIEAEQNDDESVDRQDAGRLREYQQLSSTLLHPCDAGKELCNQSKNRYKSI  503

Query  450   LPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNR  629
             +P+D  RVVL P      +  GYINAS +        FIA QGPLP T  DFW+MV Q +
Sbjct  504   IPYDHCRVVLQP----SDTGNGYINASYVDSYRSPRFFIAAQGPLPGTVVDFWQMVWQEK  559

Query  630   CPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKE  809
                IVMLT LV+  KT KC  Y+  ++ V  +G+  +T    +TT T L+ R   +  K 
Sbjct  560   TSVIVMLTGLVEQNKT-KCEQYWPEQEQV--YGDFTVTLNNTRTT-TGLVTRIFSLR-KA  614

Query  810   SEEPPLSVLHFQYAEWPDHGVPKDT---LATREIVKRLHTLPPSLGPIVVHCSAGIGRTG  980
                 P +V  F Y  WPDHGVP++    L   E+V +  +   S GP++VHCSAGIGRTG
Sbjct  615   GCALPRAVEQFHYLLWPDHGVPRNPAHLLCLVEVVNKRAS-EASAGPVLVHCSAGIGRTG  673

Query  981   TYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIK  1157
             T+ A+   ++   +G     +D+ + +   R QR+ MVQT EQY+F Y+ +   LE ++ 
Sbjct  674   TFIALDFLLK---MGKAEGKVDVFHCVQRLREQRVSMVQTKEQYIFLYEVL---LEGLLC  727

Query  1158  ESTGQP  1175
              STG P
Sbjct  728   SSTGIP  733


 Score = 72.8 bits (177),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 73/280 (26%), Positives = 116/280 (41%), Gaps = 25/280 (9%)
 Frame = +3

Query  333   IRQEFGTLQANRMRASDMRS--RCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQS  506
             + +EF TLQ    + S++     C  A    N  KNR   +LP DS R +L    +   S
Sbjct  756   LEKEFKTLQ----KFSELFQLLPCREAEKPSNQPKNRKPGILPADSWRPILMSSLNADGS  811

Query  507   ARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKC  686
               GYINA          R I TQ P   T  DFW +V    C ++V+L +L +  KT   
Sbjct  812   P-GYINAVFANTYTEEDRLIITQLPFLTTLVDFWALVWDYTCTSVVVLNQLQELDKTYV-  869

Query  687   GDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLH---FQYAEW  857
                F    G   +G   +    + + +         ++    ++P  S L    +Q  +W
Sbjct  870   --EFWPTQGEAAYGRFHVH---LISEEPGADFTAWTLALTNKQQPKKSALEVRLWQLKDW  924

Query  858   PDHGVPKDTLATREIVKRL-----HTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILL  1022
             P        LAT  I+  L     H      G I+V C  G  R+G +CA     ++I  
Sbjct  925   PMQERLPPQLAT--IISLLGKVETHHRQSQDGHILVTCWDGASRSGIFCAASFLCEQIQS  982

Query  1023  GDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEEL  1142
               +  +D+   +   + +R  +++ +EQY  CY+  +  L
Sbjct  983   EGL--VDVSQAVRTLKRRRRQLIKDVEQYRLCYELALSYL  1020



>ref|XP_010133273.1| PREDICTED: receptor-type tyrosine-protein phosphatase kappa-like, 
partial [Buceros rhinoceros silvestris]
Length=542

 Score =   176 bits (446),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 118/309 (38%), Positives = 164/309 (53%), Gaps = 31/309 (10%)
 Frame = +3

Query  285   EALKVLKEKRFQAPEKIRQEF------GTLQANRMRASDMRSRCLVALDSINISKNRYTD  446
             E LK  K    +A E+   EF      G L+  +  +S +   C    +  N SKNRY  
Sbjct  15    EVLKTFKRAEIEA-EQTEDEFVERHDAGRLREYQQLSSTLLHPCNAGKELCNQSKNRYKS  73

Query  447   VLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQN  626
             ++P+D  RVVL P      +  GYINAS +        FIA QGPLP T  DFW+MV Q 
Sbjct  74    IIPYDHCRVVLQPSD----TGNGYINASYVDSYRSPHFFIAAQGPLPGTVVDFWQMVWQE  129

Query  627   RCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILR--CLEVS  800
             +   IVMLT LV+  K +KC  Y+  ++ V  +G+  +T    +TT T L+ R  CL+  
Sbjct  130   KTSVIVMLTGLVEQNK-IKCEQYWPEQEQV--YGDFTVTLNNTRTT-TGLVTRIFCLQ--  183

Query  801   YKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPIVVHCSAGIG  971
              K     P  V  F Y  WPDHGVP+     L+  E+V +     P+ GP++VHCSAGIG
Sbjct  184   -KAGCALPRVVEQFHYLLWPDHGVPRSPAQLLSLVEMVNKRGFKAPA-GPVLVHCSAGIG  241

Query  972   RTGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELED  1148
             RTGT+ A+   ++   +G     +D+   + + R QR+ MVQT EQY F Y+ +   LE 
Sbjct  242   RTGTFIALDFLLK---MGKAEGKVDVFQCVQVLREQRVSMVQTKEQYTFLYEVL---LEG  295

Query  1149  IIKESTGQP  1175
             ++  STG P
Sbjct  296   LLCGSTGVP  304



>gb|EFA76454.1| protein-tyrosine phosphatase 1 [Polysphondylium pallidum PN500]
Length=489

 Score =   174 bits (440),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 106/290 (37%), Positives = 160/290 (55%), Gaps = 18/290 (6%)
 Frame = +3

Query  309   KRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPC  488
             K  QA   +R+EF  L+   +  S+   + +      N SKNRYT++LP D+ RV L   
Sbjct  201   KHIQAENLLREEFLALE--NIYQSNNNHQTIEGNLKHNTSKNRYTNILPCDTTRVKLEKI  258

Query  489   KDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDN  668
                 Q    YINA+ I   E   ++I TQGPL NT  DFW MV +N    IVML++ ++N
Sbjct  259   NG--QEGSDYINANFID-GEVDRQYICTQGPLQNTIIDFWRMVWENSSTIIVMLSKELEN  315

Query  669   YKTVKCGDYFQAEDGVREFGNICITTKWI-KTTDTSLILRCLEVSYKESEEPPLSVLHFQ  845
              + +KC  Y+   D + ++    ++ + I +  +  +I+R  +++ +   E  + + H+Q
Sbjct  316   CR-IKCDRYWSDSDPI-DYEQFTVSLENIERDIEREIIIRTFKLTNQTVNETRV-ITHYQ  372

Query  846   YAEWPDHGVPKDTLATREIVKRLHTLPPSL------GPIVVHCSAGIGRTGTYCAIHNTI  1007
             Y  WPDH  P DT   R ++  ++T   SL       PIVVHCSAG+GRTGT+C +H  I
Sbjct  373   YEGWPDHNAPNDTEPLRYLLHLINTTQNSLVEQYREAPIVVHCSAGVGRTGTFCTVHTLI  432

Query  1008  QRILLGDMSA---LDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELED  1148
              RI     ++    ++ + +   R QR GMVQ LEQYLFCY  I +EL++
Sbjct  433   SRIDNAKPNSKIDFNIYSIVNNLRKQRPGMVQQLEQYLFCYATIADELKE  482



>ref|XP_009645647.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
[Egretta garzetta]
Length=851

 Score =   177 bits (448),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 119/308 (39%), Positives = 165/308 (54%), Gaps = 29/308 (9%)
 Frame = +3

Query  285   EALKVLKEKRFQAPEKIRQEFGTLQANRMR-----ASDMRSRCLVALDSINISKNRYTDV  449
             E LK  K    +A +   +   T  A R+R     +S +   C V  +  N SKNRY  +
Sbjct  265   ETLKRFKRAEIEAEQTEDESVDTHGAGRLREYQQLSSTLLHPCDVGKELCNQSKNRYKGI  324

Query  450   LPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNR  629
             +P+D  RVVL P      +  GYINAS +        FIA QGPLP T  DFW+MV Q +
Sbjct  325   IPYDHCRVVLQP----SDTGNGYINASYVNSYRSPHFFIAAQGPLPGTVVDFWQMVWQEK  380

Query  630   CPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILR--CLEVSY  803
                IVMLT LV+  KT KC  Y+  ++ V  +G+  +T    +TT T L+ R  CL+   
Sbjct  381   TSVIVMLTGLVEQNKT-KCEQYWPEQEQV--YGDFTVTLNNTRTT-TGLVTRIFCLQ---  433

Query  804   KESEEPPLSVLHFQYAEWPDHGVPKDT---LATREIVKRLHTLPPSLGPIVVHCSAGIGR  974
             K     P  V  F Y  WPDHGVP++    L   E+V +     P+ GP++VHCSAGIGR
Sbjct  434   KVGCALPRVVEQFHYLLWPDHGVPRNPALLLCLVEVVNKRALEAPA-GPVLVHCSAGIGR  492

Query  975   TGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDI  1151
             TGT+ A+   ++   +G     +D+ + +   R QR+ MVQT EQYLF Y+ +   LE +
Sbjct  493   TGTFIALDFLLK---MGKAEGKVDVFHCVQRLREQRVSMVQTKEQYLFLYEVL---LEGL  546

Query  1152  IKESTGQP  1175
             +  +TG P
Sbjct  547   LCGNTGVP  554


 Score = 75.5 bits (184),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 119/283 (42%), Gaps = 23/283 (8%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+A +K  + F  L             C  A    N  KNR   +LP DS R +L  
Sbjct  578   EKEFKALQKFSELFQLLP------------CREAEKPTNQPKNRKPGILPADSCRPILMS  625

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
               +   S  GYINA       +  R I TQ P P T  DFW +V    C ++V+L +L +
Sbjct  626   SLNADGSP-GYINAVFADTYTNEDRLIITQLPFPTTLVDFWALVWDYTCTSVVVLNQLQE  684

Query  666   NYKTVKCGDYFQAEDGVREFGNICITTK-WIKTTDTSLILRCLEVSYKESEEPPLSVLHF  842
               +T       Q E     F    I+ +  +  T  +L L     + ++ ++  L V  +
Sbjct  685   LDETYVEFWPTQGEAAYGRFHVHLISEEPGVGFTGWTLAL----TNMQQPKKSALEVRFW  740

Query  843   QYAEWP-DHGVPKDTLATREIVKRL--HTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQR  1013
             Q  +WP    +P        ++ ++  H      G I+V C  G  R+G +CA     ++
Sbjct  741   QLKDWPMQQRLPLHPATIISLLGKVETHHRQSQDGHILVTCWDGASRSGIFCAASFLCEQ  800

Query  1014  ILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEEL  1142
             I       +D+   + + +  R  +++ ++QY  CY+  +  L
Sbjct  801   I--QSEGLVDVSQAVRMLKRWRRQLIKDVDQYGLCYELALSYL  841



>ref|XP_010019842.1| PREDICTED: receptor-type tyrosine-protein phosphatase mu-like, 
partial [Nestor notabilis]
Length=659

 Score =   174 bits (442),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 116/306 (38%), Positives = 162/306 (53%), Gaps = 25/306 (8%)
 Frame = +3

Query  285   EALKVLKEKRFQAPEK-----IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDV  449
             EALK LK    +A +       R   G L   +  +S +   C    +  N SKNRY  +
Sbjct  73    EALKRLKRAEIEAEQTEDESVDRHGAGRLGEYQQLSSSLLHPCDAGKELCNQSKNRYKSI  132

Query  450   LPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNR  629
             +P+D  RVVL P      +  GYINAS +   +    FIA QGPLP T  DFW+MV Q +
Sbjct  133   IPYDHCRVVLQPSD----TGNGYINASYVDSYQSPRFFIAAQGPLPGTVMDFWQMVWQEK  188

Query  630   CPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKE  809
                IVMLT LV+  KT KC  Y+   + V  +G+  +T    +TT T L+ R   +  K 
Sbjct  189   TSVIVMLTGLVEQNKT-KCEQYWPDHEQV--YGDFTVTLNNTRTT-TGLVTRIFSLQ-KA  243

Query  810   SEEPPLSVLHFQYAEWPDHGVPKDT---LATREIVKRLHTLPPSLGPIVVHCSAGIGRTG  980
                 P  V    Y  WPDHGVP+++   L   ++V +  +  P+ GP+VVHCSAGIGRTG
Sbjct  244   GCALPRVVEQLHYLLWPDHGVPRNSAQLLCLVDVVNKRTSEAPA-GPVVVHCSAGIGRTG  302

Query  981   TYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIK  1157
             T+ A+   ++   +G     +D+ + +   R QR+ MVQT EQY F Y+ +   LE ++ 
Sbjct  303   TFIALDFLLK---MGKAEGKVDVFHCVQRLREQRVSMVQTKEQYTFLYEVV---LEGLLC  356

Query  1158  ESTGQP  1175
              STG P
Sbjct  357   GSTGVP  362


 Score = 79.7 bits (195),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 73/282 (26%), Positives = 120/282 (43%), Gaps = 21/282 (7%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+A +K  + F  L             C  A    N  KNR   +LP DS R +L  
Sbjct  386   EKEFKALQKFSELFQLLP------------CREAEKPSNQPKNRKPGILPADSCRPILMS  433

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
               +   S  GYINA          R I TQ P P T  DFW +V    C A+V+L  L +
Sbjct  434   SLNADGSP-GYINAVFANTYTEEDRLIITQMPFPTTVVDFWALVWDYTCTAVVVLNYLQE  492

Query  666   NYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQ  845
               +T       Q E     F ++ + ++      T+  L     + ++ ++PPL V  +Q
Sbjct  493   LDETYAEFWPTQDEAAYGRF-HVHLISEEPGAGFTAWTLAL--TNTQQPKKPPLEVRFWQ  549

Query  846   YAEWP-DHGVPKDTLATREIVKRL--HTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRI  1016
               +WP    +P        ++  +  H      G I++ C  G  R+G +CA     ++I
Sbjct  550   LEDWPMKQHLPPHPATIISLLGNVETHHRQSWDGHILITCWDGASRSGIFCAASFLCEQI  609

Query  1017  LLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEEL  1142
                 +  +D+   + + + +R  +++ +EQY  CY+  +  L
Sbjct  610   QSEGL--VDVSQAVRMLKRRRRQLIKDVEQYGLCYELALSYL  649



>gb|KFP49996.1| Receptor-type tyrosine-protein phosphatase kappa, partial [Cathartes 
aura]
Length=374

 Score =   169 bits (429),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 108/259 (42%), Positives = 146/259 (56%), Gaps = 24/259 (9%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N SKNRY  ++P+D  RVVL P      +  GYINAS +        FIA QGPLP T  
Sbjct  1     NQSKNRYKSIIPYDHCRVVLQP----SDTGNGYINASYVDSYRSPRFFIAAQGPLPGTVV  56

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
             DFW+MV Q +   IVMLT LV+  KT KC  Y+  ++ V  +G+  +T   I+TT T L+
Sbjct  57    DFWQMVWQEKTSVIVMLTGLVEQNKT-KCEQYWPEQEQV--YGDFTVTLNNIRTT-TGLV  112

Query  780   LR--CLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPI  944
              R  CL+   K     P  V  F Y  WPDHGVP++    L   E+V +     P+ GP+
Sbjct  113   TRIFCLQ---KAGCALPRVVEQFHYLLWPDHGVPRNPAQLLCLVEMVNKRGLEAPA-GPV  168

Query  945   VVHCSAGIGRTGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCY  1121
             +VHCSAGIGRTGT+ A+   ++   +G     +D+ + +   R QR+ MVQT EQY F Y
Sbjct  169   LVHCSAGIGRTGTFIALDFLLK---MGKAEGKVDVFHCVQRLREQRVSMVQTTEQYTFLY  225

Query  1122  DAIIEELEDIIKESTGQPS  1178
             + +   LE ++  STG P 
Sbjct  226   EVL---LEGLLCGSTGVPG  241



>gb|KGL97037.1| Receptor-type tyrosine-protein phosphatase kappa, partial [Charadrius 
vociferus]
Length=368

 Score =   169 bits (429),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 105/256 (41%), Positives = 145/256 (57%), Gaps = 20/256 (8%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N SKNRY  ++P+D  RVVL P      +  GYINAS +        FIA QGPLP T  
Sbjct  1     NQSKNRYKSIIPYDHCRVVLQP----SDTGNGYINASYVDSYRSPRFFIAAQGPLPGTVV  56

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
             DFW+MV Q +   IVMLT LV+  KT KC  Y+  ++ V  +G+  +T    +TT T L+
Sbjct  57    DFWQMVWQEKTSVIVMLTGLVEQNKT-KCEQYWPEQEQV--YGDFTVTLNNTRTT-TGLV  112

Query  780   LRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPIVV  950
              R   +  K     P +V  F Y  WPDHGVP++    L   E+V +  +   S GP++V
Sbjct  113   TRIFSLR-KAGCALPRAVEQFHYLLWPDHGVPRNPAHLLCLVEVVNKRAS-EASAGPVLV  170

Query  951   HCSAGIGRTGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCYDA  1127
             HCSAGIGRTGT+ A+   ++   +G     +D+ + +   R QR+ MVQT EQY+F Y+ 
Sbjct  171   HCSAGIGRTGTFIALDFLLK---MGKAEGKVDVFHCVQRLREQRVSMVQTKEQYIFLYEV  227

Query  1128  IIEELEDIIKESTGQP  1175
             +   LE ++  STG P
Sbjct  228   L---LEGLLCSSTGIP  240



>gb|KFP04251.1| Receptor-type tyrosine-protein phosphatase kappa, partial [Calypte 
anna]
Length=368

 Score =   169 bits (429),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 111/258 (43%), Positives = 146/258 (57%), Gaps = 24/258 (9%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N SKNRY  ++P+D  RVVL+          GYINAS +        FIA+QGPLP T  
Sbjct  1     NQSKNRYKSIIPYDHCRVVLHT----SDMGNGYINASYVDSYRSPHFFIASQGPLPGTVV  56

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
             DFW+MV Q +   IVMLT LV+  KT KC  Y+  ++ V  +G+  +T   I+TT T L+
Sbjct  57    DFWQMVWQEKTSIIVMLTDLVEQNKT-KCEKYWPEQEEV--YGDFTVTLNNIRTT-TGLV  112

Query  780   LR--CLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPI  944
              R  CL+   K     P  V  F Y  WPDHGVP++    L   E+V +   L  S GP+
Sbjct  113   TRIFCLQ---KAGCALPRVVEQFHYLLWPDHGVPRNPAQLLGLVEVVNK-RGLEASAGPV  168

Query  945   VVHCSAGIGRTGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCY  1121
             VVHCSAGIGRTGT+ A+   ++   +G     +D+   +   R QRI MVQT EQY F Y
Sbjct  169   VVHCSAGIGRTGTFIALDFLLK---MGKAEGKVDVFQCVQRLREQRISMVQTKEQYNFLY  225

Query  1122  DAIIEELEDIIKESTGQP  1175
             +A+   LE ++  STG P
Sbjct  226   EAL---LEGLLCGSTGVP  240


 Score = 55.5 bits (132),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 52/118 (44%), Gaps = 13/118 (11%)
 Frame = +3

Query  306  EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
            EK F+A +K  + F  L             C  A    N  KNR   +LP DS R +L  
Sbjct  264  EKEFKALQKFSELFQLLP------------CREAEKPSNQPKNRRPGILPADSCRPILMS  311

Query  486  CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRL  659
              +   S  GYINA   +      R I TQ P P T  DFW +V    C ++V+L ++
Sbjct  312  SLNADGSP-GYINAVFASTYTQEDRLIITQLPFPTTLVDFWALVWDYTCTSVVVLNQI  368



>ref|XP_007260074.1| PREDICTED: receptor-type tyrosine-protein phosphatase epsilon-like 
[Astyanax mexicanus]
Length=537

 Score =   172 bits (437),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 105/278 (38%), Positives = 155/278 (56%), Gaps = 14/278 (5%)
 Frame = +3

Query  333   IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
             + +EF  L   R+   +MR+  L A    N+ KNR   ++P+D NRV+L+  +   Q   
Sbjct  267   LEEEFKKLTNMRIMKENMRTGNLPA----NMKKNRVLQIIPYDFNRVILSMRRG--QEFT  320

Query  513   GYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGD  692
              YINAS I        FIATQGPL +T EDFW MV + +C +IVMLT L +  +  KC  
Sbjct  321   DYINASFIDGYRQKDYFIATQGPLSHTVEDFWRMVWEWKCHSIVMLTELQEREQD-KCFQ  379

Query  693   YFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGV  872
             Y+  ED V+ +G+  +  K     D +  LR L ++++  +E  L V HF +  WP+ G+
Sbjct  380   YWPTEDSVK-YGDYSVEIKADTQCDETFSLRDLVLTHQPEKETRL-VRHFHFHGWPEIGI  437

Query  873   PKDTLATREIVKRLHTLPPSLG--PIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDL  1046
             P +     +I+  +       G  PIVVHCSAG GRTGT+ A+ N ++R+    +  LD+
Sbjct  438   PAEGKGMIDIIAAVQKQQQQSGNHPIVVHCSAGAGRTGTFIALSNILERVKAEGL--LDV  495

Query  1047  VNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKE  1160
               T+   R QR  MVQT+EQY FCY  ++++  DI  +
Sbjct  496   FQTVKSLRMQRPHMVQTVEQYDFCY-RVVQDFVDIFSD  532


 Score =   131 bits (330),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 76/229 (33%), Positives = 120/229 (52%), Gaps = 8/229 (3%)
 Frame = +3

Query  456   FDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCP  635
             +D +RV+L        S   Y+NAS I   +  ++FIA QGP   T  DFW M+ + +  
Sbjct  12    YDHSRVLLTQIDGVPHS--DYVNASYIDGYKDKNKFIAAQGPKQETVSDFWRMIWEQKSA  69

Query  636   AIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK-WIKTTDTSLILRCLEVSYKES  812
              IVMLT L +  K  KC  Y+  + G   +GN+ +  + +    D ++   C++    + 
Sbjct  70    TIVMLTNLKER-KEDKCYQYW-PDQGCWTYGNVRVAVEDFTVLVDYTIRKFCIQYQASDG  127

Query  813   EEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSL-GPIVVHCSAGIGRTGTYC  989
              + P  V    +  WPD GVP   +   + +K++  + PS  GPIVVHCSAG+GRTGT+ 
Sbjct  128   SKTPRLVTQLHFTSWPDFGVPFSPIGMLKFLKKVKQVNPSYAGPIVVHCSAGVGRTGTFI  187

Query  990   AIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIE  1136
              I   I   ++ +   +D+   ++  R QR  ++QT  QY F Y A++E
Sbjct  188   VIDGMID--MMHEEQKVDVFGFVSKIRDQRSQLIQTDMQYSFIYQALLE  234



>gb|KFV53676.1| Receptor-type tyrosine-protein phosphatase kappa, partial [Gavia 
stellata]
Length=368

 Score =   169 bits (428),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 107/258 (41%), Positives = 145/258 (56%), Gaps = 24/258 (9%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N SKNRY  ++P+D  RVVL P      +  GYINAS +        FIA QGPLP T  
Sbjct  1     NQSKNRYKSIIPYDHCRVVLQP----SDTGNGYINASYVDTYRSPRFFIAAQGPLPGTVL  56

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
             DFW+MV Q +   IVMLT LV+  KT KC  Y+  ++ V  +G+  +T    +TT T L+
Sbjct  57    DFWQMVWQEKTSVIVMLTGLVEQNKT-KCEQYWPEQEQV--YGDFTVTLNNTRTT-TGLV  112

Query  780   LR--CLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPI  944
              R  CL+   K     P  V  F Y  WPDHGVP +    L   E+V +     P+ GP+
Sbjct  113   TRIFCLQ---KAGCALPRVVEQFHYLLWPDHGVPTNPAQLLGLVEVVNKKGLEAPA-GPV  168

Query  945   VVHCSAGIGRTGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCY  1121
             +VHCSAGIGRTGT+ A+   ++   +G     +D+ + +   R QR+ MVQT EQY+F Y
Sbjct  169   LVHCSAGIGRTGTFIALDFLLK---MGKAEGKVDVFHCVQRLREQRVSMVQTKEQYIFLY  225

Query  1122  DAIIEELEDIIKESTGQP  1175
             + +   LE ++  STG P
Sbjct  226   EVL---LEGLLCGSTGGP  240



>ref|XP_784869.2| PREDICTED: receptor-type tyrosine-protein phosphatase H [Strongylocentrotus 
purpuratus]
Length=358

 Score =   169 bits (427),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 106/269 (39%), Positives = 147/269 (55%), Gaps = 19/269 (7%)
 Frame = +3

Query  363   NRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV  542
             N + A +      VA ++ N  KNR+ ++LP+D NRV L       +    YINAS I  
Sbjct  102   NSLPAMEKIRAVTVARNARNDDKNRFRNILPYDYNRVQLKG-----EVGNDYINASYIAD  156

Query  543   SEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVRE  722
              +   ++IATQGPLPNT + FWEMV + +   IVM+T LV+  KT KC  Y+        
Sbjct  157   DQGNRKYIATQGPLPNTIDHFWEMVWETKASTIVMMTALVEGGKT-KCEHYWPTGQKPHL  215

Query  723   FGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDT---LAT  893
              GN+ +T    K T+   I R L +  K +E   L+V H+QY  W DHGVP  T   +A 
Sbjct  216   HGNVTVTLVGSKQTE-HFIQRTLLIGKKGTE---LTVTHYQYLAWTDHGVPASTAPLVAL  271

Query  894   REIVKRLHTLPPSL-GPIVVHCSAGIGRTGTYCA---IHNTIQRILLGDMSALDLVNTIT  1061
                VK       +L GPI+VHCSAGIGRTGT+ A   + N IQR    D   +D+  T+ 
Sbjct  272   LYQVKMTSQEDGALTGPIIVHCSAGIGRTGTFIAADMLMNAIQRSTATDY--IDIAGTVA  329

Query  1062  IFRSQRIGMVQTLEQYLFCYDAIIEELED  1148
               R QR  +VQTL QY++ +  ++  +E+
Sbjct  330   KLREQRTSLVQTLYQYIYLHRIMLSLIEE  358



>ref|XP_009923016.1| PREDICTED: receptor-type tyrosine-protein phosphatase T-like, 
partial [Haliaeetus albicilla]
Length=659

 Score =   173 bits (439),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 118/308 (38%), Positives = 164/308 (53%), Gaps = 29/308 (9%)
 Frame = +3

