BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3209

Length=716
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006345367.1|  PREDICTED: probable receptor-like protein ki...    211   1e-59   Solanum tuberosum [potatoes]
ref|XP_004229167.1|  PREDICTED: probable receptor-like serine/thr...    210   3e-59   Solanum lycopersicum
ref|XP_011088213.1|  PREDICTED: probable receptor-like serine/thr...    207   2e-58   
ref|XP_009628102.1|  PREDICTED: probable receptor-like serine/thr...    204   3e-57   Nicotiana tomentosiformis
ref|XP_009788830.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    202   1e-56   Nicotiana sylvestris
gb|AID16051.1|  putative universal stress protein                       199   1e-56   Catharanthus roseus [chatas]
emb|CDP16448.1|  unnamed protein product                                199   2e-55   Coffea canephora [robusta coffee]
gb|EYU38253.1|  hypothetical protein MIMGU_mgv1a002401mg                198   4e-55   Erythranthe guttata [common monkey flower]
ref|XP_011091800.1|  PREDICTED: proline-rich receptor-like protei...    196   1e-54   Sesamum indicum [beniseed]
ref|XP_011102142.1|  PREDICTED: probable receptor-like serine/thr...    190   6e-52   Sesamum indicum [beniseed]
gb|EYU42966.1|  hypothetical protein MIMGU_mgv1a002423mg                185   1e-50   Erythranthe guttata [common monkey flower]
gb|EYU32494.1|  hypothetical protein MIMGU_mgv1a001977mg                186   1e-50   Erythranthe guttata [common monkey flower]
emb|CDP11935.1|  unnamed protein product                                186   2e-50   Coffea canephora [robusta coffee]
ref|XP_008441611.1|  PREDICTED: uncharacterized protein LOC103485693    184   4e-50   Cucumis melo [Oriental melon]
ref|XP_007048488.1|  Kinase protein with adenine nucleotide alpha...    182   4e-50   
ref|XP_010269084.1|  PREDICTED: probable receptor-like serine/thr...    184   8e-50   Nelumbo nucifera [Indian lotus]
ref|XP_007048485.1|  Kinase protein with adenine nucleotide alpha...    183   1e-49   
ref|XP_002520305.1|  ATP binding protein, putative                      182   2e-49   Ricinus communis
ref|XP_007019225.1|  Kinase protein with adenine nucleotide alpha...    182   3e-49   
ref|XP_011649434.1|  PREDICTED: probable receptor-like serine/thr...    182   3e-49   Cucumis sativus [cucumbers]
ref|XP_008460873.1|  PREDICTED: probable LRR receptor-like serine...    181   4e-49   Cucumis melo [Oriental melon]
gb|KDO80472.1|  hypothetical protein CISIN_1g004174mg                   181   6e-49   Citrus sinensis [apfelsine]
gb|KDO80473.1|  hypothetical protein CISIN_1g004174mg                   180   6e-49   Citrus sinensis [apfelsine]
ref|XP_011657416.1|  PREDICTED: probable receptor-like serine/thr...    181   7e-49   Cucumis sativus [cucumbers]
ref|XP_006472861.1|  PREDICTED: probable L-type lectin-domain con...    180   1e-48   Citrus sinensis [apfelsine]
ref|XP_006434295.1|  hypothetical protein CICLE_v10000358mg             180   2e-48   Citrus clementina [clementine]
gb|KDO80470.1|  hypothetical protein CISIN_1g004174mg                   180   2e-48   Citrus sinensis [apfelsine]
gb|KDO80469.1|  hypothetical protein CISIN_1g004174mg                   180   2e-48   Citrus sinensis [apfelsine]
gb|KCW72537.1|  hypothetical protein EUGRSUZ_E01004                     179   2e-48   Eucalyptus grandis [rose gum]
ref|XP_006357335.1|  PREDICTED: inactive leucine-rich repeat rece...    179   2e-48   Solanum tuberosum [potatoes]
ref|XP_004237363.1|  PREDICTED: probable receptor-like serine/thr...    179   2e-48   Solanum lycopersicum
gb|KHG01419.1|  Putative proline-rich receptor-like protein kinas...    179   4e-48   Gossypium arboreum [tree cotton]
gb|KDP32865.1|  hypothetical protein JCGZ_12157                         179   4e-48   Jatropha curcas
gb|KJB80638.1|  hypothetical protein B456_013G108200                    179   4e-48   Gossypium raimondii
ref|XP_012078327.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    179   4e-48   
gb|KCW72536.1|  hypothetical protein EUGRSUZ_E01004                     178   5e-48   Eucalyptus grandis [rose gum]
gb|KJB80639.1|  hypothetical protein B456_013G108200                    179   6e-48   Gossypium raimondii
ref|XP_010055963.1|  PREDICTED: probable receptor-like serine/thr...    178   7e-48   Eucalyptus grandis [rose gum]
ref|XP_010055962.1|  PREDICTED: probable receptor-like serine/thr...    178   7e-48   Eucalyptus grandis [rose gum]
ref|XP_002516327.1|  ATP binding protein, putative                      176   2e-47   
ref|XP_008219572.1|  PREDICTED: interleukin-1 receptor-associated...    177   2e-47   Prunus mume [ume]
ref|XP_004289287.1|  PREDICTED: probable receptor-like serine/thr...    176   2e-47   Fragaria vesca subsp. vesca
ref|XP_004502962.1|  PREDICTED: proline-rich receptor-like protei...    176   3e-47   Cicer arietinum [garbanzo]
ref|XP_008227546.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    176   4e-47   
ref|XP_009354013.1|  PREDICTED: probable receptor-like serine/thr...    176   5e-47   Pyrus x bretschneideri [bai li]
ref|XP_008394166.1|  PREDICTED: interleukin-1 receptor-associated...    176   5e-47   Malus domestica [apple tree]
ref|XP_009355832.1|  PREDICTED: probable receptor-like serine/thr...    176   6e-47   Pyrus x bretschneideri [bai li]
ref|XP_010270301.1|  PREDICTED: probable receptor-like serine/thr...    176   6e-47   
ref|XP_009795415.1|  PREDICTED: probable receptor-like serine/thr...    176   6e-47   Nicotiana sylvestris
ref|XP_009588636.1|  PREDICTED: probable receptor-like serine/thr...    176   7e-47   
ref|XP_010534448.1|  PREDICTED: probable receptor-like serine/thr...    175   8e-47   Tarenaya hassleriana [spider flower]
ref|XP_002302218.2|  kinase family protein                              174   1e-46   Populus trichocarpa [western balsam poplar]
ref|XP_010087185.1|  Proline-rich receptor-like protein kinase PERK1    174   2e-46   Morus notabilis
ref|XP_007214539.1|  hypothetical protein PRUPE_ppa002094mg             174   2e-46   
ref|XP_004290918.1|  PREDICTED: probable receptor-like serine/thr...    174   2e-46   Fragaria vesca subsp. vesca
ref|XP_007225237.1|  hypothetical protein PRUPE_ppa001811mg             174   2e-46   Prunus persica
gb|KDO57493.1|  hypothetical protein CISIN_1g041755mg                   173   3e-46   Citrus sinensis [apfelsine]
gb|KCW54155.1|  hypothetical protein EUGRSUZ_I00126                     172   3e-46   Eucalyptus grandis [rose gum]
gb|KEH35608.1|  adenine nucleotide alpha hydrolase-like domain ki...    173   3e-46   Medicago truncatula
ref|XP_010674424.1|  PREDICTED: probable receptor-like serine/thr...    173   4e-46   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH35607.1|  adenine nucleotide alpha hydrolase-like domain ki...    173   4e-46   Medicago truncatula
ref|XP_011027696.1|  PREDICTED: probable receptor-like serine/thr...    172   5e-46   Populus euphratica
ref|XP_009362341.1|  PREDICTED: probable receptor-like serine/thr...    172   6e-46   Pyrus x bretschneideri [bai li]
ref|XP_006432124.1|  hypothetical protein CICLE_v10000480mg             171   6e-46   
ref|XP_012092537.1|  PREDICTED: proline-rich receptor-like protei...    172   7e-46   Jatropha curcas
gb|EPS64167.1|  protein kinase family protein                           171   8e-46   Genlisea aurea
ref|XP_010678918.1|  PREDICTED: probable receptor-like serine/thr...    172   9e-46   Beta vulgaris subsp. vulgaris [field beet]
gb|KCW54153.1|  hypothetical protein EUGRSUZ_I00126                     172   1e-45   Eucalyptus grandis [rose gum]
ref|XP_010027607.1|  PREDICTED: proline-rich receptor-like protei...    172   1e-45   Eucalyptus grandis [rose gum]
ref|XP_007137781.1|  hypothetical protein PHAVU_009G155000g             171   2e-45   Phaseolus vulgaris [French bean]
gb|KJB48948.1|  hypothetical protein B456_008G094600                    170   2e-45   Gossypium raimondii
gb|KHG19309.1|  Proline-rich receptor-like protein kinase PERK10        171   2e-45   Gossypium arboreum [tree cotton]
ref|XP_006432126.1|  hypothetical protein CICLE_v10000480mg             171   2e-45   Citrus clementina [clementine]
ref|XP_006432127.1|  hypothetical protein CICLE_v10000480mg             171   2e-45   
ref|XP_010471913.1|  PREDICTED: probable receptor-like serine/thr...    171   2e-45   Camelina sativa [gold-of-pleasure]
gb|AAC34357.1|  Putative protein kinase                                 171   2e-45   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010428799.1|  PREDICTED: probable receptor-like serine/thr...    171   2e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010521198.1|  PREDICTED: probable receptor-like serine/thr...    171   3e-45   Tarenaya hassleriana [spider flower]
gb|KHN31175.1|  Proline-rich receptor-like protein kinase PERK9         171   3e-45   Glycine soja [wild soybean]
ref|XP_006578781.1|  PREDICTED: proline-rich receptor-like protei...    170   3e-45   Glycine max [soybeans]
gb|KJB48946.1|  hypothetical protein B456_008G094600                    170   3e-45   Gossypium raimondii
ref|NP_177852.2|  adenine nucleotide alpha hydrolases-domain cont...    171   3e-45   
ref|XP_009349910.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    171   4e-45   
ref|XP_010537354.1|  PREDICTED: probable receptor-like serine/thr...    170   5e-45   Tarenaya hassleriana [spider flower]
gb|KJB48947.1|  hypothetical protein B456_008G094600                    169   6e-45   Gossypium raimondii
gb|KJB48945.1|  hypothetical protein B456_008G094600                    169   6e-45   Gossypium raimondii
ref|XP_011016100.1|  PREDICTED: probable receptor-like serine/thr...    170   7e-45   Populus euphratica
ref|XP_002306655.2|  kinase family protein                              169   9e-45   
ref|XP_002889134.1|  kinase family protein                              169   1e-44   
gb|KHN09628.1|  Proline-rich receptor-like protein kinase PERK9         169   1e-44   Glycine soja [wild soybean]
ref|XP_003526871.1|  PREDICTED: proline-rich receptor-like protei...    169   1e-44   Glycine max [soybeans]
ref|XP_009355844.1|  PREDICTED: tyrosine-protein kinase Lck-like        169   2e-44   Pyrus x bretschneideri [bai li]
emb|CDX87529.1|  BnaA07g33440D                                          168   2e-44   
ref|XP_009106391.1|  PREDICTED: probable receptor-like serine/thr...    167   3e-44   Brassica rapa
ref|XP_006300863.1|  hypothetical protein CARUB_v10019956mg             167   4e-44   
ref|XP_008337149.1|  PREDICTED: uncharacterized protein LOC103400275    167   4e-44   
emb|CDY38354.1|  BnaA02g18470D                                          166   5e-44   Brassica napus [oilseed rape]
gb|KHN05157.1|  Receptor-like cytosolic serine/threonine-protein ...    166   7e-44   Glycine soja [wild soybean]
ref|XP_003542041.1|  PREDICTED: uncharacterized protein LOC100797280    166   9e-44   
ref|XP_006390104.1|  hypothetical protein EUTSA_v10018181mg             166   1e-43   Eutrema salsugineum [saltwater cress]
gb|EPS63840.1|  hypothetical protein M569_10941                         166   1e-43   Genlisea aurea
ref|XP_009128214.1|  PREDICTED: receptor-like cytosolic serine/th...    165   2e-43   Brassica rapa
ref|XP_003526656.1|  PREDICTED: probable receptor-like serine/thr...    166   2e-43   
gb|KEH35354.1|  adenine nucleotide alpha hydrolase-like domain ki...    166   2e-43   Medicago truncatula
ref|XP_004502543.1|  PREDICTED: uncharacterized protein LOC101504509    165   4e-43   Cicer arietinum [garbanzo]
ref|XP_011031142.1|  PREDICTED: probable LIM domain-containing se...    164   4e-43   Populus euphratica
ref|XP_011011405.1|  PREDICTED: putative leucine-rich repeat rece...    164   4e-43   Populus euphratica
emb|CDX88355.1|  BnaC06g37990D                                          164   4e-43   
gb|KGN47686.1|  hypothetical protein Csa_6G376270                       164   5e-43   
emb|CDY40878.1|  BnaCnng09690D                                          164   7e-43   Brassica napus [oilseed rape]
gb|KHN46982.1|  Putative receptor-like serine/threonine-protein k...    164   7e-43   Glycine soja [wild soybean]
emb|CDY38355.1|  BnaA02g18480D                                          164   7e-43   Brassica napus [oilseed rape]
ref|XP_011022896.1|  PREDICTED: probable leucine-rich repeat rece...    162   2e-42   Populus euphratica
ref|XP_002310531.2|  hypothetical protein POPTR_0007s04490g             162   2e-42   
ref|NP_001238713.1|  protein kinase family protein                      162   2e-42   Glycine max [soybeans]
ref|XP_011011403.1|  PREDICTED: putative leucine-rich repeat rece...    162   3e-42   Populus euphratica
ref|XP_011031140.1|  PREDICTED: probable LIM domain-containing se...    162   3e-42   Populus euphratica
ref|XP_007161426.1|  hypothetical protein PHAVU_001G067700g             162   3e-42   Phaseolus vulgaris [French bean]
emb|CBI37518.3|  unnamed protein product                                162   4e-42   Vitis vinifera
ref|XP_002307046.2|  hypothetical protein POPTR_0005s06800g             162   4e-42   
ref|XP_002264653.2|  PREDICTED: probable receptor protein kinase ...    162   5e-42   
gb|KFK42126.1|  hypothetical protein AALP_AA2G214300                    162   5e-42   Arabis alpina [alpine rockcress]
ref|XP_011031139.1|  PREDICTED: probable LRR receptor-like serine...    161   5e-42   Populus euphratica
gb|KHN38974.1|  Receptor-like cytosolic serine/threonine-protein ...    161   5e-42   Glycine soja [wild soybean]
ref|XP_006595490.1|  PREDICTED: protein kinase family protein iso...    161   6e-42   
ref|XP_011011402.1|  PREDICTED: putative leucine-rich repeat rece...    161   6e-42   Populus euphratica
ref|XP_011011404.1|  PREDICTED: probable LIM domain-containing se...    161   6e-42   Populus euphratica
ref|XP_011031141.1|  PREDICTED: probable LIM domain-containing se...    161   6e-42   Populus euphratica
ref|XP_010527069.1|  PREDICTED: probable L-type lectin-domain con...    161   9e-42   Tarenaya hassleriana [spider flower]
ref|XP_003522567.1|  PREDICTED: probable receptor-like serine/thr...    159   3e-41   
ref|XP_010461193.1|  PREDICTED: probable receptor-like serine/thr...    159   5e-41   Camelina sativa [gold-of-pleasure]
emb|CBI18962.3|  unnamed protein product                                158   7e-41   Vitis vinifera
ref|XP_006279577.1|  hypothetical protein CARUB_v10025977mg             158   8e-41   Capsella rubella
ref|XP_006394225.1|  hypothetical protein EUTSA_v10003727mg             158   8e-41   
ref|XP_007137480.1|  hypothetical protein PHAVU_009G130300g             158   8e-41   Phaseolus vulgaris [French bean]
gb|KFK44259.1|  hypothetical protein AALP_AA1G235200                    158   8e-41   Arabis alpina [alpine rockcress]
ref|XP_006394226.1|  hypothetical protein EUTSA_v10003727mg             158   9e-41   Eutrema salsugineum [saltwater cress]
gb|KHN44298.1|  Putative receptor-like serine/threonine-protein k...    158   1e-40   Glycine soja [wild soybean]
ref|XP_010664160.1|  PREDICTED: LOW QUALITY PROTEIN: probable rec...    158   1e-40   
ref|XP_010461185.1|  PREDICTED: probable receptor-like serine/thr...    157   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010461177.1|  PREDICTED: probable receptor-like serine/thr...    157   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010484157.1|  PREDICTED: probable receptor-like protein ki...    157   2e-40   Camelina sativa [gold-of-pleasure]
ref|NP_201199.1|  protein kinase protein with adenine nucleotide ...    156   3e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150459.1|  PREDICTED: probable receptor-like protein ki...    156   3e-40   Brassica rapa
ref|XP_002864878.1|  kinase family protein                              156   3e-40   Arabidopsis lyrata subsp. lyrata
gb|KFK28085.1|  hypothetical protein AALP_AA8G470300                    156   4e-40   Arabis alpina [alpine rockcress]
ref|XP_010444316.1|  PREDICTED: putative proline-rich receptor-li...    154   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_006829313.1|  PREDICTED: probable receptor-like serine/thr...    155   1e-39   Amborella trichopoda
ref|XP_010444315.1|  PREDICTED: putative proline-rich receptor-li...    154   1e-39   Camelina sativa [gold-of-pleasure]
ref|XP_009130425.1|  PREDICTED: proline-rich receptor-like protei...    154   2e-39   Brassica rapa
ref|XP_009130426.1|  PREDICTED: proline-rich receptor-like protei...    154   2e-39   Brassica rapa
ref|XP_012092538.1|  PREDICTED: proline-rich receptor-like protei...    153   4e-39   Jatropha curcas
ref|XP_010930690.1|  PREDICTED: probable receptor-like serine/thr...    153   1e-38   Elaeis guineensis
ref|XP_010093102.1|  Receptor-like cytosolic serine/threonine-pro...    151   3e-38   Morus notabilis
ref|XP_006416287.1|  hypothetical protein EUTSA_v10006893mg             150   7e-38   Eutrema salsugineum [saltwater cress]
ref|XP_008781626.1|  PREDICTED: probable receptor-like serine/thr...    150   9e-38   Phoenix dactylifera
emb|CDX84466.1|  BnaC03g50340D                                          149   2e-37   
ref|XP_010498614.1|  PREDICTED: probable receptor protein kinase ...    149   3e-37   Camelina sativa [gold-of-pleasure]
ref|XP_008783316.1|  PREDICTED: LOW QUALITY PROTEIN: serine/threo...    148   5e-37   
ref|XP_009149675.1|  PREDICTED: receptor like protein kinase S.2-...    148   6e-37   Brassica rapa
gb|KEH40498.1|  adenine nucleotide alpha hydrolase-like domain ki...    147   7e-37   Medicago truncatula
emb|CDY08194.1|  BnaA06g15320D                                          147   7e-37   Brassica napus [oilseed rape]
emb|CDY04652.1|  BnaC05g16900D                                          147   1e-36   
ref|XP_009406141.1|  PREDICTED: putative receptor protein kinase ...    147   1e-36   
ref|XP_009406140.1|  PREDICTED: probable serine/threonine-protein...    147   1e-36   
ref|XP_006303211.1|  hypothetical protein CARUB_v10011454mg             147   2e-36   Capsella rubella
ref|XP_004498354.1|  PREDICTED: uncharacterized protein LOC101490391    146   2e-36   Cicer arietinum [garbanzo]
ref|XP_010459867.1|  PREDICTED: probable receptor-like serine/thr...    146   3e-36   
ref|XP_002893177.1|  kinase family protein                              144   1e-35   
ref|XP_010911250.1|  PREDICTED: proline-rich receptor-like protei...    143   2e-35   
emb|CDX96584.1|  BnaA08g21270D                                          140   7e-35   
ref|XP_009410684.1|  PREDICTED: serine/threonine-protein kinase P...    139   8e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009110180.1|  PREDICTED: proline-rich receptor-like protei...    138   1e-33   Brassica rapa
ref|XP_009404967.1|  PREDICTED: probable receptor-like serine/thr...    138   2e-33   Musa acuminata subsp. malaccensis [pisang utan]
emb|CAN81737.1|  hypothetical protein VITISV_043580                     133   7e-32   Vitis vinifera
emb|CDY38812.1|  BnaC08g19860D                                          131   4e-31   Brassica napus [oilseed rape]
ref|XP_010905327.1|  PREDICTED: uncharacterized protein LOC105032560    131   5e-31   Elaeis guineensis
gb|AAF87904.1|AC015447_14  Similar to protein kinases                   129   3e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CDY31344.1|  BnaA02g33970D                                          129   3e-30   Brassica napus [oilseed rape]
ref|NP_173578.2|  putative protein kinase                               129   3e-30   Arabidopsis thaliana [mouse-ear cress]
emb|CDY39836.1|  BnaC02g42820D                                          127   1e-29   Brassica napus [oilseed rape]
ref|XP_010237868.1|  PREDICTED: putative L-type lectin-domain con...    127   1e-29   Brachypodium distachyon [annual false brome]
ref|XP_010237867.1|  PREDICTED: putative L-type lectin-domain con...    127   2e-29   Brachypodium distachyon [annual false brome]
gb|AFW67031.1|  putative protein kinase superfamily protein             120   5e-28   
gb|EMT19880.1|  Putative LRR receptor-like serine/threonine-prote...    122   6e-28   
gb|EMT07237.1|  Putative LRR receptor-like serine/threonine-prote...    122   2e-27   
dbj|BAJ97602.1|  predicted protein                                      120   3e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK04018.1|  predicted protein                                      120   4e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008644345.1|  PREDICTED: uncharacterized protein LOC103625730    120   5e-27   
gb|EAY92512.1|  hypothetical protein OsI_14251                          120   6e-27   Oryza sativa Indica Group [Indian rice]
ref|NP_001051845.1|  Os03g0839900                                       120   7e-27   
gb|AAO41118.1|  putative serine/threonine kinase                        120   7e-27   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA52403.1|  TPA: putative protein kinase superfamily protein       119   7e-27   
ref|XP_009413128.1|  PREDICTED: proline-rich receptor-like protei...    118   8e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006652004.1|  PREDICTED: serine/threonine-protein kinase p...    119   9e-27   Oryza brachyantha
ref|XP_008665759.1|  PREDICTED: uncharacterized protein LOC100191...    119   2e-26   Zea mays [maize]
tpg|DAA52404.1|  TPA: putative protein kinase superfamily protein       119   2e-26   
gb|AAX96058.1|  At5g63940                                               117   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010236761.1|  PREDICTED: uncharacterized protein LOC100842077    117   5e-26   Brachypodium distachyon [annual false brome]
emb|CDY43771.1|  BnaA06g23070D                                          116   8e-26   Brassica napus [oilseed rape]
ref|XP_009398916.1|  PREDICTED: proline-rich receptor-like protei...    114   3e-25   
ref|XP_008679652.1|  PREDICTED: probable receptor-like protein ki...    114   5e-25   
ref|XP_004981112.1|  PREDICTED: uncharacterized protein LOC101777140    114   7e-25   
ref|XP_006664395.1|  PREDICTED: probable receptor-like serine/thr...    112   2e-24   
ref|XP_007041840.1|  Kinase protein with adenine nucleotide alpha...    110   2e-24   
ref|XP_007041838.1|  Kinase protein with adenine nucleotide alpha...    110   3e-24   
ref|XP_008805891.1|  PREDICTED: LOW QUALITY PROTEIN: cyclin-depen...    112   3e-24   
ref|XP_006432125.1|  hypothetical protein CICLE_v10000480mg             111   3e-24   
ref|XP_007041837.1|  Kinase protein with adenine nucleotide alpha...    110   4e-24   
ref|XP_007041839.1|  Kinase protein with adenine nucleotide alpha...    110   5e-24   
ref|XP_007041834.1|  Kinase protein with adenine nucleotide alpha...    110   6e-24   
ref|XP_010028727.1|  PREDICTED: probable receptor-like serine/thr...    110   7e-24   Eucalyptus grandis [rose gum]
gb|EAY82471.1|  hypothetical protein OsI_37688                          108   3e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_009402096.1|  PREDICTED: probable receptor-like serine/thr...    108   4e-23   
gb|ABA95941.1|  Protein kinase domain containing protein                108   5e-23   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ19847.1|  hypothetical protein OsJ_35432                          108   5e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004978901.1|  PREDICTED: L-type lectin-domain containing r...    108   6e-23   Setaria italica
ref|XP_004978900.1|  PREDICTED: L-type lectin-domain containing r...    108   6e-23   
ref|XP_006422602.1|  hypothetical protein CICLE_v10027936mg             107   6e-23   
gb|KDO80468.1|  hypothetical protein CISIN_1g004174mg                   107   1e-22   Citrus sinensis [apfelsine]
ref|XP_010107667.1|  putative receptor-like serine/threonine-prot...    107   1e-22   Morus notabilis
gb|EAY82477.1|  hypothetical protein OsI_37694                          102   2e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_010266827.1|  PREDICTED: probable receptor-like protein ki...    106   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_006359697.1|  PREDICTED: proline-rich receptor-like protei...    105   3e-22   Solanum tuberosum [potatoes]
ref|XP_010320789.1|  PREDICTED: receptor-like cytosolic serine/th...    105   3e-22   Solanum lycopersicum
gb|EEE52871.1|  hypothetical protein OsJ_35430                          105   3e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010920120.1|  PREDICTED: probable receptor-like protein ki...    105   3e-22   Elaeis guineensis
ref|XP_010920119.1|  PREDICTED: probable receptor-like protein ki...    105   4e-22   Elaeis guineensis
gb|EEC78249.1|  hypothetical protein OsI_17914                          105   4e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_008813513.1|  PREDICTED: protein STRUBBELIG-RECEPTOR FAMIL...    104   6e-22   Phoenix dactylifera
ref|XP_009791612.1|  PREDICTED: probable serine/threonine-protein...    104   1e-21   Nicotiana sylvestris
ref|XP_010315381.1|  PREDICTED: probable receptor-like serine/thr...    104   1e-21   Solanum lycopersicum
ref|XP_002442921.1|  hypothetical protein SORBIDRAFT_08g004940          104   1e-21   Sorghum bicolor [broomcorn]
ref|XP_002463556.1|  hypothetical protein SORBIDRAFT_01g001890          104   2e-21   
gb|KHG28516.1|  Receptor-like cytosolic serine/threonine-protein ...    103   2e-21   Gossypium arboreum [tree cotton]
ref|XP_011046218.1|  PREDICTED: probable receptor-like serine/thr...    103   2e-21   Populus euphratica
ref|XP_006486742.1|  PREDICTED: probable receptor-like serine/thr...    103   2e-21   Citrus sinensis [apfelsine]
ref|XP_009384623.1|  PREDICTED: receptor-like cytosolic serine/th...    102   3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002313708.1|  hypothetical protein POPTR_0009s13710g             102   4e-21   
ref|XP_009626742.1|  PREDICTED: proline-rich receptor-like protei...    102   5e-21   Nicotiana tomentosiformis
ref|XP_009626743.1|  PREDICTED: proline-rich receptor-like protei...    102   5e-21   Nicotiana tomentosiformis
ref|XP_002305520.1|  kinase family protein                              102   6e-21   Populus trichocarpa [western balsam poplar]
gb|KJB15813.1|  hypothetical protein B456_002G197700                    100   9e-21   Gossypium raimondii
ref|XP_011046681.1|  PREDICTED: proline-rich receptor-like protei...    101   1e-20   Populus euphratica
gb|KJB15815.1|  hypothetical protein B456_002G197700                    100   1e-20   Gossypium raimondii
ref|XP_006663269.1|  PREDICTED: proline-rich receptor-like protei...    100   1e-20   
gb|KJB15816.1|  hypothetical protein B456_002G197700                    100   2e-20   Gossypium raimondii
gb|KJB15812.1|  hypothetical protein B456_002G197700                    100   2e-20   Gossypium raimondii
ref|XP_008663832.1|  PREDICTED: G-type lectin S-receptor-like ser...    100   2e-20   Zea mays [maize]
gb|KJB15811.1|  hypothetical protein B456_002G197700                    100   2e-20   Gossypium raimondii
gb|EPS65921.1|  hypothetical protein M569_08852                         100   2e-20   Genlisea aurea
ref|XP_010933343.1|  PREDICTED: receptor-like cytosolic serine/th...    100   2e-20   
gb|ABA95948.1|  universal stress protein family protein                 100   3e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004977217.1|  PREDICTED: proline-rich receptor-like protei...    100   3e-20   Setaria italica
ref|XP_010933340.1|  PREDICTED: proline-rich receptor-like protei...  99.8    3e-20   
ref|XP_008800175.1|  PREDICTED: probable receptor-like protein ki...  99.4    4e-20   Phoenix dactylifera
ref|XP_011457943.1|  PREDICTED: receptor-like cytosolic serine/th...  99.4    5e-20   Fragaria vesca subsp. vesca
ref|XP_011457944.1|  PREDICTED: receptor-like cytosolic serine/th...  99.4    5e-20   Fragaria vesca subsp. vesca
ref|XP_011457941.1|  PREDICTED: receptor-like cytosolic serine/th...  99.4    5e-20   Fragaria vesca subsp. vesca
gb|EYU37953.1|  hypothetical protein MIMGU_mgv1a002277mg              99.0    6e-20   Erythranthe guttata [common monkey flower]
ref|XP_011088607.1|  PREDICTED: probable receptor-like protein ki...  98.6    1e-19   Sesamum indicum [beniseed]
ref|XP_008236015.1|  PREDICTED: probable serine/threonine-protein...  97.8    2e-19   Prunus mume [ume]
ref|XP_008236014.1|  PREDICTED: probable serine/threonine-protein...  97.8    2e-19   Prunus mume [ume]
ref|XP_008236013.1|  PREDICTED: probable serine/threonine-protein...  97.8    2e-19   
ref|XP_010933342.1|  PREDICTED: proline-rich receptor-like protei...  97.4    2e-19   Elaeis guineensis
gb|AFW56237.1|  putative protein kinase superfamily protein           97.4    2e-19   
dbj|BAJ96024.1|  predicted protein                                    96.3    5e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ97343.1|  predicted protein                                    95.9    6e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011002426.1|  PREDICTED: uncharacterized protein LOC105109411  89.4    6e-19   Populus euphratica
ref|XP_003558383.1|  PREDICTED: receptor-like cytosolic serine/th...  95.9    7e-19   Brachypodium distachyon [annual false brome]
ref|XP_010228892.1|  PREDICTED: receptor-like cytosolic serine/th...  95.9    7e-19   Brachypodium distachyon [annual false brome]
ref|NP_001170103.1|  uncharacterized protein LOC100384022             94.0    8e-19   
tpg|DAA44335.1|  TPA: putative protein kinase superfamily protein     94.0    8e-19   
ref|XP_007199719.1|  hypothetical protein PRUPE_ppa002257mg           94.7    2e-18   Prunus persica
ref|XP_003577000.1|  PREDICTED: probable receptor-like serine/thr...  94.7    2e-18   Brachypodium distachyon [annual false brome]
ref|XP_012081775.1|  PREDICTED: calmodulin-binding receptor-like ...  94.4    2e-18   
gb|KDP29658.1|  hypothetical protein JCGZ_18820                       94.4    2e-18   Jatropha curcas
gb|ABF94898.1|  protein kinase family protein, putative, expressed    94.4    3e-18   Oryza sativa Japonica Group [Japonica rice]
gb|EAY89207.1|  hypothetical protein OsI_10703                        94.0    3e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_002465576.1|  hypothetical protein SORBIDRAFT_01g041400        94.0    3e-18   
ref|XP_011457945.1|  PREDICTED: receptor-like cytosolic serine/th...  94.4    3e-18   
ref|XP_011457942.1|  PREDICTED: receptor-like cytosolic serine/th...  94.0    3e-18   
ref|XP_008645813.1|  PREDICTED: uncharacterized protein LOC100384...  94.0    3e-18   
ref|XP_008377740.1|  PREDICTED: probable serine/threonine-protein...  93.6    4e-18   
ref|XP_008357286.1|  PREDICTED: probable serine/threonine-protein...  93.6    4e-18   
ref|XP_004500727.1|  PREDICTED: probable receptor-like serine/thr...  92.4    9e-18   
emb|CBI37873.3|  unnamed protein product                              92.4    1e-17   
ref|XP_006649715.1|  PREDICTED: putative proline-rich receptor-li...  92.4    1e-17   
ref|XP_010646843.1|  PREDICTED: proline-rich receptor-like protei...  92.4    1e-17   
ref|XP_004985046.1|  PREDICTED: putative proline-rich receptor-li...  92.0    1e-17   
ref|XP_008357288.1|  PREDICTED: probable serine/threonine-protein...  91.3    3e-17   
ref|XP_008377742.1|  PREDICTED: probable serine/threonine-protein...  91.3    3e-17   
ref|XP_004505819.1|  PREDICTED: proline-rich receptor-like protei...  90.1    5e-17   
ref|XP_004505816.1|  PREDICTED: proline-rich receptor-like protei...  90.1    5e-17   
ref|XP_009355672.1|  PREDICTED: probable serine/threonine-protein...  90.5    5e-17   
emb|CDP14559.1|  unnamed protein product                              89.7    8e-17   
gb|KEH30484.1|  adenine nucleotide alpha hydrolase-like domain ki...  88.2    1e-16   
ref|NP_001067422.1|  Os11g0194900                                     88.6    2e-16   
gb|KEH30483.1|  adenine nucleotide alpha hydrolase-like domain ki...  88.2    2e-16   
ref|XP_010690367.1|  PREDICTED: probable receptor-like protein ki...  88.6    2e-16   
ref|XP_010690368.1|  PREDICTED: probable receptor-like protein ki...  88.2    3e-16   
gb|AES89378.2|  adenine nucleotide alpha hydrolase-like domain ki...  87.8    3e-16   
ref|XP_003607181.1|  Wall-associated receptor kinase-like protein     87.8    3e-16   
ref|XP_009355675.1|  PREDICTED: probable serine/threonine-protein...  87.8    3e-16   
emb|CAN73629.1|  hypothetical protein VITISV_026641                   87.4    5e-16   
ref|XP_003540886.1|  PREDICTED: putative proline-rich receptor-li...  87.0    6e-16   
ref|XP_007131712.1|  hypothetical protein PHAVU_011G035600g           86.7    8e-16   
ref|XP_011092979.1|  PREDICTED: probable receptor-like serine/thr...  86.7    9e-16   
ref|XP_003538989.1|  PREDICTED: proline-rich receptor-like protei...  86.7    9e-16   
ref|XP_009376969.1|  PREDICTED: probable serine/threonine-protein...  86.3    1e-15   
ref|XP_009376952.1|  PREDICTED: probable serine/threonine-protein...  86.3    1e-15   
gb|KHN25469.1|  Putative proline-rich receptor-like protein kinas...  86.3    1e-15   
gb|EMT26702.1|  hypothetical protein F775_52533                       85.5    2e-15   
ref|XP_010516178.1|  PREDICTED: probable receptor-like serine/thr...  85.1    2e-15   
ref|XP_010516196.1|  PREDICTED: probable receptor-like serine/thr...  85.1    2e-15   
gb|EMS48655.1|  Proline-rich receptor-like protein kinase PERK13      85.5    2e-15   
ref|XP_006409395.1|  hypothetical protein EUTSA_v10022595mg           83.2    1e-14   
ref|XP_006409394.1|  hypothetical protein EUTSA_v10022595mg           83.2    1e-14   
ref|XP_003604039.1|  Receptor-like protein kinase                     82.4    2e-14   
ref|XP_010516187.1|  PREDICTED: probable receptor-like serine/thr...  81.3    4e-14   
ref|XP_010489257.1|  PREDICTED: probable receptor-like serine/thr...  80.9    6e-14   
ref|XP_010489258.1|  PREDICTED: probable receptor-like serine/thr...  80.9    6e-14   
ref|XP_006297441.1|  hypothetical protein CARUB_v10013464mg           80.5    8e-14   
ref|XP_001769145.1|  predicted protein                                79.7    9e-14   
ref|XP_010496669.1|  PREDICTED: receptor-like cytosolic serine/th...  79.3    2e-13   
ref|XP_010496668.1|  PREDICTED: probable receptor-like serine/thr...  79.0    2e-13   
ref|XP_010530898.1|  PREDICTED: receptor-like cytosolic serine/th...  79.0    3e-13   
emb|CDY47476.1|  BnaA09g08850D                                        74.3    8e-13   
ref|XP_002884015.1|  kinase family protein                            77.0    1e-12   
ref|XP_008457693.1|  PREDICTED: serine/threonine-protein kinase A...  76.3    2e-12   
ref|XP_011649290.1|  PREDICTED: receptor-like cytosolic serine/th...  73.6    2e-11   
ref|XP_010548098.1|  PREDICTED: receptor-like cytosolic serine/th...  72.0    6e-11   
ref|XP_010548097.1|  PREDICTED: receptor-like cytosolic serine/th...  71.6    7e-11   
ref|NP_179266.2|  adenine nucleotide alpha hydrolases-domain cont...  70.5    1e-10   
emb|CDY26784.1|  BnaC09g09110D                                        68.2    2e-10   
ref|XP_002983032.1|  hypothetical protein SELMODRAFT_422414           68.9    6e-10   
ref|XP_009121184.1|  PREDICTED: probable receptor-like serine/thr...  68.6    6e-10   
dbj|BAF79959.1|  receptor-like kinase                                 67.8    1e-09   
gb|ERM95272.1|  hypothetical protein AMTR_s00008p00064820             65.9    5e-09   
ref|XP_006827856.2|  PREDICTED: probable receptor-like serine/thr...  65.5    8e-09   
ref|XP_010102981.1|  putative receptor-like serine/threonine-prot...  62.8    5e-08   
gb|EMS55837.1|  Receptor-like cytosolic serine/threonine-protein ...  62.8    6e-08   
ref|XP_010928966.1|  PREDICTED: probable receptor-like serine/thr...  62.4    6e-08   
ref|XP_010246898.1|  PREDICTED: probable receptor-like serine/thr...  62.4    8e-08   
ref|XP_010246899.1|  PREDICTED: probable receptor-like serine/thr...  62.0    1e-07   
ref|XP_010913623.1|  PREDICTED: probable receptor-like serine/thr...  62.0    1e-07   
ref|XP_010913624.1|  PREDICTED: probable receptor-like serine/thr...  61.6    1e-07   
ref|XP_010246897.1|  PREDICTED: probable receptor-like serine/thr...  62.0    1e-07   
ref|XP_006659248.1|  PREDICTED: probable receptor-like serine/thr...  61.6    1e-07   
ref|XP_008782089.1|  PREDICTED: probable receptor-like serine/thr...  61.2    2e-07   
ref|XP_008789732.1|  PREDICTED: probable receptor-like serine/thr...  61.2    2e-07   
ref|NP_001061370.1|  Os08g0249100                                     60.8    2e-07   
ref|XP_008364350.1|  PREDICTED: probable receptor-like serine/thr...  59.7    5e-07   
ref|XP_007224135.1|  hypothetical protein PRUPE_ppa015992mg           59.3    7e-07   
ref|XP_008447901.1|  PREDICTED: PTI1-like tyrosine-protein kinase 2   59.3    7e-07   
dbj|BAK05434.1|  predicted protein                                    59.3    7e-07   
gb|EEC83194.1|  hypothetical protein OsI_28446                        59.3    8e-07   
gb|KJB23519.1|  hypothetical protein B456_004G102100                  58.9    8e-07   
ref|XP_010323234.1|  PREDICTED: probable receptor-like serine/thr...  58.9    1e-06   
ref|XP_002444116.1|  hypothetical protein SORBIDRAFT_07g008540        58.5    1e-06   
gb|KJB23520.1|  hypothetical protein B456_004G102100                  58.5    1e-06   
ref|XP_009339818.1|  PREDICTED: probable receptor-like serine/thr...  58.2    2e-06   
ref|XP_009384851.1|  PREDICTED: probable receptor-like serine/thr...  58.2    2e-06   
ref|XP_010656799.1|  PREDICTED: probable receptor-like serine/thr...  58.2    2e-06   
ref|XP_009339817.1|  PREDICTED: probable receptor-like serine/thr...  58.2    2e-06   
gb|AFW56858.1|  putative protein kinase superfamily protein           58.2    2e-06   
emb|CBI17761.3|  unnamed protein product                              58.2    2e-06   
gb|KJB76586.1|  hypothetical protein B456_012G095500                  58.2    2e-06   
ref|XP_008661875.1|  PREDICTED: ATP binding protein isoform X2        58.2    2e-06   
gb|KJB76587.1|  hypothetical protein B456_012G095500                  58.2    2e-06   
ref|NP_001147093.1|  ATP binding protein                              58.2    2e-06   
ref|XP_008661873.1|  PREDICTED: ATP binding protein isoform X1        58.2    2e-06   
ref|XP_009379507.1|  PREDICTED: probable receptor-like serine/thr...  57.8    2e-06   
ref|XP_002534152.1|  ATP binding protein, putative                    57.8    2e-06   
ref|XP_011658618.1|  PREDICTED: PTI1-like tyrosine-protein kinase 1   57.8    3e-06   
ref|XP_010048688.1|  PREDICTED: probable receptor-like serine/thr...  57.4    3e-06   
ref|XP_011079437.1|  PREDICTED: probable receptor-like serine/thr...  57.4    3e-06   
ref|XP_009608071.1|  PREDICTED: probable receptor-like serine/thr...  57.4    3e-06   
ref|XP_008341187.1|  PREDICTED: probable receptor-like serine/thr...  57.0    4e-06   
ref|XP_002528423.1|  serine-threonine protein kinase, plant-type,...  57.0    5e-06   
ref|XP_003573609.1|  PREDICTED: probable receptor-like serine/thr...  56.6    6e-06   
ref|XP_006474137.1|  PREDICTED: probable receptor-like serine/thr...  56.6    6e-06   
ref|XP_006474136.1|  PREDICTED: probable receptor-like serine/thr...  56.6    6e-06   
ref|XP_010266087.1|  PREDICTED: pto-interacting protein 1-like is...  56.2    7e-06   
ref|XP_006453444.1|  hypothetical protein CICLE_v10007784mg           56.2    7e-06   
ref|XP_002534342.1|  conserved hypothetical protein                   56.2    7e-06   
ref|XP_008457696.1|  PREDICTED: serine/threonine-protein kinase A...  56.2    8e-06   
gb|KHG15349.1|  hypothetical protein F383_17411                       55.8    9e-06   
ref|XP_004973093.1|  PREDICTED: probable receptor-like serine/thr...  55.8    1e-05   
ref|XP_010688514.1|  PREDICTED: probable receptor-like serine/thr...  55.8    1e-05   
ref|XP_004973092.1|  PREDICTED: probable receptor-like serine/thr...  55.8    1e-05   
ref|XP_009799763.1|  PREDICTED: probable receptor-like serine/thr...  55.5    2e-05   
ref|XP_009413203.1|  PREDICTED: PTI1-like tyrosine-protein kinase...  55.1    2e-05   
ref|XP_006343698.1|  PREDICTED: probable receptor-like serine/thr...  54.7    3e-05   
ref|XP_006381845.1|  hypothetical protein POPTR_0006s18770g           54.7    3e-05   
gb|KDO62429.1|  hypothetical protein CISIN_1g008650mg                 54.3    3e-05   
ref|XP_011012683.1|  PREDICTED: probable receptor-like serine/thr...  54.3    3e-05   
ref|XP_011012684.1|  PREDICTED: probable receptor-like serine/thr...  54.3    3e-05   
ref|XP_011649293.1|  PREDICTED: serine/threonine-protein kinase C...  53.9    5e-05   
ref|XP_011648926.1|  PREDICTED: probable receptor-like serine/thr...  53.5    7e-05   
emb|CDP02933.1|  unnamed protein product                              53.5    7e-05   
ref|XP_010103297.1|  Proline-rich receptor-like protein kinase PERK1  53.1    7e-05   
ref|XP_007142741.1|  hypothetical protein PHAVU_007G013100g           50.1    8e-05   
ref|XP_004150333.1|  PREDICTED: probable receptor-like serine/thr...  53.1    8e-05   
ref|XP_012065277.1|  PREDICTED: probable receptor-like serine/thr...  53.1    8e-05   
emb|CBI37761.3|  unnamed protein product                              53.1    8e-05   
ref|XP_010645999.1|  PREDICTED: serine/threonine-protein kinase C...  53.1    9e-05   
gb|KEH32562.1|  receptor-like kinase                                  53.1    1e-04   
ref|XP_002279474.1|  PREDICTED: serine/threonine-protein kinase C...  53.1    1e-04   
ref|XP_006386349.1|  hypothetical protein POPTR_0002s07820g           52.8    1e-04   
gb|EEC68959.1|  hypothetical protein OsI_37687                        52.8    1e-04   
ref|XP_007154801.1|  hypothetical protein PHAVU_003G149100g           52.4    1e-04   
emb|CAN75128.1|  hypothetical protein VITISV_042429                   52.8    1e-04   
ref|XP_007154802.1|  hypothetical protein PHAVU_003G149100g           52.4    1e-04   
ref|XP_010536938.1|  PREDICTED: probable receptor-like serine/thr...  52.0    2e-04   
ref|XP_003610193.1|  Nodulation receptor kinase                       52.0    2e-04   
gb|EYU34283.1|  hypothetical protein MIMGU_mgv1a021069mg              51.6    3e-04   
gb|AES92390.2|  receptor-like kinase                                  51.6    3e-04   
ref|XP_004507811.1|  PREDICTED: probable receptor-like serine/thr...  51.2    4e-04   
ref|XP_008451864.1|  PREDICTED: probable receptor-like serine/thr...  50.8    5e-04   
ref|XP_010266088.1|  PREDICTED: pto-interacting protein 1-like is...  50.8    5e-04   



>ref|XP_006345367.1| PREDICTED: probable receptor-like protein kinase At5g18500-like 
[Solanum tuberosum]
Length=717

 Score =   211 bits (536),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            K+DSRSKELLTWALVKVAQTGD ++A+HV+DP++DKSE L LVK+FD +LAAYEGFCNLK
Sbjct  57   KLDSRSKELLTWALVKVAQTGDHVVAVHVIDPNSDKSEPLSLVKSFDLMLAAYEGFCNLK  116

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            QV LKL+VCRGSP RK+LAREAK   A +LI+GTSGS HA+RS VS+AKYCAR V KSIS
Sbjct  117  QVHLKLKVCRGSPVRKVLAREAKLESAINLIIGTSGSHHAIRSSVSLAKYCARKVTKSIS  176

Query  668  VLAVNNGKVAFQSE  709
            V+AV+NGK+ +Q E
Sbjct  177  VIAVDNGKIVYQRE  190



>ref|XP_004229167.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X1 [Solanum lycopersicum]
Length=717

 Score =   210 bits (534),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            K+DSRSKELLTWALVKVAQTGD ++A+HV+DP++DKSE L LVK+FDS+L+AYEGFCNLK
Sbjct  58   KLDSRSKELLTWALVKVAQTGDHVVAVHVIDPNSDKSEPLSLVKSFDSMLSAYEGFCNLK  117