Query  285   EALKVLKEKRFQAPEKIRQEFGTLQANRMR-----ASDMRSRCLVALDSINISKNRYTDV  449
             EALK  K +  +A +   +      A R+R     +S +   C    +  N SKNRY  +
Sbjct  73    EALKRFKREEIEAEQTEDESVDRHGAGRLREYQQLSSTLLHPCDAGKELCNQSKNRYKSI  132

Query  450   LPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNR  629
             +P+D  RVVL P         GYINAS +        FIA QGPLP T  DFW+MV Q +
Sbjct  133   IPYDHCRVVLQPSD----MGNGYINASYVDSYRSPRFFIAAQGPLPGTVVDFWQMVWQEK  188

Query  630   CPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILR--CLEVSY  803
                IVMLT LV+  KT KC  Y+  ++ V  +G+  +T    +TT T L+ R  CL+   
Sbjct  189   TSIIVMLTGLVEQNKT-KCEQYWPEQEQV--YGDFTVTLSNTRTT-TGLVTRIFCLQ---  241

Query  804   KESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPIVVHCSAGIGR  974
             K     P  V  F Y  WPDHGVP++    LA  ++V +     P+ GP++VHCSAGIGR
Sbjct  242   KAGCALPRVVEQFHYLLWPDHGVPRNPAQLLALVDVVNKRGLEVPT-GPMLVHCSAGIGR  300

Query  975   TGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDI  1151
             TGT+ A+   ++   +G     +D+ + +   R QR+ MVQT EQY F Y+ +   LE +
Sbjct  301   TGTFIALDFLLK---MGKAEGKVDVFHCVQRLREQRVSMVQTKEQYTFLYEVL---LEGL  354

Query  1152  IKESTGQP  1175
             +  STG P
Sbjct  355   LCGSTGVP  362


 Score = 74.7 bits (182),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 70/285 (25%), Positives = 116/285 (41%), Gaps = 27/285 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+A +K  + F  L             C  A    N  KNR   +LP DS R +L  
Sbjct  386   EKEFKALQKFSELFQLLP------------CREAEKPSNQPKNRKPGILPADSCRPILMS  433

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
               +   S  GYINA   +      R I TQ P   T  DFW +V    C ++V+L +L +
Sbjct  434   SLNADGSP-GYINAVFASTYTQEDRLIVTQLPFLTTLVDFWALVWDYTCTSVVVLNQLQE  492

Query  666   NYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQ  845
               KT      F    G   +G   +    + + +  +       +    ++P  S L  Q
Sbjct  493   LDKTYV---EFWPTQGEAAYGRFHVH---LISEEPGVSFTAWTFALTNKQQPKKSALEVQ  546

Query  846   Y---AEWP-DHGVPKDTLATREIVKRLHT--LPPSLGPIVVHCSAGIGRTGTYCAIHNTI  1007
             +    +WP    +P        ++ ++ T       G I+V C  G  R+G +CA     
Sbjct  547   FWQLKDWPMKQRLPPQPATIISLLGKVETRHRQSQDGHILVTCWDGASRSGIFCAATFLC  606

Query  1008  QRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEEL  1142
             ++I       +D+   + + + +R  +++ +EQY  CY+  +  L
Sbjct  607   EQI--QSEGLVDVSQAVRMLKRRRRHLIKDVEQYGLCYELALSYL  649



>ref|XP_010568166.1| PREDICTED: receptor-type tyrosine-protein phosphatase T-like, 
partial [Haliaeetus leucocephalus]
Length=687

 Score =   173 bits (439),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 118/308 (38%), Positives = 164/308 (53%), Gaps = 29/308 (9%)
 Frame = +3

Query  285   EALKVLKEKRFQAPEKIRQEFGTLQANRMR-----ASDMRSRCLVALDSINISKNRYTDV  449
             EALK  K +  +A +   +      A R+R     +S +   C    +  N SKNRY  +
Sbjct  87    EALKRFKREEIEAEQTEDESVDRHGAGRLREYQQLSSTLLHPCDAGKELCNQSKNRYKSI  146

Query  450   LPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNR  629
             +P+D  RVVL P         GYINAS +        FIA QGPLP T  DFW+MV Q +
Sbjct  147   IPYDHCRVVLQP----SDMGNGYINASYVDSYRSPRFFIAAQGPLPGTVVDFWQMVWQEK  202

Query  630   CPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILR--CLEVSY  803
                IVMLT LV+  KT KC  Y+  ++ V  +G+  +T    +TT T L+ R  CL+   
Sbjct  203   TSIIVMLTGLVEQNKT-KCEQYWPEQEQV--YGDFTVTLSNTRTT-TGLVTRIFCLQ---  255

Query  804   KESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPIVVHCSAGIGR  974
             K     P  V  F Y  WPDHGVP++    LA  ++V +     P+ GP++VHCSAGIGR
Sbjct  256   KAGCALPRVVEQFHYLLWPDHGVPRNPAQLLALVDVVNKRGLEVPT-GPMLVHCSAGIGR  314

Query  975   TGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDI  1151
             TGT+ A+   ++   +G     +D+ + +   R QR+ MVQT EQY F Y+ +   LE +
Sbjct  315   TGTFIALDFLLK---MGKAEGKVDVFHCVQRLREQRVSMVQTKEQYTFLYEVL---LEGL  368

Query  1152  IKESTGQP  1175
             +  STG P
Sbjct  369   LCGSTGVP  376


 Score = 66.2 bits (160),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 71/299 (24%), Positives = 116/299 (39%), Gaps = 41/299 (14%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+A +K  + F  L             C  A    N  KNR   +LP DS R +L  
Sbjct  400   EKEFKALQKFSELFQLLP------------CREAEKPSNQPKNRKPGILPADSCRPILMS  447

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
               +   S  GYINA   +      R I TQ P   T  DFW +V    C ++V+L +L +
Sbjct  448   SLNADGSP-GYINAVFASTYTQEDRLIVTQLPFLTTLVDFWALVWDYTCTSVVVLNQLQE  506

Query  666   NYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQ  845
               KT      F    G   +G   +    + + +  +       +    ++P  S L  Q
Sbjct  507   LDKTYV---EFWPTQGKAAYGRFHVH---LISEEPGVSFTAWTFALTNKQQPKKSALEVQ  560

Query  846   Y---AEWP-DHGVPKDTLATREIVKRLHT--LPPSLGPIVVHCSAGIGRTGTYCAIHNTI  1007
             +    +WP    +P        ++ ++ T       G I+V C  G  R+G +CA     
Sbjct  561   FWQLKDWPMKQRLPPQPATIISLLGKVETRHRQSQDGHILVTCWDGASRSGIFCAATFLC  620

Query  1008  QRILLGDMSALDLVNTITIFRSQRIGMV--------------QTLEQYLFCYDAIIEEL  1142
             ++I       +D+   + + + +R  ++              +T EQY  CY+  +  L
Sbjct  621   EQI--QSEGLVDVSQAVRMLKRRRRHLIKDVVGADFKPSQDGKTREQYGLCYELALSYL  677



>gb|KFO89010.1| Receptor-type tyrosine-protein phosphatase kappa, partial [Buceros 
rhinoceros silvestris]
Length=368

 Score =   168 bits (426),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 145/258 (56%), Gaps = 24/258 (9%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N SKNRY  ++P+D  RVVL P      +  GYINAS +        FIA QGPLP T  
Sbjct  1     NQSKNRYKSIIPYDHCRVVLQP----SDTGNGYINASYVDSYRSPHFFIAAQGPLPGTVV  56

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
             DFW+MV Q +   IVMLT LV+  K +KC  Y+  ++ V  +G+  +T    +TT T L+
Sbjct  57    DFWQMVWQEKTSVIVMLTGLVEQNK-IKCEQYWPEQEQV--YGDFTVTLNNTRTT-TGLV  112

Query  780   LR--CLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPI  944
              R  CL+   K     P  V  F Y  WPDHGVP+     L+  E+V +     P+ GP+
Sbjct  113   TRIFCLQ---KAGCALPRVVEQFHYLLWPDHGVPRSPAQLLSLVEMVNKRGFKAPA-GPV  168

Query  945   VVHCSAGIGRTGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCY  1121
             +VHCSAGIGRTGT+ A+   ++   +G     +D+   + + R QR+ MVQT EQY F Y
Sbjct  169   LVHCSAGIGRTGTFIALDFLLK---MGKAEGKVDVFQCVQVLREQRVSMVQTKEQYTFLY  225

Query  1122  DAIIEELEDIIKESTGQP  1175
             + +   LE ++  STG P
Sbjct  226   EVL---LEGLLCGSTGVP  240


 Score = 57.0 bits (136),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/120 (34%), Positives = 53/120 (44%), Gaps = 13/120 (11%)
 Frame = +3

Query  300  LKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVL  479
            L EK F+A +K  + F  L             C  A    N  KNR   +LP DS R +L
Sbjct  262  LLEKEFKALQKFSELFQLLP------------CREAEKPSNQPKNRKPGMLPADSCRPIL  309

Query  480  NPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRL  659
                +   S  GYINA  +       R I TQ P P T  DFW +V    C ++V+L +L
Sbjct  310  MSSLNADGSP-GYINAVFVNTYMEEDRLIITQLPFPTTLVDFWSLVWDYTCTSVVVLNQL  368



>ref|XP_008119911.1| PREDICTED: receptor-type tyrosine-protein phosphatase T-like 
[Anolis carolinensis]
Length=1263

 Score =   176 bits (446),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 106/254 (42%), Positives = 137/254 (54%), Gaps = 17/254 (7%)
 Frame = +3

Query  396   CLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQ  575
             CL   +  N+ KNRY  +LP+D +RVVL            YINAS I       RFIA Q
Sbjct  723   CLAGKEPQNLPKNRYKSILPYDGSRVVLQ----TNDGKADYINASYIDGYRAPKRFIAAQ  778

Query  576   GPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTK--  749
             GPLP T +DFW MV Q R P IVMLT LV+  K  KC  Y+   D   E+G+I +T    
Sbjct  779   GPLPGTVQDFWRMVWQERTPVIVMLTGLVEQNKR-KCEQYW-PPDVQAEYGDITVTLSDT  836

Query  750   WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDT---LATREIVKRLHT  920
             W       ++ R   +  K     P  V HFQ  +WPDHG+P+D    L   E V R  +
Sbjct  837   WAA---PGIVSRTFSLK-KAGAVTPRKVEHFQCLQWPDHGLPRDPAGLLWLLEEVDRQVS  892

Query  921   LPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTL  1100
               PS GPIVVHCSAG+GRTGT+ A+ + ++  +      +D+   +   R QR  MVQT 
Sbjct  893   EAPSAGPIVVHCSAGVGRTGTFIALDSLLK--MGRSEGHVDIFRCVQKMREQRASMVQTK  950

Query  1101  EQYLFCYDAIIEEL  1142
              QY F Y+A++E L
Sbjct  951   GQYAFLYEALLEGL  964


 Score = 71.6 bits (174),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 64/246 (26%), Positives = 102/246 (41%), Gaps = 20/246 (8%)
 Frame = +3

Query  405   ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
             A    N +KNR  ++LP D +R +L           GYINA+ +       RF+ATQ PL
Sbjct  1017  AQKPCNQTKNRSPEILPADGSRPLLMSSLKA-DGTPGYINATFVDGYGQGERFLATQLPL  1075

Query  585   PNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTT  764
             P T  DFW +    RC  +V+L    +  +T  C  ++ A       G I +     +  
Sbjct  1076  PETQADFWALAWDYRCRTLVLLDSPSELDQT--CPAFWPASS-TSTHGVITVALS-SEEP  1131

Query  765   DTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLG--  938
              T   +R L +S  +   P L+         P    P+        + RL +     G  
Sbjct  1132  RTGYTVRGLSLSSAQQVSPVLAPAG------PGPSRPRKNPRNLATLLRLMSEVEEGGWP  1185

Query  939   -----PIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLE  1103
                   I+V C  G+ R G +CA+    ++I    +  LD+     + + ++   +Q +E
Sbjct  1186  SCPDDHILVTCRDGVSRCGVFCALSFVCEQIRAEGL--LDVSRAARMVKRRQPRFIQDVE  1243

Query  1104  QYLFCY  1121
             QY  CY
Sbjct  1244  QYRLCY  1249



>dbj|GAM20689.1| hypothetical protein SAMD00019534_038640, partial [Acytostelium 
subglobosum LB1]
Length=393

 Score =   169 bits (427),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 105/289 (36%), Positives = 150/289 (52%), Gaps = 26/289 (9%)
 Frame = +3

Query  312   RFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCK  491
             +F     + +EF  L+  R     +      AL   N  KNRY +VLP + +RV L+   
Sbjct  97    KFVYNHGVEKEFYFLEK-RTEKDLLHGDFRTALKEENKMKNRYINVLPVEPHRVRLSVDS  155

Query  492   DYRQSARGYINASLIT---VSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLV  662
             D       YINAS I          ++I TQGPL NTF DFW+MV + +   IVMLT+  
Sbjct  156   DDESEGSDYINASYINDPLSKNKEKKYICTQGPLENTFNDFWKMVWEVKSNIIVMLTK--  213

Query  663   DNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKESE----EPPLS  830
             +    +K  D +  + G +++GNI +        DTS++L      Y   E    +    
Sbjct  214   EEESNIKKCDRYWIDAGSKDYGNIRVQF------DTSIVLHEFIQRYFTLENLKTKEKRR  267

Query  831   VLHFQYAEWPDHGVPKDTLATREIVKRLHTLP--PSLGPIVVHCSAGIGRTGTYCAIHNT  1004
             ++H+QY  WPDHG P   ++ +E +  +  +   P  GPI+VHCSAGIGR+GT+C IH+ 
Sbjct  268   IIHYQYIAWPDHGTP---VSIKEFLNLIAAVEKEPKTGPIIVHCSAGIGRSGTFCVIHSV  324

Query  1005  IQRILLG-----DMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIE  1136
             +   + G     ++  L++   I  FRSQR GMVQ  EQY FCY AI E
Sbjct  325   VTNSISGGGADSNVVTLNIPKIIANFRSQRPGMVQNKEQYRFCYLAIAE  373



>ref|XP_004358810.1| protein tyrosine phosphatase [Dictyostelium fasciculatum]
 gb|EGG20960.1| protein tyrosine phosphatase [Dictyostelium fasciculatum]
Length=310

 Score =   166 bits (420),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 111/280 (40%), Positives = 150/280 (54%), Gaps = 15/280 (5%)
 Frame = +3

Query  312   RFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCK  491
             +F     + +EF  ++  +     +      AL   N  KNRY++VLP +  RV L    
Sbjct  20    KFVYNHGVEKEFSYIEK-KTEKDILHGDFKTALKDENKLKNRYSNVLPPEQYRVPLVLEP  78

Query  492   DYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNY  671
             D   S   YINAS I       R+I TQGPL NTF DFW MV + +   IVMLTR  +N 
Sbjct  79    DDHDS--DYINASYINDPAGKQRYICTQGPLENTFNDFWRMVWECKSNVIVMLTREEENS  136

Query  672   KTVKCGDYFQAEDGVREFGNI-CITTKWIKTTDTSLILRCLE-VSYKESEEPPLSVLHFQ  845
             K  KC  Y+  +D   ++G+I  I    I   D  +I R    V+ K +E+  L  +HFQ
Sbjct  137   KK-KCDRYWVDQDS-HDYGHIRLIYETHIALQD--MIQRIFTLVNLKTNEKRKL--VHFQ  190

Query  846   YAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTI---QRI  1016
             Y  WPDHG P        +++ +     + GPI+VHCSAGIGR+GT+C IH+ +   +  
Sbjct  191   YISWPDHGTPVSIKGFLNLIQAVEKEDKT-GPIIVHCSAGIGRSGTFCVIHSVVTNYKNE  249

Query  1017  LLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIE  1136
             L  +   L++   IT FR+QR GMVQT EQY FCY AI E
Sbjct  250   LKNEQYTLNIPKIITNFRTQRPGMVQTKEQYRFCYSAIAE  289



>gb|KFQ55990.1| Receptor-type tyrosine-protein phosphatase kappa, partial [Nestor 
notabilis]
Length=368

 Score =   167 bits (423),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 104/256 (41%), Positives = 144/256 (56%), Gaps = 20/256 (8%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N SKNRY  ++P+D  RVVL P      +  GYINAS +   +    FIA QGPLP T  
Sbjct  1     NQSKNRYKSIIPYDHCRVVLQP----SDTGNGYINASYVDSYQSPRFFIAAQGPLPGTVM  56

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
             DFW+MV Q +   IVMLT LV+  KT KC  Y+   + V  +G+  +T    +TT T L+
Sbjct  57    DFWQMVWQEKTSVIVMLTGLVEQNKT-KCEQYWPDHEQV--YGDFTVTLNNTRTT-TGLV  112

Query  780   LRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDT---LATREIVKRLHTLPPSLGPIVV  950
              R   +  K     P  V    Y  WPDHGVP+++   L   ++V +  +  P+ GP+VV
Sbjct  113   TRIFSLQ-KAGCALPRVVEQLHYLLWPDHGVPRNSAQLLCLVDVVNKRTSEAPA-GPVVV  170

Query  951   HCSAGIGRTGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCYDA  1127
             HCSAGIGRTGT+ A+   ++   +G     +D+ + +   R QR+ MVQT EQY F Y+ 
Sbjct  171   HCSAGIGRTGTFIALDFLLK---MGKAEGKVDVFHCVQRLREQRVSMVQTKEQYTFLYEV  227

Query  1128  IIEELEDIIKESTGQP  1175
             +   LE ++  STG P
Sbjct  228   V---LEGLLCGSTGVP  240


 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 50/118 (42%), Gaps = 13/118 (11%)
 Frame = +3

Query  306  EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
            EK F+A +K  + F  L             C  A    N  KNR   +LP DS R +L  
Sbjct  264  EKEFKALQKFSELFQLLP------------CREAEKPSNQPKNRKPGILPADSCRPILMS  311

Query  486  CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRL  659
              +   S  GYINA          R I TQ P P T  DFW +V    C A+V+L  L
Sbjct  312  SLNADGSP-GYINAVFANTYTEEDRLIITQMPFPTTVVDFWALVWDYTCTAVVVLNYL  368



>ref|XP_008641244.1| PREDICTED: receptor-type tyrosine-protein phosphatase mu-like, 
partial [Corvus brachyrhynchos]
Length=670

 Score =   171 bits (434),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 118/331 (36%), Positives = 170/331 (51%), Gaps = 32/331 (10%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEKI-----RQEFGTLQANRMRAS  380
             + FS D + P   +  ++L    EALK+ K +  +A +       R   G L+  +  +S
Sbjct  65    YSFSVDVRKPNTQILVEELL---EALKMFKREEIEAEQTDDESVDRHGAGLLREYQQLSS  121

Query  381   DMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSR  560
              +   C    +  N  KNRY  ++P+D  RVVL P      +  GYINAS +        
Sbjct  122   TLLHPCNAGKELCNQYKNRYKSIIPYDHCRVVLQP----SDTGNGYINASYVDSYRSPRF  177

Query  561   FIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICI  740
             FIA QGPL  T  DFW+MV Q +   IVMLT LV+  K +KC  Y+  ++ V     + +
Sbjct  178   FIAAQGPLAGTVVDFWQMVWQEKTSVIVMLTGLVEQNK-IKCEQYWPEQEQVYGDFTVTL  236

Query  741   TTKWIKTTDTSLILR--CLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIV  905
                W   T T L+ R  CL+   K     P +V  F Y  WPDHGVP++    L   E+V
Sbjct  237   NNTW---TTTGLVKRIFCLQ---KAGCALPRAVEQFHYLLWPDHGVPRNPSQLLYLVEVV  290

Query  906   KRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRI  1082
              +   L    GP++VHCSAGIGRTGT+ A+   ++   +G     +D+ + +   R QR+
Sbjct  291   NK-RVLEAPAGPVLVHCSAGIGRTGTFIALDFLLK---MGKAEGKVDVFHCVQQLREQRV  346

Query  1083  GMVQTLEQYLFCYDAIIEELEDIIKESTGQP  1175
              MVQT EQY F Y+A+   LE ++  +TG P
Sbjct  347   SMVQTKEQYSFLYEAL---LEGLLCGNTGVP  374


 Score = 76.3 bits (186),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 75/283 (27%), Positives = 118/283 (42%), Gaps = 23/283 (8%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+A +   + F  L             C  A    N  KNR   +LP DS R +L  
Sbjct  398   EKEFKALQSFSELFQLLP------------CREAEKPRNQPKNRKPGILPADSCRPILMS  445

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
               +   S   YINA   +      R I TQ P P T  DFW +V    C ++V+L +L +
Sbjct  446   SVNADGSP-AYINAVFASTYTEEERIIITQLPFPTTLVDFWALVWDYTCTSVVVLNQLQE  504

Query  666   NYKTVKCGDYFQAEDGVREFGNICITTK-WIKTTDTSLILRCLEVSYKESEEPPLSVLHF  842
               KT       Q ED    F    I+ +     T  +L+L     + ++ ++  + +   
Sbjct  505   LDKTYVLFWPTQGEDDYGRFHVQLISEEPGAGFTTWTLVLS----NRQQPKKAAVEIRLH  560

Query  843   QYAEWP--DHGVPK-DTLATREIVKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQR  1013
             Q  +WP   H  P  DT+ +       H      G I+V C  G  R+G +CA     ++
Sbjct  561   QLTDWPMQQHLPPHPDTIISLLGKVETHHRQSQDGHILVTCWDGASRSGIFCAASFLCEQ  620

Query  1014  ILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEEL  1142
             I    M  +D+   + + + +R   ++ +EQY  CY+  +  L
Sbjct  621   IQSEGM--VDVSQAVRMLKRRRRQFIKDVEQYGLCYELALSYL  661



>ref|XP_009894702.1| PREDICTED: receptor-type tyrosine-protein phosphatase T-like, 
partial [Picoides pubescens]
Length=649

 Score =   171 bits (434),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 115/307 (37%), Positives = 161/307 (52%), Gaps = 27/307 (9%)
 Frame = +3

Query  285   EALKVLKEKRFQAPEKIRQEFGTLQANRMR-----ASDMRSRCLVALDSINISKNRYTDV  449
             EALK  K    +A +   +   T  A R+R     +S +   C    +  N SKNRY  +
Sbjct  64    EALKRFKRAEIEAEQTEDELVDTYGAGRLREYQQLSSTLLHPCDTGNELCNQSKNRYKSI  123

Query  450   LPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNR  629
             +P+D  RVVL P      +  GYINAS +        FIA QGPLP T  DFW+MV Q +
Sbjct  124   VPYDHCRVVLQP----SDTGNGYINASYVDSYRSPRFFIAAQGPLPGTVVDFWQMVWQEK  179

Query  630   CPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILR--CLEVSY  803
                IVMLT LV+  K  KC  Y+  +  V  +G+  +T    +TT   L+ R  CL+   
Sbjct  180   TSVIVMLTGLVEQNKN-KCEQYWPEQKQV--YGDFTVTLNNTRTT-MGLVTRIFCLQ---  232

Query  804   KESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPIVVHCSAGIGR  974
             K     P  V  F Y  WPDHGVP++    L+  E+V +   L   +GP++VHCSAGIGR
Sbjct  233   KAGCALPRVVEQFHYLLWPDHGVPRNPAQLLSLVEVVNK-RALEAPVGPVLVHCSAGIGR  291

Query  975   TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  1154
             TGT+ A+   ++  +      +D+ + +   R QR+ MVQT +QY F Y+ +   LE ++
Sbjct  292   TGTFIALDFLLK--MAKAEGKVDVFHCVQRLREQRVSMVQTKDQYTFLYEVL---LEGLL  346

Query  1155  KESTGQP  1175
               STG P
Sbjct  347   CGSTGIP  353


 Score = 75.5 bits (184),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 122/283 (43%), Gaps = 23/283 (8%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+A +K  + F  L             C  A    N  KNR   +LP DS R +L  
Sbjct  377   EKEFKALQKFSELFQLLP------------CSEAEKPSNQPKNRKPGILPADSYRPILMS  424

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
               +   S  GYINA  +       R I TQ P   T  DFW +V    C ++V+L  L +
Sbjct  425   SLNADGSP-GYINAVFVDTYTEEDRLIITQLPFDTTLVDFWALVWDYTCTSVVVLNELQE  483

Query  666   NYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKES-EEPPLSVLHF  842
               KT    +++  +D    +G   +     +   T   +  L ++ ++  ++  L V  +
Sbjct  484   LDKTYV--EFWPTQDEA-AYGRFLVHLI-SEEPGTGFTVWTLALTNRQQPKKSALEVRLW  539

Query  843   QYAEWP-DHGVPKDTLATREIVKRL--HTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQR  1013
             Q  +WP    +P  +     ++ ++  H      G I+V C  G  R+G +CA +   ++
Sbjct  540   QLKDWPMQQPLPPHSATIISLLGKVETHHRQSRDGHILVTCWDGASRSGIFCAANFLCEQ  599

Query  1014  ILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEEL  1142
             I       +D+   + + + +R  +++ +EQY  CY+  I  L
Sbjct  600   I--QSEGLVDVSQAVRMVKRRRRQLIKDVEQYGLCYELAISYL  640



>ref|XP_009955762.1| PREDICTED: receptor-type tyrosine-protein phosphatase mu-like, 
partial [Leptosomus discolor]
Length=576

 Score =   171 bits (432),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 111/296 (38%), Positives = 156/296 (53%), Gaps = 24/296 (8%)
 Frame = +3

Query  285   EALKVLKEKRFQAPEKIRQEFGTLQANRMR-----ASDMRSRCLVALDSINISKNRYTDV  449
             E LK  K    +A +   +   +  A R+R     +S +   C    +  N  KNRY  +
Sbjct  14    ETLKRFKRAEIEAEQTEDESVNSHGAGRLREYQQLSSALLYPCDAGKELCNQGKNRYKSI  73

Query  450   LPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNR  629
             +P+D  RVVL P      +  GYINAS +        FIA QGPL  T  DFW+MV Q +
Sbjct  74    IPYDHCRVVLQPSD----TGNGYINASYVDSYRSPRFFIAAQGPLSETMMDFWQMVWQEK  129

Query  630   CPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILR--CLEVSY  803
                IVMLT LV+  KT KC  Y+  ++ V  +G+  +T    +TT T L+ R  CL+   
Sbjct  130   TSVIVMLTGLVEQNKT-KCEQYWPEQEQV--YGDFTVTLNHTRTT-TGLVTRIFCLK---  182

Query  804   KESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPIVVHCSAGIGR  974
             K     P  V  F Y  WPDHGVP++    L   E+V +     P+ GP++VHCSAGIGR
Sbjct  183   KAGCALPRVVEQFHYLLWPDHGVPRNPAQLLCLVEVVNKRGLEAPA-GPVLVHCSAGIGR  241