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            QV LKL+VCRGSP RK+LAREAK   A +LI+GTSGS HA+RS VS+AKYCAR + K+IS
Sbjct  118  QVHLKLKVCRGSPVRKVLAREAKLESAINLIIGTSGSHHAIRSSVSLAKYCARKLTKNIS  177

Query  668  VLAVNNGKVAFQSE  709
            V+AV+NGK+ +Q E
Sbjct  178  VIAVDNGKIVYQRE  191



>ref|XP_011088213.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Sesamum indicum]
Length=669

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            KMDSRS+ELLTWALVKVAQ+GDR++ALH+LDP+ DKS +L LVKTFDSVLAAYEGFCNLK
Sbjct  2    KMDSRSRELLTWALVKVAQSGDRVVALHILDPNADKSTLLALVKTFDSVLAAYEGFCNLK  61

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            +VDLKL+VC+GSP RKIL +EAK+  AT LI+G SG  H +RS +SVAKYCA+N+ K++S
Sbjct  62   EVDLKLKVCKGSPVRKILTQEAKSCGATSLILGASGVHHKIRSRISVAKYCAKNLQKNVS  121

Query  668  VLAVNNGKVAFQSEPN  715
            V+ V+NGK+ FQ + N
Sbjct  122  VMCVDNGKILFQRDSN  137



>ref|XP_009628102.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Nicotiana tomentosiformis]
Length=760

 Score =   204 bits (520),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 116/133 (87%), Gaps = 1/133 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-DKSEMLRLVKTFDSVLAAYEGFCNL  484
            K+DSRSKELLTWALVKVAQ GD ++A+HVLDP+T +K E + LVKTFDS+LAAYEGFCNL
Sbjct  99   KLDSRSKELLTWALVKVAQPGDHVVAVHVLDPNTTEKPEPIALVKTFDSMLAAYEGFCNL  158

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQV LKL+VCRGSP RK+LAREAK   AT+LIVGTSG+ H +RS VS+AKYCAR V KSI
Sbjct  159  KQVHLKLKVCRGSPVRKVLAREAKLESATNLIVGTSGNHHTIRSSVSIAKYCARKVAKSI  218

Query  665  SVLAVNNGKVAFQ  703
            SV+AV+NGK+ +Q
Sbjct  219  SVIAVDNGKIVYQ  231



>ref|XP_009788830.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 6-like [Nicotiana 
sylvestris]
Length=707

 Score =   202 bits (515),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 115/133 (86%), Gaps = 1/133 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-DKSEMLRLVKTFDSVLAAYEGFCNL  484
            K+DSRSKELLTWALVKVAQ GD ++A+HVLDP+T +K E + LVKTFDS+L AYEGFCNL
Sbjct  46   KLDSRSKELLTWALVKVAQPGDHVVAVHVLDPNTTEKPEPIALVKTFDSMLTAYEGFCNL  105

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQV LKL+VCRGSP RK+LAREAK   AT+LIVGTSG+ H +RS VS+AKYCAR V KSI
Sbjct  106  KQVHLKLKVCRGSPVRKVLAREAKLESATNLIVGTSGNHHTIRSSVSIAKYCARKVAKSI  165

Query  665  SVLAVNNGKVAFQ  703
            SV+AV+NGK+ +Q
Sbjct  166  SVIAVDNGKIVYQ  178



>gb|AID16051.1| putative universal stress protein, partial [Catharanthus roseus]
Length=497

 Score =   199 bits (505),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 117/135 (87%), Gaps = 1/135 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-DKSEMLRLVKTFDSVLAAYEGFCNL  484
            K+DSRS+ELLTWALVK+AQ+GDR+IALHV+DP+T DK+ +L LVK FDS+LAAYEGFCNL
Sbjct  46   KLDSRSRELLTWALVKIAQSGDRVIALHVIDPNTEDKATLLSLVKKFDSLLAAYEGFCNL  105

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQV+LKL+V RG P RK+LAREA ++ A  LIVGTSG+ +A+RS V+VAKYCARNV K I
Sbjct  106  KQVNLKLKVSRGRPVRKVLAREAISFGAMSLIVGTSGTYNAIRSSVAVAKYCARNVGKDI  165

Query  665  SVLAVNNGKVAFQSE  709
            SV+A +NGK+ FQ E
Sbjct  166  SVIAADNGKILFQRE  180



>emb|CDP16448.1| unnamed protein product [Coffea canephora]
Length=720

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 116/135 (86%), Gaps = 1/135 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-DKSEMLRLVKTFDSVLAAYEGFCNL  484
            KMD+RSKELLTWALVKVAQ+GDR+IALHV+DP+T DK+ +L LVK+FDSVLAAYEGFCNL
Sbjct  46   KMDTRSKELLTWALVKVAQSGDRVIALHVIDPNTEDKATLLSLVKSFDSVLAAYEGFCNL  105

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+V RGSP RK+LAREA +Y A  L++GT+ + H +RS VSVAKYCA+ V K I
Sbjct  106  KQVDLKLKVSRGSPIRKVLAREAMSYGAMSLVIGTAETNHPMRSVVSVAKYCAKTVGKDI  165

Query  665  SVLAVNNGKVAFQSE  709
            SV+AV NGK+ F+ E
Sbjct  166  SVMAVYNGKIMFRRE  180



>gb|EYU38253.1| hypothetical protein MIMGU_mgv1a002401mg [Erythranthe guttata]
Length=679

 Score =   198 bits (503),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 114/138 (83%), Gaps = 2/138 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            KMDS S+ELLTW LVKVAQ+GDR+IALH+LDPD DK  +L LVK FDSVLAAYE FCNLK
Sbjct  28   KMDSPSRELLTWTLVKVAQSGDRVIALHILDPDADKLTLLSLVKAFDSVLAAYESFCNLK  87

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGT--SGSRHAVRSPVSVAKYCARNVDKS  661
            QVDLKL+VC+GSP RKIL+REAK+  AT LI+GT  SG  H +RS +SVAKYCA+N+ K+
Sbjct  88   QVDLKLKVCKGSPVRKILSREAKSCGATTLILGTSSSGVHHKIRSRISVAKYCAKNLPKN  147

Query  662  ISVLAVNNGKVAFQSEPN  715
            ISV+ V+NGK  F+ E N
Sbjct  148  ISVICVDNGKTVFERESN  165



>ref|XP_011091800.1| PREDICTED: proline-rich receptor-like protein kinase PERK10 [Sesamum 
indicum]
Length=690

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            K+D+RS+ELLTWALVKVAQ+GDR+IALHVLDP  D S +L LVKTFDSVLAAYEGFCNLK
Sbjct  32   KLDARSRELLTWALVKVAQSGDRVIALHVLDPTADNSILLSLVKTFDSVLAAYEGFCNLK  91

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            QVDL+L+VCRGS  RKIL+REAK+  AT +IVGTSG    +RS ++VAKYCA+N+ K++S
Sbjct  92   QVDLRLKVCRGSSVRKILSREAKSCGATSVIVGTSGVHRTIRSRITVAKYCAKNLQKNVS  151

Query  668  VLAVNNGKVAFQ  703
            V+ V+NGK+ FQ
Sbjct  152  VVCVDNGKILFQ  163



>ref|XP_011102142.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Sesamum indicum]
Length=764

 Score =   190 bits (482),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 111/141 (79%), Gaps = 5/141 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDP----DTD-KSEMLRLVKTFDSVLAAYEG  472
            K+DS S+ELLTWALVKVAQ GDR++ALHVLD     D D KS +L LVK FDS+LA YEG
Sbjct  20   KLDSHSRELLTWALVKVAQAGDRVVALHVLDNNEIVDRDGKSSLLSLVKAFDSILAVYEG  79

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRGS  RKIL REAK+Y AT++IVGT+ + H +RS  SVAKYCA+ +
Sbjct  80   FCNLKQVDLKLKICRGSSIRKILVREAKSYYATEVIVGTAQTHHTIRSSASVAKYCAKKL  139

Query  653  DKSISVLAVNNGKVAFQSEPN  715
             K  SVLAVNNGK+ F  E N
Sbjct  140  SKDCSVLAVNNGKIVFHRESN  160



>gb|EYU42966.1| hypothetical protein MIMGU_mgv1a002423mg [Erythranthe guttata]
Length=677

 Score =   185 bits (470),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            K+DS+SKELLTWALVKVAQ+GDR++ALH+LD + DKS +L LVKTFDSVLAAYEGFC+LK
Sbjct  28   KLDSQSKELLTWALVKVAQSGDRVVALHILDSNADKSSLLSLVKTFDSVLAAYEGFCHLK  87

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            QVDLKL+VCRG+P  KIL+REAK+  AT +IVGTS     +RS +S+AK C +++ K+ S
Sbjct  88   QVDLKLKVCRGNPVHKILSREAKSCGATTVIVGTSRVHRTIRSRISIAKSCTKSLQKNAS  147

Query  668  VLAVNNGKVAFQSE  709
            ++ V+NGK+ FQ E
Sbjct  148  LMCVDNGKIVFQRE  161



>gb|EYU32494.1| hypothetical protein MIMGU_mgv1a001977mg [Erythranthe guttata]
Length=731

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 110/141 (78%), Gaps = 5/141 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            K+DS S+ELLTWALVKVA  GD +IALHVLD +       KS +L LVK FDS+L  YEG
Sbjct  24   KLDSHSRELLTWALVKVAHAGDCVIALHVLDNNQIVDRDGKSSLLSLVKAFDSILEVYEG  83

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRG+  +KIL REAK+Y A+++I+GT+ +RH +RS  SVAKYCAR +
Sbjct  84   FCNLKQVDLKLKICRGTSIKKILVREAKSYYASEVILGTAQTRHTIRSSASVAKYCARKL  143

Query  653  DKSISVLAVNNGKVAFQSEPN  715
            DK+ SVLAVNNGK+ F  E N
Sbjct  144  DKNCSVLAVNNGKILFHRESN  164



>emb|CDP11935.1| unnamed protein product [Coffea canephora]
Length=776

 Score =   186 bits (471),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 108/137 (79%), Gaps = 5/137 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            K+D++S+ELLTWALVKVAQ GDR+IALHVLD +       KS +L LVK FDSVLA YEG
Sbjct  32   KLDAQSRELLTWALVKVAQPGDRVIALHVLDSNEIVDRDGKSSLLSLVKAFDSVLAVYEG  91

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNL+QVDLKL++CRGS  RKIL REAK+Y AT+LIVGTS + H +RS  SVAKYCA+ +
Sbjct  92   FCNLRQVDLKLKICRGSSIRKILVREAKSYSATELIVGTSRNHHTIRSSASVAKYCAKKL  151

Query  653  DKSISVLAVNNGKVAFQ  703
             K  S LAVNNGK+ F 
Sbjct  152  AKDCSTLAVNNGKIVFH  168



>ref|XP_008441611.1| PREDICTED: uncharacterized protein LOC103485693 [Cucumis melo]
Length=756

 Score =   184 bits (468),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 107/139 (77%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            K+DS S+ELLTWALVKVAQ GD +IALHVL  D       KS +L LVK FDSVLA YEG
Sbjct  26   KLDSHSRELLTWALVKVAQPGDLVIALHVLGNDEIVNQDGKSSLLSLVKAFDSVLAVYEG  85

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRG  ARKIL REAK+YRAT++IVGT+   H +RS  SVAKYCA+ +
Sbjct  86   FCNLKQVDLKLKICRGESARKILVREAKSYRATNVIVGTARKHHKIRSSTSVAKYCAKKL  145

Query  653  DKSISVLAVNNGKVAFQSE  709
             K   VLAV+NGKV FQ E
Sbjct  146  PKDFWVLAVHNGKVIFQRE  164



>ref|XP_007048488.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 5 [Theobroma cacao]
 ref|XP_007048489.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 5 [Theobroma cacao]
 gb|EOX92645.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 5 [Theobroma cacao]
 gb|EOX92646.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 5 [Theobroma cacao]
Length=556

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 102/133 (77%), Gaps = 1/133 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLD-PDTDKSEMLRLVKTFDSVLAAYEGFCNL  484
            K D  SKELLTWALVKVAQ GD IIALH+LD P    + +L LVKTFDS+LA YEGFCNL
Sbjct  22   KFDGESKELLTWALVKVAQPGDHIIALHILDTPTESTASILSLVKTFDSILAVYEGFCNL  81

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQ+DLKL+VCRGS A+KIL REAK+Y A  LI+GTS + H +RS  SVAKYCAR + K  
Sbjct  82   KQLDLKLKVCRGSSAKKILVREAKSYEAAKLILGTSKTHHPIRSTASVAKYCARKLPKCF  141

Query  665  SVLAVNNGKVAFQ  703
             V AV NGK+ FQ
Sbjct  142  WVYAVGNGKIVFQ  154



>ref|XP_010269084.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Nelumbo nucifera]
Length=765

 Score =   184 bits (466),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 109/139 (78%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDP----DTD-KSEMLRLVKTFDSVLAAYEG  472
            K+D +S+ELLTWALVKVAQ GDR+IALHVL      D D KS +L LVK FDSVLA YEG
Sbjct  29   KLDQQSRELLTWALVKVAQPGDRVIALHVLSNTEILDKDGKSSLLSLVKAFDSVLAVYEG  88

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRGS  R++L REAK+Y AT +IVGT+   HA+ SPVSVAKYCA+ +
Sbjct  89   FCNLKQVDLKLKICRGSSIRRVLVREAKSYLATKVIVGTATHHHAIGSPVSVAKYCAKKL  148

Query  653  DKSISVLAVNNGKVAFQSE  709
             K   VLAVNNGKV F+ E
Sbjct  149  SKDCLVLAVNNGKVVFERE  167



>ref|XP_007048485.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 ref|XP_007048486.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 ref|XP_007048487.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 gb|EOX92642.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 gb|EOX92643.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 gb|EOX92644.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
Length=726

 Score =   183 bits (464),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 102/133 (77%), Gaps = 1/133 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLD-PDTDKSEMLRLVKTFDSVLAAYEGFCNL  484
            K D  SKELLTWALVKVAQ GD IIALH+LD P    + +L LVKTFDS+LA YEGFCNL
Sbjct  22   KFDGESKELLTWALVKVAQPGDHIIALHILDTPTESTASILSLVKTFDSILAVYEGFCNL  81

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQ+DLKL+VCRGS A+KIL REAK+Y A  LI+GTS + H +RS  SVAKYCAR + K  
Sbjct  82   KQLDLKLKVCRGSSAKKILVREAKSYEAAKLILGTSKTHHPIRSTASVAKYCARKLPKCF  141

Query  665  SVLAVNNGKVAFQ  703
             V AV NGK+ FQ
Sbjct  142  WVYAVGNGKIVFQ  154



>ref|XP_002520305.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF42091.1| ATP binding protein, putative [Ricinus communis]
Length=758

 Score =   182 bits (463),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 107/139 (77%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            K+DS S+ELLTWA+VKVAQ GD +IALHVL  +       KS +L LVK FDSVLA YEG
Sbjct  23   KLDSESRELLTWAMVKVAQPGDTVIALHVLGNNEIVDREGKSSLLSLVKAFDSVLAVYEG  82

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRGS  RKIL REAK+Y AT++IVG + + H +RSP SVAKYCA+ +
Sbjct  83   FCNLKQVDLKLKICRGSSIRKILVREAKSYSATNIIVGAARTHHTIRSPTSVAKYCAKKL  142

Query  653  DKSISVLAVNNGKVAFQSE  709
             K   VLAV+NGKV FQ E
Sbjct  143  SKDCLVLAVHNGKVVFQKE  161



>ref|XP_007019225.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Theobroma cacao]
 gb|EOY16450.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Theobroma cacao]
Length=771

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 108/139 (78%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDP----DTD-KSEMLRLVKTFDSVLAAYEG  472
            K+DS S+ELLTWALVKVAQ GD +IALHVL      D D KS +L LVK FDSVLA YEG
Sbjct  27   KLDSPSRELLTWALVKVAQPGDSVIALHVLGNNEIVDRDGKSSLLSLVKAFDSVLAVYEG  86

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRGS  RKIL REAK+Y AT LIVGT+   H +RS  SVAKYCA+ +
Sbjct  87   FCNLKQVDLKLKICRGSSIRKILVREAKSYSATKLIVGTAAKLHKIRSSTSVAKYCAKKL  146

Query  653  DKSISVLAVNNGKVAFQSE  709
             K+ SVLAV+NGKV FQ E
Sbjct  147  TKNCSVLAVHNGKVLFQRE  165



>ref|XP_011649434.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Cucumis sativus]
 gb|KGN62217.1| hypothetical protein Csa_2G336150 [Cucumis sativus]
Length=725

 Score =   182 bits (461),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 106/136 (78%), Gaps = 5/136 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLD----PDTDKSEMLRLVKTFDSVLAAYEGF  475
            KMDS S+ELLTWALVKVAQ GD +IALHVLD    P+  KS +L LVK+FDSVL+AYEGF
Sbjct  21   KMDSHSRELLTWALVKVAQPGDSVIALHVLDSAAVPEG-KSTLLSLVKSFDSVLSAYEGF  79

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQV+LKL+VCRGSP RK++ RE  +Y    LI+GTS + H +RS  SVAKYCAR + 
Sbjct  80   CNLKQVELKLKVCRGSPVRKVIRREVNSYEEASLILGTSKTHHRIRSSASVAKYCARKLS  139

Query  656  KSISVLAVNNGKVAFQ  703
               +VLAVNNGKV FQ
Sbjct  140  SRFTVLAVNNGKVIFQ  155



>ref|XP_008460873.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g10290 [Cucumis melo]
Length=725

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 106/136 (78%), Gaps = 5/136 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLD----PDTDKSEMLRLVKTFDSVLAAYEGF  475
            KMDS S+ELLTWALVKVAQ GD +IALHVLD    P+  KS +L LVK+FDSVL+AYEGF
Sbjct  21   KMDSHSRELLTWALVKVAQPGDSVIALHVLDSAAVPEG-KSTLLSLVKSFDSVLSAYEGF  79

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQV+LKL+VCRGSP RK++ RE  +Y    LI+GTS + H +RS  SVAKYCAR + 
Sbjct  80   CNLKQVELKLKVCRGSPVRKVIRREVDSYEEASLILGTSKTHHRIRSSASVAKYCARKLS  139

Query  656  KSISVLAVNNGKVAFQ  703
               +VLAVNNGKV FQ
Sbjct  140  SRFTVLAVNNGKVIFQ  155



>gb|KDO80472.1| hypothetical protein CISIN_1g004174mg [Citrus sinensis]
Length=643

 Score =   181 bits (458),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 107/140 (76%), Gaps = 7/140 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL------DPDTDKSEMLRLVKTFDSVLAAYE  469
            K+D+ S+ELLTWALVKVAQ GD +IALHVL      D D  KS +L LVK FDSVLA YE
Sbjct  24   KLDTHSRELLTWALVKVAQPGDTVIALHVLANNAIVDRD-GKSSLLSLVKAFDSVLAVYE  82

Query  470  GFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARN  649
            GFCNLKQVDLKL++CRG+  RKIL REA++Y AT  IVGT+ + H +RS  S+AKYCA+ 
Sbjct  83   GFCNLKQVDLKLKICRGTSIRKILVREAQSYSATKFIVGTAKNHHTIRSTTSLAKYCAKK  142

Query  650  VDKSISVLAVNNGKVAFQSE  709
            + K  SVLAVNNGKV FQ E
Sbjct  143  LSKDCSVLAVNNGKVVFQKE  162



>gb|KDO80473.1| hypothetical protein CISIN_1g004174mg [Citrus sinensis]
Length=611

 Score =   180 bits (457),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 107/140 (76%), Gaps = 7/140 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL------DPDTDKSEMLRLVKTFDSVLAAYE  469
            K+D+ S+ELLTWALVKVAQ GD +IALHVL      D D  KS +L LVK FDSVLA YE
Sbjct  24   KLDTHSRELLTWALVKVAQPGDTVIALHVLANNAIVDRD-GKSSLLSLVKAFDSVLAVYE  82

Query  470  GFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARN  649
            GFCNLKQVDLKL++CRG+  RKIL REA++Y AT  IVGT+ + H +RS  S+AKYCA+ 
Sbjct  83   GFCNLKQVDLKLKICRGTSIRKILVREAQSYSATKFIVGTAKNHHTIRSTTSLAKYCAKK  142

Query  650  VDKSISVLAVNNGKVAFQSE  709
            + K  SVLAVNNGKV FQ E
Sbjct  143  LSKDCSVLAVNNGKVVFQKE  162



>ref|XP_011657416.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Cucumis sativus]
Length=756

 Score =   181 bits (459),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 106/139 (76%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDP-----DTDKSEMLRLVKTFDSVLAAYEG  472
            K+DS S+ELLTWALVKVAQ GD +IALHVL          KS +L LVK FD+VLA YEG
Sbjct  26   KLDSHSRELLTWALVKVAQPGDLVIALHVLGNHEIVNQDGKSSLLSLVKAFDTVLAVYEG  85

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRG  ARKIL REAK+YRAT+LIVGT+   H +RS  SVAKYCA+ +
Sbjct  86   FCNLKQVDLKLKICRGESARKILVREAKSYRATNLIVGTARKHHKIRSSTSVAKYCAKKL  145

Query  653  DKSISVLAVNNGKVAFQSE  709
             K   VLAV+NGKV F+ E
Sbjct  146  PKDFWVLAVHNGKVIFERE  164



>ref|XP_006472861.1| PREDICTED: probable L-type lectin-domain containing receptor 
kinase II.1-like [Citrus sinensis]
Length=770

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 107/140 (76%), Gaps = 7/140 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL------DPDTDKSEMLRLVKTFDSVLAAYE  469
            K+D+ S+ELLTWALVKVAQ GD +IALHVL      D D  KS +L LVK FDSVLA YE
Sbjct  24   KLDTHSRELLTWALVKVAQPGDTVIALHVLANNAIVDRDG-KSSLLSLVKAFDSVLAVYE  82

Query  470  GFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARN  649
            GFCNLKQVDLKL++CRG+  RKIL REA++Y AT  IVGT+ + H +RS  S+AKYCA+ 
Sbjct  83   GFCNLKQVDLKLKICRGTSIRKILVREAQSYSATKFIVGTAKNHHTIRSTTSLAKYCAKK  142

Query  650  VDKSISVLAVNNGKVAFQSE  709
            + K  SVLAVNNGKV FQ E
Sbjct  143  LSKDCSVLAVNNGKVVFQKE  162



>ref|XP_006434295.1| hypothetical protein CICLE_v10000358mg [Citrus clementina]
 gb|ESR47535.1| hypothetical protein CICLE_v10000358mg [Citrus clementina]
Length=770

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 107/140 (76%), Gaps = 7/140 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL------DPDTDKSEMLRLVKTFDSVLAAYE  469
            K+D+ S+ELLTWALVKVAQ GD +IALHVL      D D  KS +L LVK FDSVLA YE
Sbjct  24   KLDTHSRELLTWALVKVAQPGDTVIALHVLANNAIVDRDG-KSSLLSLVKAFDSVLAVYE  82

Query  470  GFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARN  649
            GFCNLKQVDLKL++CRG+  RKIL REA++Y AT  IVGT+ + H +RS  S+AKYCA+ 
Sbjct  83   GFCNLKQVDLKLKICRGTSIRKILVREAQSYSATKFIVGTAKNHHTIRSTTSLAKYCAKK  142

Query  650  VDKSISVLAVNNGKVAFQSE  709
            + K  SVLAVNNGKV FQ E
Sbjct  143  LSKDCSVLAVNNGKVVFQKE  162



>gb|KDO80470.1| hypothetical protein CISIN_1g004174mg [Citrus sinensis]
Length=770