Query  975   TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEEL  1142
             TGT+ A+   ++  +      +D+ + +   R QR+ MVQT EQY F Y+A++E L
Sbjct  242   TGTFIALDFLLK--MAKAEGKVDVFHCVQRLREQRVSMVQTKEQYTFLYEALLEGL  295


 Score = 66.6 bits (161),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 63/235 (27%), Positives = 93/235 (40%), Gaps = 25/235 (11%)
 Frame = +3

Query  306  EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
            EK F+A +K  + F  L             C  A    N  KNR   +LP DS R +L  
Sbjct  327  EKEFKALQKFSELFQLLP------------CREAEKPSNQPKNRKPGILPADSCRPILMS  374

Query  486  CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
              +   S  GYINA          R I TQ P P T  DFW +V    C ++V+L +L  
Sbjct  375  SLNADGSP-GYINAVFANTYTEEDRLIITQLPFPTTLVDFWALVWDYTCTSVVVLNQLQQ  433

Query  666  NYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQ  845
              KT      F    G   +G   +    + + +  +      +S    ++P  S L  Q
Sbjct  434  LDKTYV---EFWPTQGEAAYGRFHVH---LISEELGVDFAAWTLSVTNRQQPKKSALKVQ  487

Query  846  Y---AEWP-DHGVPKDTLATREIVKRL--HTLPPSLGPIVVHCSAGIGRTGTYCA  992
            +    +WP    +P        ++ ++  H      G I+V C  G  R+G +CA
Sbjct  488  FWQLKDWPMQQRLPPHPATIISLLGKVETHHRQSQDGHILVTCWDGASRSGIFCA  542



>ref|XP_011407047.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha-like 
[Amphimedon queenslandica]
Length=643

 Score =   171 bits (433),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 94/283 (33%), Positives = 156/283 (55%), Gaps = 15/283 (5%)
 Frame = +3

Query  333   IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSAR  512
              R +FG L +     +       V L S N   NR+ +++ +D NR+ L P   ++    
Sbjct  121   FRNQFGMLDSGESEHT-----VTVGLTSSNKLLNRFANIVVYDDNRITLRPMSGHKDCTN  175

Query  513   GYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGD  692
              YINA  I    +  ++IATQGP+ NT  DFW ++ Q + P I+M+T +++  K VKC  
Sbjct  176   EYINACYINDYSNQYQYIATQGPVSNTLVDFWRLIWQEKSPIIIMITNVIEEGK-VKCQQ  234

Query  693   YFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKES-EEPPLSVLHFQYAEWPDHG  869
             Y+   D  + +G   +T    +   T   +R + V   +S ++PPL +  + +  WPDHG
Sbjct  235   YWPDSD-TKNYGPFSVTLN-DEQVLTDYTVRKMHVKLVDSNDQPPLMITQYHFTSWPDHG  292

Query  870   VPKDTLATREIVKRL-HTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDL  1046
             VP+   +  +  +R+ +   P+ GP++VHCSAG+GRTGT+ AI   +Q+        +D+
Sbjct  293   VPEYATSILQFHRRIKNEYKPTKGPMLVHCSAGVGRTGTFMAIDMGLQQ--AEKEGGIDI  350

Query  1047  VNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQP  1175
             ++ I   R QR+ MVQT +QY+F  DA+   LE ++++ T +P
Sbjct  351   ISIINRMRQQRMKMVQTADQYIFVNDAV---LESVLQQVTQRP  390


 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 69/253 (27%), Positives = 110/253 (43%), Gaps = 23/253 (9%)
 Frame = +3

Query  408   LDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLP  587
             + S N  KNR    LP D+ RV L      +     YINA+ I   +    FI  + P+ 
Sbjct  397   IASQNKDKNRSKQFLPPDNYRVPL------KGEHPDYINAAFINGYKEKKAFIIAESPMF  450

Query  588   NTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFG--NICITTKWIKT  761
             NT  +FW+M+      AIVML    +N + V C  Y+ +       G  NI + +   + 
Sbjct  451   NTARNFWKMIDDRNVTAIVMLCHENENNQEV-CYQYWPSTPSGMILGEYNIKLLS---EE  506

Query  762   TDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLG-  938
             T    I R  EV  + +     SV  +Q   W   G   +      +++ ++      G 
Sbjct  507   THNGYIERKFEVK-QTNTGATQSVTQYQITNWDSTGKLTNPQTILLVIEEMYRTQRKRGN  565

Query  939   -PIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRI---GMVQTLEQ  1106
               IVVHCS  + R+  +CA   TI +          +++   + +SQRI   G VQT++Q
Sbjct  566   TSIVVHCSDTVSRSAMFCAAATTINKC-----KTEGVIDVFQVLKSQRIQKPGSVQTVQQ  620

Query  1107  YLFCYDAIIEELE  1145
             Y   +  ++  L+
Sbjct  621   YQVIFQIVLTYLD  633



>pdb|1NWL|A Chain A, Crystal Structure Of The Ptp1b Complexed With Sp7343-Sp7964, 
A Ptyr Mimetic
 pdb|1NWE|A Chain A, Ptp1b R47c Modified At C47 With N-[4-(2-{2-[3-(2-Bromo- 
Acetylamino)-Propionylamino]-3-Hydroxy-Propionylamino}- 
Ethyl)-Phenyl]-Oxalamic Acid
Length=298

 Score =   165 bits (417),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 109/300 (36%), Positives = 164/300 (55%), Gaps = 26/300 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+  +K        Q  R  ASD  SR  VA    N ++NRY DV PFD +R+ L+ 
Sbjct  4     EKEFEQIDKSGSWAAIYQDIRHEASDFPSR--VAKLPKNKNRNRYCDVSPFDHSRIKLH-  60

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
                  Q    YINASLI + E    +I TQGPLPNT   FWEMV + +   +VML R+++
Sbjct  61    -----QEDNDYINASLIKMEEAQRSYILTQGPLPNTVGHFWEMVWEQKSRGVVMLNRVME  115

Query  666   NYKTVKCGDYF---QAEDGVREFGNICIT--TKWIKTTDTSLILRCLEVSYKESEEPPLS  830
                ++KC  Y+   + ++ + E  N+ +T  ++ IK+  T   L    ++ +E+ E    
Sbjct  116   K-GSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETRE----  170

Query  831   VLHFQYAEWPDHGVPKDTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHN  1001
             +LHF Y  WPD GVP+   +       V+   +L P  GP+VVHCSAGIGR+GT+C    
Sbjct  171   ILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADT  230

Query  1002  TIQRILLG---DMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQ  1172
              +  +L+    D S++D+   +   R  R+G++QT +Q  F Y A+IE  + I+ +S+ Q
Sbjct  231   CL--LLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQ  288



>ref|XP_009483938.1| PREDICTED: receptor-type tyrosine-protein phosphatase alpha-like, 
partial [Pelecanus crispus]
Length=601

 Score =   171 bits (432),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 115/308 (37%), Positives = 162/308 (53%), Gaps = 29/308 (9%)
 Frame = +3

Query  285   EALKVLKEKRFQAPEKIRQEFGTLQANRMR-----ASDMRSRCLVALDSINISKNRYTDV  449
             E LK  K    +A +   +        R+R     +S +   C    +  N SKNRY ++
Sbjct  15    ETLKSFKRAEIEAEQTEDESVDPHGVGRLREYQQLSSTLLHPCDAGKELCNNSKNRYKNI  74

Query  450   LPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNR  629
             +P+D  RVVL P      +   YINAS +        FIA QGPLP T  DFW+MV Q +
Sbjct  75    IPYDHCRVVLQP----SDTGNDYINASYVDSYRSPRFFIAAQGPLPGTVVDFWQMVWQEK  130

Query  630   CPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILR--CLEVSY  803
                IVMLT LV+  KT KC  Y+  ++ V  +G++ +T    +TT T L+ R  CL+   
Sbjct  131   TSVIVMLTGLVEQNKT-KCEQYWPEQEEV--YGDLTVTLNNTRTT-TGLVTRIFCLQ---  183

Query  804   KESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPIVVHCSAGIGR  974
             K     P  V  F Y  WPDHGVP++    L   E+V +     P+ GP++VHCSAGIGR
Sbjct  184   KAGCALPRVVEQFHYLLWPDHGVPRNPAQLLCLMEVVNKRGLEAPA-GPVLVHCSAGIGR  242

Query  975   TGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDI  1151
             TGT+ A+   ++   +G     +D+ + +   R QR+ MVQT EQY F Y+ +   LE +
Sbjct  243   TGTFIALDFLLK---MGKAEGKVDVFHCVQRLREQRVSMVQTKEQYTFLYEVL---LEGL  296

Query  1152  IKESTGQP  1175
             +  STG P
Sbjct  297   LCGSTGVP  304


 Score = 79.3 bits (194),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 119/285 (42%), Gaps = 27/285 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             +K F+A +K  + F  L             C  A  + N  KNR   +LP DS R +L  
Sbjct  328   QKEFKALQKFSELFQLLP------------CREAEKASNQPKNRKPGILPADSCRPILMS  375

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
               +   S  GYINA          R I TQ PL  T  DFW +V    C ++V+L +L +
Sbjct  376   SLNADCSP-GYINAVFANTYTKEDRLIITQLPLSTTLVDFWALVWDYTCTSVVVLNQLQE  434

Query  666   NYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKESEEP---PLSVL  836
               KT      F    G   +G   +    + + +  +      ++    ++P    L VL
Sbjct  435   LDKTYV---EFWPTQGEAAYGRFHVR---LVSEEPGVGFTAWTLALTNRQQPKKSALEVL  488

Query  837   HFQYAEWP-DHGVPKDTLATREIVKRL--HTLPPSLGPIVVHCSAGIGRTGTYCAIHNTI  1007
              +Q  +WP    +P        ++ ++  H      G I+V C  G  R+G +CA     
Sbjct  489   FWQLKDWPMQQCLPPHPATIISLLGKVETHHRQSQDGHILVTCWDGASRSGIFCAASFLC  548

Query  1008  QRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEEL  1142
             ++I       +D+   + + + QR  +++ +EQY  CY+  +  L
Sbjct  549   EQI--QSEGLVDVSQAVRMLKRQRRQLIKDVEQYGLCYELALSYL  591



>gb|KFV69414.1| Tyrosine-protein phosphatase non-receptor type 1, partial [Picoides 
pubescens]
Length=415

 Score =   167 bits (424),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 105/284 (37%), Positives = 156/284 (55%), Gaps = 26/284 (9%)
 Frame = +3

Query  354   LQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASL  533
             LQ  R  ASD    C VA    N ++NRY DV PFD +R+ LN      Q    YINASL
Sbjct  2     LQDIRHEASDFP--CKVAKHPRNKNRNRYRDVSPFDHSRIKLN------QGDNDYINASL  53

Query  534   ITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDG  713
             I + E    +I TQGPLPNT   FWEMV + +C  +VML R+++   +VKC  Y+  ++ 
Sbjct  54    IKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKCRGVVMLNRVMEK-GSVKCAQYWPRKEE  112

Query  714   VREFG-----NICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPK  878
                F       + + ++ IK+  T   L    ++ +E+ E    +LHF Y  WPD GVP+
Sbjct  113   KEMFFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETRE----ILHFHYTTWPDFGVPE  168

Query  879   DTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLG---DMSAL  1040
                +       V+   +L P  GP+VVHCSAGIGR+GT+C +   +  +L+    D S++
Sbjct  169   SPASFLNFLFKVRESGSLNPEHGPVVVHCSAGIGRSGTFCLVDTCL--LLMDKRKDPSSV  226

Query  1041  DLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQ  1172
             D+   +   R  R+G++QT +Q  F Y A+IE  + I+ +++ Q
Sbjct  227   DVKQVLLEMRKYRMGLIQTADQLRFSYLAVIEGAKFIMGDASVQ  270



>pdb|1BZH|A Chain A, Cyclic Peptide Inhibitor Of Human Ptp1b
Length=298

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 109/300 (36%), Positives = 163/300 (54%), Gaps = 26/300 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+  +K        Q  R  ASD    C VA    N ++NRY DV PFD +R+ L+ 
Sbjct  4     EKEFEQIDKSGSWAAIYQDIRHEASDFP--CRVAKLPKNKNRNRYRDVSPFDHSRIKLH-  60

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
                  Q    YINASLI + E    +I TQGPLPNT   FWEMV + +   +VML R+++
Sbjct  61    -----QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVME  115

Query  666   NYKTVKCGDYF---QAEDGVREFGNICIT--TKWIKTTDTSLILRCLEVSYKESEEPPLS  830
                ++KC  Y+   + ++ + E  N+ +T  ++ IK+  T   L    ++ +E+ E    
Sbjct  116   K-GSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETRE----  170

Query  831   VLHFQYAEWPDHGVPKDTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHN  1001
             +LHF Y  WPD GVP+   +       V+   +L P  GP+VVHCSAGIGR+GT+C    
Sbjct  171   ILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADT  230

Query  1002  TIQRILLG---DMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQ  1172
              +  +L+    D S++D+   +   R  R+G++QT EQ  F Y A+IE  + I+ +S+ Q
Sbjct  231   CL--LLMDKRKDPSSVDIKKVLLDMRKFRMGLIQTAEQLRFSYLAVIEGAKFIMGDSSVQ  288



>pdb|1ECV|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b 
Complexed With 5-Iodo-2-(Oxalyl-Amino)-Benzoic Acid
 pdb|1C83|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b 
Complexed With 6-(Oxalyl-Amino)-1h-Indole-5-Carboxylic Acid
 pdb|1C84|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b 
Complexed With 3-(Oxalyl-Amino)-Naphthalene-2-Carboxlic Acid
 pdb|1C85|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b 
Complexed With 2-(Oxalyl-Amino)-Benzoic Acid
 pdb|1C87|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b 
Complexed With 2-(Oxalyl-Amino-4,7-Dihydro-5h-Thieno[2,3- C]pyran-3-Carboxylic 
Acid
 pdb|1C88|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b 
Complexed With 2-(Oxalyl-Amino)-4,5,6,7-Tetrahydro- Thieno[2,3-C]pyridine-3-Carboxylic 
Acid
Length=298

 Score =   164 bits (416),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 109/300 (36%), Positives = 163/300 (54%), Gaps = 26/300 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+  +K        Q  R  ASD    C VA    N ++NRY DV PFD +R+ L+ 
Sbjct  4     EKEFEQIDKSGSWAAIYQDIRHEASDFP--CRVAKLPKNKNRNRYRDVSPFDHSRIKLH-  60

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
                  Q    YINASLI + E    +I TQGPLPNT   FWEMV + +   +VML R+++
Sbjct  61    -----QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVME  115

Query  666   NYKTVKCGDYF---QAEDGVREFGNICIT--TKWIKTTDTSLILRCLEVSYKESEEPPLS  830
                ++KC  Y+   + ++ + E  N+ +T  ++ IKT  T   L    ++ +E+ E    
Sbjct  116   K-GSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKTYYTVRQLELENLTTQETRE----  170

Query  831   VLHFQYAEWPDHGVPKDTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHN  1001
             +LHF Y  WPD GVP+   +       V+   +L P  GP+VVHCSAGIGR+GT+C    
Sbjct  171   ILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADT  230

Query  1002  TIQRILLG---DMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQ  1172
              +  +L+    D S++D+   +   R  R+G++QT +Q  F Y A+IE  + I+ +S+ Q
Sbjct  231   CL--LLMDKRKDPSSVDIKKVLLDMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQ  288



>ref|XP_008496426.1| PREDICTED: receptor-type tyrosine-protein phosphatase mu-like 
[Calypte anna]
Length=980

 Score =   173 bits (439),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 116/286 (41%), Positives = 155/286 (54%), Gaps = 24/286 (8%)
 Frame = +3

Query  336   RQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARG  515
             R   G L+  +  +S     C    +  N SKNRY  ++P+D  RVVL+          G
Sbjct  416   RHGAGHLREYQQLSSSFLHPCNAGKELCNQSKNRYKSIIPYDHCRVVLHT----SDMGNG  471

Query  516   YINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDY  695
             YINAS +        FIA+QGPLP T  DFW+MV Q +   IVMLT LV+  KT KC  Y
Sbjct  472   YINASYVDSYRSPHFFIASQGPLPGTVVDFWQMVWQEKTSIIVMLTDLVEQNKT-KCEKY  530

Query  696   FQAEDGVREFGNICITTKWIKTTDTSLILR--CLEVSYKESEEPPLSVLHFQYAEWPDHG  869
             +  ++ V  +G+  +T   I+TT T L+ R  CL+   K     P  V  F Y  WPDHG
Sbjct  531   WPEQEEV--YGDFTVTLNNIRTT-TGLVTRIFCLQ---KAGCALPRVVEQFHYLLWPDHG  584

Query  870   VPKDT---LATREIVKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSA-  1037
             VP++    L   E+V +   L  S GP+VVHCSAGIGRTGT+ A+   ++   +G     
Sbjct  585   VPRNPAQLLGLVEVVNK-RGLEASAGPVVVHCSAGIGRTGTFIALDFLLK---MGKAEGK  640

Query  1038  LDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQP  1175
             +D+   +   R QRI MVQT EQY F Y+A+   LE ++  STG P
Sbjct  641   VDVFQCVQRLREQRISMVQTKEQYNFLYEAL---LEGLLCGSTGVP  683


 Score = 77.8 bits (190),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 71/288 (25%), Positives = 119/288 (41%), Gaps = 27/288 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+A +K  + F  L             C  A    N  KNR   +LP DS R +L  
Sbjct  707   EKEFKALQKFSELFQLLP------------CREAEKPSNQPKNRRPGILPADSCRPILMS  754

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
               +   S  GYINA   +      R I TQ P P T  DFW +V    C ++V+L ++ +
Sbjct  755   SLNADGSP-GYINAVFASTYTQEDRLIITQLPFPTTLVDFWALVWDYTCTSVVVLNQIQE  813

Query  666   NYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQ  845
               KT      F    G   +G   +    + + +         ++    ++P  S L  Q
Sbjct  814   LDKTYV---EFWPTQGEATYGRFHVH---LISEEPGAGFTAWTLALSNRQQPKKSALEVQ  867

Query  846   YAE---WP-DHGVPKDTLATREIVKRL--HTLPPSLGPIVVHCSAGIGRTGTYCAIHNTI  1007
             + +   WP +  +P        ++ R+  H      G I+V C  G  R+G +CA     
Sbjct  868   FWQLNDWPMEQCLPLYPSTIISLLGRVETHHRQSQGGHILVTCWDGASRSGIFCAASFLC  927

Query  1008  QRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDI  1151
             ++I    +  +D+   + + + +R  +++ +EQY  CY+  +  L   
Sbjct  928   EQIQSEGL--VDVSQAVRMLKRRRRELIKDVEQYGLCYELALSYLNSF  973



>ref|XP_009977801.1| PREDICTED: receptor-type tyrosine-protein phosphatase mu-like 
[Tauraco erythrolophus]
Length=650

 Score =   171 bits (432),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 116/308 (38%), Positives = 162/308 (53%), Gaps = 29/308 (9%)
 Frame = +3

Query  285   EALKVLKEKRFQAPEKIRQEFGTLQANRMR-----ASDMRSRCLVALDSINISKNRYTDV  449
             EALK  K    +A +   +      A R+R     +S +   C    +  N SKNRY  +
Sbjct  64    EALKKFKRAEIEAEQAEDESVHRHGAGRLREYQQLSSTLLHPCDAGKELCNQSKNRYKSI  123

Query  450   LPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNR  629
             +P+D  RVVL P     ++   YINAS +        FIA QGPLP T  DFW+MV Q +
Sbjct  124   IPYDHCRVVLQP----SETGNDYINASYVDSYRSPRFFIAAQGPLPGTVVDFWQMVWQEK  179

Query  630   CPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILR--CLEVSY  803
                IVMLT LV+  KT KC  Y+  ++ V  +G+  +T    +TT T L+ R  CL+   
Sbjct  180   TSVIVMLTGLVEQNKT-KCEQYWPEQEEV--YGDFTVTLNNTRTT-TGLVTRIFCLQ---  232

Query  804   KESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPIVVHCSAGIGR  974
             K     P  V  F Y  WPDHGVP++    L   E+V +     P+ GP++VHCSAGIGR
Sbjct  233   KAGCALPRVVEQFHYLLWPDHGVPRNPSQLLCLVEVVNKRGLEAPA-GPVLVHCSAGIGR  291

Query  975   TGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDI  1151
             TGT+ A+   ++   +G     +D+ + +   R QR+ MVQ  EQY F Y+ +   LE +
Sbjct  292   TGTFIALDFLLK---MGKAEGKVDVFHCVQRLREQRVSMVQNKEQYSFLYEVL---LEGL  345

Query  1152  IKESTGQP  1175
             +  STG P
Sbjct  346   LCGSTGVP  353


 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 68/285 (24%), Positives = 118/285 (41%), Gaps = 27/285 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+A +K  + F  +             C  A    N  KNR   +LP DS R +L  
Sbjct  377   EKEFKALQKFSELFQLVP------------CREAEKPSNQPKNRKPGILPADSFRPILMS  424

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
               +   S  GYINA   +      R I TQ P P T  DFW +V    C ++V+L +L +
Sbjct  425   SLNADGSP-GYINAVFASTYTEEDRLIVTQLPFPATLVDFWSLVWDYTCTSVVVLNQLQE  483

Query  666   NYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLH--  839
               +T      F    G   +G   +    + + +         ++    ++P  S L   
Sbjct  484   LDETYV---EFWPTQGEAAYGRFHVH---LISEEPGFGFAAWTLALTNRQQPKKSALEVR  537

Query  840   -FQYAEWP-DHGVPKDTLATREIVKRLHTLPPSL--GPIVVHCSAGIGRTGTYCAIHNTI  1007
              +Q  +WP    +P        ++ ++ T    +  G I++ C  G  R+G +CA     
Sbjct  538   FWQLKDWPMQQRLPPHPATIISLLGKVETHHRQIQDGHILITCWDGASRSGIFCAASFLC  597

Query  1008  QRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEEL  1142
             ++I       +D+   + + + +R  +++ +EQY  CY+  +  L
Sbjct  598   EQI--QSEGLVDVSQAVRMLKRRRRQLIKDMEQYGLCYELALSYL  640



>gb|KFQ52922.1| Receptor-type tyrosine-protein phosphatase kappa, partial [Pelecanus 
crispus]
Length=368

 Score =   166 bits (421),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 146/258 (57%), Gaps = 24/258 (9%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N SKNRY +++P+D  RVVL P      +   YINAS +        FIA QGPLP T  
Sbjct  1     NNSKNRYKNIIPYDHCRVVLQP----SDTGNDYINASYVDSYRSPRFFIAAQGPLPGTVV  56

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
             DFW+MV Q +   IVMLT LV+  KT KC  Y+  ++ V  +G++ +T    +TT T L+
Sbjct  57    DFWQMVWQEKTSVIVMLTGLVEQNKT-KCEQYWPEQEEV--YGDLTVTLNNTRTT-TGLV  112

Query  780   LR--CLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPI  944
              R  CL+   K     P  V  F Y  WPDHGVP++    L   E+V +     P+ GP+
Sbjct  113   TRIFCLQ---KAGCALPRVVEQFHYLLWPDHGVPRNPAQLLCLMEVVNKRGLEAPA-GPV  168

Query  945   VVHCSAGIGRTGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCY  1121
             +VHCSAGIGRTGT+ A+   ++   +G     +D+ + +   R QR+ MVQT EQY F Y
Sbjct  169   LVHCSAGIGRTGTFIALDFLLK---MGKAEGKVDVFHCVQRLREQRVSMVQTKEQYTFLY  225

Query  1122  DAIIEELEDIIKESTGQP  1175
             + +   LE ++  STG P
Sbjct  226   EVL---LEGLLCGSTGVP  240


 Score = 52.8 bits (125),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 58/126 (46%), Gaps = 8/126 (6%)
 Frame = +3

Query  291  LKVLKEKRFQAPEKIRQ-EFGTLQANRMRASDMRSR--CLVALDSINISKNRYTDVLPFD  461
            ++ L+E     P  + Q EF  LQ    + S++     C  A  + N  KNR   +LP D
Sbjct  248  VRCLQEAETSRPNAVLQKEFKALQ----KFSELFQLLPCREAEKASNQPKNRKPGILPAD  303

Query  462  SNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAI  641
            S R +L    +   S  GYINA          R I TQ PL  T  DFW +V    C ++
Sbjct  304  SCRPILMSSLNADCSP-GYINAVFANTYTKEDRLIITQLPLSTTLVDFWALVWDYTCTSV  362

Query  642  VMLTRL  659
            V+L +L
Sbjct  363  VVLNQL  368



>gb|KFQ68023.1| Receptor-type tyrosine-protein phosphatase kappa, partial [Phaethon 
lepturus]
Length=368

 Score =   166 bits (421),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 145/258 (56%), Gaps = 24/258 (9%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N SKNRY  ++P+D  RVVL P         GYINAS +        FIA QGPLP T  
Sbjct  1     NQSKNRYKSIIPYDHCRVVLQP----SDMGNGYINASYVDSYRSPRFFIAAQGPLPGTVV  56

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
             DFW+MV Q +   IVMLT LV+  KT KC  Y+  ++ V  +G+  +T    +TT T L+
Sbjct  57    DFWQMVWQEKTSVIVMLTGLVEQNKT-KCEQYWPEQEQV--YGDFTVTLNNTRTT-TGLV  112

Query  780   LR--CLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPI  944
              R  CL    K     P  V  F Y  WPDHGVP++    L+  E++ +  +  P+ GP+
Sbjct  113   TRIFCLR---KAGCSLPRVVEQFHYLLWPDHGVPRNPAQLLSLVEVMNKRGSEAPA-GPV  168

Query  945   VVHCSAGIGRTGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCY  1121
             +VHCSAGIGRTGT+ A+   ++   +G     +D+ + +   R QR+ MVQT EQY F Y
Sbjct  169   LVHCSAGIGRTGTFIALDFLLK---MGKAEGKVDVFHCVQRLREQRVSMVQTKEQYTFLY  225

Query  1122  DAIIEELEDIIKESTGQP  1175
             + +   LE ++  STG P
Sbjct  226   EVL---LEGLLCGSTGIP  240


 Score = 53.9 bits (128),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 50/118 (42%), Gaps = 13/118 (11%)
 Frame = +3

Query  306  EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
            EK F+A +K  + F  L             C  A    N  KNR  ++LP DS R +L  
Sbjct  264  EKEFKALQKFSELFQLLP------------CSEAEKPCNQPKNRKPEILPADSCRPILMS  311

Query  486  CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRL  659
              +   S  GYINA          R I TQ P   T  DFW +V    C ++V L +L
Sbjct  312  SLNADGSP-GYINAVFANTYTEEDRLIITQLPFATTLADFWALVWDYTCTSVVALNQL  368



>gb|KFW71638.1| Receptor-type tyrosine-protein phosphatase kappa, partial [Pygoscelis 
adeliae]
Length=368

 Score =   166 bits (421),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 107/258 (41%), Positives = 143/258 (55%), Gaps = 24/258 (9%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N SKNRY  ++P+D  RVVL P         GYINAS +        FIA QGPLP T  
Sbjct  1     NQSKNRYKSIIPYDHCRVVLQP----SDMGNGYINASYMDSYRSPHFFIAAQGPLPGTVV  56

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
             DFW+MV Q +   IVMLT LV+  KT KC  Y+  ++ V  +G+  +T    +TT T L+
Sbjct  57    DFWQMVWQEKTSVIVMLTSLVEQNKT-KCEQYWPEQEQV--YGDFTVTLSNTRTT-TGLV  112

Query  780   LR--CLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPI  944
              R  CL+   K     P  V  F Y  WPDHGVP++    L   E+V +   L    GP+
Sbjct  113   TRIFCLQ---KAGCALPRVVEQFHYLLWPDHGVPRNPAQLLCLVEVVNK-RVLEAPAGPV  168

Query  945   VVHCSAGIGRTGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCY  1121
             +VHCSAGIGRTGT+ A+   ++   +G     +D+ + +   R QR+ MVQT EQY F Y
Sbjct  169   LVHCSAGIGRTGTFIALDFLLK---MGKAEGEVDVFHCVQRLREQRVSMVQTKEQYTFLY  225

Query  1122  DAIIEELEDIIKESTGQP  1175
             + +   LE ++  STG P
Sbjct  226   EVL---LEGLLCGSTGVP  240


 Score = 54.7 bits (130),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 54/118 (46%), Gaps = 13/118 (11%)
 Frame = +3

Query  306  EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
            EK F+A +K  + F  L     R ++  S         N +KNR   +LP DS R +L  
Sbjct  264  EKEFKALQKFSELFQLLPH---REAEKPS---------NQTKNRKPGILPADSCRPILMS  311

Query  486  CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRL  659
              +   S  GYINA          R I TQ P P T  DFW +V    C ++V+L +L
Sbjct  312  SLNADGSP-GYINAIFANTYTEEDRLIITQLPFPTTLVDFWALVWDYTCTSVVVLNQL  368



>ref|XP_006629971.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 9-like 
[Lepisosteus oculatus]
Length=697

 Score =   171 bits (432),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 107/254 (42%), Positives = 141/254 (56%), Gaps = 21/254 (8%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N  +NRY+DVL  D +RV L+P  D  +++  YINAS +   +  S +IATQGPLP TF 
Sbjct  427   NQIRNRYSDVLCLDHSRVKLSPVNDEDETS-DYINASFMDGYKRKSAYIATQGPLPKTFG  485

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDG-VREFGNICITTKWIKTTDTSL  776
             DFW MV + R   IVM TR+V+  + VKCG Y+  E G + E+G   I    IK      
Sbjct  486   DFWRMVWEQRVLIIVMTTRVVERGR-VKCGQYWPLEPGKMEEYGQFLIKNVHIKMFQ-DF  543

Query  777   ILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLAT---REIVKRLH----------  917
              L  LEV   E++E    + H+ Y  WPD GVPK   A    R  VK+            
Sbjct  544   KLSHLEVYNMETKE-SRDIAHYLYMSWPDFGVPKSASAMLDFRAQVKQHQEAAVQALGSE  602

Query  918   -TLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQ  1094
              T P    P+VVHCSAGIGRTGT+C +   + R  L D+  +D+  T+   R+QR   +Q
Sbjct  603   WTGPAGGPPVVVHCSAGIGRTGTFCTLDICLSR--LEDIGTVDVNQTVRRMRTQRAFSIQ  660

Query  1095  TLEQYLFCYDAIIE  1136
             T +QY FCY A+IE
Sbjct  661   TWDQYYFCYMAVIE  674



>ref|XP_002611110.1| hypothetical protein BRAFLDRAFT_206217 [Branchiostoma floridae]
 gb|EEN67120.1| hypothetical protein BRAFLDRAFT_206217, partial [Branchiostoma 
floridae]
Length=578

 Score =   170 bits (430),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 106/289 (37%), Positives = 156/289 (54%), Gaps = 29/289 (10%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N +KNR+ ++  +D +RVVL   +D  Q    Y+NA+ I    H   FIA QGPLPNT  
Sbjct  45    NGTKNRFKNIFTYDHSRVVLTTLED--QPGTDYVNANFIDGYNHPKMFIAAQGPLPNTIN  102

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTD-TSL  776
             DFW MV +     IVM+T L +  KT KC  Y+  +D + ++  I +T +  +TT+    
Sbjct  103   DFWRMVWEQDTATIVMVTNLKEKNKT-KCSQYWPNKDSM-DYDKIRVTLE--ETTNLVDY  158

Query  777   ILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTL-PPSLGPIVVH  953
             ++R  +V     E+PP +V  F +  WPD GVP+  L   + ++R  T  PP  GPIVVH
Sbjct  159   VIRTFDVQKVTDEDPPRTVTQFHFISWPDFGVPQSPLGMMKFIRRAKTSNPPGRGPIVVH  218

Query  954   CSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAII  1133
             CSAG+GR+GT+ AI   +Q ++  +   +D+   I   R  R  MVQT +QY+F Y A++
Sbjct  219   CSAGVGRSGTFIAI-EAMQEMMAAE-GRVDVHGFIGQMRHNRHSMVQT-DQYVFIYRALL  275

Query  1134  E---------ELEDI------IKESTGQPSS*SIETTFK*KLKLLRSPI  1235
             E         E+ +I      +K  +  P+    E  FK   KL R P+
Sbjct  276   EQHLYGDTEVEVANIHRHMHKLKAPSADPNEMGYEAEFK---KLTRIPV  321


 Score =   139 bits (350),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 85/244 (35%), Positives = 124/244 (51%), Gaps = 10/244 (4%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N  KNR   ++P+D+ RV L        S   YIN S I        FIATQGPLPNT E
Sbjct  334   NKGKNRVVSIVPYDTCRVFLPKITGVIGS--DYINGSFIDGYRQRDGFIATQGPLPNTVE  391

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
              FW MV      +IVMLT L +N +  K   Y+  +   + +G + +  K  + ++    
Sbjct  392   TFWRMVWHWESCSIVMLTELEENGRE-KSAKYWPEDR--QTYGKVRVELKNTEQSE-GYT  447

Query  780   LRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHT--LPPSLGPIVVH  953
             LR   VS  + + P   +  F + +W   GVP+      +++ ++    +    GPI VH
Sbjct  448   LRTFHVSNTDKQSPRREIRQFHFHDWSATGVPRSANRVLDLIGQVQKQQMKSGNGPITVH  507

Query  954   CSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAII  1133
             CS G GRTG + A++  ++R+    +   DL  T+   R  R  MVQT EQYLFCY A++
Sbjct  508   CSNGAGRTGAFIALNTVLERVKAEGI--CDLFQTVKSMRYSRPHMVQTAEQYLFCYKAVM  565

Query  1134  EELE  1145
             E L+
Sbjct  566   EYLD  569



>ref|XP_011599120.1| PREDICTED: receptor-type tyrosine-protein phosphatase mu-like 
[Aquila chrysaetos canadensis]
Length=650

 Score =   171 bits (432),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 117/308 (38%), Positives = 161/308 (52%), Gaps = 29/308 (9%)
 Frame = +3

Query  285   EALKVLKEKRFQAPEKIRQEFGTLQANRMR-----ASDMRSRCLVALDSINISKNRYTDV  449
             EALK  K    +A +   +      A R+R     +S +   C    +  N SKNRY  +
Sbjct  64    EALKRFKRAEIEAEQTEDESVDRHGAGRLREYQQLSSTLLHPCDAGKELCNQSKNRYKSI  123

Query  450   LPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNR  629
             +P+D  RVVL P         GYINAS +        FIA QGPLP T  DFW+MV Q +
Sbjct  124   IPYDHCRVVLQPS----DMGNGYINASYVDSYRSPRFFIAAQGPLPGTVVDFWQMVWQEK  179

Query  630   CPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILR--CLEVSY  803
                IVMLT LV+  KT KC  Y+   + V  +G+  +T    +TT T L+ R  CL+   
Sbjct  180   TSIIVMLTGLVEQNKT-KCEQYWPEHEQV--YGDFTVTLSNTRTT-TGLVTRIFCLQ---  232

Query  804   KESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPIVVHCSAGIGR  974
             K     P  V    Y  WPDHGVP++    LA  ++V +     P+ GP++VHCSAGIGR
Sbjct  233   KAGCALPRVVEQLHYLLWPDHGVPRNPAQLLALVDVVNKRGLEVPT-GPVLVHCSAGIGR  291

Query  975   TGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDI  1151
             TGT+ A+   ++   +G     +D+ + +   R QR+ MVQT EQY F Y+ +   LE +
Sbjct  292   TGTFIALDFLLK---MGKAEGKVDVFHCVQRLREQRVSMVQTKEQYTFLYEVL---LEGL  345

Query  1152  IKESTGQP  1175
             +  STG P
Sbjct  346   LCGSTGVP  353


 Score = 77.8 bits (190),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 73/283 (26%), Positives = 120/283 (42%), Gaps = 23/283 (8%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+A +K  + F  L             C  A    N  KNR   +LP DS R +L  
Sbjct  377   EKEFKALQKFSELFQLLP------------CREAEKPSNQPKNRKPGILPADSCRPILMS  424

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
               +   S  GYINA   +      R I TQ P   T  DFW +V    C ++V+L +L +
Sbjct  425   SLNADGSP-GYINAVFASTYTQEDRLIVTQLPFLTTLVDFWALVWDYSCTSVVVLNQLQE  483

Query  666   NYKTVKCGDYFQAEDGVREFGNICITTK-WIKTTDTSLILRCLEVSYKESEEPPLSVLHF  842
               KT       Q E     F    I+ +  +  T  +L L     + ++ ++  L V  +
Sbjct  484   LDKTYVEFWPTQGEAAYGRFHVHLISEEPGVNFTAWTLAL----TNKQQPKKSALEVRFW  539

Query  843   QYAEWP-DHGVPKDTLATREIVKRL--HTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQR  1013
             Q  +WP    +P+       ++ ++  H      G I+V C  G  R+G +CA     ++
Sbjct  540   QLKDWPMKQRLPRQPATIISLLGKVETHHRQSQDGHILVTCWDGASRSGIFCAASFLCEQ  599

Query  1014  ILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEEL  1142
             I       +D+   + + + +R  +++ +EQY  CY+  +  L
Sbjct  600   I--QSEGLVDVSQAVRMLKRRRRQLIKDVEQYGLCYELALSYL  640



>ref|XP_002155297.2| PREDICTED: receptor-type tyrosine-protein phosphatase F-like 
[Hydra vulgaris]
Length=662

 Score =   171 bits (432),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/242 (38%), Positives = 136/242 (56%), Gaps = 9/242 (4%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N  KNRY +++ +D +RV+L+  ++  +    YINAS +   +  +  IATQGPLPNTF 
Sbjct  120   NKPKNRYANIVAYDHSRVILSKIEN--EPGSDYINASYLDTYKKANSAIATQGPLPNTFN  177

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
             DFW MV +     IVMLT L +  K +KC  Y+   D   E+G + +     +       
Sbjct  178   DFWRMVWEVTSSCIVMLTNLQEKNK-LKCHKYW--PDASNEYGQVIVNL-LAEEIFADYT  233

Query  780   LRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTL-PPSLGPIVVHC  956
             +R  ++++K   +    V  F +  WPDHGVP    A     +++ +   P  GPI+VHC
Sbjct  234   IRSFKIAHKNFAQEFREVKQFHFTSWPDHGVPTQPTALLSFWRKVRSYEKPKSGPIIVHC  293

Query  957   SAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIE  1136
             SAG+GRTG Y A+   + R  L +   +D  N IT  R +RI MVQT +QY+F +DAI+E
Sbjct  294   SAGVGRTGVYIALDAMLDR--LKEEGTVDTFNFITAMRMRRIAMVQTEDQYIFLHDAIVE  351

Query  1137  EL  1142
             E+
Sbjct  352   EI  353


 Score =   105 bits (262),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 79/262 (30%), Positives = 126/262 (48%), Gaps = 25/262 (10%)
 Frame = +3

Query  402   VALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGP  581
             VA+   N SKNR++ +LP DS+RV+L P     ++   YINA  I   +  + +I +Q P
Sbjct  403   VAMALQNNSKNRFSTILPTDSSRVLLLPIDGSEETT--YINAVYIDSYKQKNAYILSQCP  460

Query  582   LPNTFEDFWEMVIQNRCPAIVMLTRL--VDNYKTVKCGDYFQAEDGVREFGNICITTKWI  755
             LP T  DFW MV ++    IVML  L   D+Y T      F  E G   +G I + +   
Sbjct  461   LPKTVADFWRMVCEHGSSTIVMLNTLDEGDDYAT------FWPEKGSFNYGKITVASLES  514

Query  756   KTTD-----------TSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD--TLATR  896
               +D             L +R  +VS        L+V   QY  W +  VP +  T+ + 
Sbjct  515   SKSDDINLNGVLKLPVELNVRNFKVSDVRQSNMLLTVKLLQYTGWTETRVPTNYKTMISL  574

Query  897   EIVKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQ  1076
              ++ +         PI++ CS G+GR+GT  AI  T++++ +  +  +D+   +   R  
Sbjct  575   LVIIQKWIQQSKDSPIIILCSDGVGRSGTLAAILYTLEQLKIEQV--VDVFQAVKRMRMH  632

Query  1077  RIGMVQTLEQYLFCYDAIIEEL  1142
             R  +V+ ++QY F Y  + E L
Sbjct  633   RPHLVKYMDQYRFIYLVVQEYL  654



>gb|KFV12427.1| Receptor-type tyrosine-protein phosphatase kappa, partial [Pterocles 
gutturalis]
Length=368

 Score =   166 bits (420),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 103/256 (40%), Positives = 143/256 (56%), Gaps = 20/256 (8%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N SKNRY  ++P+D  RVVL P      +  GYINAS +        FIA QGPLP T  
Sbjct  1     NQSKNRYKSIIPYDHCRVVLQP----SDTGNGYINASYVDSYRSPHFFIAAQGPLPGTVV  56

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
             DFW+MV Q +   IVMLT LV+  KT KC  Y+  ++ +  +G+  +T    +TT T L+
Sbjct  57    DFWQMVWQEKISVIVMLTGLVEQNKT-KCEQYWPEQEQI--YGDFTVTLNNTRTT-TGLV  112

Query  780   LRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPIVV  950
              R   +  K     P  V  F Y  WPDHGVP++    L   ++V +     P+ GP++V
Sbjct  113   TRIFSLQ-KTGCALPRVVEQFHYLLWPDHGVPRNPAQLLCLVDLVNKTGVEAPA-GPVLV  170

Query  951   HCSAGIGRTGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCYDA  1127
             HCSAGIGRTGT+ A+   ++   +G     +D+ + +   R QR+ MVQT EQY F Y+ 
Sbjct  171   HCSAGIGRTGTFIALDFLLK---MGKAEGKVDVFHCVQRLREQRVSMVQTKEQYTFLYEV  227

Query  1128  IIEELEDIIKESTGQP  1175
             +   LE ++  STG P
Sbjct  228   L---LEGLLCGSTGVP  240


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 50/118 (42%), Gaps = 13/118 (11%)
 Frame = +3

Query  306  EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
            EK F+A +K  + F  L             C  A    N  KNR   +LP DS R +L  
Sbjct  264  EKEFKALQKFSELFQLLP------------CREAEKPSNQPKNRKPGILPADSCRPILMS  311

Query  486  CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRL  659
              +   S  GYINA          R I TQ P   T  DFW +V    C ++V+L +L
Sbjct  312  SLNADGSP-GYINAVFANTYTEEDRLIVTQLPFTTTLVDFWALVWDYTCTSVVVLNQL  368



>pdb|1BZC|A Chain A, Human Ptp1b Catalytic Domain Complexed With Tpi
Length=321

 Score =   164 bits (416),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 109/300 (36%), Positives = 163/300 (54%), Gaps = 26/300 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+  +K        Q  R  ASD    C VA    N ++NRY DV PFD +R+ L+ 
Sbjct  4     EKEFEQIDKSGSWAAIYQDIRHEASDFP--CRVAKLPKNKNRNRYRDVSPFDHSRIKLH-  60

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
                  Q    YINASLI + E    +I TQGPLPNT   FWEMV + +   +VML R+++
Sbjct  61    -----QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVME  115

Query  666   NYKTVKCGDYF---QAEDGVREFGNICIT--TKWIKTTDTSLILRCLEVSYKESEEPPLS  830
                ++KC  Y+   + ++ + E  N+ +T  ++ IK+  T   L    ++ +E+ E    
Sbjct  116   K-GSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETRE----  170

Query  831   VLHFQYAEWPDHGVPKDTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHN  1001
             +LHF Y  WPD GVP+   +       V+   +L P  GP+VVHCSAGIGR+GT+C    
Sbjct  171   ILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADT  230

Query  1002  TIQRILLG---DMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQ  1172
              +  +L+    D S++D+   +   R  R+G++QT EQ  F Y A+IE  + I+ +S+ Q
Sbjct  231   CL--LLMDKRKDPSSVDIKKVLLDMRKFRMGLIQTAEQLRFSYLAVIEGAKFIMGDSSVQ  288



>ref|XP_009683697.1| PREDICTED: receptor-type tyrosine-protein phosphatase mu-like 
[Struthio camelus australis]
Length=647

 Score =   170 bits (431),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 112/307 (36%), Positives = 159/307 (52%), Gaps = 26/307 (8%)
 Frame = +3

Query  285   EALKVLKEKRFQAPEK------IRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTD  446
             EALK  K +  +A +        R+  G L   +   S +   C    +  N  KNRY  
Sbjct  60    EALKRFKREEVEAEQTEDESVINREGAGRLGEYQKLVSTLLHPCDAGKELCNEGKNRYKS  119

Query  447   VLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQN  626
             ++P+D  RVVL P      +  GYINAS +   +    FIA QGPLP T  DFW+MV Q 
Sbjct  120   IIPYDHCRVVLQP----SDTGNGYINASYVESYQSPRFFIAAQGPLPGTVVDFWQMVWQE  175

Query  627   RCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYK  806
             +   IVMLT LV+  KT KC  Y+  ++ V  +G+  +T    +TT + L+ R   +   
Sbjct  176   KTSVIVMLTSLVEQNKT-KCEQYWPEQEQV--YGDFTVTLSNTRTT-SGLVTRIFHLQKA  231

Query  807   ESEEPPLSVLHFQYAEWPDHGVPKDTLA----TREIVKRLHTLPPSLGPIVVHCSAGIGR  974
               + P L V  F Y  WPDHGVP++         ++ KR+   P   GP++VHCSAGIGR
Sbjct  232   GCDLPRL-VEQFHYLLWPDHGVPRNPAQLLCLVEKVNKRVSEDPA--GPVLVHCSAGIGR  288

Query  975   TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDII  1154
             TGT+ A+   ++  +      +D+   +   R QR+ MVQT EQY F Y+ +   LE ++
Sbjct  289   TGTFIALDFLLK--MAKAEGKVDVFRCVQRLREQRVSMVQTKEQYTFLYEVL---LEGLL  343

Query  1155  KESTGQP  1175
               STG P
Sbjct  344   CGSTGVP  350


 Score = 70.5 bits (171),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 72/285 (25%), Positives = 116/285 (41%), Gaps = 27/285 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+A +K  + F  L             C  A    N  KNR   +LP DS R VL  
Sbjct  374   EKEFKALQKFSELFQLLP------------CKEAEKPSNQPKNRKPGILPADSCRPVLMS  421

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
               +   S R YINA          RFI TQ P   T  DFW +V    C ++V+L +L +
Sbjct  422   SLNADGSPR-YINAVFADTYTEEDRFIITQLPFLATLVDFWALVWDYTCTSVVVLNQLQE  480

Query  666   NYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQ  845
               +T      F    G   +G  C   + I + +         ++    ++P  S L  Q
Sbjct  481   LDQTYV---EFWPTQGETIYG--CFHVQLI-SEEPGAGFTVWTLALTNKQQPKKSALKVQ  534

Query  846   YAE---WP-DHGVPKDTLATREIVKRL--HTLPPSLGPIVVHCSAGIGRTGTYCAIHNTI  1007
             + +   WP    +P        ++ ++  H        ++V C  G  R+G +CA     
Sbjct  535   FCQLEDWPMQQCLPPCPATIISLLGKVETHQHQSQGSHVLVTCWDGASRSGIFCASSFLC  594

Query  1008  QRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEEL  1142
             ++I       +D+   + + + +R  +V+ +EQY  CY+  +  L
Sbjct  595   EQI--QSEGQVDVSQAVRMLKRRRRQLVKDVEQYRLCYELALSYL  637



>ref|XP_001635917.1| predicted protein [Nematostella vectensis]
 gb|EDO43854.1| predicted protein, partial [Nematostella vectensis]
Length=580

 Score =   169 bits (429),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/246 (38%), Positives = 141/246 (57%), Gaps = 10/246 (4%)
 Frame = +3

Query  405   ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
             +L   N  KNRY +++ +D +RV+L P +   +S   YINA+ I        FIA+QGPL
Sbjct  41    SLHPANKYKNRYANIVAYDHSRVLLTPLEGVLES--DYINANYIDGYNRSGAFIASQGPL  98

Query  585   PNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTT  764
             P TF+DFW MV +     IVMLT+L +  +  KC  Y+  + G R +G + +T    +T 
Sbjct  99    PETFDDFWRMVWEQGSAIIVMLTQLEERGRR-KCDQYW-PDRGTRNYGALRVTAN--ETF  154

Query  765   DTS-LILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTL-PPSLG  938
               S  +LR   VS+ + EE P  V  + Y  WPDHGVP        +V+ + +  PP+ G
Sbjct  155   HMSYYVLRTFLVSHMQEEEEPRQVRQYHYTSWPDHGVPAHPAPLLSMVRTVSSANPPTAG  214

Query  939   PIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFC  1118
             P++VHCSAG+GRTGT+  + + +QR        +D+   +   R++R  MVQT  QY+F 
Sbjct  215   PMIVHCSAGVGRTGTFITLDSMLQRA--AQEGTIDVFGFVRQMRNKRNLMVQTESQYVFI  272

Query  1119  YDAIIE  1136
             +DA++E
Sbjct  273   HDALVE  278


 Score =   152 bits (383),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 91/249 (37%), Positives = 137/249 (55%), Gaps = 10/249 (4%)
 Frame = +3

Query  405   ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
             A+ S N +KNRY ++LP++  RV L+      +    YINAS I  +  +  +IATQ P+
Sbjct  331   AMLSCNAAKNRYANILPYERTRVALHMRPG--EVGSDYINASFIDGNHRLKAYIATQAPV  388

Query  585   PNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTT  764
             P TFEDFW M+ +     IVMLTR  +  K +KC  Y+ + DG R +  I +     + T
Sbjct  389   PRTFEDFWRMLWEQESAVIVMLTREEEAGK-LKCHRYWPS-DGSRLYDKILVELT-EELT  445

Query  765   DTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGP-  941
              +  +LR   +++ E E+    V  FQ  +WPD G+P+  +   +++ ++       G  
Sbjct  446   YSDYVLRQFSLTHTE-EKSSRIVRQFQCTDWPDSGLPESGVGLIDLIGQVEKWQQQSGNT  504

Query  942   -IVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFC  1118
              I VHCS G+GRTG +CA+   I+R+    +  +D+  T+   R QR  MVQT +QY FC
Sbjct  505   CITVHCSGGVGRTGVFCAVSILIERVKAEGL--IDVFQTVQHLRLQRPAMVQTKDQYEFC  562

Query  1119  YDAIIEELE  1145
             Y  I E LE
Sbjct  563   YTTIQEYLE  571



>ref|XP_002127301.1| PREDICTED: receptor-type tyrosine-protein phosphatase gamma-like 
[Ciona intestinalis]
Length=939

 Score =   172 bits (436),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 103/282 (37%), Positives = 157/282 (56%), Gaps = 15/282 (5%)
 Frame = +3

Query  339   QEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKD-YRQSARG  515
             +EF  +Q N  R   +R    V ++  N  KNRYT+++ +D  RV+L   ++ +R   RG
Sbjct  282   EEFEEIQ-NWQRPCSLRCDASVLVE--NTEKNRYTNIVAYDHTRVLLQANRNRHRNLHRG  338

Query  516   --YINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCG  689
               YINA+ ++       +IA QGPLPNTF DFW MV +N    I+M+T LV+  +  KC 
Sbjct  339   ADYINANYVSSYTSNRAYIACQGPLPNTFNDFWRMVWENNTSTIIMITNLVEKGRR-KCD  397

Query  690   DYFQAEDGVREFGNICITTK----WIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEW  857
              Y+  E G  ++ +I +T K    +   T  S  L+  ++S +        V+ F Y +W
Sbjct  398   QYWPQE-GREQYKHIVVTLKSTEVFANYTVRSFTLKNNKLSRRNGRGGERRVMQFHYTQW  456

Query  858   PDHGVPKDTLATREIVKRLHTL-PPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMS  1034
             PDHG P+  L     +++  T  PP  GPIV+HCSAG+GRTGTY  IH+ ++  +L    
Sbjct  457   PDHGTPEYLLPVLSFIRKSSTYKPPHAGPIVIHCSAGVGRTGTYIVIHSMME--MLQATG  514

Query  1035  ALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKE  1160
              +++   +   R QR  +VQT +QY+F +DAI+E +   I E
Sbjct  515   YVNVREFLRQIRLQRNHLVQTEDQYVFVHDAILEHITSGITE  556


 Score = 56.6 bits (135),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 85/173 (49%), Gaps = 12/173 (7%)
 Frame = +3

Query  405  ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARG--YINASLITVSEHVSRFIATQG  578
            A+ S+N +KNR   +LP   +R +L  C   R SA G  YINAS +        FI TQ 
Sbjct  613  AMRSVNENKNRPGALLPVFRSRALL--CN--RTSAEGSDYINASFLQSYRSSHGFIITQL  668