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 107/140 (76%), Gaps = 7/140 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL------DPDTDKSEMLRLVKTFDSVLAAYE  469
            K+D+ S+ELLTWALVKVAQ GD +IALHVL      D D  KS +L LVK FDSVLA YE
Sbjct  24   KLDTHSRELLTWALVKVAQPGDTVIALHVLANNAIVDRDG-KSSLLSLVKAFDSVLAVYE  82

Query  470  GFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARN  649
            GFCNLKQVDLKL++CRG+  RKIL REA++Y AT  IVGT+ + H +RS  S+AKYCA+ 
Sbjct  83   GFCNLKQVDLKLKICRGTSIRKILVREAQSYSATKFIVGTAKNHHTIRSTTSLAKYCAKK  142

Query  650  VDKSISVLAVNNGKVAFQSE  709
            + K  SVLAVNNGKV FQ E
Sbjct  143  LSKDCSVLAVNNGKVVFQKE  162



>gb|KDO80469.1| hypothetical protein CISIN_1g004174mg [Citrus sinensis]
Length=766

 Score =   180 bits (456),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 107/140 (76%), Gaps = 7/140 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL------DPDTDKSEMLRLVKTFDSVLAAYE  469
            K+D+ S+ELLTWALVKVAQ GD +IALHVL      D D  KS +L LVK FDSVLA YE
Sbjct  24   KLDTHSRELLTWALVKVAQPGDTVIALHVLANNAIVDRDG-KSSLLSLVKAFDSVLAVYE  82

Query  470  GFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARN  649
            GFCNLKQVDLKL++CRG+  RKIL REA++Y AT  IVGT+ + H +RS  S+AKYCA+ 
Sbjct  83   GFCNLKQVDLKLKICRGTSIRKILVREAQSYSATKFIVGTAKNHHTIRSTTSLAKYCAKK  142

Query  650  VDKSISVLAVNNGKVAFQSE  709
            + K  SVLAVNNGKV FQ E
Sbjct  143  LSKDCSVLAVNNGKVVFQKE  162



>gb|KCW72537.1| hypothetical protein EUGRSUZ_E01004 [Eucalyptus grandis]
Length=595

 Score =   179 bits (453),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 108/139 (78%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            K+D +S+ELLTWALVKVA+ GDR++ALHVL  +       KS +L LV+ FDSVLA YEG
Sbjct  28   KLDPQSRELLTWALVKVAEPGDRVLALHVLGSNEIVDRDGKSSLLSLVRAFDSVLAVYEG  87

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRG+  RKIL REAK+Y AT +IVGT+ + H++RS  SVAKYCA+ +
Sbjct  88   FCNLKQVDLKLKICRGTSIRKILVREAKSYVATRVIVGTAKNHHSIRSSTSVAKYCAKKL  147

Query  653  DKSISVLAVNNGKVAFQSE  709
             K   VLAVNNGKV FQ E
Sbjct  148  PKDCWVLAVNNGKVVFQRE  166



>ref|XP_006357335.1| PREDICTED: inactive leucine-rich repeat receptor-like serine/threonine-protein 
kinase At1g60630-like [Solanum tuberosum]
Length=769

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 107/139 (77%), Gaps = 7/139 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDP----DTD-KSEMLRLVKTFDSVLAAYEG  472
            K+D  S+ELLTWALVKVAQ GDR+IALHVL+     D D KS +L LVK FDSVLA YEG
Sbjct  23   KLDGASRELLTWALVKVAQPGDRVIALHVLNNNEIVDRDGKSSLLSLVKAFDSVLAVYEG  82

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRG+  RKI+ REA  Y ATD+IVGT+   H +RS  SVAKYCAR +
Sbjct  83   FCNLKQVDLKLKICRGTSIRKIIVREANAYLATDVIVGTAN--HTIRSSASVAKYCARKL  140

Query  653  DKSISVLAVNNGKVAFQSE  709
             K  SVLAVNNGKV FQ E
Sbjct  141  PKDCSVLAVNNGKVVFQRE  159



>ref|XP_004237363.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Solanum lycopersicum]
Length=769

 Score =   179 bits (455),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 107/139 (77%), Gaps = 7/139 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDP----DTD-KSEMLRLVKTFDSVLAAYEG  472
            K+D  S+ELLTWALVKVAQ GDR+IALHVL+     D D KS +L LVK FDSVLA YEG
Sbjct  23   KLDGASRELLTWALVKVAQPGDRVIALHVLNNNEIVDRDGKSSLLSLVKAFDSVLAVYEG  82

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRG+  RKI+ REA  Y ATD+IVGT  + H +RS  SVAKYCAR +
Sbjct  83   FCNLKQVDLKLKICRGTSIRKIIVREANAYLATDVIVGT--ANHTIRSSASVAKYCARKL  140

Query  653  DKSISVLAVNNGKVAFQSE  709
             K  SVLAVNNGKV FQ E
Sbjct  141  PKDCSVLAVNNGKVVFQRE  159



>gb|KHG01419.1| Putative proline-rich receptor-like protein kinase PERK11 [Gossypium 
arboreum]
Length=772

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 106/139 (76%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDP----DTD-KSEMLRLVKTFDSVLAAYEG  472
            K+DS S+ELLTWALVKVAQ GD +IALHVL      D D KS +L LVK FDSVLA YEG
Sbjct  31   KLDSPSRELLTWALVKVAQPGDCVIALHVLGNNEIVDRDGKSSLLSLVKAFDSVLAVYEG  90

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRGS  RKIL REAK+Y AT LIVGT+   H +RS  SVAKYCA+ +
Sbjct  91   FCNLKQVDLKLKICRGSSIRKILVREAKSYSATKLIVGTAAKLHKIRSSTSVAKYCAKKL  150

Query  653  DKSISVLAVNNGKVAFQSE  709
              + SVLAVNNGKV F  E
Sbjct  151  SNNCSVLAVNNGKVVFHRE  169



>gb|KDP32865.1| hypothetical protein JCGZ_12157 [Jatropha curcas]
Length=751

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 104/137 (76%), Gaps = 5/137 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            K+DS+S+ELLTWA+VKVAQ GD +IALHVL  +       KS  L LVK FDSVLA YEG
Sbjct  14   KLDSQSRELLTWAMVKVAQPGDTVIALHVLGNNEIVDREGKSSFLSLVKAFDSVLAVYEG  73

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRGS  RKIL REA +Y A  +IVG + S H +RSP SVAKYCAR +
Sbjct  74   FCNLKQVDLKLKICRGSSIRKILVREANSYSAKKIIVGAAKSHHTIRSPTSVAKYCARKL  133

Query  653  DKSISVLAVNNGKVAFQ  703
             K  SV+AV+NGK+ FQ
Sbjct  134  SKDCSVVAVDNGKIVFQ  150



>gb|KJB80638.1| hypothetical protein B456_013G108200 [Gossypium raimondii]
Length=775

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 106/139 (76%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDP----DTD-KSEMLRLVKTFDSVLAAYEG  472
            K+DS S+ELLTWALVKVAQ GD +IALHVL      D D KS +L LVK FDSVLA YEG
Sbjct  33   KLDSPSRELLTWALVKVAQPGDCVIALHVLGNNEIVDRDGKSSLLSLVKAFDSVLAVYEG  92

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRGS  RKIL REAK+Y AT LIVGT+   H +RS  SVAKYCA+ +
Sbjct  93   FCNLKQVDLKLKICRGSSIRKILVREAKSYSATKLIVGTAAKLHKIRSSTSVAKYCAKKL  152

Query  653  DKSISVLAVNNGKVAFQSE  709
              + SVLAVNNGKV F  E
Sbjct  153  SNNCSVLAVNNGKVVFHRE  171



>ref|XP_012078327.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor-like serine/threonine-protein 
kinase At5g57670 [Jatropha curcas]
Length=794

 Score =   179 bits (454),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 104/137 (76%), Gaps = 5/137 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            K+DS+S+ELLTWA+VKVAQ GD +IALHVL  +       KS  L LVK FDSVLA YEG
Sbjct  24   KLDSQSRELLTWAMVKVAQPGDTVIALHVLGNNEIVDREGKSSFLSLVKAFDSVLAVYEG  83

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRGS  RKIL REA +Y A  +IVG + S H +RSP SVAKYCAR +
Sbjct  84   FCNLKQVDLKLKICRGSSIRKILVREANSYSAKKIIVGAAKSHHTIRSPTSVAKYCARKL  143

Query  653  DKSISVLAVNNGKVAFQ  703
             K  SV+AV+NGK+ FQ
Sbjct  144  SKDCSVVAVDNGKIVFQ  160



>gb|KCW72536.1| hypothetical protein EUGRSUZ_E01004 [Eucalyptus grandis]
Length=710

 Score =   178 bits (452),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 108/139 (78%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            K+D +S+ELLTWALVKVA+ GDR++ALHVL  +       KS +L LV+ FDSVLA YEG
Sbjct  28   KLDPQSRELLTWALVKVAEPGDRVLALHVLGSNEIVDRDGKSSLLSLVRAFDSVLAVYEG  87

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRG+  RKIL REAK+Y AT +IVGT+ + H++RS  SVAKYCA+ +
Sbjct  88   FCNLKQVDLKLKICRGTSIRKILVREAKSYVATRVIVGTAKNHHSIRSSTSVAKYCAKKL  147

Query  653  DKSISVLAVNNGKVAFQSE  709
             K   VLAVNNGKV FQ E
Sbjct  148  PKDCWVLAVNNGKVVFQRE  166



>gb|KJB80639.1| hypothetical protein B456_013G108200 [Gossypium raimondii]
Length=805

 Score =   179 bits (453),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 106/139 (76%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDP----DTD-KSEMLRLVKTFDSVLAAYEG  472
            K+DS S+ELLTWALVKVAQ GD +IALHVL      D D KS +L LVK FDSVLA YEG
Sbjct  33   KLDSPSRELLTWALVKVAQPGDCVIALHVLGNNEIVDRDGKSSLLSLVKAFDSVLAVYEG  92

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRGS  RKIL REAK+Y AT LIVGT+   H +RS  SVAKYCA+ +
Sbjct  93   FCNLKQVDLKLKICRGSSIRKILVREAKSYSATKLIVGTAAKLHKIRSSTSVAKYCAKKL  152

Query  653  DKSISVLAVNNGKVAFQSE  709
              + SVLAVNNGKV F  E
Sbjct  153  SNNCSVLAVNNGKVVFHRE  171



>ref|XP_010055963.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X2 [Eucalyptus grandis]
Length=765

 Score =   178 bits (451),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 109/139 (78%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDP----DTD-KSEMLRLVKTFDSVLAAYEG  472
            K+D +S+ELLTWALVKVA+ GDR++ALHVL      D D KS +L LV+ FDSVLA YEG
Sbjct  28   KLDPQSRELLTWALVKVAEPGDRVLALHVLGSNEIVDRDGKSSLLSLVRAFDSVLAVYEG  87

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRG+  RKIL REAK+Y AT +IVGT+ + H++RS  SVAKYCA+ +
Sbjct  88   FCNLKQVDLKLKICRGTSIRKILVREAKSYVATRVIVGTAKNHHSIRSSTSVAKYCAKKL  147

Query  653  DKSISVLAVNNGKVAFQSE  709
             K   VLAVNNGKV FQ E
Sbjct  148  PKDCWVLAVNNGKVVFQRE  166



>ref|XP_010055962.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X1 [Eucalyptus grandis]
 gb|KCW72535.1| hypothetical protein EUGRSUZ_E01004 [Eucalyptus grandis]
Length=767

 Score =   178 bits (451),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 109/139 (78%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDP----DTD-KSEMLRLVKTFDSVLAAYEG  472
            K+D +S+ELLTWALVKVA+ GDR++ALHVL      D D KS +L LV+ FDSVLA YEG
Sbjct  28   KLDPQSRELLTWALVKVAEPGDRVLALHVLGSNEIVDRDGKSSLLSLVRAFDSVLAVYEG  87

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRG+  RKIL REAK+Y AT +IVGT+ + H++RS  SVAKYCA+ +
Sbjct  88   FCNLKQVDLKLKICRGTSIRKILVREAKSYVATRVIVGTAKNHHSIRSSTSVAKYCAKKL  147

Query  653  DKSISVLAVNNGKVAFQSE  709
             K   VLAVNNGKV FQ E
Sbjct  148  PKDCWVLAVNNGKVVFQRE  166



>ref|XP_002516327.1| ATP binding protein, putative [Ricinus communis]
 gb|EEF46074.1| ATP binding protein, putative [Ricinus communis]
Length=674

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 104/138 (75%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTD----KSEMLRLVKTFDSVLAAYEGF  475
            K+D  S+ELLTW L+K+A+ GDR+IALHVLD  T+    ++ +L LVKTFD  LA YEGF
Sbjct  31   KLDGDSRELLTWTLMKLAKPGDRVIALHVLDSLTEFVGGRTSLLSLVKTFDCFLAVYEGF  90

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQVDLKL+VCRGS  RK L REAK+  A  LI GTS  RH +RS  SVAKYCARN+ 
Sbjct  91   CNLKQVDLKLKVCRGSSVRKTLVREAKSSGAAMLITGTSKKRHKIRSSTSVAKYCARNLS  150

Query  656  KSISVLAVNNGKVAFQSE  709
            KS SV AV+NGK+ FQ E
Sbjct  151  KSFSVFAVSNGKIMFQRE  168



>ref|XP_008219572.1| PREDICTED: interleukin-1 receptor-associated kinase-like 2 [Prunus 
mume]
Length=761

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 107/139 (77%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDP----DTD-KSEMLRLVKTFDSVLAAYEG  472
            K+D++S+ELLTWALVKVAQ GDR+IALHVL      D D KS +L LVK FDSVLA YEG
Sbjct  25   KLDAKSRELLTWALVKVAQPGDRVIALHVLGKNEIVDQDGKSSLLSLVKAFDSVLAVYEG  84

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRG+  +KIL REA +Y A+ +IVGT+ + H +RS  +VAKYCA+ +
Sbjct  85   FCNLKQVDLKLKICRGASVKKILVREANSYTASKVIVGTAQNHHKIRSSTTVAKYCAKKL  144

Query  653  DKSISVLAVNNGKVAFQSE  709
             K   VLAVNNGKV F  E
Sbjct  145  SKDCGVLAVNNGKVVFNRE  163



>ref|XP_004289287.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Fragaria vesca subsp. vesca]
Length=698

 Score =   176 bits (447),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 108/133 (81%), Gaps = 1/133 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSE-MLRLVKTFDSVLAAYEGFCNL  484
            K+DS SKELLTWALVKVA  GD +IA+HVLD  ++++  +L LVKTFDSVL+AYEGFC+L
Sbjct  14   KLDSHSKELLTWALVKVADPGDHVIAVHVLDSVSEETSCLLSLVKTFDSVLSAYEGFCSL  73

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+VCRG+P RKILAREA+ + A  +IVG S + H +RS V+VAKYCA  + KS 
Sbjct  74   KQVDLKLKVCRGNPIRKILAREAQAFHADVVIVGPSKTHHRIRSSVAVAKYCAWKLPKSF  133

Query  665  SVLAVNNGKVAFQ  703
            SV A++NGKV F+
Sbjct  134  SVFAIDNGKVVFK  146



>ref|XP_004502962.1| PREDICTED: proline-rich receptor-like protein kinase PERK14-like 
[Cicer arietinum]
Length=695

 Score =   176 bits (446),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 106/135 (79%), Gaps = 1/135 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTD-KSEMLRLVKTFDSVLAAYEGFCNL  484
            K+D RS+ELLTWALVKVA+ GD +IALHVLD  T+  S +L LVKTFDSVLA YEGFCNL
Sbjct  18   KLDPRSRELLTWALVKVAEPGDLVIALHVLDTVTEGTSSLLSLVKTFDSVLAVYEGFCNL  77

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDL+L+VCRG   RK+L +EAK +  + +I+GTS + H +RS V VAKYCA+ + K +
Sbjct  78   KQVDLRLKVCRGGSVRKLLVQEAKAFGVSTVILGTSKTHHTIRSSVRVAKYCAKKLHKCV  137

Query  665  SVLAVNNGKVAFQSE  709
            SV AV+NGK+AF  E
Sbjct  138  SVFAVDNGKIAFHRE  152



>ref|XP_008227546.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103327047 
[Prunus mume]
Length=748

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 105/137 (77%), Gaps = 5/137 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLD-----PDTDKSEMLRLVKTFDSVLAAYEG  472
            K+DS SKELLTWALVKVA+ GD +IA+HVL+     P    S +L LVKTFDSVL+AYEG
Sbjct  21   KLDSHSKELLTWALVKVAEPGDNVIAIHVLEDHLHTPSEGTSSLLSLVKTFDSVLSAYEG  80

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL+VCRG+  RK+L +EAK+Y A   IVGTS + H + S  SVAKYCAR +
Sbjct  81   FCNLKQVDLKLKVCRGNSVRKLLVQEAKSYNAAATIVGTSKTHHRIGSSASVAKYCARKL  140

Query  653  DKSISVLAVNNGKVAFQ  703
             +S SV AV+NGKV F+
Sbjct  141  SRSFSVFAVDNGKVVFK  157



>ref|XP_009354013.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Pyrus x bretschneideri]
Length=759

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 106/139 (76%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            K+DS+S+ELLTWALVKVAQ GDR+IALHVL  +       KS +L LVK FDSVLA Y+G
Sbjct  26   KLDSKSRELLTWALVKVAQPGDRVIALHVLGKNEIVDRDGKSSLLSLVKAFDSVLAVYDG  85

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRG+  +KIL REA +Y A+ +IVGT+ + H +RS  +VAKYCA+ +
Sbjct  86   FCNLKQVDLKLKICRGTSVKKILVREANSYTASKVIVGTAQNHHKIRSSTTVAKYCAKKL  145

Query  653  DKSISVLAVNNGKVAFQSE  709
             K   VLAVNNGKV F  E
Sbjct  146  SKDCGVLAVNNGKVLFNRE  164



>ref|XP_008394166.1| PREDICTED: interleukin-1 receptor-associated kinase-like 2 [Malus 
domestica]
Length=759

 Score =   176 bits (445),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 106/139 (76%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            K+DS+S+ELLTWALVKVAQ GDR+IALHVL  +       KS +L LVK FDSVLA Y+G
Sbjct  26   KLDSKSRELLTWALVKVAQPGDRVIALHVLGKNEIVDRDGKSSLLSLVKAFDSVLAVYDG  85

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRG+  +KIL REA +Y A+ +IVGT+ + H +RS  +VAKYCA+ +
Sbjct  86   FCNLKQVDLKLKICRGTSVKKILVREANSYTASKVIVGTAQNHHKIRSSTTVAKYCAKKL  145

Query  653  DKSISVLAVNNGKVAFQSE  709
             K   VLAVNNGKV F  E
Sbjct  146  SKDCGVLAVNNGKVLFNRE  164



>ref|XP_009355832.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Pyrus x bretschneideri]
Length=761

 Score =   176 bits (445),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 106/139 (76%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            K+DS+S+ELLTWALVKVAQ GDR+IALHVL  +       KS +L LVK FDSVLA Y+G
Sbjct  28   KLDSKSRELLTWALVKVAQPGDRVIALHVLGKNEIVDRDGKSSLLSLVKAFDSVLAVYDG  87

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRG+  +KIL REA +Y A+ +IVGT+ + H +RS  +VAKYCA+ +
Sbjct  88   FCNLKQVDLKLKICRGTSVKKILVREANSYTASKVIVGTAQNHHKIRSSTTVAKYCAKKL  147

Query  653  DKSISVLAVNNGKVAFQSE  709
             K   VLAVNNGKV F  E
Sbjct  148  SKDCGVLAVNNGKVLFNRE  166



>ref|XP_010270301.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Nelumbo nucifera]
Length=775

 Score =   176 bits (445),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 108/140 (77%), Gaps = 7/140 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTD------KSEMLRLVKTFDSVLAAYE  469
            K+D +S+ELLTW+LVKVAQ GDR+IALHVL  +T+      KS +L LVK FDSVLA YE
Sbjct  37   KLDQQSRELLTWSLVKVAQPGDRVIALHVLG-NTEILDREGKSSLLSLVKAFDSVLAVYE  95

Query  470  GFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARN  649
            GFCNLKQVDLKL++CRGS  RK+L REAK+Y A+ +IVGT+   H + S VS+AKYCAR 
Sbjct  96   GFCNLKQVDLKLKICRGSSIRKVLVREAKSYVASKVIVGTATHHHTIGSSVSIAKYCARK  155

Query  650  VDKSISVLAVNNGKVAFQSE  709
            + K   VLAVNNGK+ F+ E
Sbjct  156  LSKDCWVLAVNNGKIVFERE  175



>ref|XP_009795415.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Nicotiana sylvestris]
Length=774

 Score =   176 bits (445),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 105/139 (76%), Gaps = 6/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD-----TDKSEMLRLVKTFDSVLAAYEG  472
            K+D  S+ELLTWALVKVAQ GD +IALHVL+ +       KS +L LVK FDSVLA YEG
Sbjct  25   KLDGASRELLTWALVKVAQPGDLVIALHVLNNNEIVDRNGKSSLLSLVKAFDSVLAVYEG  84

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRG+  RKI+ REA  Y ATD+I+GT+  R  +RS  SVAKYCAR +
Sbjct  85   FCNLKQVDLKLKICRGTSIRKIIVREANAYLATDIILGTASHR-TIRSSASVAKYCARKL  143

Query  653  DKSISVLAVNNGKVAFQSE  709
             K  SVLAVNNGKV FQ E
Sbjct  144  PKDCSVLAVNNGKVVFQRE  162



>ref|XP_009588636.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Nicotiana tomentosiformis]
Length=772

 Score =   176 bits (445),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 106/139 (76%), Gaps = 6/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD-----TDKSEMLRLVKTFDSVLAAYEG  472
            K+D  S+ELLTWALVKVAQ GD +IALHVL+ +       KS +L LVK FDSVLA YEG
Sbjct  23   KLDGASRELLTWALVKVAQPGDLVIALHVLNNNEIVDRNGKSSLLSLVKAFDSVLAVYEG  82

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRG+  +KI+ REA  Y ATD+I+GT+ + H +RS  SVAKYCAR +
Sbjct  83   FCNLKQVDLKLKICRGTSIQKIIVREANAYLATDVILGTA-NHHTIRSSASVAKYCARKL  141

Query  653  DKSISVLAVNNGKVAFQSE  709
             K  SVLAVNNGKV FQ E
Sbjct  142  PKDCSVLAVNNGKVVFQRE  160



>ref|XP_010534448.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Tarenaya hassleriana]
Length=739

 Score =   175 bits (444),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 104/138 (75%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD----TDKSEMLRLVKTFDSVLAAYEGF  475
            K+D+ S+ELLTWALVKVA+ GD +IALH+L  +      KS +L LVKTFDSVL  YEGF
Sbjct  29   KLDAPSRELLTWALVKVAEPGDTVIALHILGNEIVDRAGKSSLLSLVKTFDSVLEVYEGF  88

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQVDLKL+VCRGS  RKIL REAK++ A  +IVG S S HA+RS  SVAKYCA+ + 
Sbjct  89   CNLKQVDLKLKVCRGSSIRKILVREAKSFSAAKVIVGISRSHHAIRSSSSVAKYCAKKLS  148

Query  656  KSISVLAVNNGKVAFQSE  709
                VLAVNNGK+ FQ E
Sbjct  149  DDCWVLAVNNGKIVFQKE  166



>ref|XP_002302218.2| kinase family protein [Populus trichocarpa]
 gb|EEE81491.2| kinase family protein [Populus trichocarpa]
Length=749

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 106/143 (74%), Gaps = 7/143 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            K+DS S+ELLTWALVKVAQ GD +IALHVL  +       KS +L LVK FDSVLA YEG
Sbjct  25   KLDSMSRELLTWALVKVAQPGDTVIALHVLGSNEIVDREGKSSLLSLVKAFDSVLAVYEG  84

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRGS  RKIL RE K+Y AT +IVG + +  ++ S  SVAKYCA+ +
Sbjct  85   FCNLKQVDLKLKICRGSSTRKILVREVKSYAATKVIVGAAKNHPSIWSSTSVAKYCAKKL  144

Query  653  DKSISVLAVNNGKVAFQSE--PN  715
             K  SVLAVNNGKV FQ E  PN
Sbjct  145  PKDCSVLAVNNGKVVFQRERSPN  167



>ref|XP_010087185.1| Proline-rich receptor-like protein kinase PERK1 [Morus notabilis]
 gb|EXB28442.1| Proline-rich receptor-like protein kinase PERK1 [Morus notabilis]
Length=718

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 106/139 (76%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            ++D+ S+ELLTWALVKVAQ GD +IALHVL  +       KS +L LVK FDSVLA YEG
Sbjct  22   RLDAPSRELLTWALVKVAQPGDCVIALHVLGKNEIFDRDGKSSLLSLVKAFDSVLAVYEG  81

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRG+ A+KIL REA++Y A  LIVGT+ + H +RS  SVAKYCA+ +
Sbjct  82   FCNLKQVDLKLKICRGASAKKILVREAESYSAAKLIVGTAHNHHKIRSTTSVAKYCAKKL  141

Query  653  DKSISVLAVNNGKVAFQSE  709
             K+  VLAVNNGKV F  E
Sbjct  142  PKTCGVLAVNNGKVVFNRE  160



>ref|XP_007214539.1| hypothetical protein PRUPE_ppa002094mg [Prunus persica]
 gb|EMJ15738.1| hypothetical protein PRUPE_ppa002094mg [Prunus persica]
Length=717

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 104/136 (76%), Gaps = 5/136 (4%)
 Frame = +2

Query  311  MDSRSKELLTWALVKVAQTGDRIIALHVLD-----PDTDKSEMLRLVKTFDSVLAAYEGF  475
            +DS SKELLTWALVKVA+ GD +IA+HVL+     P    S +L LVKTFDSVL+AYEGF
Sbjct  22   LDSHSKELLTWALVKVAEPGDNVIAIHVLEDHLHTPSEGTSSLLSLVKTFDSVLSAYEGF  81

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQVDLKL+VCRG+  RK+L +EAK+Y A   IVGTS + H + S  SVAKYCAR + 
Sbjct  82   CNLKQVDLKLKVCRGNSVRKLLVQEAKSYNAAATIVGTSKTHHRIGSSASVAKYCARKLS  141

Query  656  KSISVLAVNNGKVAFQ  703
            +S SV AV+NGKV F+
Sbjct  142  RSFSVFAVDNGKVVFK  157



>ref|XP_004290918.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Fragaria vesca subsp. vesca]
Length=744

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 105/139 (76%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDP----DTD-KSEMLRLVKTFDSVLAAYEG  472
            K+DS+S+ELLTWALVKVA+ GD ++ALHVL      D D KS +L LVK FDSVLA YEG
Sbjct  24   KLDSKSRELLTWALVKVAEPGDSVVALHVLGKNEIVDRDGKSSLLSLVKAFDSVLAVYEG  83

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRG+  +KIL REAK+Y A   IVGTS S H +RS  +VAKYCA+ +
Sbjct  84   FCNLKQVDLKLKICRGASIKKILVREAKSYNACKCIVGTSQSHHKIRSSTTVAKYCAKKL  143

Query  653  DKSISVLAVNNGKVAFQSE  709
             K   +LAVNNGKV F  E
Sbjct  144  SKDCGILAVNNGKVVFSRE  162



>ref|XP_007225237.1| hypothetical protein PRUPE_ppa001811mg [Prunus persica]
 gb|EMJ26436.1| hypothetical protein PRUPE_ppa001811mg [Prunus persica]
Length=761

 Score =   174 bits (440),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 106/139 (76%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDP----DTD-KSEMLRLVKTFDSVLAAYEG  472
            K+D++S+ELLTWALVKVAQ GDR+IALHVL      D D KS +L LVK FDSVLA YEG
Sbjct  25   KLDAKSRELLTWALVKVAQPGDRVIALHVLGKNEIVDQDGKSSLLSLVKAFDSVLAVYEG  84

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRG+  +K L REA +Y A+ +IVGT+ + H +RS  +VA+YCA+ +
Sbjct  85   FCNLKQVDLKLKICRGASVKKFLVREANSYTASKVIVGTAQNHHKIRSSTTVAEYCAKKL  144

Query  653  DKSISVLAVNNGKVAFQSE  709
             K   VLAVNNGKV F  E
Sbjct  145  SKDCGVLAVNNGKVVFNRE  163



>gb|KDO57493.1| hypothetical protein CISIN_1g041755mg, partial [Citrus sinensis]
Length=678

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 102/134 (76%), Gaps = 1/134 (1%)
 Frame = +2

Query  311  MDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNLK  487
             D  S+ELLTWALVKVAQ GDRIIALHVLD  T+ +  +L LVKTFDS+L+ YEGFCNLK
Sbjct  13   FDGESRELLTWALVKVAQPGDRIIALHVLDTITESTGSLLSLVKTFDSMLSVYEGFCNLK  72

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            QVDLKL+VCRG+  +KI+ +EAK+Y    +IVG S +   +RS VSVAKYCAR + K+  
Sbjct  73   QVDLKLKVCRGTSVKKIIVKEAKSYGEAKVIVGISKTHRTIRSSVSVAKYCARKLSKNFG  132

Query  668  VLAVNNGKVAFQSE  709
            V AV NGK+ FQ E
Sbjct  133  VFAVENGKIVFQRE  146



>gb|KCW54155.1| hypothetical protein EUGRSUZ_I00126 [Eucalyptus grandis]
Length=551

 Score =   172 bits (436),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 104/135 (77%), Gaps = 4/135 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDK---SEMLRLVKTFDSVLAAYEGFC  478
            +MD+ S+ELLTWALVK AQ GDR++ALHV++ DT     +  L LVK FDSVLA YEGFC
Sbjct  25   RMDAASRELLTWALVKAAQPGDRVVALHVIE-DTSSIGTASFLSLVKAFDSVLAVYEGFC  83

Query  479  NLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDK  658
            +LKQVDLKL+VCRG   RK+L +EAK+Y +  ++VGTS S H +RSP SVAKYCARN+ K
Sbjct  84   HLKQVDLKLKVCRGPSVRKVLVQEAKSYPSAKVVVGTSKSNHTIRSPASVAKYCARNLPK  143

Query  659  SISVLAVNNGKVAFQ  703
            S  V AV+NGK  F+
Sbjct  144  SFWVFAVDNGKFIFK  158



>gb|KEH35608.1| adenine nucleotide alpha hydrolase-like domain kinase [Medicago 
truncatula]
Length=648

 Score =   173 bits (438),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 104/135 (77%), Gaps = 1/135 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTD-KSEMLRLVKTFDSVLAAYEGFCNL  484
            K+D RS+ELLTWALVKVA+ GD +IALHVLD  T+  S +L LVKT DSVLA YEGFCNL
Sbjct  18   KLDPRSRELLTWALVKVAEPGDLVIALHVLDTVTEGTSSLLSLVKTLDSVLAVYEGFCNL  77

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+VCRG   RK+L +EAK    + +I+GTS S H +RS   VAKYCA+ + K +
Sbjct  78   KQVDLKLKVCRGDSVRKLLVQEAKALGVSTVILGTSKSHHTIRSSAWVAKYCAKKLHKCV  137

Query  665  SVLAVNNGKVAFQSE  709
            SV AV+NGK+AFQ E
Sbjct  138  SVFAVDNGKIAFQRE  152



>ref|XP_010674424.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Beta vulgaris subsp. vulgaris]
Length=754

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 106/136 (78%), Gaps = 2/136 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTD--KSEMLRLVKTFDSVLAAYEGFCN  481
            ++D +SKELLTWAL+KVAQ GD ++ALHVL   T+  +S +L LVKTFDS LA YEGFC+
Sbjct  37   RLDQQSKELLTWALMKVAQPGDLVVALHVLHSSTEVEQSTLLSLVKTFDSTLAVYEGFCH  96

Query  482  LKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKS  661
            LKQVDLKL+VCRGS  RKIL REAK Y +  LI+GT  ++H +RSP SVAKYCAR +  +
Sbjct  97   LKQVDLKLKVCRGSSLRKILVREAKAYESATLILGTCKAQHMIRSPTSVAKYCARKLPHN  156

Query  662  ISVLAVNNGKVAFQSE  709
             SV AV++GK+ ++ E
Sbjct  157  FSVFAVDSGKIVYRRE  172



>gb|KEH35607.1| adenine nucleotide alpha hydrolase-like domain kinase [Medicago 
truncatula]
Length=690

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 104/135 (77%), Gaps = 1/135 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTD-KSEMLRLVKTFDSVLAAYEGFCNL  484
            K+D RS+ELLTWALVKVA+ GD +IALHVLD  T+  S +L LVKT DSVLA YEGFCNL
Sbjct  18   KLDPRSRELLTWALVKVAEPGDLVIALHVLDTVTEGTSSLLSLVKTLDSVLAVYEGFCNL  77

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+VCRG   RK+L +EAK    + +I+GTS S H +RS   VAKYCA+ + K +
Sbjct  78   KQVDLKLKVCRGDSVRKLLVQEAKALGVSTVILGTSKSHHTIRSSAWVAKYCAKKLHKCV  137

Query  665  SVLAVNNGKVAFQSE  709
            SV AV+NGK+AFQ E
Sbjct  138  SVFAVDNGKIAFQRE  152



>ref|XP_011027696.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Populus euphratica]
Length=704

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 105/143 (73%), Gaps = 7/143 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            K+DS S+ELLTWALVKVAQ GD +IALHVL  +       KS +L LVK FDSVLA YEG
Sbjct  25   KLDSMSRELLTWALVKVAQPGDTVIALHVLGSNEIVDREGKSSLLSLVKAFDSVLAVYEG  84

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRGS  RKIL RE K++ AT  IVG + +  ++ S  SVAKYCA+ +
Sbjct  85   FCNLKQVDLKLKICRGSSTRKILVREVKSHAATKFIVGAAKNHPSIWSSTSVAKYCAKKL  144

Query  653  DKSISVLAVNNGKVAFQSE--PN  715
             K  SVLAVNNGKV FQ E  PN
Sbjct  145  PKDCSVLAVNNGKVVFQRERSPN  167



>ref|XP_009362341.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Pyrus x bretschneideri]
 ref|XP_009362344.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Pyrus x bretschneideri]
Length=759

 Score =   172 bits (437),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 107/140 (76%), Gaps = 7/140 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHV------LDPDTDKSEMLRLVKTFDSVLAAYE  469
            K+DS+S+ELLTWA+VKVAQ GDR+IALHV      +D D  KS +L LVK FDSVLA Y+
Sbjct  26   KLDSKSRELLTWAMVKVAQPGDRVIALHVPGKNEIVDRDG-KSSLLSLVKAFDSVLAVYD  84

Query  470  GFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARN  649
            GFCNLKQVDLKL++CRG+  +KIL REA +Y A+ +IVGT+ + H +RS  +VAKYCA+ 
Sbjct  85   GFCNLKQVDLKLKICRGTSIKKILVREANSYTASKVIVGTAQNHHKIRSSTAVAKYCAKK  144

Query  650  VDKSISVLAVNNGKVAFQSE  709
            + K   VLAVNNGKV F  E
Sbjct  145  LSKDCGVLAVNNGKVVFNRE  164



>ref|XP_006432124.1| hypothetical protein CICLE_v10000480mg [Citrus clementina]
 gb|ESR45364.1| hypothetical protein CICLE_v10000480mg [Citrus clementina]
Length=509

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 117/163 (72%), Gaps = 6/163 (4%)
 Frame = +2

Query  224  MKLTGNCAAAECTansgsnggavvvvgvKMDSRSKELLTWALVKVAQTGDRIIALHVLDP  403
            M+L G+C   E     G   G VVVVGVK D  S+ELLTWALVKVAQ GD IIALHVLD 
Sbjct  1    MRLVGDCTYGE-----GGGQGKVVVVGVKFDGESRELLTWALVKVAQPGDCIIALHVLDT  55

Query  404  DTDKS-EMLRLVKTFDSVLAAYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLI  580
             T+ +  +L LVKTFDS+L+ YEGFCNLKQVDLKL+VCRG+  +KI+ +EAK+Y    +I
Sbjct  56   ITESTGSLLSLVKTFDSMLSVYEGFCNLKQVDLKLKVCRGTSVKKIIVKEAKSYGEAKVI  115

Query  581  VGTSGSRHAVRSPVSVAKYCARNVDKSISVLAVNNGKVAFQSE  709
            VG S +   +RS VSVAKYCAR + K+  V AV NGK+ FQ E
Sbjct  116  VGISKTHRTIRSSVSVAKYCARKLSKNFGVFAVENGKIVFQRE  158



>ref|XP_012092537.1| PREDICTED: proline-rich receptor-like protein kinase PERK14 isoform 
X1 [Jatropha curcas]
 gb|KDP20470.1| hypothetical protein JCGZ_05332 [Jatropha curcas]
Length=713

 Score =   172 bits (436),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 105/135 (78%), Gaps = 1/135 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNL  484
            K D+ S+ELLTWAL++VA+ GD +IALHVLD     +  +L LVK FDS+LA YEGFCNL
Sbjct  31   KFDAESRELLTWALMQVAKPGDLVIALHVLDSIAGGTASLLSLVKAFDSLLAVYEGFCNL  90

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLK++VCRGS A+KIL REAK+  A  +IVGTS + H + S  SVAKYCARN+ KS+
Sbjct  91   KQVDLKIQVCRGSSAKKILVREAKSSSAAKVIVGTSKAHHKIHSSTSVAKYCARNLSKSL  150

Query  665  SVLAVNNGKVAFQSE  709
            SV AV+NGK+ FQ E
Sbjct  151  SVFAVSNGKIIFQRE  165



>gb|EPS64167.1| protein kinase family protein, partial [Genlisea aurea]
Length=520

 Score =   171 bits (432),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 104/134 (78%), Gaps = 2/134 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLD--PDTDKSEMLRLVKTFDSVLAAYEGFCN  481
            KMD RSKE+LTW LVKVA++GDR++ALHV+D     DKS +L L   FDSV+AAYEGFCN
Sbjct  16   KMDRRSKEMLTWTLVKVARSGDRVVALHVMDYKAGEDKSSLLGLAMNFDSVVAAYEGFCN  75

Query  482  LKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKS  661
            LKQVDLKL++CRGS ARKIL REAK      L++GTS   H +RS   VA+YCA+N+ ++
Sbjct  76   LKQVDLKLKICRGSVARKILVREAKACGTGTLVIGTSPGHHKLRSRTFVAEYCAKNLPEN  135

Query  662  ISVLAVNNGKVAFQ  703
            I+++ V+NGKV FQ
Sbjct  136  ITIICVDNGKVVFQ  149



>ref|XP_010678918.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Beta vulgaris subsp. vulgaris]
Length=752

 Score =   172 bits (436),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 101/139 (73%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            KMD+ S+ELLTW+LVKVAQ GD +IALHVL  D       KS  L LVK FDSVL  YEG
Sbjct  21   KMDALSRELLTWSLVKVAQPGDVVIALHVLAKDEIFDQDGKSSFLSLVKAFDSVLGVYEG  80

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLK+++CRGS  RKI+ REA +Y A+ +IVGT+   H +RS  SVAKYCA+ +
Sbjct  81   FCNLKQVDLKMKICRGSSVRKIIVREANSYAASKVIVGTTAKHHTIRSSTSVAKYCAKKL  140

Query  653  DKSISVLAVNNGKVAFQSE  709
                SVLAV NGKV FQ E
Sbjct  141  PMDCSVLAVRNGKVVFQRE  159



>gb|KCW54153.1| hypothetical protein EUGRSUZ_I00126 [Eucalyptus grandis]
Length=742

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 104/135 (77%), Gaps = 4/135 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDK---SEMLRLVKTFDSVLAAYEGFC  478
            +MD+ S+ELLTWALVK AQ GDR++ALHV++ DT     +  L LVK FDSVLA YEGFC
Sbjct  25   RMDAASRELLTWALVKAAQPGDRVVALHVIE-DTSSIGTASFLSLVKAFDSVLAVYEGFC  83

Query  479  NLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDK  658
            +LKQVDLKL+VCRG   RK+L +EAK+Y +  ++VGTS S H +RSP SVAKYCARN+ K
Sbjct  84   HLKQVDLKLKVCRGPSVRKVLVQEAKSYPSAKVVVGTSKSNHTIRSPASVAKYCARNLPK  143

Query  659  SISVLAVNNGKVAFQ  703
            S  V AV+NGK  F+
Sbjct  144  SFWVFAVDNGKFIFK  158



>ref|XP_010027607.1| PREDICTED: proline-rich receptor-like protein kinase PERK8 [Eucalyptus 
grandis]
 gb|KCW54154.1| hypothetical protein EUGRSUZ_I00126 [Eucalyptus grandis]
Length=717

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 104/135 (77%), Gaps = 4/135 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDK---SEMLRLVKTFDSVLAAYEGFC  478
            +MD+ S+ELLTWALVK AQ GDR++ALHV++ DT     +  L LVK FDSVLA YEGFC
Sbjct  25   RMDAASRELLTWALVKAAQPGDRVVALHVIE-DTSSIGTASFLSLVKAFDSVLAVYEGFC  83

Query  479  NLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDK  658
            +LKQVDLKL+VCRG   RK+L +EAK+Y +  ++VGTS S H +RSP SVAKYCARN+ K
Sbjct  84   HLKQVDLKLKVCRGPSVRKVLVQEAKSYPSAKVVVGTSKSNHTIRSPASVAKYCARNLPK  143

Query  659  SISVLAVNNGKVAFQ  703
            S  V AV+NGK  F+
Sbjct  144  SFWVFAVDNGKFIFK  158



>ref|XP_007137781.1| hypothetical protein PHAVU_009G155000g [Phaseolus vulgaris]
 gb|ESW09775.1| hypothetical protein PHAVU_009G155000g [Phaseolus vulgaris]
Length=697

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 107/137 (78%), Gaps = 1/137 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNL  484
            K+D  S+ELLTWALVKVA++GD +IALHVLD  T+ +  +L LVKTFDSVLA YEGFCNL
Sbjct  18   KLDPCSRELLTWALVKVAESGDLVIALHVLDSITEGTASLLSLVKTFDSVLAVYEGFCNL  77

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQV L+L+VCRG   RK+L +EAKT+  + +I+GTS S H +RS   VAKYCA+ + K I
Sbjct  78   KQVGLRLKVCRGDSVRKVLVQEAKTFGVSTVILGTSKSHHTIRSSAWVAKYCAKKLPKCI  137

Query  665  SVLAVNNGKVAFQSEPN  715
            SV +V+NGK+AF+ E N
Sbjct  138  SVFSVDNGKIAFRREAN  154



>gb|KJB48948.1| hypothetical protein B456_008G094600 [Gossypium raimondii]
Length=541

 Score =   170 bits (430),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 101/135 (75%), Gaps = 1/135 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDK-SEMLRLVKTFDSVLAAYEGFCNL  484
            K D+ S ELLTWALVKVAQ GD+IIALH+LD   +  + +L LVKTFD  L  YEGFCNL
Sbjct  16   KFDADSNELLTWALVKVAQPGDQIIALHILDAAAESPASILSLVKTFDYTLGVYEGFCNL  75

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+VCRGS  ++IL REAK++  T LI+GTS + + ++SP SVAK+CAR +    
Sbjct  76   KQVDLKLKVCRGSSPKRILVREAKSFETTKLILGTSKTHNPLQSPASVAKFCARKLPNCF  135

Query  665  SVLAVNNGKVAFQSE  709
            SV AV NGKV FQ E
Sbjct  136  SVYAVRNGKVVFQRE  150



>gb|KHG19309.1| Proline-rich receptor-like protein kinase PERK10 [Gossypium arboreum]
Length=711

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 102/135 (76%), Gaps = 1/135 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTD-KSEMLRLVKTFDSVLAAYEGFCNL  484
            K D+ S ELLTWALVKVAQ GD+IIALH+LD  T+  + +L LVKTFD  LA YEGFCNL
Sbjct  16   KFDADSNELLTWALVKVAQPGDQIIALHILDAATECPASILSLVKTFDYTLAVYEGFCNL  75

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+VCRG   ++IL REAK++  T LI+GTS + + ++SP SVAK+CAR +    
Sbjct  76   KQVDLKLKVCRGPSPKRILVREAKSFETTKLILGTSKTHNPLQSPASVAKFCARKLSNCF  135

Query  665  SVLAVNNGKVAFQSE  709
            SV AV NGKV FQ E
Sbjct  136  SVYAVRNGKVVFQRE  150



>ref|XP_006432126.1| hypothetical protein CICLE_v10000480mg [Citrus clementina]
 ref|XP_006465102.1| PREDICTED: proline-rich receptor-like protein kinase PERK2-like 
isoform X2 [Citrus sinensis]
 gb|ESR45366.1| hypothetical protein CICLE_v10000480mg [Citrus clementina]
Length=679

 Score =   171 bits (432),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 110/163 (67%), Gaps = 6/163 (4%)
 Frame = +2

Query  224  MKLTGNCAAAECTansgsnggavvvvgvKMDSRSKELLTWALVKVAQTGDRIIALHVLDP  403
            M+L G+C   E           V     K D  S+ELLTWALVKVAQ GD IIALHVLD 
Sbjct  1    MRLVGDCTYGEGGGQGKVVVVGV-----KFDGESRELLTWALVKVAQPGDCIIALHVLDT  55

Query  404  DTDKS-EMLRLVKTFDSVLAAYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLI  580
             T+ +  +L LVKTFDS+L+ YEGFCNLKQVDLKL+VCRG+  +KI+ +EAK+Y    +I
Sbjct  56   ITESTGSLLSLVKTFDSMLSVYEGFCNLKQVDLKLKVCRGTSVKKIIVKEAKSYGEAKVI  115

Query  581  VGTSGSRHAVRSPVSVAKYCARNVDKSISVLAVNNGKVAFQSE  709
            VG S +   +RS VSVAKYCAR + K+  V AV NGK+ FQ E
Sbjct  116  VGISKTHRTIRSSVSVAKYCARKLSKNFGVFAVENGKIVFQRE  158



>ref|XP_006432127.1| hypothetical protein CICLE_v10000480mg [Citrus clementina]
 ref|XP_006465101.1| PREDICTED: proline-rich receptor-like protein kinase PERK2-like 
isoform X1 [Citrus sinensis]
 gb|ESR45367.1| hypothetical protein CICLE_v10000480mg [Citrus clementina]
Length=690

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 110/163 (67%), Gaps = 6/163 (4%)
 Frame = +2

Query  224  MKLTGNCAAAECTansgsnggavvvvgvKMDSRSKELLTWALVKVAQTGDRIIALHVLDP  403
            M+L G+C   E           V     K D  S+ELLTWALVKVAQ GD IIALHVLD 
Sbjct  1    MRLVGDCTYGEGGGQGKVVVVGV-----KFDGESRELLTWALVKVAQPGDCIIALHVLDT  55