Query  579  PLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTV-KCGDYFQAEDGVREFGNICITTKWI  755
            PLP T +DFW+++  + C +IV    ++DN  T  +C    Q+        N+   ++ +
Sbjct  669  PLPTTKKDFWQLIWDHNCSSIVT---ILDNESTENECYWPNQSRPLHCNSFNVSFGSESL  725

Query  756  KTTDTSLILRCLEVSYKESEEP-PLSVLHFQYAEWPDHGVPKDTL-ATREIVK  908
             + ++   L+C E   + +++   L+V  F+ + W         L A R I+K
Sbjct  726  VSDESECRLKCREFILEATKDDYVLAVKQFELSSWSTETPSITQLNALRHIIK  778



>pdb|3QCL|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 
1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-(4-Hydroxybut-1-Yn-1- 
Yl)benzoic Acid
 pdb|3QCN|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 
1, Trigonal Crystal Form
Length=310

 Score =   164 bits (415),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 137/251 (55%), Gaps = 14/251 (6%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N  KNRY ++L +D +RV L P          YINA+ +        +IATQGPL +TFE
Sbjct  56    NKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFE  115

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKT----TD  767
             DFW M+ +     IVM+T LV+  +  KC  Y+  E+   E+GNI +T K  K     T 
Sbjct  116   DFWRMIWEQNTGIIVMITNLVEKGRR-KCDQYWPTEN-TEEYGNIIVTLKSTKIHACYTV  173

Query  768   TSLILRCLEVSYKESEEPPLS-----VLHFQYAEWPDHGVPKDTLATREIVKRLHTLP-P  929
                 +R  +V   +   P        V+ + Y +WPD GVP+  L     V+R      P
Sbjct  174   RRFSIRNTKVKKGQKGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMP  233

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
               GP++VHCSAG+GRTGTY  I + +Q+I   D S ++++  +   R+QR  +VQT EQY
Sbjct  234   ETGPVLVHCSAGVGRTGTYIVIDSMLQQI--KDKSTVNVLGFLKHIRTQRNYLVQTEEQY  291

Query  1110  LFCYDAIIEEL  1142
             +F +DA++E +
Sbjct  292   IFIHDALLEAI  302



>ref|XP_005524932.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 1 [Pseudopodoces 
humilis]
Length=434

 Score =   167 bits (423),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 164/300 (55%), Gaps = 26/300 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK FQ  ++        Q  +  ASD    C VA    N ++NRY DV PFD +R+ LN 
Sbjct  4     EKEFQRLDQAASWAAIYQDIKHEASDFP--CKVAKHPRNKNRNRYRDVSPFDHSRIKLN-  60

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
                  Q    YINASLI + E    +I TQGPLPNT   FWEMV + +   +VML R+++
Sbjct  61    -----QGDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVME  115

Query  666   NYKTVKCGDYF---QAEDGVREFGNICIT--TKWIKTTDTSLILRCLEVSYKESEEPPLS  830
                ++KC  Y+   + ++ V E  N+ +T  ++ IK+  T   L    ++ +E+ E    
Sbjct  116   K-GSIKCAQYWPRKENKEMVFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETRE----  170

Query  831   VLHFQYAEWPDHGVPKDTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHN  1001
             +LHF Y  WPD GVP+   +       V+   +L P  GP+VVHCSAGIGR+GT+C +  
Sbjct  171   ILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPGHGPVVVHCSAGIGRSGTFCLVDT  230

Query  1002  TIQRILLG---DMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQ  1172
              +  +L+    D S++D+   +   R  R+G++QT +Q  F Y A+IE  + I+ +++ Q
Sbjct  231   CL--LLMDKRKDPSSVDVKQVLLEMRKYRMGLIQTADQLRFSYLAVIEGAKFIMGDASVQ  288



>ref|XP_002948414.1| hypothetical protein VOLCADRAFT_45223 [Volvox carteri f. nagariensis]
 gb|EFJ50289.1| hypothetical protein VOLCADRAFT_45223, partial [Volvox carteri 
f. nagariensis]
Length=251

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 101/256 (39%), Positives = 137/256 (54%), Gaps = 27/256 (11%)
 Frame = +3

Query  429   KNRYTDVLPFDSNRVVLNPCKDYRQSARG--YINASLITVSEHVS----RFIATQGPLPN  590
             ++RY++VLP+D NRV+L P    +Q +    YINAS +   +       R+IA QGPLP+
Sbjct  1     RHRYSNVLPYDLNRVILQPSPAPQQGSPDPTYINASHVIHDDAQCGFSVRYIACQGPLPS  60

Query  591   TFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITT-KWIKTTD  767
             T  DFW M    R  A+VMLT +V+     KC  Y+ A+ G R    +  ++    + T 
Sbjct  61    TEADFWRMCWGERVGAVVMLTNVVER-GINKCSTYYPAQPGARLVMAVSSSSLHAGELTY  119

Query  768   TSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPIV  947
             T L L C       S +    V H QY  WPDHG P D  A R +   +  +  + G +V
Sbjct  120   TVLRLSCSGCGGASSRD----VTHLQYNAWPDHGTPADASAIRTMCDMVEPVRGAGGAVV  175

Query  948   VHCSAGIGRTGTYCAIHNTIQRILL---------GDM------SALDLVNTITIFRSQRI  1082
             VHCSAGIGRTGT+CAI    +R+           G++      +ALDL   +   R QR 
Sbjct  176   VHCSAGIGRTGTFCAIDIMRRRLAYLEACAASRPGNVRADAVQAALDLPELVHSLRRQRS  235

Query  1083  GMVQTLEQYLFCYDAI  1130
             GMVQT+EQY+FCY AI
Sbjct  236   GMVQTIEQYVFCYQAI  251



>pdb|1L8G|A Chain A, Crystal Structure Of Ptp1b Complexed With 7-(1,1-dioxo-1h- 
Benzo[d]isothiazol-3-yloxymethyl)-2-(oxalyl-amino)-4,7- 
Dihydro-5h-thieno[2,3-c]pyran-3-carboxylic Acid
Length=321

 Score =   164 bits (415),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 109/300 (36%), Positives = 163/300 (54%), Gaps = 26/300 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+  +K        Q  R  ASD    C VA    N ++NRY DV PFD +R+ L+ 
Sbjct  4     EKEFEQIDKSGSWAAIYQDIRHEASDFP--CRVAKLPKNKNRNRYRDVSPFDHSRIKLH-  60

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
                  Q    YINASLI + E    +I TQGPLPNT   FWEMV + +   +VML R+++
Sbjct  61    -----QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVME  115

Query  666   NYKTVKCGDYF---QAEDGVREFGNICIT--TKWIKTTDTSLILRCLEVSYKESEEPPLS  830
                ++KC  Y+   + ++ + E  N+ +T  ++ IKT  T   L    ++ +E+ E    
Sbjct  116   K-GSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKTYYTVRQLELENLTTQETRE----  170

Query  831   VLHFQYAEWPDHGVPKDTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHN  1001
             +LHF Y  WPD GVP+   +       V+   +L P  GP+VVHCSAGIGR+GT+C    
Sbjct  171   ILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADT  230

Query  1002  TIQRILLG---DMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQ  1172
              +  +L+    D S++D+   +   R  R+G++QT +Q  F Y A+IE  + I+ +S+ Q
Sbjct  231   CL--LLMDKRKDPSSVDIKKVLLDMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQ  288



>ref|XP_003463711.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 1 [Cavia 
porcellus]
Length=432

 Score =   167 bits (422),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 110/297 (37%), Positives = 157/297 (53%), Gaps = 20/297 (7%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+  +K        Q  R  ASD    C VA    N ++NRY DV PFD +R+ L+ 
Sbjct  4     EKEFEQIDKAGSWAAIYQDIRHEASDFP--CRVAKLPKNKNRNRYRDVSPFDHSRIKLH-  60

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
                  Q    YINASLI + E    +I TQGPLPNT   FWEMV + +   +VML RL++
Sbjct  61    -----QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRLIE  115

Query  666   NYKTVKCGDYF-QAEDGVREFGNICITTKWI-KTTDTSLILRCLEVSYKESEEPPLSVLH  839
                +VKC  Y+ Q E+    F +  +    I +   +   +R LE+    ++E    +LH
Sbjct  116   K-GSVKCAQYWPQKENKEMVFDDTNLKLTLISEDIKSYYTVRQLELENPTTQE-TREILH  173

Query  840   FQYAEWPDHGVPKDTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQ  1010
             F Y  WPD GVP+   +       V+   +L P  GPIVVHCSAGIGR+GT+C     + 
Sbjct  174   FHYTTWPDFGVPESPASFLNFLFKVRESGSLNPEHGPIVVHCSAGIGRSGTFCLADTCL-  232

Query  1011  RILLG---DMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQ  1172
              +L+    D S++D+   +   R  R+G++QT +Q  F Y A+IE    I+ +S+ Q
Sbjct  233   -LLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGARFIMGDSSAQ  288



>gb|KFQ83372.1| Receptor-type tyrosine-protein phosphatase kappa, partial [Phoenicopterus 
ruber ruber]
Length=368

 Score =   165 bits (418),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 146/258 (57%), Gaps = 24/258 (9%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N SKNRY  ++P+D  RVVL        +  GYINAS +        FIA QGPLP T  
Sbjct  1     NQSKNRYKSIIPYDHCRVVLQT----SDTGSGYINASYVDSYRSPCFFIAAQGPLPGTVV  56

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
             DFW+M+ Q +   IVMLT LV+  K +KC  Y+  ++ V  +G+  +T   I+TT T L+
Sbjct  57    DFWQMIWQEKVSVIVMLTGLVEQNK-IKCEQYWPEQEQV--YGDFTVTLNNIRTT-TGLV  112

Query  780   LR--CLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPI  944
              R  CL+   K     P +V  F Y  WPDHGVP++    L   E+V +  +L    GP+
Sbjct  113   TRIFCLQ---KAGCALPRAVEQFHYLLWPDHGVPRNPAQLLCLVEVVNK-RSLEAPAGPV  168

Query  945   VVHCSAGIGRTGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCY  1121
             +VHCSAGIGRTGT+ A+   ++   +G     +D+ + +   R QR+ MVQT EQY F Y
Sbjct  169   LVHCSAGIGRTGTFIALDFLLK---MGKAEGKVDVFHCVQRLREQRVSMVQTKEQYTFLY  225

Query  1122  DAIIEELEDIIKESTGQP  1175
             + +   LE ++  +TG P
Sbjct  226   EVL---LEGLLCGTTGVP  240



>pdb|2H4V|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphatase 
Gamma
 pdb|2H4V|B Chain B, Crystal Structure Of The Human Tyrosine Receptor Phosphatase 
Gamma
Length=320

 Score =   164 bits (415),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 101/298 (34%), Positives = 151/298 (51%), Gaps = 26/298 (9%)
 Frame = +3

Query  315   FQAPEKIRQEFGTLQANRMRA------------SDMRSRCLVALDSINISKNRYTDVLPF  458
             FQ+ ++  +  G L +N                +DM      +    N  KNRY ++L +
Sbjct  20    FQSMKQFVKHIGELYSNNQHGFSEDFEEVQRCTADMNITAEHSNHPENKHKNRYINILAY  79

Query  459   DSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPA  638
             D +RV L P          YINA+ +        +IATQGPL +TFEDFW M+ +     
Sbjct  80    DHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFEDFWRMIWEQNTGI  139

Query  639   IVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKT----TDTSLILRCLEVSYK  806
             IVM+T LV+  +  KC  Y+  E+   E+GNI +T K  K     T     +R  +V   
Sbjct  140   IVMITNLVEKGRR-KCDQYWPTENS-EEYGNIIVTLKSTKIHACYTVRRFSIRNTKVKKG  197

Query  807   ESEEPPLS-----VLHFQYAEWPDHGVPKDTLATREIVKRLHTLP-PSLGPIVVHCSAGI  968
             +   P        V+ + Y +WPD GVP+  L     V+R      P  GP++VHCSAG+
Sbjct  198   QKGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMPETGPVLVHCSAGV  257

Query  969   GRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEEL  1142
             GRTGTY  I + +Q+I   D S ++++  +   R+QR  +VQT EQY+F +DA++E +
Sbjct  258   GRTGTYIVIDSMLQQI--KDKSTVNVLGFLKHIRTQRNYLVQTEEQYIFIHDALLEAI  313



>gb|KFM13528.1| Receptor-type tyrosine-protein phosphatase kappa, partial [Aptenodytes 
forsteri]
Length=368

 Score =   165 bits (418),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 106/258 (41%), Positives = 143/258 (55%), Gaps = 24/258 (9%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N SKNRY  ++P+D  RVVL P         GYINAS +        FIA QGPLP T  
Sbjct  1     NQSKNRYKSIIPYDHCRVVLQPSG----MGNGYINASYVDSYRSPRFFIAAQGPLPGTVV  56

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
             DFW+MV Q +   IVMLT LV+  KT KC  Y+  ++ V  +G+  +T    +TT   L+
Sbjct  57    DFWQMVWQEKTSVIVMLTSLVEQNKT-KCEQYWPEQEQV--YGDFTVTLSNTRTT-MGLV  112

Query  780   LR--CLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPI  944
              R  CL+   K     P  V  F Y  WPDHGVP++    L   E+V +   L  + GP+
Sbjct  113   TRIFCLQ---KAGCALPRVVQQFHYLLWPDHGVPRNPAQLLCLVEVVNK-RVLEVTAGPV  168

Query  945   VVHCSAGIGRTGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCY  1121
             +VHCSAGIGRTGT+ A+   ++   +G     +D+ + +   R QR+ MVQT EQY F Y
Sbjct  169   LVHCSAGIGRTGTFIALDFLLK---MGKAEGKVDVFHCVQRLREQRVSMVQTKEQYTFLY  225

Query  1122  DAIIEELEDIIKESTGQP  1175
             + +   LE ++  STG P
Sbjct  226   EVL---LEGLLCGSTGVP  240


 Score = 56.2 bits (134),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 52/118 (44%), Gaps = 13/118 (11%)
 Frame = +3

Query  306  EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
            EK F+A +K  + F  L             C  A    N +KNR   +LP DS R +L  
Sbjct  264  EKEFKALQKFSELFQLLP------------CREAEKPSNQTKNRKPGILPADSCRPILMS  311

Query  486  CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRL  659
              +   S  GYINA          R I TQ P P T  DFW +V    C ++V+L +L
Sbjct  312  SLNADGSP-GYINAIFANTYTEEDRLIITQLPFPTTLVDFWALVWDYTCTSVVVLNQL  368



>ref|XP_005235887.1| PREDICTED: receptor-type tyrosine-protein phosphatase mu-like 
[Falco peregrinus]
Length=661

 Score =   169 bits (429),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 115/297 (39%), Positives = 158/297 (53%), Gaps = 35/297 (12%)
 Frame = +3

Query  336   RQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARG  515
             R   G L+  +  +S +   C    +  N SKNRY  ++P+D  RVVL P      +  G
Sbjct  86    RHGAGRLREYQQLSSTLLHPCDAGKELCNQSKNRYKSIIPYDHCRVVLQP----SDTGNG  141

Query  516   YINASLITVSEHVSR-----------FIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLV  662
             YINAS + V    S            FIA QGPLP T  DFW+MV Q +   IVMLT LV
Sbjct  142   YINASYVDVGSKESLSPSRSYRSPRFFIAAQGPLPGTVVDFWQMVWQEKISVIVMLTGLV  201

Query  663   DNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILR--CLEVSYKESEEPPLSVL  836
             +  KT KC  Y+  ++ V  +G+  +T    +TT T LI R  CL+   K    P   V 
Sbjct  202   EQNKT-KCEQYWPEQEQV--YGDFTVTLSNTRTT-TGLITRIFCLQ---KAGCAPLRVVE  254

Query  837   HFQYAEWPDHGVPKDT---LATREIVKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTI  1007
              F Y  WPDHGVP+++   L   E+V +     P+ GP++VHCSAGIGRTGT+ A+   +
Sbjct  255   QFHYLLWPDHGVPRNSAQLLCLVEMVNKTGLEKPA-GPVLVHCSAGIGRTGTFIALDFLL  313

Query  1008  QRILLGDMS-ALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQP  1175
             +   +G     +D+ + +   R QR+ MVQT EQY F Y+ +   LE ++  STG P
Sbjct  314   K---MGKAERKVDVFHCVQRLREQRVSMVQTKEQYAFLYEVL---LEGLLCGSTGVP  364


 Score = 82.0 bits (201),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 73/284 (26%), Positives = 123/284 (43%), Gaps = 25/284 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+A +K  + F  L             C  A    N  KNR   +LP DS R +L  
Sbjct  388   EKEFKALQKFSELFQLLP------------CREAEKPTNQPKNRKPGILPADSCRPILMS  435

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
               +   S  GYINA   +      R I TQ P P T  DFW +V    C ++V+L ++ +
Sbjct  436   LLNADGSP-GYINAVFASTYIEEDRLIITQLPFPTTLVDFWALVWDYTCTSVVVLNQVQE  494

Query  666   NYKTVKCGDYFQAEDGVREFG--NICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLH  839
               KT      F    G   +G  N+ + ++  +   T+  L     + ++ ++  L V  
Sbjct  495   LDKTYV---EFWPTQGQAAYGHFNVHLISEEPEAGFTAWTLAL--TNRQQPKKSALEVRF  549

Query  840   FQYAEWP-DHGVPKDTLATREIVKRL--HTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQ  1010
             +Q  +WP  H +P        ++ ++  H      G I+V C  G  R+G +CA     +
Sbjct  550   WQLKDWPMQHRLPPHPATIISLLGKVETHHRQSQDGHILVTCWDGASRSGIFCAASFLCE  609

Query  1011  RILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEEL  1142
             +I       +D+   + + + +R  +++ +EQY  CY+  +  L
Sbjct  610   QI--QSEGLVDVSQAVRMLKKRRRQLIKDVEQYGLCYELALSYL  651



>ref|XP_011670232.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 9 isoform 
X2 [Strongylocentrotus purpuratus]
Length=576

 Score =   169 bits (428),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 102/262 (39%), Positives = 146/262 (56%), Gaps = 36/262 (14%)
 Frame = +3

Query  417   INISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGP  581
             +N+ KNRY DVL +D +RV L     +P  DY       +NA+ +   +  + FIATQG 
Sbjct  303   LNVHKNRYADVLCYDHSRVFLPILNGDPYSDY-------LNANYMDGYKQKNAFIATQGA  355

Query  582   LPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVR-EFGNICITTKWIK  758
             LP TF DFW M+ +++C  IVM TR V+  + +KCG Y+  E+G   E+G I +    I+
Sbjct  356   LPKTFSDFWLMIWESQCRTIVMTTRTVERGR-LKCGQYWPLEEGTSGEYGKISVANLEIE  414

Query  759   TTD--TSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLAT---REIVKRLH--  917
             T    T  +L     +  ES      + HFQ+  WPD G P+  LA    RE V++    
Sbjct  415   TRRDYTITVLTVHNSTTNESRR----ITHFQFTSWPDFGTPRSALAMLEFREEVRQYQST  470

Query  918   ---------TLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFR  1070
                      T  P   PIVVHCSAGIGRTGT+C +  ++ R  L D++ +D+ NT+ + R
Sbjct  471   SVKEMGDEWTGHPGGPPIVVHCSAGIGRTGTFCTLDISLAR--LEDVATIDVCNTVRLMR  528

Query  1071  SQRIGMVQTLEQYLFCYDAIIE  1136
             +QR   +QT +QY FCY A++E
Sbjct  529   AQRAYSIQTPDQYEFCYFALVE  550



>dbj|BAD02404.1| protein tyrosine phosphatase e [Oryzias latipes]
Length=680

 Score =   169 bits (429),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 167/320 (52%), Gaps = 17/320 (5%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
             + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  368   YSFIYQALLEYYLYGDTELDVCSLEGHLHRLHNTRAPNDRLGLEEEFRKLTNVRIMKENM  427

Query  387   RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
             R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  428   RTGNLPA----NMRKNRVLQIIPYDFNRVILSVRRG--QEFTDYINASFIDGYRQKDYFI  481

Query  567   ATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITT  746
             ATQGPL +T EDFW MV + RC +IVMLT L +  +  KC  Y+ +E  V  FG+  +  
Sbjct  482   ATQGPLSHTVEDFWRMVWEWRCHSIVMLTELKEREQE-KCFQYWPSEGSVI-FGDYAVEL  539

Query  747   KWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLP  926
                ++   +   + + ++YK  E+ P  V HF +  WP+ G+P D     +I+  +    
Sbjct  540   TG-ESQGETFTRKDMLLTYKSQEKQPQHVRHFHFHGWPEIGIPVDGRGMIDIIAAVQRQQ  598

Query  927   PSLG--PIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTL  1100
                G  PI+VHCSAG GRTGT+ A+ N ++R+    +  LD+  T+   R QR  MVQT+
Sbjct  599   QQSGNRPIIVHCSAGAGRTGTFIALSNILERVKAEGL--LDVFQTVKSLRMQRPHMVQTV  656

Query  1101  EQYLFCYDAIIEELEDIIKE  1160
             EQY FCY  ++++  DI  +
Sbjct  657   EQYDFCY-KVVQDFIDIFSD  675


 Score =   155 bits (392),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 94/242 (39%), Positives = 135/242 (56%), Gaps = 10/242 (4%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N  KNRY ++LP+D +RVVL+    +  S   YINAS I   +  ++FIA QGP P T  
Sbjct  143   NREKNRYPNILPYDHSRVVLSHLDGHLCS--DYINASYIDGFKEKNKFIAAQGPKPETLA  200

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
             DFW MV + +   IVMLT L +  K  KC  Y+  E G   +GNI +  + +       I
Sbjct  201   DFWRMVWEQKTATIVMLTNLKER-KEEKCCQYW-PEKGCWMYGNIRVALEDVTVLVDYTI  258

Query  780   LRCLEVSYKESEEP--PLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSL-GPIVV  950
              +C  V Y++S+ P  P  V    +  WPD GVP   +   + +K++ T+ PS  GPIVV
Sbjct  259   RKCC-VQYQDSDGPRAPRLVTQLHFTSWPDFGVPFTPIGMLKFLKKVKTVNPSYAGPIVV  317

Query  951   HCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAI  1130
             HCSAG+GRTGT+  I + I   ++     +D+   ++  R QR  ++QT  QY F Y A+
Sbjct  318   HCSAGVGRTGTFIVIDSMID--MMHVEQRVDVFGFVSRIREQRCQLIQTDMQYSFIYQAL  375

Query  1131  IE  1136
             +E
Sbjct  376   LE  377



>ref|XP_011206340.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 9 isoform 
X6 [Bactrocera dorsalis]
 ref|XP_011206341.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 9 isoform 
X6 [Bactrocera dorsalis]
 ref|XP_011206342.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 9 isoform 
X6 [Bactrocera dorsalis]
 ref|XP_011206343.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 9 isoform 
X6 [Bactrocera dorsalis]
Length=507

 Score =   168 bits (425),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 107/297 (36%), Positives = 162/297 (55%), Gaps = 45/297 (15%)
 Frame = +3

Query  291   LKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNR  470
             +K   E R +APE      GT    RMR               N++KNRYTDVL +D +R
Sbjct  217   VKEYAEIRNRAPE------GTFVYARMRN--------------NLTKNRYTDVLCYDHSR  256

Query  471   VVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVML  650
             VVL+     R+    YINA+ +   +  + +I+TQGPLP T +DFW M+ +  C  +VM 
Sbjct  257   VVLS-----REDGEDYINANFVDGYKQKNAYISTQGPLPKTSQDFWRMIWEQHCLVVVMT  311

Query  651   TRLVDNYKTVKCGDYFQ-AEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPL  827
             TR+++  + VKCG Y++  E+   EFGN  + T  I+  +    +  LE+   +++E   
Sbjct  312   TRVMERGR-VKCGQYWEPTENSSLEFGNFHVRTLSIEINE-DYTVASLELKNLKTDE-IR  368

Query  828   SVLHFQYAEWPDHGVPKDTLATREIVKRLH----TLPPSLG----------PIVVHCSAG  965
             +V H+Q+  WPD+GVP   +A    ++++     ++  +LG          PIVVHCSAG
Sbjct  369   NVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQASMVKALGDTWAGHPRGPPIVVHCSAG  428

Query  966   IGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIE  1136
             IGRTGT+  +   I R  L D+   D+  T+   RSQR   +Q  +QY+FC+ A+IE
Sbjct  429   IGRTGTFITLDICISR--LEDVGTADIRGTVEKIRSQRAYSIQMPDQYVFCHLALIE  483



>gb|KFP94960.1| Receptor-type tyrosine-protein phosphatase kappa, partial [Haliaeetus 
albicilla]
Length=368

 Score =   165 bits (417),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 107/258 (41%), Positives = 145/258 (56%), Gaps = 24/258 (9%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N SKNRY  ++P+D  RVVL P         GYINAS +        FIA QGPLP T  
Sbjct  1     NQSKNRYKSIIPYDHCRVVLQP----SDMGNGYINASYVDSYRSPRFFIAAQGPLPGTVV  56

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
             DFW+MV Q +   IVMLT LV+  KT KC  Y+  ++ V  +G+  +T    +TT T L+
Sbjct  57    DFWQMVWQEKTSIIVMLTGLVEQNKT-KCEQYWPEQEQV--YGDFTVTLSNTRTT-TGLV  112

Query  780   LR--CLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPI  944
              R  CL+   K     P  V  F Y  WPDHGVP++    LA  ++V +     P+ GP+
Sbjct  113   TRIFCLQ---KAGCALPRVVEQFHYLLWPDHGVPRNPAQLLALVDVVNKRGLEVPT-GPM  168

Query  945   VVHCSAGIGRTGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCY  1121
             +VHCSAGIGRTGT+ A+   ++   +G     +D+ + +   R QR+ MVQT EQY F Y
Sbjct  169   LVHCSAGIGRTGTFIALDFLLK---MGKAEGKVDVFHCVQRLREQRVSMVQTKEQYTFLY  225

Query  1122  DAIIEELEDIIKESTGQP  1175
             + +   LE ++  STG P
Sbjct  226   EVL---LEGLLCGSTGVP  240


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 51/118 (43%), Gaps = 13/118 (11%)
 Frame = +3

Query  306  EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
            EK F+A +K  + F  L             C  A    N  KNR   +LP DS R +L  
Sbjct  264  EKEFKALQKFSELFQLLP------------CREAEKPSNQPKNRKPGILPADSCRPILMS  311