Query  404  DTDKS-EMLRLVKTFDSVLAAYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLI  580
             T+ +  +L LVKTFDS+L+ YEGFCNLKQVDLKL+VCRG+  +KI+ +EAK+Y    +I
Sbjct  56   ITESTGSLLSLVKTFDSMLSVYEGFCNLKQVDLKLKVCRGTSVKKIIVKEAKSYGEAKVI  115

Query  581  VGTSGSRHAVRSPVSVAKYCARNVDKSISVLAVNNGKVAFQSE  709
            VG S +   +RS VSVAKYCAR + K+  V AV NGK+ FQ E
Sbjct  116  VGISKTHRTIRSSVSVAKYCARKLSKNFGVFAVENGKIVFQRE  158



>ref|XP_010471913.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Camelina sativa]
Length=753

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 105/138 (76%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD----TDKSEMLRLVKTFDSVLAAYEGF  475
            K+D+ S+ELLTWALVKVA+ GD +IALH+L  +       S +L LVKTFDSVL  YEGF
Sbjct  28   KLDAPSRELLTWALVKVAEPGDTVIALHILGNEIVDRAGNSSLLSLVKTFDSVLDVYEGF  87

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQVDLKL++CRGS ARKI+ REAK++ A+ ++VG S + H +RSP SVAKY A+ + 
Sbjct  88   CNLKQVDLKLKLCRGSSARKIIVREAKSFSASKVLVGISKTHHTIRSPASVAKYVAKKLS  147

Query  656  KSISVLAVNNGKVAFQSE  709
            K   V+AVNNGK+ FQ E
Sbjct  148  KDCWVIAVNNGKIVFQRE  165



>gb|AAC34357.1| Putative protein kinase [Arabidopsis thaliana]
Length=781

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 105/138 (76%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD----TDKSEMLRLVKTFDSVLAAYEGF  475
            K+D+ S+ELLTWALVKVA+ GD +IALH+L  +       S +L LV+TFDSVL  YEGF
Sbjct  55   KLDAPSRELLTWALVKVAEPGDTVIALHILGNEIVDRAGNSSLLSLVRTFDSVLDVYEGF  114

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQVDLKL++CRGS ARKIL REAK++ AT ++VG S S HA+RS  SVAKY A+ + 
Sbjct  115  CNLKQVDLKLKLCRGSSARKILVREAKSFSATKVLVGISKSHHAIRSSASVAKYIAKKLS  174

Query  656  KSISVLAVNNGKVAFQSE  709
            K   V+AVNNGK+ FQ E
Sbjct  175  KDCWVIAVNNGKILFQKE  192



>ref|XP_010428799.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Camelina sativa]
Length=756

 Score =   171 bits (433),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 105/138 (76%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD----TDKSEMLRLVKTFDSVLAAYEGF  475
            K+D+ S+ELLTWALVKVA+ GD +IALH++  +       S +L LVKTFDSVL  YEGF
Sbjct  29   KLDAPSRELLTWALVKVAEPGDTVIALHIIGNEIVDRAGNSSLLSLVKTFDSVLDVYEGF  88

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQVDLKL++CRGS ARKI+ REAK++ A+ ++VG S S H +RSP SVAKY A+ + 
Sbjct  89   CNLKQVDLKLKLCRGSSARKIIVREAKSFSASKVLVGISKSHHTIRSPASVAKYIAKKLS  148

Query  656  KSISVLAVNNGKVAFQSE  709
            K   V+AVNNGK+ FQ E
Sbjct  149  KDCWVIAVNNGKIVFQRE  166



>ref|XP_010521198.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Tarenaya hassleriana]
 ref|XP_010521207.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Tarenaya hassleriana]
 ref|XP_010521216.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Tarenaya hassleriana]
 ref|XP_010521224.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Tarenaya hassleriana]
Length=709

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 101/133 (76%), Gaps = 1/133 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNL  484
            K D R +E+LTWALV VA+ GDRI+ALHVLD   D S  ++ LV+TFDS+L  YE FCNL
Sbjct  31   KPDERRREVLTWALVNVARPGDRIVALHVLDYAVDGSASLISLVRTFDSMLGVYESFCNL  90

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+VCRG  ARKIL  EAK+YRA  LIVG+S   H +RS  SVAKYCARN+ K +
Sbjct  91   KQVDLKLKVCRGKSARKILVEEAKSYRAASLIVGSSRKHHTIRSSASVAKYCARNLVKDV  150

Query  665  SVLAVNNGKVAFQ  703
            SV AV +GK+ F+
Sbjct  151  SVFAVKSGKIMFR  163



>gb|KHN31175.1| Proline-rich receptor-like protein kinase PERK9 [Glycine soja]
Length=699

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 105/137 (77%), Gaps = 1/137 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNL  484
            K+D RS+ELLTWALVKVA+ GD +IALHVLD  T+ +  +L LVKTFDSVLA YEGFCNL
Sbjct  18   KLDPRSRELLTWALVKVAEPGDLVIALHVLDTITEGTASLLSLVKTFDSVLAVYEGFCNL  77

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQV L+L+VCRG   RK L +EAK +  + +I+GTS S H +RS   VAKYCA+ + K I
Sbjct  78   KQVGLRLKVCRGDSVRKALVQEAKAFGVSTVILGTSKSHHTIRSSAWVAKYCAKKLPKCI  137

Query  665  SVLAVNNGKVAFQSEPN  715
            SV +V+NGK+AF+ E N
Sbjct  138  SVFSVDNGKIAFRREAN  154



>ref|XP_006578781.1| PREDICTED: proline-rich receptor-like protein kinase PERK14-like 
[Glycine max]
Length=699

 Score =   170 bits (431),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 105/137 (77%), Gaps = 1/137 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNL  484
            K+D RS+ELLTWALVKVA+ GD +IALHVLD  T+ +  +L LVKTFDSVLA YEGFCNL
Sbjct  18   KLDPRSRELLTWALVKVAEPGDLVIALHVLDTITEGTASLLSLVKTFDSVLAVYEGFCNL  77

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQV L+L+VCRG   RK L +EAK +  + +I+GTS S H +RS   VAKYCA+ + K I
Sbjct  78   KQVGLRLKVCRGDSVRKALVQEAKAFGVSTVILGTSKSHHTIRSSAWVAKYCAKKLPKCI  137

Query  665  SVLAVNNGKVAFQSEPN  715
            SV +V+NGK+AF+ E N
Sbjct  138  SVFSVDNGKIAFRREAN  154



>gb|KJB48946.1| hypothetical protein B456_008G094600 [Gossypium raimondii]
Length=594

 Score =   170 bits (430),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 101/135 (75%), Gaps = 1/135 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDK-SEMLRLVKTFDSVLAAYEGFCNL  484
            K D+ S ELLTWALVKVAQ GD+IIALH+LD   +  + +L LVKTFD  L  YEGFCNL
Sbjct  16   KFDADSNELLTWALVKVAQPGDQIIALHILDAAAESPASILSLVKTFDYTLGVYEGFCNL  75

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+VCRGS  ++IL REAK++  T LI+GTS + + ++SP SVAK+CAR +    
Sbjct  76   KQVDLKLKVCRGSSPKRILVREAKSFETTKLILGTSKTHNPLQSPASVAKFCARKLPNCF  135

Query  665  SVLAVNNGKVAFQSE  709
            SV AV NGKV FQ E
Sbjct  136  SVYAVRNGKVVFQRE  150



>ref|NP_177852.2| adenine nucleotide alpha hydrolases-domain containing protein 
kinase [Arabidopsis thaliana]
 gb|AEE35957.1| adenine nucleotide alpha hydrolases-domain containing protein 
kinase [Arabidopsis thaliana]
Length=794

 Score =   171 bits (433),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 105/138 (76%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD----TDKSEMLRLVKTFDSVLAAYEGF  475
            K+D+ S+ELLTWALVKVA+ GD +IALH+L  +       S +L LV+TFDSVL  YEGF
Sbjct  55   KLDAPSRELLTWALVKVAEPGDTVIALHILGNEIVDRAGNSSLLSLVRTFDSVLDVYEGF  114

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQVDLKL++CRGS ARKIL REAK++ AT ++VG S S HA+RS  SVAKY A+ + 
Sbjct  115  CNLKQVDLKLKLCRGSSARKILVREAKSFSATKVLVGISKSHHAIRSSASVAKYIAKKLS  174

Query  656  KSISVLAVNNGKVAFQSE  709
            K   V+AVNNGK+ FQ E
Sbjct  175  KDCWVIAVNNGKILFQKE  192



>ref|XP_009349910.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor-like serine/threonine-protein 
kinase At5g57670 [Pyrus x bretschneideri]
Length=764

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 107/145 (74%), Gaps = 12/145 (8%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHV-----------LDPDTDKSEMLRLVKTFDSV  454
            K+DS+S+ELLTWA+VKVAQ GDR+IALHV           +D D  KS +L LVK FDSV
Sbjct  26   KLDSKSRELLTWAMVKVAQPGDRVIALHVPGKNGXXNLEIVDRDG-KSSLLSLVKAFDSV  84

Query  455  LAAYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAK  634
            LA Y+GFCNLKQVDLKL++CRG+  +KIL REA +Y A+ +IVGT+ + H +RS  +VAK
Sbjct  85   LAVYDGFCNLKQVDLKLKICRGTSIKKILVREANSYTASKVIVGTAQNHHKIRSSTAVAK  144

Query  635  YCARNVDKSISVLAVNNGKVAFQSE  709
            YCA+ + K   VLAVNNGKV F  E
Sbjct  145  YCAKKLSKDCGVLAVNNGKVVFNRE  169



>ref|XP_010537354.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Tarenaya hassleriana]
Length=765

 Score =   170 bits (431),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 86/138 (62%), Positives = 102/138 (74%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD----TDKSEMLRLVKTFDSVLAAYEGF  475
            K+D+ S+ELLTWALVKVA+ GD +IALHVL  +       S +L LVKTFDSVL  YEGF
Sbjct  35   KLDAPSRELLTWALVKVAEPGDTVIALHVLGNEIVDRAGTSSLLSLVKTFDSVLEVYEGF  94

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQVDLKL++CRGS  RKIL REAK++ A  +IVG S   HA+RS  SVAKYCA+ + 
Sbjct  95   CNLKQVDLKLKLCRGSSIRKILVREAKSFSAAKVIVGISRHHHAIRSSASVAKYCAKKLT  154

Query  656  KSISVLAVNNGKVAFQSE  709
                VLAVNNGK+ FQ E
Sbjct  155  DDCWVLAVNNGKIVFQKE  172



>gb|KJB48947.1| hypothetical protein B456_008G094600 [Gossypium raimondii]
Length=699

 Score =   169 bits (429),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 101/135 (75%), Gaps = 1/135 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDK-SEMLRLVKTFDSVLAAYEGFCNL  484
            K D+ S ELLTWALVKVAQ GD+IIALH+LD   +  + +L LVKTFD  L  YEGFCNL
Sbjct  16   KFDADSNELLTWALVKVAQPGDQIIALHILDAAAESPASILSLVKTFDYTLGVYEGFCNL  75

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+VCRGS  ++IL REAK++  T LI+GTS + + ++SP SVAK+CAR +    
Sbjct  76   KQVDLKLKVCRGSSPKRILVREAKSFETTKLILGTSKTHNPLQSPASVAKFCARKLPNCF  135

Query  665  SVLAVNNGKVAFQSE  709
            SV AV NGKV FQ E
Sbjct  136  SVYAVRNGKVVFQRE  150



>gb|KJB48945.1| hypothetical protein B456_008G094600 [Gossypium raimondii]
Length=711

 Score =   169 bits (429),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 101/135 (75%), Gaps = 1/135 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDK-SEMLRLVKTFDSVLAAYEGFCNL  484
            K D+ S ELLTWALVKVAQ GD+IIALH+LD   +  + +L LVKTFD  L  YEGFCNL
Sbjct  16   KFDADSNELLTWALVKVAQPGDQIIALHILDAAAESPASILSLVKTFDYTLGVYEGFCNL  75

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+VCRGS  ++IL REAK++  T LI+GTS + + ++SP SVAK+CAR +    
Sbjct  76   KQVDLKLKVCRGSSPKRILVREAKSFETTKLILGTSKTHNPLQSPASVAKFCARKLPNCF  135

Query  665  SVLAVNNGKVAFQSE  709
            SV AV NGKV FQ E
Sbjct  136  SVYAVRNGKVVFQRE  150



>ref|XP_011016100.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Populus euphratica]
Length=758

 Score =   170 bits (430),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 105/143 (73%), Gaps = 7/143 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            K+D  S+ELLTWALVKVAQ GD +IALH+LD +       KS +L LVK FD+VLA YEG
Sbjct  24   KLDPASRELLTWALVKVAQPGDTVIALHILDNNEIVDREGKSSLLSLVKAFDNVLAVYEG  83

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRGS  R+IL REAK+Y AT +IVG + +  ++    SVAKYCA+ +
Sbjct  84   FCNLKQVDLKLKICRGSSTRRILVREAKSYTATKVIVGATRNHLSIWPSTSVAKYCAKKL  143

Query  653  DKSISVLAVNNGKVAFQSE--PN  715
             K  SVLA NNGKV FQ E  PN
Sbjct  144  PKDCSVLAFNNGKVVFQRERTPN  166



>ref|XP_002306655.2| kinase family protein [Populus trichocarpa]
 gb|EEE93651.2| kinase family protein [Populus trichocarpa]
Length=707

 Score =   169 bits (428),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 105/143 (73%), Gaps = 7/143 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            K+D  S+ELLTWALVKVAQ GD +IALH+LD +       KS +L LVK FD+VLA YEG
Sbjct  24   KLDPASRELLTWALVKVAQPGDTVIALHILDNNEIVDREGKSSLLSLVKAFDNVLAVYEG  83

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRGS  R+IL REAK+Y AT +IVG + +  ++    SVAKYCA+ +
Sbjct  84   FCNLKQVDLKLKICRGSSIRRILVREAKSYTATKVIVGATRNHLSIWPSTSVAKYCAKKL  143

Query  653  DKSISVLAVNNGKVAFQSE--PN  715
             K  SVLA NNGKV FQ E  PN
Sbjct  144  PKDCSVLAFNNGKVVFQRERTPN  166



>ref|XP_002889134.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65393.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=793

 Score =   169 bits (429),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 104/138 (75%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT----DKSEMLRLVKTFDSVLAAYEGF  475
            K+D+ S+ELLTWALVKVA+ GD +IALH+L  +       S +L LVKTFDSVL  YEGF
Sbjct  60   KLDAPSRELLTWALVKVAEPGDTVIALHILGNEVVDRAGNSSLLSLVKTFDSVLDVYEGF  119

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQVDLKL++CRGS ARKI+ REAK++ AT ++VG S S H +RS  SVAKY A+ + 
Sbjct  120  CNLKQVDLKLKLCRGSSARKIIVREAKSFSATKVLVGISKSHHTIRSSASVAKYIAKKLS  179

Query  656  KSISVLAVNNGKVAFQSE  709
            K   V+AVNNGK+ FQ E
Sbjct  180  KDCWVIAVNNGKILFQKE  197



>gb|KHN09628.1| Proline-rich receptor-like protein kinase PERK9 [Glycine soja]
Length=699

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 104/137 (76%), Gaps = 1/137 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNL  484
            K+D RS+ELLTWALVKVA+ GD +IALHVLD  T+ +  +L LVKTFDSVL  YEGFCNL
Sbjct  17   KLDPRSRELLTWALVKVAEPGDLVIALHVLDSITEGTASLLSLVKTFDSVLGVYEGFCNL  76

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQV L+L+VCRG   RK L +EAK +  + +I+GTS S H +RS   VAKYCA+ + K I
Sbjct  77   KQVGLRLKVCRGGSVRKALVQEAKAFGVSTVILGTSKSYHTIRSSAWVAKYCAKKLPKCI  136

Query  665  SVLAVNNGKVAFQSEPN  715
            SV +V+NGK+AF+ E N
Sbjct  137  SVFSVDNGKIAFRREAN  153



>ref|XP_003526871.1| PREDICTED: proline-rich receptor-like protein kinase PERK14-like 
[Glycine max]
Length=700

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 104/137 (76%), Gaps = 1/137 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNL  484
            K+D RS+ELLTWALVKVA+ GD +IALHVLD  T+ +  +L LVKTFDSVL  YEGFCNL
Sbjct  18   KLDPRSRELLTWALVKVAEPGDLVIALHVLDSITEGTASLLSLVKTFDSVLGVYEGFCNL  77

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQV L+L+VCRG   RK L +EAK +  + +I+GTS S H +RS   VAKYCA+ + K I
Sbjct  78   KQVGLRLKVCRGGSVRKALVQEAKAFGVSTVILGTSKSYHTIRSSAWVAKYCAKKLPKCI  137

Query  665  SVLAVNNGKVAFQSEPN  715
            SV +V+NGK+AF+ E N
Sbjct  138  SVFSVDNGKIAFRREAN  154



>ref|XP_009355844.1| PREDICTED: tyrosine-protein kinase Lck-like [Pyrus x bretschneideri]
Length=742

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 103/138 (75%), Gaps = 6/138 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLD-----PDTDKSEMLRLVKTFDSVLAAYEG  472
            K+DS SKELLTWALVKVA+TGD ++A+HVL+          S +L LVKTFDSVL+AYEG
Sbjct  24   KLDSHSKELLTWALVKVAETGDNVVAIHVLEDHLLATSEGTSSLLSLVKTFDSVLSAYEG  83

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAV-RSPVSVAKYCARN  649
            FCNLKQVDLKL+VCRG   RK+L REAK + A   IVGTS + H +  S  SVAKYCAR 
Sbjct  84   FCNLKQVDLKLKVCRGDSVRKLLVREAKAFHAATTIVGTSKTHHRIGSSSTSVAKYCARK  143

Query  650  VDKSISVLAVNNGKVAFQ  703
            + K+ SV AV+NGK+ F+
Sbjct  144  LSKNFSVFAVDNGKIVFK  161



>emb|CDX87529.1| BnaA07g33440D [Brassica napus]
Length=743

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 82/135 (61%), Positives = 105/135 (78%), Gaps = 1/135 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD-TDKSEMLRLVKTFDSVLAAYEGFCNL  484
            K+D+ S+ELLTWALVKVA+ GD +IALH+L  +  + S +L LVKTFDSVL  YEGFCNL
Sbjct  59   KLDAPSRELLTWALVKVAEPGDTVIALHILSNEIVENSSLLSLVKTFDSVLDVYEGFCNL  118

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL++CRG   RK++AREAK++ A+ ++VG S + HA+RS  SVAKY A+ + K  
Sbjct  119  KQVDLKLKLCRGDSPRKMIAREAKSFSASKVLVGISKTHHAIRSSASVAKYLAKKLPKDR  178

Query  665  SVLAVNNGKVAFQSE  709
             VLAVNNGK+ FQ E
Sbjct  179  WVLAVNNGKIVFQRE  193



>ref|XP_009106391.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Brassica rapa]
Length=696

 Score =   167 bits (424),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 105/135 (78%), Gaps = 1/135 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD-TDKSEMLRLVKTFDSVLAAYEGFCNL  484
            K+D+ S+ELLTWALVKVA+ GD +IALH+L  +  + S +L LVKTFDSVL  YEGFCNL
Sbjct  25   KLDAPSRELLTWALVKVAEPGDTVIALHILSNEIVENSSLLSLVKTFDSVLDVYEGFCNL  84

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL++CRG   RK++ARE+K++ A+ ++VG S + HA+RS  SVAKY A+ + K  
Sbjct  85   KQVDLKLKLCRGDSPRKMIARESKSFSASKVLVGISKTHHAIRSSASVAKYLAKKLPKDR  144

Query  665  SVLAVNNGKVAFQSE  709
             VLAVNNGK+ FQ E
Sbjct  145  WVLAVNNGKIVFQRE  159



>ref|XP_006300863.1| hypothetical protein CARUB_v10019956mg [Capsella rubella]
 gb|EOA33761.1| hypothetical protein CARUB_v10019956mg [Capsella rubella]
Length=632

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 104/138 (75%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD----TDKSEMLRLVKTFDSVLAAYEGF  475
            K+D+ S+ELLTWALVKVA+ GD +IALH+L  +       S +L LVKTFDSVL  YEGF
Sbjct  27   KLDAPSRELLTWALVKVAEPGDTVIALHILGNEIVDRAGNSSLLSLVKTFDSVLDVYEGF  86

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQVDLKL++CRGS ARKI+ REAK++ A+ ++VG S S H +RS  SVAKY A+ + 
Sbjct  87   CNLKQVDLKLKLCRGSCARKIIVREAKSFSASKVLVGISKSHHTIRSSASVAKYIAKKLS  146

Query  656  KSISVLAVNNGKVAFQSE  709
            K   V+AVNNGK+ FQ E
Sbjct  147  KDCWVIAVNNGKIMFQKE  164



>ref|XP_008337149.1| PREDICTED: uncharacterized protein LOC103400275 [Malus domestica]
Length=701

 Score =   167 bits (423),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 102/137 (74%), Gaps = 6/137 (4%)
 Frame = +2

Query  311  MDSRSKELLTWALVKVAQTGDRIIALHVLDPD-----TDKSEMLRLVKTFDSVLAAYEGF  475
            +DS SKELLTWALVKVA+TGD ++A+HVL+          S +L LVKTFDSVL+AYEGF
Sbjct  80   LDSHSKELLTWALVKVAETGDNVVAIHVLEDHLLAXSDGTSSLLSLVKTFDSVLSAYEGF  139

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAV-RSPVSVAKYCARNV  652
            CNLKQVDLKL+VCRG   RK+L REAK + A   IVGTS + H +  S  SVAKYCAR +
Sbjct  140  CNLKQVDLKLKVCRGXSVRKLLVREAKAFHAATTIVGTSKTHHRIGSSSTSVAKYCARKL  199

Query  653  DKSISVLAVNNGKVAFQ  703
             K+ SV AV+NGK+ F+
Sbjct  200  SKNFSVFAVDNGKIVFK  216



>emb|CDY38354.1| BnaA02g18470D [Brassica napus]
Length=540

 Score =   166 bits (420),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 104/135 (77%), Gaps = 1/135 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDK-SEMLRLVKTFDSVLAAYEGFCNL  484
            K+D+ S+ELLTWALVKVA+ GD +IALH+L  +  K S +L LVKTFDSVL  YEGFCNL
Sbjct  118  KLDAPSRELLTWALVKVAEPGDTVIALHILGNEIVKNSSLLSLVKTFDSVLDVYEGFCNL  177

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL++CRG  ARKI+AREA+++ A  +IVG S + HA+RS  S+AKY A+ + K  
Sbjct  178  KQVDLKLKLCRGDSARKIIAREARSFCAWKVIVGVSKTHHAIRSSASLAKYLAKKLPKEC  237

Query  665  SVLAVNNGKVAFQSE  709
             V AVNNGKV FQ E
Sbjct  238  WVHAVNNGKVVFQRE  252



>gb|KHN05157.1| Receptor-like cytosolic serine/threonine-protein kinase RBK2 
[Glycine soja]
Length=711

 Score =   166 bits (421),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 99/139 (71%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            KMDS S ELLTWAL KVAQ GD ++ALHVL  D       KS +  LVK FDS+LA YEG
Sbjct  2    KMDSHSTELLTWALFKVAQPGDVVLALHVLGNDEIVNREGKSSLFSLVKAFDSILAVYEG  61

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLK ++CRGS  R+IL REA  Y AT +IVG+S   H +R  +SVA+YCA+ +
Sbjct  62   FCNLKQVDLKFKICRGSSVRRILVREANAYSATHIIVGSSQGLHIIRPCISVARYCAKKL  121

Query  653  DKSISVLAVNNGKVAFQSE  709
             K   VLAV+NGK+ F+ E
Sbjct  122  PKDCWVLAVDNGKIVFKRE  140



>ref|XP_003542041.1| PREDICTED: uncharacterized protein LOC100797280 [Glycine max]
Length=736

 Score =   166 bits (421),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 99/139 (71%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            KMDS S ELLTWAL KVAQ GD ++ALHVL  D       KS +  LVK FDS+LA YEG
Sbjct  27   KMDSHSTELLTWALFKVAQPGDVVLALHVLGNDEIVNREGKSSLFSLVKAFDSILAVYEG  86

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLK ++CRGS  R+IL REA  Y AT +IVG+S   H +R  +SVA+YCA+ +
Sbjct  87   FCNLKQVDLKFKICRGSSVRRILVREANAYSATHIIVGSSQGLHIIRPCISVARYCAKKL  146

Query  653  DKSISVLAVNNGKVAFQSE  709
             K   VLAV+NGK+ F+ E
Sbjct  147  PKDCWVLAVDNGKIVFKRE  165



>ref|XP_006390104.1| hypothetical protein EUTSA_v10018181mg [Eutrema salsugineum]
 gb|ESQ27390.1| hypothetical protein EUTSA_v10018181mg [Eutrema salsugineum]
Length=750

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 84/138 (61%), Positives = 103/138 (75%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD----TDKSEMLRLVKTFDSVLAAYEGF  475
            K+D+ S+ELLTWALVKVA+ GD +IALH+L  +       S +L LVK FDSVL  YEGF
Sbjct  26   KLDAPSRELLTWALVKVAEPGDTVIALHILGNEIVDRAGNSSLLSLVKAFDSVLDVYEGF  85

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQVDLKL++CRGS ARKIL REAK++ A+ ++VG S S H +RS  SVAKY A+ + 
Sbjct  86   CNLKQVDLKLKLCRGSSARKILVREAKSFCASKVLVGISKSHHTIRSSASVAKYLAKKLP  145

Query  656  KSISVLAVNNGKVAFQSE  709
            K   VLAVNNGK+ FQ E
Sbjct  146  KDCWVLAVNNGKIMFQKE  163



>gb|EPS63840.1| hypothetical protein M569_10941, partial [Genlisea aurea]
Length=721

 Score =   166 bits (419),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 102/139 (73%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            K+DSRS+ELLTW LVKVAQ GD ++ALHVLD +       KS  L LVK FD++LA Y  
Sbjct  8    KLDSRSRELLTWTLVKVAQPGDHVVALHVLDANEIVDQEGKSSFLSLVKAFDAILAVYGS  67

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDL+L++CRGS  ++IL  E+K   A  L+VG S +RH +RSPVSVAK+CA  +
Sbjct  68   FCNLKQVDLRLKICRGSSVKRILIHESKAQNAVHLVVGASQTRHRIRSPVSVAKHCAGKL  127

Query  653  DKSISVLAVNNGKVAFQSE  709
             K  SV+AV+NGK+AF  +
Sbjct  128  PKDCSVIAVDNGKIAFHRQ  146



>ref|XP_009128214.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Brassica rapa]
Length=698

 Score =   165 bits (418),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/135 (62%), Positives = 104/135 (77%), Gaps = 1/135 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDK-SEMLRLVKTFDSVLAAYEGFCNL  484
            K+D+ S+ELLTWALVKVA+ GD +IALH+L  +  K S +L LVKTFDSVL  YEGFCNL
Sbjct  21   KLDAPSRELLTWALVKVAEPGDTVIALHILGNEIVKNSSLLSLVKTFDSVLDVYEGFCNL  80

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL++CRG  ARKI+AREA+++ A  +IVG S + HA+RS  S+AKY A+ + K  
Sbjct  81   KQVDLKLKLCRGDSARKIIAREARSFCAWKVIVGVSKTHHAIRSSASLAKYLAKKLPKEC  140

Query  665  SVLAVNNGKVAFQSE  709
             V AVNNGKV FQ E
Sbjct  141  WVHAVNNGKVVFQRE  155



>ref|XP_003526656.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670-like [Glycine max]
Length=743

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 100/137 (73%), Gaps = 5/137 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            KMDS SKELLTWALVKVA  GD ++ALHVL  +       KS +L LVK FDSVLAAY+G
Sbjct  19   KMDSPSKELLTWALVKVAHPGDTVVALHVLGNNETVNGDGKSSLLSLVKAFDSVLAAYKG  78

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRGS  +K L REA  Y AT ++VGT+   H +RS   VAK+CA+ +
Sbjct  79   FCNLKQVDLKLKICRGSSVKKTLVREANGYSATHVVVGTTHGLHKIRSSTVVAKHCAKKL  138

Query  653  DKSISVLAVNNGKVAFQ  703
             K   VLAVNNGKV F+
Sbjct  139  SKDCCVLAVNNGKVVFK  155



>gb|KEH35354.1| adenine nucleotide alpha hydrolase-like domain kinase [Medicago 
truncatula]
Length=754

 Score =   166 bits (419),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 84/137 (61%), Positives = 100/137 (73%), Gaps = 5/137 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            KMDS SKELLTWALVKVAQ GD ++ALHVL  +       KS +L LVK FDSVL  YEG
Sbjct  20   KMDSPSKELLTWALVKVAQPGDLVVALHVLGTNEIVNGDGKSSLLSLVKAFDSVLNVYEG  79

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRGS  ++IL REA  Y A+ +IVG+    H +RS  SVAKYCA+ +
Sbjct  80   FCNLKQVDLKLKICRGSSVKRILVREANAYSASHVIVGSVHGFHRIRSSSSVAKYCAKKL  139

Query  653  DKSISVLAVNNGKVAFQ  703
             K   VLAVNNGKV ++
Sbjct  140  SKDCCVLAVNNGKVVYK  156



>ref|XP_004502543.1| PREDICTED: uncharacterized protein LOC101504509 [Cicer arietinum]
Length=731

 Score =   165 bits (417),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 86/137 (63%), Positives = 100/137 (73%), Gaps = 7/137 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            KMDS S ELLTWALVKVAQ GD ++ALHVL  +       KS +L LVK FDSVLA YEG
Sbjct  17   KMDSSSNELLTWALVKVAQPGDLVVALHVLGTNEIVNGDGKSSLLSLVKAFDSVLAVYEG  76

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRGS  +KIL REA  Y AT ++VGT    H +RS  +VAKYCAR +
Sbjct  77   FCNLKQVDLKLKICRGSSVKKILVREAVAYSATHVMVGT--GFHRIRSSTTVAKYCARKL  134

Query  653  DKSISVLAVNNGKVAFQ  703
             K   VLAV+NGKV F+
Sbjct  135  SKECCVLAVSNGKVVFK  151



>ref|XP_011031142.1| PREDICTED: probable LIM domain-containing serine/threonine-protein 
kinase DDB_G0287001 isoform X4 [Populus euphratica]
Length=713

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 99/138 (72%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTD----KSEMLRLVKTFDSVLAAYEGF  475
            K+D  S+ELLTW+LVK+AQ GDR+IALHVLD  T+       +L LVKTFDS+LA YEGF
Sbjct  28   KLDGHSRELLTWSLVKMAQPGDRVIALHVLDSGTECVAGTGSVLSLVKTFDSLLAVYEGF  87

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQVDLKL+VCRG   RKIL +EAK      LIVGTS +R  + S  S AKYCA+ + 
Sbjct  88   CNLKQVDLKLKVCRGESVRKILVKEAKASNVAKLIVGTSKTRQKLNSSTSTAKYCAKKLS  147

Query  656  KSISVLAVNNGKVAFQSE  709
            K  SV AV +GK+ FQ E
Sbjct  148  KGCSVYAVRSGKILFQRE  165



>ref|XP_011011405.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g53590 isoform X4 [Populus euphratica]
Length=713

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/138 (60%), Positives = 99/138 (72%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTD----KSEMLRLVKTFDSVLAAYEGF  475
            K+D  S+ELLTW+LVK+AQ GDR+IALHVLD  T+       +L LVKTFDS+LA YEGF
Sbjct  28   KLDGHSRELLTWSLVKMAQPGDRVIALHVLDSGTECVAGTGSVLSLVKTFDSLLAVYEGF  87

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQVDLKL+VCRG   RKIL +EAK      LIVGTS +R  + S  S AKYCA+ + 
Sbjct  88   CNLKQVDLKLKVCRGESVRKILVKEAKASNVAKLIVGTSKTRQKLNSSTSTAKYCAKKMS  147

Query  656  KSISVLAVNNGKVAFQSE  709
            K  SV AV +GK+ FQ E
Sbjct  148  KGCSVYAVRSGKILFQRE  165



>emb|CDX88355.1| BnaC06g37990D [Brassica napus]
Length=707

 Score =   164 bits (416),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 105/136 (77%), Gaps = 2/136 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD-TDKSEMLRLVKTFDSVLAAYEGFCNL  484
            K+D+ S+ELLTWALVKVA+ GD +IALH+L  +  + S +L LVKTFDSVL  YEGFCNL
Sbjct  21   KLDAPSRELLTWALVKVAEPGDTVIALHILSNEIVENSSLLSLVKTFDSVLDVYEGFCNL  80

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRH-AVRSPVSVAKYCARNVDKS  661
            KQVDLKL++CRG   RK++AREAK++ A+ ++VG S SRH A+RS  SVAKY A+ + K 
Sbjct  81   KQVDLKLKLCRGDSPRKMIAREAKSFSASKVLVGISKSRHNAIRSSASVAKYLAKKLPKD  140

Query  662  ISVLAVNNGKVAFQSE  709
              V AVNNGK+ FQ E
Sbjct  141  RWVHAVNNGKIVFQRE  156



>gb|KGN47686.1| hypothetical protein Csa_6G376270 [Cucumis sativus]
Length=722

 Score =   164 bits (416),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 84/134 (63%), Positives = 101/134 (75%), Gaps = 8/134 (6%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            K+DS S+ELLTWALVKVAQ         +++ D  KS +L LVK FD+VLA YEGFCNLK
Sbjct  26   KLDSHSRELLTWALVKVAQP-------EIVNQDG-KSSLLSLVKAFDTVLAVYEGFCNLK  77

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            QVDLKL++CRG  ARKIL REAK+YRAT+LIVGT+   H +RS  SVAKYCA+ + K   
Sbjct  78   QVDLKLKICRGESARKILVREAKSYRATNLIVGTARKHHKIRSSTSVAKYCAKKLPKDFW  137

Query  668  VLAVNNGKVAFQSE  709
            VLAV+NGKV F+ E
Sbjct  138  VLAVHNGKVIFERE  151



>emb|CDY40878.1| BnaCnng09690D [Brassica napus]
Length=705

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 103/135 (76%), Gaps = 1/135 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDK-SEMLRLVKTFDSVLAAYEGFCNL  484
            K+D+ S+ELLTWALVKVA+ GD +IALH+L  +  K S +L LVKTFDSVL  YEGFCNL
Sbjct  63   KLDAPSRELLTWALVKVAEPGDTVIALHILGNEIVKNSSLLSLVKTFDSVLDVYEGFCNL  122

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL++CRG  ARKI+AREA+++ A  +IVG S + H +RS  S+AKY A+ + K  
Sbjct  123  KQVDLKLKLCRGDSARKIIAREARSFCAWKVIVGVSKTHHTIRSSASLAKYLAKKLPKEC  182

Query  665  SVLAVNNGKVAFQSE  709
             V AVNNGKV FQ E
Sbjct  183  WVHAVNNGKVVFQRE  197



>gb|KHN46982.1| Putative receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=724

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 99/136 (73%), Gaps = 5/136 (4%)
 Frame = +2

Query  311  MDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEGF  475
            MDS SKELLTWALVKVA  GD ++ALHVL  +       KS +L LVK FDSVLAAY+GF
Sbjct  1    MDSPSKELLTWALVKVAHPGDTVVALHVLGNNETVNGDGKSSLLSLVKAFDSVLAAYKGF  60

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQVDLKL++CRGS  +K L REA  Y AT ++VGT+   H +RS   VAK+CA+ + 
Sbjct  61   CNLKQVDLKLKICRGSSVKKTLVREANGYSATHVVVGTTHGLHKIRSSTVVAKHCAKKLS  120

Query  656  KSISVLAVNNGKVAFQ  703
            K   VLAVNNGKV F+
Sbjct  121  KDCCVLAVNNGKVVFK  136



>emb|CDY38355.1| BnaA02g18480D [Brassica napus]
Length=701

 Score =   164 bits (414),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 83/135 (61%), Positives = 103/135 (76%), Gaps = 1/135 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDK-SEMLRLVKTFDSVLAAYEGFCNL  484
            K+D+ S+ELLTWALVKVA+ GD +IALH+L  +  K S +L LVKTFDSVL  YEGFCNL
Sbjct  21   KLDAPSRELLTWALVKVAEPGDTVIALHILGNEIVKNSSLLSLVKTFDSVLDVYEGFCNL  80

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL++CRG  ARKI+AREA+++ A  +IVG S + H +RS  S+AKY A+ + K  
Sbjct  81   KQVDLKLKLCRGDSARKIIAREARSFCAWKVIVGVSKTHHTIRSSASLAKYLAKKLPKEC  140

Query  665  SVLAVNNGKVAFQSE  709
             V AVNNGKV FQ E
Sbjct  141  WVHAVNNGKVVFQRE  155



>ref|XP_011022896.1| PREDICTED: probable leucine-rich repeat receptor-like serine/threonine-protein 
kinase At5g15730 [Populus euphratica]
Length=718

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 98/143 (69%), Gaps = 7/143 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTD----KSEMLRLVKTFDSVLAAYEGF  475
            K D  SKELLTW+L+K+AQ GD +IA+HVLD  T+       +L LVKTFDS+LA YEGF
Sbjct  31   KFDGPSKELLTWSLMKMAQPGDHVIAVHVLDSATECMAGTGSLLSLVKTFDSLLAVYEGF  90

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQVDLKL+VCRG   RKIL REAK   A  LIVGTS     + S  S AKYCA+ + 
Sbjct  91   CNLKQVDLKLKVCRGESVRKILVREAKANSAAKLIVGTSKKHQKLYSSTSTAKYCAKKLS  150

Query  656  KSISVLAVNNGKVAFQSE---PN  715
            K  SV AV NGK+ FQ E   PN
Sbjct  151  KGFSVYAVRNGKLVFQREATVPN  173



>ref|XP_002310531.2| hypothetical protein POPTR_0007s04490g [Populus trichocarpa]
 gb|EEE90981.2| hypothetical protein POPTR_0007s04490g [Populus trichocarpa]
Length=743

 Score =   162 bits (411),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 99/143 (69%), Gaps = 7/143 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTD----KSEMLRLVKTFDSVLAAYEGF  475
            K D  SKELLTW+L+K+AQ GD +IA+HVLD  T+     + +L LVKTFDS+LA YEGF
Sbjct  32   KFDGPSKELLTWSLMKMAQPGDHVIAVHVLDSATECMAGTASLLSLVKTFDSLLAVYEGF  91

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQVDLKL+VCRG   RKIL REAK   A  LIVGTS     + S  S AKYCA+ + 
Sbjct  92   CNLKQVDLKLKVCRGESVRKILVREAKANSAAKLIVGTSKKHQKLYSSTSTAKYCAKKLS  151

Query  656  KSISVLAVNNGKVAFQSE---PN  715
            K  SV AV NGK+ FQ E   PN
Sbjct  152  KGFSVYAVRNGKLVFQREASVPN  174



>ref|NP_001238713.1| protein kinase family protein [Glycine max]
 gb|ACM89509.1| protein kinase family protein [Glycine max]
Length=649

 Score =   162 bits (410),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 96/139 (69%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            KMDS S ELLTWAL KVAQ GD ++ALHVL  D       KS +  LVK FDS+LA YEG
Sbjct  25   KMDSHSTELLTWALFKVAQPGDVVLALHVLGNDEIVNREGKSSLFSLVKAFDSILAVYEG  84

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLK ++CRGS   +IL REA  Y AT +IVG+S   H  R  +SVA+YCA+ +
Sbjct  85   FCNLKQVDLKFKICRGSSVTRILVREANAYSATHIIVGSSQGLHITRPCISVARYCAKKL  144

Query  653  DKSISVLAVNNGKVAFQSE  709
             K   V AV+NGK+ F+ E
Sbjct  145  PKDCWVFAVDNGKIVFKRE  163



>ref|XP_011011403.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g53590 isoform X2 [Populus euphratica]
Length=718

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 98/143 (69%), Gaps = 9/143 (6%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSE---------MLRLVKTFDSVLA  460
            K+D  S+ELLTW+LVK+AQ GDR+IALHVLD  T             +L LVKTFDS+LA
Sbjct  28   KLDGHSRELLTWSLVKMAQPGDRVIALHVLDSGTGNGNSECVAGTGSVLSLVKTFDSLLA  87

Query  461  AYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYC  640
             YEGFCNLKQVDLKL+VCRG   RKIL +EAK      LIVGTS +R  + S  S AKYC
Sbjct  88   VYEGFCNLKQVDLKLKVCRGESVRKILVKEAKASNVAKLIVGTSKTRQKLNSSTSTAKYC  147

Query  641  ARNVDKSISVLAVNNGKVAFQSE  709
            A+ + K  SV AV +GK+ FQ E
Sbjct  148  AKKMSKGCSVYAVRSGKILFQRE  170



>ref|XP_011031140.1| PREDICTED: probable LIM domain-containing serine/threonine-protein 
kinase DDB_G0287001 isoform X2 [Populus euphratica]
Length=718

 Score =   162 bits (409),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 98/143 (69%), Gaps = 9/143 (6%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSE---------MLRLVKTFDSVLA  460
            K+D  S+ELLTW+LVK+AQ GDR+IALHVLD  T             +L LVKTFDS+LA
Sbjct  28   KLDGHSRELLTWSLVKMAQPGDRVIALHVLDSGTGNGNSECVAGTGSVLSLVKTFDSLLA  87

Query  461  AYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYC  640
             YEGFCNLKQVDLKL+VCRG   RKIL +EAK      LIVGTS +R  + S  S AKYC
Sbjct  88   VYEGFCNLKQVDLKLKVCRGESVRKILVKEAKASNVAKLIVGTSKTRQKLNSSTSTAKYC  147

Query  641  ARNVDKSISVLAVNNGKVAFQSE  709
            A+ + K  SV AV +GK+ FQ E
Sbjct  148  AKKLSKGCSVYAVRSGKILFQRE  170



>ref|XP_007161426.1| hypothetical protein PHAVU_001G067700g [Phaseolus vulgaris]
 gb|ESW33420.1| hypothetical protein PHAVU_001G067700g [Phaseolus vulgaris]
Length=742

 Score =   162 bits (410),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 96/137 (70%), Gaps = 5/137 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            KMDS S ELLTWAL KVAQ  D ++ALHVL  D       KS +  LVK FDSVLA YEG
Sbjct  24   KMDSHSTELLTWALFKVAQPCDVVLALHVLGNDEIVNRDGKSSLFSLVKAFDSVLAVYEG  83

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLK ++CRGS  RKIL REA  Y AT +IVG+    H +R  +SVA+YCAR +
Sbjct  84   FCNLKQVDLKFKICRGSSVRKILVREANAYSATHIIVGSPQGLHRIRPCISVARYCARKL  143

Query  653  DKSISVLAVNNGKVAFQ  703
             K   VLAV+NGK+ F+
Sbjct  144  PKDCWVLAVHNGKIVFK  160



>emb|CBI37518.3| unnamed protein product [Vitis vinifera]
Length=726

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 103/142 (73%), Gaps = 13/142 (9%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTD---------KSEMLRLVKTFDSVLA  460
            K+D RSKELLTWALVKVAQ+GDR++A+HVL   TD         KS +L L  TF ++LA
Sbjct  59   KLDQRSKELLTWALVKVAQSGDRVVAVHVL---TDAAAVTMTGGKSSLLSLFDTFKTLLA  115

Query  461  AYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAV-RSPVSVAKY  637
            AYEGFCNLKQV+LKL+VCRGS   KIL REAK++    +IVG S + H + RSP  VAKY
Sbjct  116  AYEGFCNLKQVELKLKVCRGSSVPKILVREAKSHANVKVIVGISRTNHTIWRSPAWVAKY  175

Query  638  CARNVDKSISVLAVNNGKVAFQ  703
            CAR +  + SV AV+NGK+ FQ
Sbjct  176  CARKLSSNFSVFAVDNGKIVFQ  197



>ref|XP_002307046.2| hypothetical protein POPTR_0005s06800g [Populus trichocarpa]
 gb|EEE94042.2| hypothetical protein POPTR_0005s06800g [Populus trichocarpa]
Length=720

 Score =   162 bits (409),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 99/145 (68%), Gaps = 11/145 (8%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSE-----------MLRLVKTFDSV  454
            K+D +S+ELLTW+LVK+AQ GDR+IALHVLD  T               +L LVKTFDS+
Sbjct  28   KLDGQSRELLTWSLVKMAQPGDRVIALHVLDSGTGNGNSGKECVAGTGSVLSLVKTFDSL  87

Query  455  LAAYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAK  634
            LA YEGFCNLKQVDLKL+VCRG   RKIL +EAK      LIVGTS +R  + S  S AK
Sbjct  88   LAVYEGFCNLKQVDLKLKVCRGESVRKILVKEAKASNVAKLIVGTSKTRQKLNSSTSTAK  147

Query  635  YCARNVDKSISVLAVNNGKVAFQSE  709
            YCA+ + K  SV AV +GK+ FQ E
Sbjct  148  YCAKKLSKGCSVYAVRSGKILFQRE  172



>ref|XP_002264653.2| PREDICTED: probable receptor protein kinase TMK1 [Vitis vinifera]
Length=768

 Score =   162 bits (410),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 103/142 (73%), Gaps = 13/142 (9%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTD---------KSEMLRLVKTFDSVLA  460
            K+D RSKELLTWALVKVAQ+GDR++A+HVL   TD         KS +L L  TF ++LA
Sbjct  66   KLDQRSKELLTWALVKVAQSGDRVVAVHVL---TDAAAVTMTGGKSSLLSLFDTFKTLLA  122

Query  461  AYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAV-RSPVSVAKY  637
            AYEGFCNLKQV+LKL+VCRGS   KIL REAK++    +IVG S + H + RSP  VAKY
Sbjct  123  AYEGFCNLKQVELKLKVCRGSSVPKILVREAKSHANVKVIVGISRTNHTIWRSPAWVAKY  182

Query  638  CARNVDKSISVLAVNNGKVAFQ  703
            CAR +  + SV AV+NGK+ FQ
Sbjct  183  CARKLSSNFSVFAVDNGKIVFQ  204



>gb|KFK42126.1| hypothetical protein AALP_AA2G214300 [Arabis alpina]
Length=738

 Score =   162 bits (409),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 102/138 (74%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT----DKSEMLRLVKTFDSVLAAYEGF  475
            K+D+ S+ELLTWALVK+A+ GD +IALH+L  +       S +L LVKTFDSVL  YEGF
Sbjct  17   KLDAPSRELLTWALVKIAEPGDTVIALHILGNEIVDGGGNSSLLSLVKTFDSVLDVYEGF  76

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQVDLKL++CRG+ ARKI+ REA +  A+ ++VG S S H +RS  S+AKY A+ + 
Sbjct  77   CNLKQVDLKLKLCRGTSARKIIVREANSCSASKVLVGVSKSHHTIRSSTSLAKYLAKKLS  136

Query  656  KSISVLAVNNGKVAFQSE  709
            K   V+AVNNGK+ FQ E
Sbjct  137  KECWVIAVNNGKILFQKE  154



>ref|XP_011031139.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At1g53430 isoform X1 [Populus euphratica]
Length=720