Query  486  CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRL  659
              +   S  GYINA   +      R I TQ P   T  DFW +V    C ++V+L +L
Sbjct  312  SLNADGSP-GYINAVFASTYTQEDRLIVTQLPFLTTLVDFWALVWDYTCTSVVVLNQL  368



>pdb|1G7F|A Chain A, Human Ptp1b Catalytic Domain Complexed With Pnu177496
Length=298

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 163/300 (54%), Gaps = 26/300 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+  +K        Q  R  ASD    C VA    N ++NRY DV PFD +R+ L+ 
Sbjct  4     EKEFEQIDKSGSWAAIYQDIRHEASDFP--CRVAKLPKNKNRNRYRDVSPFDHSRIKLH-  60

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
                  Q    YINASLI + E    +I TQGPLPNT   FWEMV + +   +VML R+++
Sbjct  61    -----QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVME  115

Query  666   NYKTVKCGDYF---QAEDGVREFGNICIT--TKWIKTTDTSLILRCLEVSYKESEEPPLS  830
                ++KC  Y+   + ++ + E  N+ +T  ++ IK+  T   L    ++ +E+ E    
Sbjct  116   K-GSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETRE----  170

Query  831   VLHFQYAEWPDHGVPKDTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHN  1001
             +LHF Y  WPD GVP+   +       V+   +L P  GP+VVHCSAGIGR+GT+C    
Sbjct  171   ILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADT  230

Query  1002  TIQRILLG---DMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQ  1172
              +  +L+    D S++D+   +   R  R+G++QT +Q  F Y A+IE  + I+ +S+ Q
Sbjct  231   CL--LLMDKRKDPSSVDIKKVLLDMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQ  288



>pdb|1G7G|A Chain A, Human Ptp1b Catalytic Domain Complexes With Pnu179326
 pdb|1JF7|A Chain A, Human Ptp1b Catalytic Domain Complexed With Pnu177836
 pdb|1JF7|B Chain B, Human Ptp1b Catalytic Domain Complexed With Pnu177836
 pdb|1KAK|A Chain A, Human Tyrosine Phosphatase 1b Complexed With An Inhibitor
 pdb|1KAV|A Chain A, Human Tyrosine Phosphatase 1b Complexed With An Inhibitor
 pdb|1T48|A Chain A, Allosteric Inhibition Of Protein Tyrosine Phosphatase 
1b
 pdb|1T49|A Chain A, Allosteric Inhibition Of Protein Tyrosine Phosphatase 
1b
 pdb|1T4J|A Chain A, Allosteric Inhibition Of Protein Tyrosine Phosphatase 
1b
 pdb|2F6T|A Chain A, Protein Tyrosine Phosphatase 1b With Sulfamic Acid Inhibitors
 pdb|2F6V|A Chain A, Protein Tyrosine Phosphatase 1b With Sulfamic Acid Inhibitors
 pdb|2F6W|A Chain A, Protein Tyrosine Phosphatase 1b With Sulfamic Acid Inhibitors
 pdb|2F6Y|A Chain A, Protein Tyrosine Phosphatase 1b With Sulfamic Acid Inhibitors
 pdb|2F6Z|A Chain A, Protein Tyrosine Phosphatase 1b With Sulfamic Acid Inhibitors
 pdb|2F70|A Chain A, Protein Tyrosine Phosphatase 1b With Sulfamic Acid Inhibitors
 pdb|2F71|A Chain A, Protein Tyrosine Phosphatase 1b With Sulfamic Acid Inhibitors
Length=298

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 163/300 (54%), Gaps = 26/300 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+  +K        Q  R  ASD    C VA    N ++NRY DV PFD +R+ L+ 
Sbjct  4     EKEFEQIDKSGSWAAIYQDIRHEASDFP--CRVAKLPKNKNRNRYRDVSPFDHSRIKLH-  60

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
                  Q    YINASLI + E    +I TQGPLPNT   FWEMV + +   +VML R+++
Sbjct  61    -----QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVME  115

Query  666   NYKTVKCGDYF---QAEDGVREFGNICIT--TKWIKTTDTSLILRCLEVSYKESEEPPLS  830
                ++KC  Y+   + ++ + E  N+ +T  ++ IK+  T   L    ++ +E+ E    
Sbjct  116   K-GSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETRE----  170

Query  831   VLHFQYAEWPDHGVPKDTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHN  1001
             +LHF Y  WPD GVP+   +       V+   +L P  GP+VVHCSAGIGR+GT+C    
Sbjct  171   ILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADT  230

Query  1002  TIQRILLG---DMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQ  1172
              +  +L+    D S++D+   +   R  R+G++QT +Q  F Y A+IE  + I+ +S+ Q
Sbjct  231   CL--LLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQ  288



>pdb|2NT7|A Chain A, Crystal Structure Of Ptp1b-inhibitor Complex
 pdb|2NTA|A Chain A, Crystal Structure Of Ptp1b-Inhibitor Complex
Length=299

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 163/300 (54%), Gaps = 26/300 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+  +K        Q  R  ASD    C VA    N ++NRY DV PFD +R+ L+ 
Sbjct  4     EKEFEQIDKSGSWAAIYQDIRHEASDFP--CRVAKLPKNKNRNRYRDVSPFDHSRIKLH-  60

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
                  Q    YINASLI + E    +I TQGPLPNT   FWEMV + +   +VML R+++
Sbjct  61    -----QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVME  115

Query  666   NYKTVKCGDYF---QAEDGVREFGNICIT--TKWIKTTDTSLILRCLEVSYKESEEPPLS  830
                ++KC  Y+   + ++ + E  N+ +T  ++ IK+  T   L    ++ +E+ E    
Sbjct  116   K-GSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETRE----  170

Query  831   VLHFQYAEWPDHGVPKDTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHN  1001
             +LHF Y  WPD GVP+   +       V+   +L P  GP+VVHCSAGIGR+GT+C    
Sbjct  171   ILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADT  230

Query  1002  TIQRILLG---DMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQ  1172
              +  +L+    D S++D+   +   R  R+G++QT +Q  F Y A+IE  + I+ +S+ Q
Sbjct  231   CL--LLMDKRKDPSSVDIKKVLLDMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQ  288



>pdb|3QCB|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 
1, Apo
 pdb|3QCB|B Chain B, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 
1, Apo
 pdb|3QCC|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 
1, In Complex With Vanadate, Orthorhombic Crystal Form
 pdb|3QCC|B Chain B, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 
1, In Complex With Vanadate, Orthorhombic Crystal Form
 pdb|3QCD|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 
1, In Complex With Vanadate, Trigonal Crystal Form
 pdb|3QCE|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 
1, In Complex With 3-[(3,4-Dichlorobenzyl)sulfanyl]thiophene-2-Carboxylic 
Acid Via Soaking
 pdb|3QCE|B Chain B, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 
1, In Complex With 3-[(3,4-Dichlorobenzyl)sulfanyl]thiophene-2-Carboxylic 
Acid Via Soaking
 pdb|3QCF|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 
1, In Complex With 3-[(3,4-Dichlorobenzyl)sulfanyl]thiophene-2-Carboxylic 
Acid Via Co-Crystallization
 pdb|3QCF|B Chain B, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 
1, In Complex With 3-[(3,4-Dichlorobenzyl)sulfanyl]thiophene-2-Carboxylic 
Acid Via Co-Crystallization
 pdb|3QCG|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 
1, In Complex With 3-[(3-Bromo-4-Chlorobenzyl)sulfanyl]thiophene-2- 
Carboxylic Acid
 pdb|3QCH|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 
1, In Complex With 3-[(3,4-Dichlorobenzyl)sulfanyl]-N-(Methylsulfonyl) 
Thiophene-2-Carboxamide
 pdb|3QCI|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 
1, In Complex With N-[(3-Aminophenyl)sulfonyl]-3-[(3,4-Dichlorobenzyl) 
Sulfanyl]thiophene-2-Carboxamide
 pdb|3QCJ|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 
1, In Complex With 5-[({3-[(3,4-Dichlorobenzyl)sulfanyl]thiophen-2- 
Yl}carbonyl)sulfamoyl]-2-Methoxybenzoic Acid
 pdb|3QCK|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 
1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]benzoic 
Acid
Length=310

 Score =   163 bits (413),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 137/251 (55%), Gaps = 14/251 (6%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N  KNRY ++L +D +RV L P          YINA+ +        +IATQGPL +TFE
Sbjct  56    NKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFE  115

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKT----TD  767
             DFW M+ +     IVM+T LV+  +  KC  Y+  E+   E+GNI +T K  K     T 
Sbjct  116   DFWRMIWEQNTGIIVMITNLVEKGRR-KCDQYWPTENS-EEYGNIIVTLKSTKIHACYTV  173

Query  768   TSLILRCLEVSYKESEEPPLS-----VLHFQYAEWPDHGVPKDTLATREIVKRLHTLP-P  929
                 +R  +V   +   P        V+ + Y +WPD GVP+  L     V+R      P
Sbjct  174   RRFSIRNTKVKKGQKGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMP  233

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
               GP++VHCSAG+GRTGTY  I + +Q+I   D S ++++  +   R+QR  +VQT EQY
Sbjct  234   ETGPVLVHCSAGVGRTGTYIVIDSMLQQI--KDKSTVNVLGFLKHIRTQRNYLVQTEEQY  291

Query  1110  LFCYDAIIEEL  1142
             +F +DA++E +
Sbjct  292   IFIHDALLEAI  302



>pdb|1BZJ|A Chain A, Human Ptp1b Complexed With Tpicooh
Length=297

 Score =   163 bits (412),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 163/300 (54%), Gaps = 26/300 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+  +K        Q  R  ASD    C VA    N ++NRY DV PFD +R+ L+ 
Sbjct  3     EKEFEQIDKSGSWAAIYQDIRHEASDFP--CRVAKLPKNKNRNRYRDVSPFDHSRIKLH-  59

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
                  Q    YINASLI + E    +I TQGPLPNT   FWEMV + +   +VML R+++
Sbjct  60    -----QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVME  114

Query  666   NYKTVKCGDYF---QAEDGVREFGNICIT--TKWIKTTDTSLILRCLEVSYKESEEPPLS  830
                ++KC  Y+   + ++ + E  N+ +T  ++ IK+  T   L    ++ +E+ E    
Sbjct  115   K-GSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETRE----  169

Query  831   VLHFQYAEWPDHGVPKDTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHN  1001
             +LHF Y  WPD GVP+   +       V+   +L P  GP+VVHCSAGIGR+GT+C    
Sbjct  170   ILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADT  229

Query  1002  TIQRILLG---DMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQ  1172
              +  +L+    D S++D+   +   R  R+G++QT +Q  F Y A+IE  + I+ +S+ Q
Sbjct  230   CL--LLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQ  287



>ref|XP_011670231.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 9 isoform 
X1 [Strongylocentrotus purpuratus]
Length=601

 Score =   169 bits (427),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 102/262 (39%), Positives = 146/262 (56%), Gaps = 36/262 (14%)
 Frame = +3

Query  417   INISKNRYTDVLPFDSNRVVL-----NPCKDYRQSARGYINASLITVSEHVSRFIATQGP  581
             +N+ KNRY DVL +D +RV L     +P  DY       +NA+ +   +  + FIATQG 
Sbjct  328   LNVHKNRYADVLCYDHSRVFLPILNGDPYSDY-------LNANYMDGYKQKNAFIATQGA  380

Query  582   LPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVR-EFGNICITTKWIK  758
             LP TF DFW M+ +++C  IVM TR V+  + +KCG Y+  E+G   E+G I +    I+
Sbjct  381   LPKTFSDFWLMIWESQCRTIVMTTRTVERGR-LKCGQYWPLEEGTSGEYGKISVANLEIE  439

Query  759   TTD--TSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLAT---REIVKRLH--  917
             T    T  +L     +  ES      + HFQ+  WPD G P+  LA    RE V++    
Sbjct  440   TRRDYTITVLTVHNSTTNESRR----ITHFQFTSWPDFGTPRSALAMLEFREEVRQYQST  495

Query  918   ---------TLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFR  1070
                      T  P   PIVVHCSAGIGRTGT+C +  ++ R  L D++ +D+ NT+ + R
Sbjct  496   SVKEMGDEWTGHPGGPPIVVHCSAGIGRTGTFCTLDISLAR--LEDVATIDVCNTVRLMR  553

Query  1071  SQRIGMVQTLEQYLFCYDAIIE  1136
             +QR   +QT +QY FCY A++E
Sbjct  554   AQRAYSIQTPDQYEFCYFALVE  575



>pdb|1C86|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b 
(R47v, D48n) Complexed With 2-(Oxalyl-Amino-4,7-Dihydro-5h- 
Thieno[2,3-C]pyran-3-Carboxylic Acid
Length=298

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 163/300 (54%), Gaps = 26/300 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+  +K        Q  R  ASD    C VA    N ++NRY +V PFD +R+ L+ 
Sbjct  4     EKEFEQIDKSGSWAAIYQDIRHEASDFP--CRVAKLPKNKNRNRYVNVSPFDHSRIKLH-  60

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
                  Q    YINASLI + E    +I TQGPLPNT   FWEMV + +   +VML R+++
Sbjct  61    -----QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVME  115

Query  666   NYKTVKCGDYF---QAEDGVREFGNICIT--TKWIKTTDTSLILRCLEVSYKESEEPPLS  830
                ++KC  Y+   + ++ + E  N+ +T  ++ IKT  T   L    ++ +E+ E    
Sbjct  116   K-GSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKTYYTVRQLELENLTTQETRE----  170

Query  831   VLHFQYAEWPDHGVPKDTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHN  1001
             +LHF Y  WPD GVP+   +       V+   +L P  GP+VVHCSAGIGR+GT+C    
Sbjct  171   ILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADT  230

Query  1002  TIQRILLG---DMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQ  1172
              +  +L+    D S++D+   +   R  R+G++QT +Q  F Y A+IE  + I+ +S+ Q
Sbjct  231   CL--LLMDKRKDPSSVDIKKVLLDMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQ  288



>gb|KFV86644.1| Receptor-type tyrosine-protein phosphatase kappa, partial [Struthio 
camelus australis]
Length=368

 Score =   165 bits (417),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 101/256 (39%), Positives = 141/256 (55%), Gaps = 20/256 (8%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N  KNRY  ++P+D  RVVL P      +  GYINAS +   +    FIA QGPLP T  
Sbjct  1     NEGKNRYKSIIPYDHCRVVLQP----SDTGNGYINASYVESYQSPRFFIAAQGPLPGTVV  56

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
             DFW+MV Q +   IVMLT LV+  KT KC  Y+  ++ V  +G+  +T    +TT + L+
Sbjct  57    DFWQMVWQEKTSVIVMLTSLVEQNKT-KCEQYWPEQEQV--YGDFTVTLSNTRTT-SGLV  112

Query  780   LRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLA----TREIVKRLHTLPPSLGPIV  947
              R   +     + P L V  F Y  WPDHGVP++         ++ KR+   P   GP++
Sbjct  113   TRIFHLQKAGCDLPRL-VEQFHYLLWPDHGVPRNPAQLLCLVEKVNKRVSEDPA--GPVL  169

Query  948   VHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDA  1127
             VHCSAGIGRTGT+ A+   ++  +      +D+   +   R QR+ MVQT EQY F Y+ 
Sbjct  170   VHCSAGIGRTGTFIALDFLLK--MAKAEGKVDVFRCVQRLREQRVSMVQTKEQYTFLYEV  227

Query  1128  IIEELEDIIKESTGQP  1175
             +   LE ++  STG P
Sbjct  228   L---LEGLLCGSTGVP  240


 Score = 53.1 bits (126),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 51/118 (43%), Gaps = 13/118 (11%)
 Frame = +3

Query  306  EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
            EK F+A +K  + F  L             C  A    N  KNR   +LP DS R VL  
Sbjct  264  EKEFKALQKFSELFQLLP------------CKEAEKPSNQPKNRKPGILPADSCRPVLMS  311

Query  486  CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRL  659
              +   S R YINA          RFI TQ P   T  DFW +V    C ++V+L +L
Sbjct  312  SLNADGSPR-YINAVFADTYTEEDRFIITQLPFLATLVDFWALVWDYTCTSVVVLNQL  368



>pdb|2CM2|A Chain A, Structure Of Protein Tyrosine Phosphatase 1b (P212121)
 pdb|2CM3|A Chain A, Structure Of Protein Tyrosine Phosphatase 1b (C2)
 pdb|2CM3|B Chain B, Structure Of Protein Tyrosine Phosphatase 1b (C2)
 pdb|2CMB|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine 
Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate 
Mimetics
 pdb|2CMC|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine 
Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate 
Mimetics
 pdb|2CNE|A Chain A, Structural Insights Into The Design Of Nonpeptidic Isothiazolidinone-Containing 
Inhibitors Of Protein Tyrosine Phosphatase 
1b
Length=304

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 163/300 (54%), Gaps = 26/300 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+  +K        Q  R  ASD    C VA    N ++NRY DV PFD +R+ L+ 
Sbjct  10    EKEFEQIDKSGSWAAIYQDIRHEASDFP--CRVAKLPKNKNRNRYRDVSPFDHSRIKLH-  66

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
                  Q    YINASLI + E    +I TQGPLPNT   FWEMV + +   +VML R+++
Sbjct  67    -----QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVME  121

Query  666   NYKTVKCGDYF---QAEDGVREFGNICIT--TKWIKTTDTSLILRCLEVSYKESEEPPLS  830
                ++KC  Y+   + ++ + E  N+ +T  ++ IK+  T   L    ++ +E+ E    
Sbjct  122   K-GSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETRE----  176

Query  831   VLHFQYAEWPDHGVPKDTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHN  1001
             +LHF Y  WPD GVP+   +       V+   +L P  GP+VVHCSAGIGR+GT+C    
Sbjct  177   ILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADT  236

Query  1002  TIQRILLG---DMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQ  1172
              +  +L+    D S++D+   +   R  R+G++QT +Q  F Y A+IE  + I+ +S+ Q
Sbjct  237   CL--LLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQ  294



>pdb|2AZR|A Chain A, Crystal Structure Of Ptp1b With Bicyclic Thiophene Inhibitor
 pdb|2B07|A Chain A, Crystal Structure Of Ptp1b With Tricyclic Thiophene 
Inhibitor.
 pdb|2H4G|A Chain A, Crystal Structure Of Ptp1b With Monocyclic Thiophene 
Inhibitor
 pdb|2H4K|A Chain A, Crystal Structure Of Ptp1b With A Monocyclic Thiophene 
Inhibitor
 pdb|2HB1|A Chain A, Crystal Structure Of Ptp1b With Monocyclic Thiophene 
Inhibitor
 pdb|2QBP|A Chain A, Crystal Structure Of Ptp1b-inhibitor Complex
 pdb|2QBQ|A Chain A, Crystal Structure Of Ptp1b-Inhibitor Complex
 pdb|2QBR|A Chain A, Crystal Structure Of Ptp1b-Inhibitor Complex
 pdb|2QBS|A Chain A, Crystal Structure Of Ptp1b-Inhibitor Complex
 pdb|2ZMM|A Chain A, Crystal Structure Of Ptp1b-Inhibitor Complex
 pdb|2ZN7|A Chain A, Crystal Structures Of Ptp1b-Inhibitor Complexes
 pdb|4QBW|A Chain A, The Second Sphere Residue T263 Is Important For Function 
And Activity Of Ptp1b Through Modulating Wpd Loop
Length=299

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 163/300 (54%), Gaps = 26/300 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+  +K        Q  R  ASD    C VA    N ++NRY DV PFD +R+ L+ 
Sbjct  4     EKEFEQIDKSGSWAAIYQDIRHEASDFP--CRVAKLPKNKNRNRYRDVSPFDHSRIKLH-  60

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
                  Q    YINASLI + E    +I TQGPLPNT   FWEMV + +   +VML R+++
Sbjct  61    -----QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVME  115

Query  666   NYKTVKCGDYF---QAEDGVREFGNICIT--TKWIKTTDTSLILRCLEVSYKESEEPPLS  830
                ++KC  Y+   + ++ + E  N+ +T  ++ IK+  T   L    ++ +E+ E    
Sbjct  116   K-GSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETRE----  170

Query  831   VLHFQYAEWPDHGVPKDTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHN  1001
             +LHF Y  WPD GVP+   +       V+   +L P  GP+VVHCSAGIGR+GT+C    
Sbjct  171   ILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADT  230

Query  1002  TIQRILLG---DMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQ  1172
              +  +L+    D S++D+   +   R  R+G++QT +Q  F Y A+IE  + I+ +S+ Q
Sbjct  231   CL--LLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQ  288



>pdb|2PBN|A Chain A, Crystal Structure Of The Human Tyrosine Receptor Phosphate 
Gamma
Length=313

 Score =   163 bits (413),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 94/251 (37%), Positives = 137/251 (55%), Gaps = 14/251 (6%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N  KNRY ++L +D +RV L P          YINA+ +        +IATQGPL +TFE
Sbjct  57    NKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFE  116

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKT----TD  767
             DFW M+ +     IVM+T LV+  +  KC  Y+  E+   E+GNI +T K  K     T 
Sbjct  117   DFWRMIWEQNTGIIVMITNLVEKGRR-KCDQYWPTENS-EEYGNIIVTLKSTKIHACYTV  174

Query  768   TSLILRCLEVSYKESEEPPLS-----VLHFQYAEWPDHGVPKDTLATREIVKRLHTLP-P  929
                 +R  +V   +   P        V+ + Y +WPD GVP+  L     V+R      P
Sbjct  175   RRFSIRNTKVKKGQKGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMP  234

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
               GP++VHCSAG+GRTGTY  I + +Q+I   D S ++++  +   R+QR  +VQT EQY
Sbjct  235   ETGPVLVHCSAGVGRTGTYIVIDSMLQQI--KDKSTVNVLGFLKHIRTQRNYLVQTEEQY  292

Query  1110  LFCYDAIIEEL  1142
             +F +DA++E +
Sbjct  293   IFIHDALLEAI  303



>ref|NP_001098558.1| protein tyrosine phosphatase e [Oryzias latipes]
 dbj|BAD02401.1| protein tyrosine phosphatase e [Oryzias latipes]
Length=680

 Score =   169 bits (428),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 110/320 (34%), Positives = 167/320 (52%), Gaps = 17/320 (5%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
             + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  368   YSFIYQALLEYYLYGDTELDVCSLEGHLHRLHNTRAPNDRLGLEEEFRKLTNVRIMKENM  427

Query  387   RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
             R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  428   RTGNLPA----NMRKNRVLQIIPYDFNRVILSVRRG--QEFTDYINASFIDGYRQKDYFI  481

Query  567   ATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITT  746
             ATQGPL +T EDFW MV + RC +IVMLT L +  +  KC  Y+ +E  V  FG+  +  
Sbjct  482   ATQGPLSHTVEDFWRMVWEWRCHSIVMLTELKEREQE-KCFQYWPSEGSVI-FGDYTVEL  539

Query  747   KWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLP  926
                ++   +   + + ++YK  E+ P  V HF +  WP+ G+P D     +I+  +    
Sbjct  540   TG-ESQGETFTRKDMLLTYKSQEKQPQHVRHFHFHGWPEIGIPVDGRGMIDIIAAVQRQQ  598

Query  927   PSLG--PIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTL  1100
                G  PI+VHCSAG GRTGT+ A+ N ++R+    +  LD+  T+   R QR  MVQT+
Sbjct  599   QQSGNRPIIVHCSAGAGRTGTFIALSNILERVKAEGL--LDVFQTVKSLRMQRPHMVQTV  656

Query  1101  EQYLFCYDAIIEELEDIIKE  1160
             EQY FCY  ++++  DI  +
Sbjct  657   EQYDFCY-KVVQDFIDIFSD  675


 Score =   155 bits (391),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 94/242 (39%), Positives = 135/242 (56%), Gaps = 10/242 (4%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N  KNRY ++LP+D +RVVL+    +  S   YINAS I   +  ++FIA QGP P T  
Sbjct  143   NREKNRYPNILPYDHSRVVLSHLDGHLCS--DYINASYIDGFKEKNKFIAAQGPKPETLA  200

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
             DFW MV + +   IVMLT L +  K  KC  Y+  E G   +GNI +  + +       I
Sbjct  201   DFWRMVWEQKTTTIVMLTNLKER-KEEKCCQYW-PEKGCWMYGNIRVALEDVTVLVDYTI  258

Query  780   LRCLEVSYKESEEP--PLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSL-GPIVV  950
              +C  V Y++S+ P  P  V    +  WPD GVP   +   + +K++ T+ PS  GPIVV
Sbjct  259   RKCC-VQYQDSDGPRAPRLVTQLHFTSWPDFGVPFTPIGMLKFLKKVKTVNPSYAGPIVV  317

Query  951   HCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAI  1130
             HCSAG+GRTGT+  I + I   ++     +D+   ++  R QR  ++QT  QY F Y A+
Sbjct  318   HCSAGVGRTGTFIVIDSMID--MMHVEQRVDVFGFVSRIREQRCQLIQTDMQYSFIYQAL  375

Query  1131  IE  1136
             +E
Sbjct  376   LE  377



>pdb|3SME|A Chain A, Structure Of Ptp1b Inactivated By H2o2BICARBONATE
Length=300

 Score =   163 bits (412),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 163/300 (54%), Gaps = 26/300 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+  +K        Q  R  ASD    C VA    N ++NRY DV PFD +R+ L+ 
Sbjct  6     EKEFEQIDKSGSWAAIYQDIRHEASDFP--CRVAKLPKNKNRNRYRDVSPFDHSRIKLH-  62

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
                  Q    YINASLI + E    +I TQGPLPNT   FWEMV + +   +VML R+++
Sbjct  63    -----QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVME  117

Query  666   NYKTVKCGDYF---QAEDGVREFGNICIT--TKWIKTTDTSLILRCLEVSYKESEEPPLS  830
                ++KC  Y+   + ++ + E  N+ +T  ++ IK+  T   L    ++ +E+ E    
Sbjct  118   K-GSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETRE----  172

Query  831   VLHFQYAEWPDHGVPKDTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHN  1001
             +LHF Y  WPD GVP+   +       V+   +L P  GP+VVHCSAGIGR+GT+C    
Sbjct  173   ILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADT  232

Query  1002  TIQRILLG---DMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQ  1172
              +  +L+    D S++D+   +   R  R+G++QT +Q  F Y A+IE  + I+ +S+ Q
Sbjct  233   CL--LLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQ  290



>pdb|3QCM|A Chain A, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 
1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- 
(Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic 
Acid
 pdb|3QCM|B Chain B, Human Receptor Protein Tyrosine Phosphatase Gamma, Domain 
1, In Complex With 2-[(3,4-Dichlorobenzyl)sulfanyl]-4-{[3-({n-[2- 
(Methylamino)ethyl]glycyl}amino)phenyl]ethynyl}benzoic 
Acid
Length=310

 Score =   163 bits (412),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 93/251 (37%), Positives = 137/251 (55%), Gaps = 14/251 (6%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N  KNRY ++L +D +RV L P          YINA+ +        +IATQGPL +TFE
Sbjct  56    NKHKNRYINILAYDHSRVKLRPLPGKDSKHSDYINANYVDGYNKAKAYIATQGPLKSTFE  115

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKT----TD  767
             DFW M+ +     I+M+T LV+  +  KC  Y+  E+   E+GNI +T K  K     T 
Sbjct  116   DFWRMIWEQNTGIIIMITNLVEKGRR-KCDQYWPTEN-TEEYGNIIVTLKSTKIHACYTV  173

Query  768   TSLILRCLEVSYKESEEPPLS-----VLHFQYAEWPDHGVPKDTLATREIVKRLHTLP-P  929
                 +R  +V   +   P        V+ + Y +WPD GVP+  L     V+R      P
Sbjct  174   RRFSIRNTKVKKGQKGNPKGRQNERVVIQYHYTQWPDMGVPEYALPVLTFVRRSSAARMP  233

Query  930   SLGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQY  1109
               GP++VHCSAG+GRTGTY  I + +Q+I   D S ++++  +   R+QR  +VQT EQY
Sbjct  234   ETGPVLVHCSAGVGRTGTYIVIDSMLQQI--KDKSTVNVLGFLKHIRTQRNYLVQTEEQY  291

Query  1110  LFCYDAIIEEL  1142
             +F +DA++E +
Sbjct  292   IFIHDALLEAI  302



>ref|XP_007905141.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 11-like 
isoform X2 [Callorhinchus milii]
Length=587

 Score =   168 bits (426),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 138/258 (53%), Gaps = 20/258 (8%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH---VSRFIATQGPLPN  590
             N SKNRY ++LPFD+ RV L    D       YINA+ IT  E       +IATQG L N
Sbjct  273   NKSKNRYKNILPFDNTRVTLKEI-DETTLGSDYINANYITNGESGDDCKEYIATQGCLQN  331

Query  591   TFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDT  770
             T  DFW+MV Q     IVM T+ V+  +  KC  Y+  E+  +++G I +     +    
Sbjct  332   TINDFWKMVYQENTHVIVMTTKEVERGRN-KCFRYWPDEEASKDYGAILVRNLEERRAQ-  389

Query  771   SLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGP  941
               I+R LEV   +  EP   + H+QY  WPDHGVP +    L+  + V R     P  GP
Sbjct  390   DYIVRELEVIQTDRNEPSRHIWHYQYLSWPDHGVPNEPGGVLSFLDQVNRTQQSIPDTGP  449

Query  942   IVVHCSAGIGRTGTYCAIHNTIQRILLGDMSA------LDLVNTITIFRSQRIGMVQTLE  1103
             I+VHCSAGIGRTGT   +      IL+ D+S       +D+  TI + R QR GMVQT  
Sbjct  450   IIVHCSAGIGRTGTIIVVD-----ILVNDISRQGLDCDIDVPKTIQMVRKQRSGMVQTEA  504

Query  1104  QYLFCYDAIIEELEDIIK  1157
             QY F Y A+ + +E + K
Sbjct  505   QYKFIYMAVQQYIETVQK  522



>gb|EMP25998.1| Tyrosine-protein phosphatase non-receptor type 11, partial [Chelonia 
mydas]
Length=558

 Score =   168 bits (425),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 108/257 (42%), Positives = 141/257 (55%), Gaps = 22/257 (9%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARG--YINASLITV-------SEHVSRFIAT  572
             N +KNRY ++LPFD+ RV L   +D  +S  G  YINA+ I         SEH   +IAT
Sbjct  270   NKAKNRYKNILPFDTTRVAL---RDVDESLPGSDYINANYIKSIPEDGRSSEHCKVYIAT  326

Query  573   QGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKW  752
             QG L  T  DFW MV Q     IVM T+ V+  +  KC  Y+  ++  +E+G+IC+    
Sbjct  327   QGCLQTTVNDFWAMVYQENTHVIVMTTKEVERGRN-KCFRYWPDKNCTKEYGHICVRIVS  385

Query  753   IKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTL  923
              +       LR LE++  + EE P  V H+QY  WPDHGVP +    L+  + V R    
Sbjct  386   EREAQ-GYYLRELEITRTDREEHPRQVKHYQYFSWPDHGVPNEPGGVLSFLDQVNRAQRS  444

Query  924   PPSLGPIVVHCSAGIGRTGTYCAIH---NTIQRILLGDMSALDLVNTITIFRSQRIGMVQ  1094
              P  GPIVVHCSAGIGRTGT   I    +TI R  L     +D+  TI + R QR GMVQ
Sbjct  445   IPDSGPIVVHCSAGIGRTGTIIVIDILVDTIHRQGLD--CDIDIPKTIQMVRRQRSGMVQ  502

Query  1095  TLEQYLFCYDAIIEELE  1145
             T  QY F Y A+ + +E
Sbjct  503   TEAQYKFVYMAVQQYIE  519



>pdb|1NL9|A Chain A, Potent, Selective Protein Tyrosine Phosphatase 1b Inhibitor 
Compound 12 Using A Linked-Fragment Strategy
 pdb|1NNY|A Chain A, Potent, Selective Protein Tyrosine Phosphatase 1b Inhibitor 
Compound 23 Using A Linked-fragment Strategy
 pdb|1NO6|A Chain A, Potent, Selective Protein Tyrosine Phosphatase 1b Inhibitor 
Compound 5 Using A Linked-fragment Strategy
 pdb|1NZ7|A Chain A, Potent, Selective Inhibitors Of Protein Tyrosine Phosphatase 
1b Using A Second Phosphotyrosine Binding Site, Complexed 
With Compound 19.
 pdb|1ONY|A Chain A, Oxalyl-aryl-amino Benzoic Acid Inhibitors Of Ptp1b, 
Compound 17
 pdb|1ONZ|A Chain A, Oxalyl-Aryl-Amino Benzoic Acid Inhibitors Of Ptp1b, 
Compound 8b
 pdb|1OEM|X Chain X, Ptp1b With The Catalytic Cysteine Oxidized To A Sulfenyl-Amide 
Bond
 pdb|1OES|A Chain A, Oxidation State Of Protein Tyrosine Phosphatase 1b
 pdb|1PXH|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b 
With Potent And Selective Bidentate Inhibitor Compound 2
 pdb|1PH0|A Chain A, Non-Carboxylic Acid-Containing Inhibitor Of Ptp1b Targeting 
The Second Phosphotyrosine Site
 pdb|1PYN|A Chain A, Dual-Site Potent, Selective Protein Tyrosine Phosphatase 
1b Inhibitor Using A Linked Fragment Strategy And A Malonate 
Head On The First Site
 pdb|1Q1M|A Chain A, A Highly Efficient Approach To A Selective And Cell 
Active Ptp1b Inhibitors
 pdb|1QXK|A Chain A, Monoacid-Based, Cell Permeable, Selective Inhibitors 
Of Protein Tyrosine Phosphatase 1b
 pdb|1SUG|A Chain A, 1.95 A Structure Of Apo Protein Tyrosine Phosphatase 
1b
 pdb|1XBO|A Chain A, Ptp1b Complexed With Isoxazole Carboxylic Acid
 pdb|1WAX|A Chain A, Protein Tyrosine Phosphatase 1b With Active Site Inhibitor
 pdb|2BGD|A Chain A, Structure-Based Design Of Protein Tyrosine Phosphatase-1b 
Inhibitors
 pdb|2BGE|A Chain A, Structure-Based Design Of Protein Tyrosine Phosphatase-1b 
Inhibitors
 pdb|2CM7|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine 
Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate 
Mimetics
 pdb|2CM8|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine 
Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate 
Mimetics
 pdb|2CNF|A Chain A, Structural Insights Into The Design Of Nonpeptidic Isothiazolidinone-Containing 
Inhibitors Of Protein Tyrosine Phosphatase 
1b
 pdb|2CNG|A Chain A, Structural Insights Into The Design Of Nonpeptidic Isothiazolidinone-Containing 
Inhibitors Of Protein Tyrosine Phosphatase 
1b
 pdb|2CNH|A Chain A, Structural Insights Into The Design Of Nonpeptidic Isothiazolidinone-Containing 
Inhibitors Of Protein Tyrosine Phosphatase 
1b
 pdb|2CNI|A Chain A, Structural Insights Into The Design Of Nonpeptidic Isothiazolidinone-Containing 
Inhibitors Of Protein Tyrosine Phosphatase 
1b
 pdb|2HNP|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase 
1b
 pdb|2HNQ|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase 
1b
 pdb|2VEU|A Chain A, Crystal Structure Of Protein Tyrosine Phosphatase 1b 
In Complex With An Isothiazolidinone-containing Inhibitor
 pdb|2VEV|A Chain A, Crystal Strucutre Of Protein Tyrosine Phosphatase 1b 
In Complex With An Isothiazolidinone-Containing Inhibitor
 pdb|2VEW|A Chain A, Crystal Strucutre Of Protein Tyrosine Phosphatase 1b 
In Complex With An Isothiazolidinone-Containing Inhibitor
 pdb|2VEX|A Chain A, Crystal Strucutre Of Protein Tyrosine Phosphatase 1b 
In Complex With An Isothiazolidinone-Containing Inhibitor
 pdb|2VEY|A Chain A, Crystal Strucutre Of Protein Tyrosine Phosphatase 1b 
In Complex With An Isothiazolidinone-Containing Inhibitor
 pdb|3D9C|A Chain A, Crystal Structure Ptp1b Complex With Aryl Seleninic 
Acid
 pdb|3EAX|A Chain A, Crystal Structure Ptp1b Complex With Small Molecule 
Compound Lzp-6
 pdb|3EB1|A Chain A, Crystal Structure Ptp1b Complex With Small Molecule 
Inhibitor Lzp-25
 pdb|3I7Z|A Chain A, Protein Tyrosine Phosphatase 1b - Transition State Analog 
Fo First Catalytic Step
 pdb|3I80|A Chain A, Protein Tyrosine Phosphatase 1b - Transition State Analog 
Fo Second Catalytic Step
Length=321

 Score =   163 bits (412),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 163/300 (54%), Gaps = 26/300 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+  +K        Q  R  ASD    C VA    N ++NRY DV PFD +R+ L+ 
Sbjct  4     EKEFEQIDKSGSWAAIYQDIRHEASDFP--CRVAKLPKNKNRNRYRDVSPFDHSRIKLH-  60

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
                  Q    YINASLI + E    +I TQGPLPNT   FWEMV + +   +VML R+++
Sbjct  61    -----QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVME  115

Query  666   NYKTVKCGDYF---QAEDGVREFGNICIT--TKWIKTTDTSLILRCLEVSYKESEEPPLS  830
                ++KC  Y+   + ++ + E  N+ +T  ++ IK+  T   L    ++ +E+ E    
Sbjct  116   K-GSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETRE----  170

Query  831   VLHFQYAEWPDHGVPKDTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHN  1001
             +LHF Y  WPD GVP+   +       V+   +L P  GP+VVHCSAGIGR+GT+C    
Sbjct  171   ILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADT  230

Query  1002  TIQRILLG---DMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQ  1172
              +  +L+    D S++D+   +   R  R+G++QT +Q  F Y A+IE  + I+ +S+ Q
Sbjct  231   CL--LLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQ  288



>ref|XP_010393398.1| PREDICTED: receptor-type tyrosine-protein phosphatase T-like 
[Corvus cornix cornix]
Length=649

 Score =   169 bits (427),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 113/308 (37%), Positives = 160/308 (52%), Gaps = 29/308 (9%)
 Frame = +3

Query  285   EALKVLKEKRFQAPEKI-----RQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDV  449
             EALK+ K +  +A +       R   G L+  +  +S +   C    +  N  KNRY  +
Sbjct  63    EALKMFKREEIEAEQTDDESVDRHGAGLLREYQQLSSTLLHPCNAGKELCNQYKNRYKSI  122

Query  450   LPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNR  629
             +P+D  RVVL P      +  GYINAS +        FIA QGPL  T  DFW+MV Q +
Sbjct  123   IPYDHCRVVLQP----SDTGNGYINASYVDSYRSPRFFIAAQGPLAGTVVDFWQMVWQEK  178

Query  630   CPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILR--CLEVSY  803
                IVMLT LV+  K +KC  Y+  ++ V     + +   W   T T L+ R  CL+   
Sbjct  179   TSVIVMLTGLVEQNK-IKCEQYWPEQEQVYGDFTVTLNNTW---TTTGLVKRIFCLQ---  231

Query  804   KESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPIVVHCSAGIGR  974
             K     P +V  F Y  WPDHGVP++    L   E+V +   L    GP++VHCSAGIGR
Sbjct  232   KAGCALPRAVEQFHYLLWPDHGVPRNPSQLLYLVEVVNK-RVLEAPAGPMLVHCSAGIGR  290

Query  975   TGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDI  1151
             TGT+ A+   ++   +G     +D+ + +   R QR+ MVQT EQY F Y+A+   LE +
Sbjct  291   TGTFIALDFLLK---MGKAEGKVDVFHCVQQLREQRVSMVQTKEQYSFLYEAL---LEGL  344

Query  1152  IKESTGQP  1175
             +  +TG P
Sbjct  345   LCGNTGVP  352


 Score = 76.3 bits (186),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 75/283 (27%), Positives = 116/283 (41%), Gaps = 23/283 (8%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+A +   + F  L             C  A    N  KNR   +LP DS R +L  
Sbjct  376   EKEFKALQSFSELFQLLP------------CREAEKPRNQPKNRKPGILPADSCRPILMS  423

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
               +   S   YINA   +      R I TQ P P T  DFW +V    C ++V+L +L +
Sbjct  424   SVNADGSP-AYINAVFASTYTEEERIIITQLPFPTTLVDFWALVWDYTCTSVVVLNQLQE  482

Query  666   NYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKES-EEPPLSVLHF  842
               KT       Q ED    F    I+    + T        L +S ++  ++  + +   
Sbjct  483   LDKTYVLFWPTQGEDDYGRFHVQLIS----EETGAGFTTWTLVLSNRQQPKKAAVEIRLH  538

Query  843   QYAEWP--DHGVPK-DTLATREIVKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQR  1013
             Q  +WP   H  P  DT+ +       H      G I+V C  G  R+G +CA     ++
Sbjct  539   QLTDWPMQQHLPPHPDTIISLLGKVETHHRQSQDGHILVTCWDGASRSGIFCAASFLCEQ  598

Query  1014  ILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEEL  1142
             I    M  +D+   + + + +R   ++ +EQY  CY+  +  L
Sbjct  599   IQSEGM--VDVSQAVRMLKRRRRQFIKDVEQYGLCYELALSYL  639



>ref|XP_009466664.1| PREDICTED: receptor-type tyrosine-protein phosphatase kappa-like 
[Nipponia nippon]
Length=1110

 Score =   171 bits (434),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 118/309 (38%), Positives = 161/309 (52%), Gaps = 29/309 (9%)
 Frame = +3

Query  285   EALKVLKEKRFQAPEKI-----RQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDV  449
             EALK  K    +A +       R   G L   +  +S     C    +  N SKNRY  +
Sbjct  552   EALKRFKRAEVEAEQTEDESVDRHGAGRLGEYQQLSSTSLHPCDAGKELCNQSKNRYKSI  611

Query  450   LPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNR  629
             +P+D  RVVL P         GYINAS +        FIA QGPLP T  DFW+MV Q +
Sbjct  612   IPYDHCRVVLQP----SDMGNGYINASYVDSYRSPRFFIAAQGPLPGTVVDFWQMVWQEK  667

Query  630   CPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILR--CLEVSY  803
                IVMLT LV+  KT KC  Y+  ++ V  +G+  +T    +TT T L+ R  CL+   
Sbjct  668   TSVIVMLTGLVEQNKT-KCEQYWPEQEQV--YGDFTVTLSNTRTT-TGLVTRIFCLQ---  720

Query  804   KESEEPPLSVLHFQYAEWPDHGVPKDT---LATREIVKRLHTLPPSLGPIVVHCSAGIGR  974
             K     P  V  F Y  WPDHGVP++    L   E+V +     P+ GP++VHCSAGIGR
Sbjct  721   KAGCALPRVVEQFHYLLWPDHGVPRNPAQLLCLVEVVNKRALEAPA-GPVLVHCSAGIGR  779

Query  975   TGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDI  1151
             TGT+ A+   ++   +G     +D+ + +   R QR+ MVQT EQY F Y+ +   LE +
Sbjct  780   TGTFIALDFLLK---MGKAEGQVDVFHCVQRLREQRVSMVQTQEQYTFLYEVL---LEGL  833

Query  1152  IKESTGQPS  1178
             +  STG P+
Sbjct  834   LCGSTGGPA  842


 Score = 75.9 bits (185),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 63/247 (26%), Positives = 110/247 (45%), Gaps = 9/247 (4%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N  KNR   +LP DS R +L    +   S  GYINA  +       + I TQ P P T  
Sbjct  863   NQPKNRNPGMLPADSCRPILMSSLNADGSP-GYINAVFVNTYTKEDKLIITQLPFPTTLV  921

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
             DFW +V    C ++V+L ++ +  KT       Q E     F ++C+ ++      T+  
Sbjct  922   DFWSLVWDYTCTSVVVLNQIQELDKTYVQVWPTQGEAVYGRF-HVCLISEEPGVGFTTWK  980

Query  780   LRCLEVSYKESEEPPLSVLHFQYAEWP-DHGVPKDTLATREIVKRLHTLPPSLGP--IVV  950
             L     + ++ ++  L VL +Q  +WP    +P        ++ ++ T         I+V
Sbjct  981   LSL--TNRQQPKKSALEVLFWQLKDWPMQQRLPPHPATIISLLGKVETYQRQSQDRHILV  1038

Query  951   HCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAI  1130
              C  G  R+G +CA     ++I    +  +D+   + + + +R  M++ +EQY  CY+  
Sbjct  1039  TCWDGASRSGIFCAASFLCEQIQSEGL--VDVSQAVRMLKRRRRQMIKDVEQYGLCYELA  1096

Query  1131  IEELEDI  1151
             +  L   
Sbjct  1097  LSYLNSF  1103



>ref|XP_007905142.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 11-like 
isoform X3 [Callorhinchus milii]
Length=585

 Score =   168 bits (425),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 138/258 (53%), Gaps = 20/258 (8%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH---VSRFIATQGPLPN  590
             N SKNRY ++LPFD+ RV L    D       YINA+ IT  E       +IATQG L N
Sbjct  271   NKSKNRYKNILPFDNTRVTLKEI-DETTLGSDYINANYITNGESGDDCKEYIATQGCLQN  329

Query  591   TFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDT  770
             T  DFW+MV Q     IVM T+ V+  +  KC  Y+  E+  +++G I +     +    
Sbjct  330   TINDFWKMVYQENTHVIVMTTKEVERGRN-KCFRYWPDEEASKDYGAILVRNLEERRAQ-  387

Query  771   SLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGP  941
               I+R LEV   +  EP   + H+QY  WPDHGVP +    L+  + V R     P  GP
Sbjct  388   DYIVRELEVIQTDRNEPSRHIWHYQYLSWPDHGVPNEPGGVLSFLDQVNRTQQSIPDTGP  447

Query  942   IVVHCSAGIGRTGTYCAIHNTIQRILLGDMSA------LDLVNTITIFRSQRIGMVQTLE  1103
             I+VHCSAGIGRTGT   +      IL+ D+S       +D+  TI + R QR GMVQT  
Sbjct  448   IIVHCSAGIGRTGTIIVVD-----ILVNDISRQGLDCDIDVPKTIQMVRKQRSGMVQTEA  502

Query  1104  QYLFCYDAIIEELEDIIK  1157
             QY F Y A+ + +E + K
Sbjct  503   QYKFIYMAVQQYIETVQK  520



>gb|KFZ69517.1| Receptor-type tyrosine-protein phosphatase kappa, partial [Podiceps 
cristatus]
Length=370

 Score =   164 bits (415),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 105/260 (40%), Positives = 148/260 (57%), Gaps = 26/260 (10%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSR--FIATQGPLPNT  593
             N SKNRY  ++P+D  RVVL P      +  GYINAS + V+  +++   +  QGPLP T
Sbjct  1     NQSKNRYKSIIPYDHCRVVLQP----SDTGNGYINASYVDVAWTLAQGSLLPLQGPLPGT  56

Query  594   FEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTS  773
               DFW+MV Q +   IVMLT LV+  K +KC  Y+  +D V  +G+  +T    +TT T 
Sbjct  57    VVDFWQMVWQEKISVIVMLTGLVEQNK-IKCEQYWPEQDQV--YGDFTVTLNNTRTT-TG  112

Query  774   LILR--CLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLG  938
             L+ R  CL+   K     P  V  F Y  WPDHGVP++    L   E+V +     P+ G
Sbjct  113   LVTRVFCLQ---KAGCALPRVVEQFHYLLWPDHGVPRNPAQLLCLVEVVNKRRLEAPA-G  168

Query  939   PIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSA-LDLVNTITIFRSQRIGMVQTLEQYLF  1115
             P++VHCSAGIGRTGT+ A+   ++   +G     +D+ + +   R QR+ MVQT EQY F
Sbjct  169   PVLVHCSAGIGRTGTFIALDFLLK---MGKAEGKVDVFHCVQRLREQRVSMVQTKEQYTF  225

Query  1116  CYDAIIEELEDIIKESTGQP  1175
              Y+ +   LE ++  STG P
Sbjct  226   LYEVL---LEGLLCGSTGGP  242


 Score = 55.5 bits (132),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 39/118 (33%), Positives = 51/118 (43%), Gaps = 13/118 (11%)
 Frame = +3

Query  306  EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
            EK F+A +K  + F  L             C  A    N  KNR   +LP DS R +L  
Sbjct  266  EKEFKALQKFSELFQLLP------------CREAEKPSNQPKNRKPGILPADSCRPILMS  313

Query  486  CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRL  659
              +   S  GYINA   +      R I TQ P P T  DFW ++    C ++V+L  L
Sbjct  314  SLNADGSP-GYINAVFASTYIEEDRLIITQLPFPTTLADFWALIWDYTCTSVVVLNEL  370



>pdb|2CMA|A Chain A, Structural Basis For Inhibition Of Protein Tyrosine 
Phosphatase 1b By Isothiazolidinone Heterocyclic Phosphonate 
Mimetics
 pdb|3A5J|A Chain A, Crystal Structure Of Protein-Tyrosine Phosphatase 1b
Length=327

 Score =   163 bits (412),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 108/300 (36%), Positives = 163/300 (54%), Gaps = 26/300 (9%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+  +K        Q  R  ASD    C VA    N ++NRY DV PFD +R+ L+ 
Sbjct  10    EKEFEQIDKSGSWAAIYQDIRHEASDFP--CRVAKLPKNKNRNRYRDVSPFDHSRIKLH-  66

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
                  Q    YINASLI + E    +I TQGPLPNT   FWEMV + +   +VML R+++
Sbjct  67    -----QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVME  121

Query  666   NYKTVKCGDYF---QAEDGVREFGNICIT--TKWIKTTDTSLILRCLEVSYKESEEPPLS  830
                ++KC  Y+   + ++ + E  N+ +T  ++ IK+  T   L    ++ +E+ E    
Sbjct  122   K-GSLKCAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETRE----  176

Query  831   VLHFQYAEWPDHGVPKDTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHN  1001
             +LHF Y  WPD GVP+   +       V+   +L P  GP+VVHCSAGIGR+GT+C    
Sbjct  177   ILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADT  236

Query  1002  TIQRILLG---DMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQ  1172
              +  +L+    D S++D+   +   R  R+G++QT +Q  F Y A+IE  + I+ +S+ Q
Sbjct  237   CL--LLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQ  294



>emb|CAQ14262.1| protein tyrosine phosphatase 1b [Danio rerio]
Length=433

 Score =   166 bits (419),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 108/286 (38%), Positives = 159/286 (56%), Gaps = 28/286 (10%)
 Frame = +3

Query  357   QANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLN-PCKDYRQSARGYINASL  533
             Q  R ++SD+   C +A    N S+NRY DV PFD +R+ L   C DY       INASL
Sbjct  19    QEIRQQSSDLP--CKIAKLPENRSRNRYRDVSPFDHSRICLQIGCNDY-------INASL  69

Query  534   ITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYF---QA  704
             I+V E   ++I TQGPLPNT   FWEMV + R   +VML R+++   +VKC  Y+   + 
Sbjct  70    ISVEEAQRKYILTQGPLPNTCGHFWEMVWEQRSRGVVMLNRVIEK-GSVKCAQYWPQREE  128

Query  705   EDGVREFGNICIT--TKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPK  878
              + V E  N  +T  ++ +K+  T   L    +S +E+ E    +LHF Y  WPD GVP+
Sbjct  129   REAVFEDTNFRLTLISEDVKSYYTVRQLELENLSTQETRE----ILHFHYTTWPDFGVPE  184

Query  879   DTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLG---DMSAL  1040
                +       V+    L P LGP+VVHCSAGIGR+GT+C +   +  +L+    D S++
Sbjct  185   SPASFLNFLFKVRESGCLSPELGPVVVHCSAGIGRSGTFCLVDTCL--LLMSQRKDPSSV  242

Query  1041  DLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQPS  1178
              +   +   R  R+G++QT +Q  F Y A IE  + I+ +++ Q S
Sbjct  243   RIQEVLLEMRRYRMGLIQTADQLRFSYLAFIEGAKYIMGDTSVQES  288



>dbj|BAC06424.1| protein tyrosine phosphatase e [Oryzias latipes]
Length=419

 Score =   165 bits (418),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 110/324 (34%), Positives = 168/324 (52%), Gaps = 21/324 (6%)
 Frame = +3

Query  216   FDFSYDSQPPRLVLSSDQLRYCSEALKVLKEKRFQAPEK---IRQEFGTLQANRMRASDM  386
             + F Y +     +    +L  CS    + +    +AP     + +EF  L   R+   +M
Sbjct  103   YSFIYQALLEYYLYGDTELDVCSLEGHLHRLHNTRAPNDRLGLEEEFRKLTNVRIMKENM  162

Query  387   RSRCLVALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFI  566
             R+  L A    N+ KNR   ++P+D NRV+L+  +   Q    YINAS I        FI
Sbjct  163   RTGNLPA----NMRKNRVLQIIPYDFNRVILSVRRG--QEFTDYINASFIDGYRQKDYFI  216

Query  567   ATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITT  746
             ATQGPL +T EDFW MV + RC +IVMLT L +  +  KC  Y+ +E  V  FG+  +  
Sbjct  217   ATQGPLSHTVEDFWRMVWEWRCHSIVMLTELKEREQE-KCFQYWPSEGSVI-FGDYAVEL  274

Query  747   KWIKTTDTSLILRCLEVSYK----ESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRL  914
                ++   +   + + ++YK    + E+ P  V HF +  WP+ G+P D     +I+  +
Sbjct  275   TG-ESQGETFTRKDMLLTYKSCLSQQEKQPQHVRHFHFHGWPEIGIPVDGRGMIDIIAAV  333

Query  915   HTLPPSLG--PIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGM  1088
                    G  PI+VHCSAG GRTGT+ A+ N ++R+    +  LD+  T+   R QR  M
Sbjct  334   QRQQQQSGNRPIIVHCSAGAGRTGTFIALSNILERVKAEGL--LDVFQTVKSLRMQRPHM  391

Query  1089  VQTLEQYLFCYDAIIEELEDIIKE  1160
             VQT+EQY FCY  ++++  DI  +
Sbjct  392   VQTVEQYDFCY-KVVQDFIDIFSD  414


 Score = 81.3 bits (199),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 66/114 (58%), Gaps = 5/114 (4%)
 Frame = +3

Query  804   KESEEP--PLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSL-GPIVVHCSAGIGR  974
             ++S+ P  P  V    +  WPD GVP   +   + +K++ T+ PS  GPIVVHCSAG+GR
Sbjct  1     QDSDGPRAPRLVTQLHFTSWPDFGVPFTPIGMLKFLKKVKTVNPSYAGPIVVHCSAGVGR  60

Query  975   TGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIE  1136
             TGT+  I + I   ++     +D+   ++  R QR  ++QT  QY F Y A++E
Sbjct  61    TGTFIVIDSMID--MMHVEQRVDVFGFVSRIREQRCQLIQTDMQYSFIYQALLE  112



>ref|XP_007070311.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 11-like 
[Chelonia mydas]
Length=602

 Score =   168 bits (425),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 108/257 (42%), Positives = 141/257 (55%), Gaps = 22/257 (9%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARG--YINASLITV-------SEHVSRFIAT  572
             N +KNRY ++LPFD+ RV L   +D  +S  G  YINA+ I         SEH   +IAT
Sbjct  282   NKAKNRYKNILPFDTTRVAL---RDVDESLPGSDYINANYIKSIPEDGRSSEHCKVYIAT  338

Query  573   QGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKW  752
             QG L  T  DFW MV Q     IVM T+ V+  +  KC  Y+  ++  +E+G+IC+    
Sbjct  339   QGCLQTTVNDFWAMVYQENTHVIVMTTKEVERGRN-KCFRYWPDKNCTKEYGHICVRIVS  397

Query  753   IKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTL  923
              +       LR LE++  + EE P  V H+QY  WPDHGVP +    L+  + V R    
Sbjct  398   EREAQ-GYYLRELEITRTDREEHPRQVKHYQYFSWPDHGVPNEPGGVLSFLDQVNRAQRS  456

Query  924   PPSLGPIVVHCSAGIGRTGTYCAIH---NTIQRILLGDMSALDLVNTITIFRSQRIGMVQ  1094
              P  GPIVVHCSAGIGRTGT   I    +TI R  L     +D+  TI + R QR GMVQ
Sbjct  457   IPDSGPIVVHCSAGIGRTGTIIVIDILVDTIHRQGLD--CDIDIPKTIQMVRRQRSGMVQ  514

Query  1095  TLEQYLFCYDAIIEELE  1145
             T  QY F Y A+ + +E
Sbjct  515   TEAQYKFVYMAVQQYIE  531



>ref|XP_005508139.1| PREDICTED: receptor-type tyrosine-protein phosphatase T-like 
[Columba livia]
Length=650

 Score =   168 bits (426),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 116/308 (38%), Positives = 163/308 (53%), Gaps = 29/308 (9%)
 Frame = +3

Query  285   EALKVLKEKRFQAPEKIRQEFGTLQANRMR-----ASDMRSRCLVALDSINISKNRYTDV  449
             EALK  K    ++ +   +      A R+R     +S +   C    +  N +KNRY  +
Sbjct  64    EALKRFKRAEIESEQTEDESVDRHGAGRLREYQQLSSTLLHPCDAGKELRNQNKNRYNSI  123

Query  450   LPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNR  629
             +P+D  RVVL        +  GYINAS +        FIA QGPLP T  DFW+MV Q +
Sbjct  124   IPYDHCRVVLQNSD----TENGYINASYVDSYRSPHFFIAAQGPLPGTVVDFWQMVWQEK  179

Query  630   CPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILR--CLEVSY  803
                IVMLT LV+  KT KC  Y+  ++ V  +G+  +T    +TT TSL+ R  CL+   
Sbjct  180   TSVIVMLTGLVEQNKT-KCEQYWPEQEQV--YGDFTVTLNNTRTT-TSLVTRVFCLQ---  232

Query  804   KESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPIVVHCSAGIGR  974
             K     P  V  F Y  WPDHGVP++    L   E+V +     P+ GP++VHCSAGIGR
Sbjct  233   KAGCALPRVVEQFHYLLWPDHGVPRNPAQLLCLVEVVNKRALEAPA-GPVLVHCSAGIGR  291

Query  975   TGTYCAIHNTIQRILLGDMS-ALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDI  1151
             TGT+ A+   ++   +G     +D+ + I   R QR+ MVQT EQY F Y+ +   LE +
Sbjct  292   TGTFIALDFLLK---MGKAERKVDVFHCIQKLREQRVSMVQTKEQYTFLYEVL---LEGL  345

Query  1152  IKESTGQP  1175
             +  +TG P
Sbjct  346   LCGNTGVP  353


 Score = 78.6 bits (192),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 69/282 (24%), Positives = 120/282 (43%), Gaps = 21/282 (7%)
 Frame = +3

Query  306   EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
             EK F+A +K  + F  +             C  A    N  KNR   +LP DS R +L  
Sbjct  377   EKEFKALQKFSELFELMP------------CREAEKPSNQPKNRKPGILPADSCRPILMS  424

Query  486   CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVD  665
               +   S  GYINA   +      R + TQ P P T  DFW +V    C ++V+L +L +
Sbjct  425   SLNADGSP-GYINAVFASTYTKEDRLVITQLPFPTTLVDFWALVWDYTCTSVVVLNQLQE  483

Query  666   NYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQ  845
               +T    +++  +D    +G   +     +  D          + ++ ++  L V  +Q
Sbjct  484   LDQTYV--EFWPTQDEA-AYGRFHVHLISEEPGDGFTTWTLALTNKQQPKKSALEVQFWQ  540

Query  846   YAEWP-DHGVPKDTLATREIVKRL--HTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRI  1016
               +WP    +P        ++ ++  H      G I+V C  G  R+G +CA     ++I
Sbjct  541   LKDWPMQQRLPPHPATIISLLGKVETHHRQRQDGHILVTCWDGASRSGIFCAAGFLCEQI  600

Query  1017  LLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEEL  1142
                    +D+   + + + +R  M++ +EQY FCY+  +  L
Sbjct  601   --QSEGLVDVSQAVRMLKRRRRQMIKDVEQYGFCYELALSYL  640



>ref|NP_570999.1| tyrosine-protein phosphatase non-receptor type 1 [Danio rerio]
 emb|CAB65732.1| PTP1B protein [Danio rerio]
Length=433

 Score =   166 bits (419),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 108/286 (38%), Positives = 159/286 (56%), Gaps = 28/286 (10%)
 Frame = +3

Query  357   QANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLN-PCKDYRQSARGYINASL  533
             Q  R ++SD+   C +A    N S+NRY DV PFD +R+ L   C DY       INASL
Sbjct  19    QEIRQQSSDLP--CKIAKLPENRSRNRYRDVSPFDHSRICLQIGCNDY-------INASL  69

Query  534   ITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYF---QA  704
             I+V E   ++I TQGPLPNT   FWEMV + R   +VML R+++   +VKC  Y+   + 
Sbjct  70    ISVEEAQRKYILTQGPLPNTCGHFWEMVWEQRSRGVVMLNRVIEK-GSVKCAQYWPQREE  128

Query  705   EDGVREFGNICIT--TKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPK  878
              + V E  N  +T  ++ +K+  T   L    +S +E+ E    +LHF Y  WPD GVP+
Sbjct  129   REAVFEDTNFRLTLISEDVKSYYTVRQLELENLSTQETRE----ILHFHYTTWPDFGVPE  184

Query  879   DTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLG---DMSAL  1040
                +       V+    L P LGP+VVHCSAGIGR+GT+C +   +  +L+    D S++
Sbjct  185   SPASFLNFLFKVRESGCLSPELGPVVVHCSAGIGRSGTFCLVDTCL--LLMSQRKDPSSV  242

Query  1041  DLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQPS  1178
              +   +   R  R+G++QT +Q  F Y A IE  + I+ +++ Q S
Sbjct  243   RIQEVLLEMRRYRMGLIQTADQLRFSYLAFIEGAKYIMGDTSVQES  288



>emb|CAC33882.1| receptor protein tyrosine phosphatase [Geodia cydonium]
Length=999

 Score =   171 bits (432),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 96/240 (40%), Positives = 134/240 (56%), Gaps = 10/240 (4%)
 Frame = +3

Query  432   NRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWE  611
             NR+ ++  +D+NR+VL P + +    R +INA  +   +  ++FIATQGPLP T  DFW 
Sbjct  469   NRFGNITVYDNNRIVLRPLEGHADCQRDFINACYVDGYKFRNKFIATQGPLPKTIVDFWR  528

Query  612   MVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLILRCL  791
             +V Q + P IVM+T L +  K +KC  Y+  E G + FG   IT    +T       R L
Sbjct  529   LVWQEKPPTIVMVTNLKEGTK-IKCQQYW-PESGTKNFGPFEITISEEQTL-ADYTTRTL  585

Query  792   EVSYKESEEPPLSVLHFQYAEWPDHGVPK---DTLATREIVKRLHTLPPSLGPIVVHCSA  962
              V  K S E PL V  F +  WPDHGVP      LA  + +++ H   PS GP+++HCSA
Sbjct  586   LVQLKGSSECPLKVTQFHFTAWPDHGVPDYATPILAFHKKIRKQHR--PSKGPLLMHCSA  643

Query  963   GIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEEL  1142
             G+GRTGT   I   + +I       +D+   I   R QR+ MVQ  EQY+F  DAI+E +
Sbjct  644   GVGRTGTLITIDRVLDQI--AKERVVDIAGVIQHLRGQRMKMVQNPEQYIFINDAILEAI  701


 Score = 92.0 bits (227),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 72/249 (29%), Positives = 115/249 (46%), Gaps = 16/249 (6%)
 Frame = +3

Query  405   ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
             ALD  N +KNR  D LP D  RVVL      +     YI+A  +   +    FI  Q P+
Sbjct  754   ALD--NPTKNRSEDFLPGDRWRVVL------KGETEDYIHAVAVNGYKQQRAFIIAQSPM  805

Query  585   PNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTT  764
              +T  DFW+MV   +C  IVML  LV++ K   C  Y+ +  GV+  G   I     +  
Sbjct  806   QSTARDFWKMVYDRKCGVIVMLCDLVESGKEA-CYKYWPSS-GVQHVGEFTIDILGEEEL  863

Query  765   DTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLG--  938
             +    LR   V +K++ +    V       W   G   +  +   ++  +  +    G  
Sbjct  864   E-GFTLRTFGVLHKKTNK-SHQVQQIYIQGWAPDGQCSNLGSITAVIAEVTKIQQRTGNN  921

Query  939   PIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFC  1118
             PI+VHCS  + R+G +CAI  TI+R        +D+   +   R Q+ G V+++ QY   
Sbjct  922   PILVHCSDTVNRSGMFCAIATTIERCKT--EGVVDVFQVVKALRVQKPGAVRSVMQYHSL  979

Query  1119  YDAIIEELE  1145
             ++ ++  L+
Sbjct  980   FETVLVYLD  988



>ref|XP_007905140.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 11-like 
isoform X1 [Callorhinchus milii]
Length=627

 Score =   168 bits (425),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 104/258 (40%), Positives = 138/258 (53%), Gaps = 20/258 (8%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEH---VSRFIATQGPLPN  590
             N SKNRY ++LPFD+ RV L    D       YINA+ IT  E       +IATQG L N
Sbjct  313   NKSKNRYKNILPFDNTRVTLKEI-DETTLGSDYINANYITNGESGDDCKEYIATQGCLQN  371

Query  591   TFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDT  770
             T  DFW+MV Q     IVM T+ V+  +  KC  Y+  E+  +++G I +     +    
Sbjct  372   TINDFWKMVYQENTHVIVMTTKEVERGRN-KCFRYWPDEEASKDYGAILVRNLEERRAQ-  429

Query  771   SLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGP  941
               I+R LEV   +  EP   + H+QY  WPDHGVP +    L+  + V R     P  GP
Sbjct  430   DYIVRELEVIQTDRNEPSRHIWHYQYLSWPDHGVPNEPGGVLSFLDQVNRTQQSIPDTGP  489

Query  942   IVVHCSAGIGRTGTYCAIHNTIQRILLGDMSA------LDLVNTITIFRSQRIGMVQTLE  1103
             I+VHCSAGIGRTGT   +      IL+ D+S       +D+  TI + R QR GMVQT  
Sbjct  490   IIVHCSAGIGRTGTIIVVD-----ILVNDISRQGLDCDIDVPKTIQMVRKQRSGMVQTEA  544

Query  1104  QYLFCYDAIIEELEDIIK  1157
             QY F Y A+ + +E + K
Sbjct  545   QYKFIYMAVQQYIETVQK  562



>gb|AAH54648.1| Protein tyrosine phosphatase 1b [Danio rerio]
 gb|AAI64734.1| Ptp1b protein [Danio rerio]
Length=433

 Score =   165 bits (418),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 108/286 (38%), Positives = 159/286 (56%), Gaps = 28/286 (10%)
 Frame = +3

Query  357   QANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLN-PCKDYRQSARGYINASL  533
             Q  R ++SD+   C +A    N S+NRY DV PFD +R+ L   C DY       INASL
Sbjct  19    QEIRQQSSDLP--CKIAKLPENRSRNRYRDVSPFDHSRICLQIGCNDY-------INASL  69

Query  534   ITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYF---QA  704
             I+V E   ++I TQGPLPNT   FWEMV + R   +VML R+++   +VKC  Y+   + 
Sbjct  70    ISVEEAQRKYILTQGPLPNTCGHFWEMVWEQRSRGVVMLNRVIEK-GSVKCAQYWPQREE  128

Query  705   EDGVREFGNICIT--TKWIKTTDTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPK  878
              + V E  N  +T  ++ +K+  T   L    +S +E+ E    +LHF Y  WPD GVP+
Sbjct  129   REAVFEDTNFRLTLISEDVKSYYTVRQLELENLSTQETRE----ILHFHYTTWPDFGVPE  184

Query  879   DTLATREI---VKRLHTLPPSLGPIVVHCSAGIGRTGTYCAIHNTIQRILLG---DMSAL  1040
                +       V+    L P LGP+VVHCSAGIGR+GT+C +   +  +L+    D S++
Sbjct  185   SPASFLNFLFKVRESGCLSPELGPVVVHCSAGIGRSGTFCLVDTCL--LLMSQRKDPSSV  242

Query  1041  DLVNTITIFRSQRIGMVQTLEQYLFCYDAIIEELEDIIKESTGQPS  1178
              +   +   R  R+G++QT +Q  F Y A IE  + I+ +++ Q S
Sbjct  243   RIQEVLLEMRRYRMGLIQTADQLRFSYLAFIEGAKYIMGDTSVQES  288



>ref|XP_005412662.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20-like 
isoform X7 [Chinchilla lanigera]
 ref|XP_005412663.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20-like 
isoform X8 [Chinchilla lanigera]
 ref|XP_005412664.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20-like 
isoform X9 [Chinchilla lanigera]
 ref|XP_005412665.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20-like 
isoform X10 [Chinchilla lanigera]
Length=357

 Score =   164 bits (414),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 110/310 (35%), Positives = 163/310 (53%), Gaps = 30/310 (10%)
 Frame = +3

Query  243   PRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSIN  422
             PR   S D+     + LK+L+ K       I QEFG L+  + R S+    C    +  N
Sbjct  69    PR-TFSFDKQSAFKDYLKILERK---GVFDITQEFGDLERKKSRCSE----CTYGNEPWN  120

Query  423   ISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIATQGPLPNTF  596
               KNRY D++P++S RV L   +DY       INAS I +   E    +IATQGPLP+T 
Sbjct  121   RQKNRYRDIIPYESTRVPLGKSQDY-------INASYIRIINQEEEYFYIATQGPLPDTI  173

Query  597   EDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAED----GVREFGNICITTKWIKTT  764
             +DFW+MV ++    I M+TR +++   +KC +Y+         +R+F  IC+    I   
Sbjct  174   DDFWQMVFEHNSNVIAMVTRDIED-GIIKCHNYWPVSPEEPLELRQF-RICLKNYQILAY  231

Query  765   DTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPI  944
                 I+R  +V  K+  E  L V H Q+ +W DHG+P  T +  + V+ +       GP+
Sbjct  232   ---FIVRMFQVV-KKPTETSLMVKHVQFTKWADHGIPASTDSFIKYVRYVRK-SHCTGPM  286

Query  945   VVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYD  1124
             VVHCSAG+GRTG +  I   +    +      D+VN +T  R QR GM+QT EQY F Y+
Sbjct  287   VVHCSAGVGRTGVF--ICTDVAFCAMEKSYLFDIVNIVTQMREQRYGMIQTKEQYCFTYE  344

Query  1125  AIIEELEDII  1154
              I++ L+  +
Sbjct  345   IILKVLKKFL  354



>ref|XP_005412666.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 20-like 
isoform X11 [Chinchilla lanigera]
Length=355

 Score =   164 bits (414),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 110/310 (35%), Positives = 163/310 (53%), Gaps = 30/310 (10%)
 Frame = +3

Query  243   PRLVLSSDQLRYCSEALKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSIN  422
             PR   S D+     + LK+L+ K       I QEFG L+  + R S+    C    +  N
Sbjct  67    PR-TFSFDKQSAFKDYLKILERK---GVFDITQEFGDLERKKSRCSE----CTYGNEPWN  118

Query  423   ISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITV--SEHVSRFIATQGPLPNTF  596
               KNRY D++P++S RV L   +DY       INAS I +   E    +IATQGPLP+T 
Sbjct  119   RQKNRYRDIIPYESTRVPLGKSQDY-------INASYIRIINQEEEYFYIATQGPLPDTI  171

Query  597   EDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAED----GVREFGNICITTKWIKTT  764
             +DFW+MV ++    I M+TR +++   +KC +Y+         +R+F  IC+    I   
Sbjct  172   DDFWQMVFEHNSNVIAMVTRDIED-GIIKCHNYWPVSPEEPLELRQF-RICLKNYQILAY  229

Query  765   DTSLILRCLEVSYKESEEPPLSVLHFQYAEWPDHGVPKDTLATREIVKRLHTLPPSLGPI  944
                 I+R  +V  K+  E  L V H Q+ +W DHG+P  T +  + V+ +       GP+
Sbjct  230   ---FIVRMFQVV-KKPTETSLMVKHVQFTKWADHGIPASTDSFIKYVRYVRK-SHCTGPM  284

Query  945   VVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYD  1124
             VVHCSAG+GRTG +  I   +    +      D+VN +T  R QR GM+QT EQY F Y+
Sbjct  285   VVHCSAGVGRTGVF--ICTDVAFCAMEKSYLFDIVNIVTQMREQRYGMIQTKEQYCFTYE  342

Query  1125  AIIEELEDII  1154
              I++ L+  +
Sbjct  343   IILKVLKKFL  352



>gb|KFQ00833.1| Receptor-type tyrosine-protein phosphatase kappa, partial [Leptosomus 
discolor]
Length=368

 Score =   164 bits (414),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 101/246 (41%), Positives = 138/246 (56%), Gaps = 19/246 (8%)
 Frame = +3

Query  420   NISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFE  599
             N  KNRY  ++P+D  RVVL P      +  GYINAS +        FIA QGPL  T  
Sbjct  1     NQGKNRYKSIIPYDHCRVVLQP----SDTGNGYINASYVDSYRSPRFFIAAQGPLSETMM  56

Query  600   DFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVREFGNICITTKWIKTTDTSLI  779
             DFW+MV Q +   IVMLT LV+  KT KC  Y+  ++ V  +G+  +T    +TT T L+
Sbjct  57    DFWQMVWQEKTSVIVMLTGLVEQNKT-KCEQYWPEQEQV--YGDFTVTLNHTRTT-TGLV  112

Query  780   LR--CLEVSYKESEEPPLSVLHFQYAEWPDHGVPKD---TLATREIVKRLHTLPPSLGPI  944
              R  CL+   K     P  V  F Y  WPDHGVP++    L   E+V +     P+ GP+
Sbjct  113   TRIFCLK---KAGCALPRVVEQFHYLLWPDHGVPRNPAQLLCLVEVVNKRGLEAPA-GPV  168

Query  945   VVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYD  1124
             +VHCSAGIGRTGT+ A+   ++  +      +D+ + +   R QR+ MVQT EQY F Y+
Sbjct  169   LVHCSAGIGRTGTFIALDFLLK--MAKAEGKVDVFHCVQRLREQRVSMVQTKEQYTFLYE  226

Query  1125  AIIEEL  1142
             A++E L
Sbjct  227   ALLEGL  232


 Score = 55.8 bits (133),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 51/118 (43%), Gaps = 13/118 (11%)
 Frame = +3

Query  306  EKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNRVVLNP  485
            EK F+A +K  + F  L             C  A    N  KNR   +LP DS R +L  
Sbjct  264  EKEFKALQKFSELFQLLP------------CREAEKPSNQPKNRKPGILPADSCRPILMS  311

Query  486  CKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVMLTRL  659
              +   S  GYINA          R I TQ P P T  DFW +V    C ++V+L +L
Sbjct  312  SLNADGSP-GYINAVFANTYTEEDRLIITQLPFPTTLVDFWALVWDYTCTSVVVLNQL  368



>ref|XP_011206337.1| PREDICTED: tyrosine-protein phosphatase non-receptor type 9 isoform 
X4 [Bactrocera dorsalis]
Length=595

 Score =   168 bits (425),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 107/297 (36%), Positives = 162/297 (55%), Gaps = 45/297 (15%)
 Frame = +3

Query  291   LKVLKEKRFQAPEKIRQEFGTLQANRMRASDMRSRCLVALDSINISKNRYTDVLPFDSNR  470
             +K   E R +APE      GT    RMR               N++KNRYTDVL +D +R
Sbjct  305   VKEYAEIRNRAPE------GTFVYARMRN--------------NLTKNRYTDVLCYDHSR  344

Query  471   VVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPLPNTFEDFWEMVIQNRCPAIVML  650
             VVL+     R+    YINA+ +   +  + +I+TQGPLP T +DFW M+ +  C  +VM 
Sbjct  345   VVLS-----REDGEDYINANFVDGYKQKNAYISTQGPLPKTSQDFWRMIWEQHCLVVVMT  399

Query  651   TRLVDNYKTVKCGDYFQ-AEDGVREFGNICITTKWIKTTDTSLILRCLEVSYKESEEPPL  827
             TR+++  + VKCG Y++  E+   EFGN  + T  I+  +    +  LE+   +++E   
Sbjct  400   TRVMERGR-VKCGQYWEPTENSSLEFGNFHVRTLSIEINE-DYTVASLELKNLKTDE-IR  456

Query  828   SVLHFQYAEWPDHGVPKDTLATREIVKRLH----TLPPSLG----------PIVVHCSAG  965
             +V H+Q+  WPD+GVP   +A    ++++     ++  +LG          PIVVHCSAG
Sbjct  457   NVSHWQFTSWPDYGVPSSAMAMLNFLQKVREKQASMVKALGDTWAGHPRGPPIVVHCSAG  516

Query  966   IGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYLFCYDAIIE  1136
             IGRTGT+  +   I R  L D+   D+  T+   RSQR   +Q  +QY+FC+ A+IE
Sbjct  517   IGRTGTFITLDICISR--LEDVGTADIRGTVEKIRSQRAYSIQMPDQYVFCHLALIE  571



>emb|CDJ85585.1| Protein-tyrosine phosphatase domain containing protein [Haemonchus 
contortus]
Length=454

 Score =   166 bits (419),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 96/246 (39%), Positives = 147/246 (60%), Gaps = 10/246 (4%)
 Frame = +3

Query  405   ALDSINISKNRYTDVLPFDSNRVVLNPCKDYRQSARGYINASLITVSEHVSRFIATQGPL  584
             A +S+++ +NRY D+LP+D NRV L+   D   ++ GYINAS I++++   RFIA Q PL
Sbjct  133   ASESVHVMRNRYRDILPYDRNRVALSQSDD---NSNGYINASFISLTKGRMRFIAAQAPL  189

Query  585   PNTFEDFWEMVIQNRCPAIVMLTRLVDNYKTVKCGDYFQAEDGVRE-FGNICITTKWIKT  761
             P T E++W+MV + +   IVML +LV+  K VKC  Y+ AE G    FG   IT   ++T
Sbjct  190   PATLEEWWKMVDEQKVVLIVMLCKLVEMNK-VKCERYWPAEIGQSLLFGCYEITLDEVET  248

Query  762   -TDTSLILRCLEVSYKESEEPPLSVLH-FQYAEWPDHGVPKDTLATREIVKRLHTL-PPS  932
               D   +LR L ++ ++S E    V+H   Y EWPDHG P        +++++  L   +
Sbjct  249   YPDDEYLLRRLRMTNQKSGES--RVIHQLHYKEWPDHGCPSGESQLINMIEKMAELHEKT  306

Query  933   LGPIVVHCSAGIGRTGTYCAIHNTIQRILLGDMSALDLVNTITIFRSQRIGMVQTLEQYL  1112
               P++VHCSAG+GRTGT  +++   + I   ++ +LDL + +   R QR  MVQT +QY 
Sbjct  307   DAPVLVHCSAGVGRTGTIISVNYIRELIKSAELESLDLFDLVMSLRKQRASMVQTQDQYQ  366

Query  1113  FCYDAI  1130
             F +  +
Sbjct  367   FVHKCV  372



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 4788965082913