 Score =   161 bits (408),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 98/145 (68%), Gaps = 11/145 (8%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSE-----------MLRLVKTFDSV  454
            K+D  S+ELLTW+LVK+AQ GDR+IALHVLD  T               +L LVKTFDS+
Sbjct  28   KLDGHSRELLTWSLVKMAQPGDRVIALHVLDSGTGNGNSGKECVAGTGSVLSLVKTFDSL  87

Query  455  LAAYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAK  634
            LA YEGFCNLKQVDLKL+VCRG   RKIL +EAK      LIVGTS +R  + S  S AK
Sbjct  88   LAVYEGFCNLKQVDLKLKVCRGESVRKILVKEAKASNVAKLIVGTSKTRQKLNSSTSTAK  147

Query  635  YCARNVDKSISVLAVNNGKVAFQSE  709
            YCA+ + K  SV AV +GK+ FQ E
Sbjct  148  YCAKKLSKGCSVYAVRSGKILFQRE  172



>gb|KHN38974.1| Receptor-like cytosolic serine/threonine-protein kinase RBK2 
[Glycine soja]
Length=733

 Score =   161 bits (408),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 96/139 (69%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            KMDS S ELLTWAL KVAQ GD ++ALHVL  D       KS +  LVK FDS+LA YEG
Sbjct  25   KMDSHSTELLTWALFKVAQPGDVVLALHVLGNDEIVNREGKSSLFSLVKAFDSILAVYEG  84

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLK ++CRGS   +IL REA  Y AT +IVG+S   H  R  +SVA+YCA+ +
Sbjct  85   FCNLKQVDLKFKICRGSSVTRILVREANAYSATHIIVGSSQGLHITRPCISVARYCAKKL  144

Query  653  DKSISVLAVNNGKVAFQSE  709
             K   V AV+NGK+ F+ E
Sbjct  145  PKDCWVFAVDNGKIVFKRE  163



>ref|XP_006595490.1| PREDICTED: protein kinase family protein isoform X1 [Glycine 
max]
Length=735

 Score =   161 bits (408),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 96/139 (69%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            KMDS S ELLTWAL KVAQ GD ++ALHVL  D       KS +  LVK FDS+LA YEG
Sbjct  27   KMDSHSTELLTWALFKVAQPGDVVLALHVLGNDEIVNREGKSSLFSLVKAFDSILAVYEG  86

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLK ++CRGS   +IL REA  Y AT +IVG+S   H  R  +SVA+YCA+ +
Sbjct  87   FCNLKQVDLKFKICRGSSVTRILVREANAYSATHIIVGSSQGLHITRPCISVARYCAKKL  146

Query  653  DKSISVLAVNNGKVAFQSE  709
             K   V AV+NGK+ F+ E
Sbjct  147  PKDCWVFAVDNGKIVFKRE  165



>ref|XP_011011402.1| PREDICTED: putative leucine-rich repeat receptor-like serine/threonine-protein 
kinase At3g53590 isoform X1 [Populus euphratica]
Length=720

 Score =   161 bits (408),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 98/145 (68%), Gaps = 11/145 (8%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSE-----------MLRLVKTFDSV  454
            K+D  S+ELLTW+LVK+AQ GDR+IALHVLD  T               +L LVKTFDS+
Sbjct  28   KLDGHSRELLTWSLVKMAQPGDRVIALHVLDSGTGNGNSGKECVAGTGSVLSLVKTFDSL  87

Query  455  LAAYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAK  634
            LA YEGFCNLKQVDLKL+VCRG   RKIL +EAK      LIVGTS +R  + S  S AK
Sbjct  88   LAVYEGFCNLKQVDLKLKVCRGESVRKILVKEAKASNVAKLIVGTSKTRQKLNSSTSTAK  147

Query  635  YCARNVDKSISVLAVNNGKVAFQSE  709
            YCA+ + K  SV AV +GK+ FQ E
Sbjct  148  YCAKKMSKGCSVYAVRSGKILFQRE  172



>ref|XP_011011404.1| PREDICTED: probable LIM domain-containing serine/threonine-protein 
kinase DDB_G0287001 isoform X3 [Populus euphratica]
Length=714

 Score =   161 bits (408),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 98/145 (68%), Gaps = 11/145 (8%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSE-----------MLRLVKTFDSV  454
            K+D  S+ELLTW+LVK+AQ GDR+IALHVLD  T               +L LVKTFDS+
Sbjct  28   KLDGHSRELLTWSLVKMAQPGDRVIALHVLDSGTGNGNSGKECVAGTGSVLSLVKTFDSL  87

Query  455  LAAYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAK  634
            LA YEGFCNLKQVDLKL+VCRG   RKIL +EAK      LIVGTS +R  + S  S AK
Sbjct  88   LAVYEGFCNLKQVDLKLKVCRGESVRKILVKEAKASNVAKLIVGTSKTRQKLNSSTSTAK  147

Query  635  YCARNVDKSISVLAVNNGKVAFQSE  709
            YCA+ + K  SV AV +GK+ FQ E
Sbjct  148  YCAKKMSKGCSVYAVRSGKILFQRE  172



>ref|XP_011031141.1| PREDICTED: probable LIM domain-containing serine/threonine-protein 
kinase DDB_G0287001 isoform X3 [Populus euphratica]
Length=714

 Score =   161 bits (408),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 83/145 (57%), Positives = 98/145 (68%), Gaps = 11/145 (8%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSE-----------MLRLVKTFDSV  454
            K+D  S+ELLTW+LVK+AQ GDR+IALHVLD  T               +L LVKTFDS+
Sbjct  28   KLDGHSRELLTWSLVKMAQPGDRVIALHVLDSGTGNGNSGKECVAGTGSVLSLVKTFDSL  87

Query  455  LAAYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAK  634
            LA YEGFCNLKQVDLKL+VCRG   RKIL +EAK      LIVGTS +R  + S  S AK
Sbjct  88   LAVYEGFCNLKQVDLKLKVCRGESVRKILVKEAKASNVAKLIVGTSKTRQKLNSSTSTAK  147

Query  635  YCARNVDKSISVLAVNNGKVAFQSE  709
            YCA+ + K  SV AV +GK+ FQ E
Sbjct  148  YCAKKLSKGCSVYAVRSGKILFQRE  172



>ref|XP_010527069.1| PREDICTED: probable L-type lectin-domain containing receptor 
kinase II.1 [Tarenaya hassleriana]
Length=745

 Score =   161 bits (407),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 80/136 (59%), Positives = 104/136 (76%), Gaps = 3/136 (2%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLD--PDTDKSEMLRLVKTFDSVLAAYEGFCN  481
            K   RS+ELLTWALVKVA +GDR+IALHV+D  P+   S +L +VK+F+++L  YEGFCN
Sbjct  25   KFGGRSRELLTWALVKVANSGDRVIALHVVDSVPENSAS-LLSVVKSFEAMLRVYEGFCN  83

Query  482  LKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKS  661
            LKQV+LKL+VCRG+  R++LA EA +  A   I+GTS SRH +RS  SVAKYCA  + K 
Sbjct  84   LKQVELKLKVCRGASVRRVLATEANSCGAATFILGTSKSRHCLRSSASVAKYCATKLPKK  143

Query  662  ISVLAVNNGKVAFQSE  709
            +SVLAV+NG++ FQ E
Sbjct  144  LSVLAVDNGRIVFQRE  159



>ref|XP_003522567.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670-like isoform X1 [Glycine max]
 ref|XP_006578953.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670-like isoform X2 [Glycine max]
Length=750

 Score =   159 bits (403),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 96/137 (70%), Gaps = 5/137 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD-----TDKSEMLRLVKTFDSVLAAYEG  472
            KMDS  KELLTWALVKVA   D ++ALHVL          KS +L LVK FDSVLA Y+G
Sbjct  26   KMDSPCKELLTWALVKVAHPRDTVVALHVLGSHETVNGVGKSSLLSLVKAFDSVLAVYKG  85

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRGS  +K L REA  Y AT ++VGT+   H +RS   VAKYCA+ +
Sbjct  86   FCNLKQVDLKLKICRGSSVKKSLVREANGYSATHIVVGTTHGLHKIRSSTVVAKYCAKKL  145

Query  653  DKSISVLAVNNGKVAFQ  703
             K   VLAVNNGKV F+
Sbjct  146  SKDCCVLAVNNGKVVFK  162



>ref|XP_010461193.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X3 [Camelina sativa]
Length=714

 Score =   159 bits (401),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 99/136 (73%), Gaps = 0/136 (0%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            K D  S+E+LTW LV VA+ GDRI+ALHVLD     + ++ LV++FD++L  YE FCNLK
Sbjct  36   KPDEWSREVLTWYLVNVARPGDRIVALHVLDYPLGSTSLISLVRSFDTMLGVYESFCNLK  95

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            QVDLKL+V RG  ARK+L +E K+  AT LIVG+S   H +RS  S+AKYCARN+ K +S
Sbjct  96   QVDLKLKVFRGKSARKVLVQEVKSCGATSLIVGSSRRHHTIRSSASLAKYCARNLSKDVS  155

Query  668  VLAVNNGKVAFQSEPN  715
            V AV +GK+ F+  PN
Sbjct  156  VFAVKSGKIMFRRVPN  171



>emb|CBI18962.3| unnamed protein product [Vitis vinifera]
Length=732

 Score =   158 bits (400),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 101/139 (73%), Gaps = 9/139 (6%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            K+DS+S+ELLTWALVKVAQ GDR+IALHVL  +      +      +V +F    A YEG
Sbjct  25   KLDSQSRELLTWALVKVAQPGDRVIALHVLGHNEMGVCRNCGSRWEIVASF----AVYEG  80

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRGS   KIL RE K+Y A+ +IVGT+ + HA+RS  +VAKYCA+ +
Sbjct  81   FCNLKQVDLKLKICRGSSIGKILVREVKSYVASKVIVGTARNHHAIRSSAAVAKYCAKKL  140

Query  653  DKSISVLAVNNGKVAFQSE  709
             K  SVLAVNNGKV FQ E
Sbjct  141  PKDCSVLAVNNGKVVFQRE  159



>ref|XP_006279577.1| hypothetical protein CARUB_v10025977mg [Capsella rubella]
 gb|EOA12475.1| hypothetical protein CARUB_v10025977mg [Capsella rubella]
Length=711

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNL  484
            K D  S+E+LTW+LV VA+ GDRI+ALHVLD   + S  ++ LV++FD++L  YE FCNL
Sbjct  33   KPDEWSREVLTWSLVNVARPGDRIVALHVLDYSLEGSTSLISLVRSFDTMLGVYESFCNL  92

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+V RG  ARK+L +E K+  AT LIVG+S   H +RS  S+AKYCARN+ K +
Sbjct  93   KQVDLKLKVFRGKSARKVLVQEVKSCGATSLIVGSSKKHHTIRSSASLAKYCARNLSKDV  152

Query  665  SVLAVNNGKVAFQSEPN  715
            SV AV +GK+ F+  PN
Sbjct  153  SVFAVKSGKIMFRRVPN  169



>ref|XP_006394225.1| hypothetical protein EUTSA_v10003727mg [Eutrema salsugineum]
 gb|ESQ31511.1| hypothetical protein EUTSA_v10003727mg [Eutrema salsugineum]
Length=708

 Score =   158 bits (399),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNL  484
            K D  S+E+LTW+LV VA+ GDRI+ALHVLD   + S  ++ LV+TFD++L  YE FCNL
Sbjct  33   KPDEWSREVLTWSLVNVARPGDRIVALHVLDYSLEGSTSLISLVRTFDTMLGVYESFCNL  92

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+V RG  ARK+L +E K+  AT LIVG+S   H +RS  S+AKYCARN+ K +
Sbjct  93   KQVDLKLKVFRGKSARKVLVQEVKSCGATSLIVGSSRKHHTIRSSASLAKYCARNLAKDV  152

Query  665  SVLAVNNGKVAFQSEPN  715
            SV AV +GK+ F+  PN
Sbjct  153  SVFAVKSGKIMFRRVPN  169



>ref|XP_007137480.1| hypothetical protein PHAVU_009G130300g [Phaseolus vulgaris]
 gb|ESW09474.1| hypothetical protein PHAVU_009G130300g [Phaseolus vulgaris]
Length=753

 Score =   158 bits (400),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/137 (60%), Positives = 97/137 (71%), Gaps = 5/137 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            KMDS SKELLTWALVKVA  GD ++ALHVL          KS +L LVK FDSVLA YEG
Sbjct  25   KMDSPSKELLTWALVKVAHPGDTVVALHVLGNQETVNGDGKSSLLSLVKAFDSVLAVYEG  84

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQV+L+L++CRGS  +KIL REA    AT ++VGT+   H +RS   VAKYCA+ +
Sbjct  85   FCNLKQVNLRLKICRGSSVKKILVREANGSSATHVVVGTTHGLHRIRSSTFVAKYCAKKL  144

Query  653  DKSISVLAVNNGKVAFQ  703
             K   VLAVNN KV F+
Sbjct  145  SKDCCVLAVNNRKVVFK  161



>gb|KFK44259.1| hypothetical protein AALP_AA1G235200 [Arabis alpina]
Length=758

 Score =   158 bits (400),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 100/138 (72%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD----TDKSEMLRLVKTFDSVLAAYEGF  475
            K D+ S ELL WALVKVA+ GD +IALH+L  +     DKS ++ LVKTFDSVL  YEGF
Sbjct  18   KFDASSSELLDWALVKVAEPGDTVIALHILSNEMVDRVDKSSLVSLVKTFDSVLEVYEGF  77

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            C LKQV+LKL++CRGS  RKIL REAK   A+ ++VG S S H + S +SVAKY AR + 
Sbjct  78   CKLKQVELKLKLCRGSSTRKILVREAKLCYASKVVVGISKSYHTIHSSISVAKYLARKLS  137

Query  656  KSISVLAVNNGKVAFQSE  709
            K   VLAV+NGK+ FQ++
Sbjct  138  KHCWVLAVDNGKIMFQTD  155



>ref|XP_006394226.1| hypothetical protein EUTSA_v10003727mg [Eutrema salsugineum]
 gb|ESQ31512.1| hypothetical protein EUTSA_v10003727mg [Eutrema salsugineum]
Length=710

 Score =   158 bits (399),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNL  484
            K D  S+E+LTW+LV VA+ GDRI+ALHVLD   + S  ++ LV+TFD++L  YE FCNL
Sbjct  33   KPDEWSREVLTWSLVNVARPGDRIVALHVLDYSLEGSTSLISLVRTFDTMLGVYESFCNL  92

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+V RG  ARK+L +E K+  AT LIVG+S   H +RS  S+AKYCARN+ K +
Sbjct  93   KQVDLKLKVFRGKSARKVLVQEVKSCGATSLIVGSSRKHHTIRSSASLAKYCARNLAKDV  152

Query  665  SVLAVNNGKVAFQSEPN  715
            SV AV +GK+ F+  PN
Sbjct  153  SVFAVKSGKIMFRRVPN  169



>gb|KHN44298.1| Putative receptor-like serine/threonine-protein kinase [Glycine 
soja]
Length=724

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/136 (60%), Positives = 95/136 (70%), Gaps = 5/136 (4%)
 Frame = +2

Query  311  MDSRSKELLTWALVKVAQTGDRIIALHVLDPD-----TDKSEMLRLVKTFDSVLAAYEGF  475
            MDS  KELLTWALVKVA   D ++ALHVL          KS +L LVK FDSVLA Y+GF
Sbjct  1    MDSPCKELLTWALVKVAHPRDTVVALHVLGSHETVNGVGKSSLLSLVKAFDSVLAVYKGF  60

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQVDLKL++CRGS  +K L REA  Y AT ++VGT+   H +RS   VAKYCA+ + 
Sbjct  61   CNLKQVDLKLKICRGSSVKKSLVREANGYSATHIVVGTTHGLHKIRSSTVVAKYCAKKLS  120

Query  656  KSISVLAVNNGKVAFQ  703
            K   VLAVNNGKV F+
Sbjct  121  KDCCVLAVNNGKVVFK  136



>ref|XP_010664160.1| PREDICTED: LOW QUALITY PROTEIN: probable receptor-like serine/threonine-protein 
kinase At5g57670 [Vitis vinifera]
Length=754

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 100/139 (72%), Gaps = 14/139 (10%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEG  472
            K+DS+S+ELLTWALVKVAQ GDR+IALHVL  +       KS +L  V         YEG
Sbjct  25   KLDSQSRELLTWALVKVAQPGDRVIALHVLGHNEIVDRDGKSSLLSXV---------YEG  75

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            FCNLKQVDLKL++CRGS   KIL RE K+Y A+ +IVGT+ + HA+RS  +VAKYCA+ +
Sbjct  76   FCNLKQVDLKLKICRGSSIGKILVREVKSYVASKVIVGTARNHHAIRSSAAVAKYCAKKL  135

Query  653  DKSISVLAVNNGKVAFQSE  709
             K  SVLAVNNGKV FQ E
Sbjct  136  PKDCSVLAVNNGKVVFQRE  154



>ref|XP_010461185.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X2 [Camelina sativa]
Length=715

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 100/137 (73%), Gaps = 1/137 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLD-PDTDKSEMLRLVKTFDSVLAAYEGFCNL  484
            K D  S+E+LTW LV VA+ GDRI+ALHVLD P    + ++ LV++FD++L  YE FCNL
Sbjct  36   KPDEWSREVLTWYLVNVARPGDRIVALHVLDYPLEGSTSLISLVRSFDTMLGVYESFCNL  95

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+V RG  ARK+L +E K+  AT LIVG+S   H +RS  S+AKYCARN+ K +
Sbjct  96   KQVDLKLKVFRGKSARKVLVQEVKSCGATSLIVGSSRRHHTIRSSASLAKYCARNLSKDV  155

Query  665  SVLAVNNGKVAFQSEPN  715
            SV AV +GK+ F+  PN
Sbjct  156  SVFAVKSGKIMFRRVPN  172



>ref|XP_010461177.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X1 [Camelina sativa]
Length=715

 Score =   157 bits (398),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 100/137 (73%), Gaps = 1/137 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLD-PDTDKSEMLRLVKTFDSVLAAYEGFCNL  484
            K D  S+E+LTW LV VA+ GDRI+ALHVLD P    + ++ LV++FD++L  YE FCNL
Sbjct  36   KPDEWSREVLTWYLVNVARPGDRIVALHVLDYPLEGSTSLISLVRSFDTMLGVYESFCNL  95

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+V RG  ARK+L +E K+  AT LIVG+S   H +RS  S+AKYCARN+ K +
Sbjct  96   KQVDLKLKVFRGKSARKVLVQEVKSCGATSLIVGSSRRHHTIRSSASLAKYCARNLSKDV  155

Query  665  SVLAVNNGKVAFQSEPN  715
            SV AV +GK+ F+  PN
Sbjct  156  SVFAVKSGKIMFRRVPN  172



>ref|XP_010484157.1| PREDICTED: probable receptor-like protein kinase At3g17420 [Camelina 
sativa]
Length=712

 Score =   157 bits (397),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNL  484
            K D  S+E+LTW+LV VA+ GDRI+ALHVLD   + S  ++ LV++FD++L  YE FCNL
Sbjct  33   KPDEWSREVLTWSLVNVARPGDRIVALHVLDYSLEGSTSLISLVRSFDTMLGVYESFCNL  92

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+V RG  ARK+L +E K+  AT LIVG+S   H +RS  S+AKYCARN+ K +
Sbjct  93   KQVDLKLKVFRGKSARKVLVQEVKSCGATSLIVGSSRRHHTIRSSASLAKYCARNLSKDV  152

Query  665  SVLAVNNGKVAFQSEPN  715
            SV AV +GK+ F+  PN
Sbjct  153  SVFAVKSGKIMFRRVPN  169



>ref|NP_201199.1| protein kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Arabidopsis thaliana]
 dbj|BAA96897.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM13057.1| unknown protein [Arabidopsis thaliana]
 gb|AAP68229.1| At5g63940 [Arabidopsis thaliana]
 gb|AED97818.1| protein kinase protein with adenine nucleotide alpha hydrolases-like 
domain [Arabidopsis thaliana]
Length=705

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 100/137 (73%), Gaps = 1/137 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNL  484
            K D  S+E+LTW+LV VA+ GDRI+ALHVLD   + S  ++ LV+ FD++L  YE FCNL
Sbjct  27   KPDEWSREVLTWSLVNVARPGDRIVALHVLDYSLEGSTSLISLVRNFDTMLGVYESFCNL  86

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+V RG  ARK+L +E K+  AT LIVG+S   H +RS  S+AKYCARN+ K +
Sbjct  87   KQVDLKLKVFRGKSARKVLVQEVKSCGATSLIVGSSRKHHTIRSSASLAKYCARNLAKDV  146

Query  665  SVLAVNNGKVAFQSEPN  715
            SV AV +GK+ F+  PN
Sbjct  147  SVFAVKSGKIMFRRVPN  163



>ref|XP_009150459.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Brassica 
rapa]
Length=697

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNL  484
            K D  S+E+LTW+LV VA+ GDRI+ALHVLD   + S  ++ LV+TFD++L  YE FCNL
Sbjct  28   KPDEWSREVLTWSLVNVARPGDRIVALHVLDYSLEGSTSLVSLVRTFDTMLGVYESFCNL  87

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+V RG  ARK+L +E K+  AT LIVG+S   H +RS  S+AKYCARN+ K +
Sbjct  88   KQVDLKLKVFRGKSARKVLVQEVKSSGATSLIVGSSKRHHTIRSSASLAKYCARNLAKDV  147

Query  665  SVLAVNNGKVAFQSEPN  715
            SV AV +GK+ F+  P+
Sbjct  148  SVFAVKSGKIMFRRVPS  164



>ref|XP_002864878.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41137.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=708

 Score =   156 bits (395),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 100/137 (73%), Gaps = 1/137 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNL  484
            K D  S+E+LTW+LV VA+ GDRI+ALHVLD   + S  ++ LV+ FD++L  YE FCNL
Sbjct  31   KPDEWSREVLTWSLVNVARPGDRIVALHVLDYSLEGSTSLISLVRNFDTMLGVYESFCNL  90

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+V RG  ARK+L +E K+  AT LIVG+S   H +RS  S+AKYCARN+ K +
Sbjct  91   KQVDLKLKVFRGKSARKVLVQEVKSCGATSLIVGSSRKHHTIRSSASLAKYCARNLAKDV  150

Query  665  SVLAVNNGKVAFQSEPN  715
            SV AV +GK+ F+  PN
Sbjct  151  SVFAVKSGKIMFRRVPN  167



>gb|KFK28085.1| hypothetical protein AALP_AA8G470300 [Arabis alpina]
Length=699

 Score =   156 bits (394),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNL  484
            K D  S+E+LTW+LV VA+ GDRI+ALHVLD   + S  ++ LV++FD++L  YE FCNL
Sbjct  32   KPDEWSREVLTWSLVNVARPGDRIVALHVLDYALEGSTSLISLVRSFDTMLGVYESFCNL  91

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+V RG  ARK+L +E K+  AT LIVG+S   H +RS  S+AKYCARN+ K +
Sbjct  92   KQVDLKLKVFRGKSARKVLVQEVKSSGATSLIVGSSRRHHTIRSSASLAKYCARNLAKDV  151

Query  665  SVLAVNNGKVAFQSEPN  715
            SV AV +GK+ F+  PN
Sbjct  152  SVFAVKSGKIMFRRVPN  168



>ref|XP_010444316.1| PREDICTED: putative proline-rich receptor-like protein kinase 
PERK11 isoform X2 [Camelina sativa]
 ref|XP_010444317.1| PREDICTED: putative proline-rich receptor-like protein kinase 
PERK11 isoform X3 [Camelina sativa]
Length=713

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNL  484
            K D  S+E+LTW+LV VA+ GDRI+ALHVLD   + S  ++ LV++FD++L  YE FCNL
Sbjct  34   KPDEWSREVLTWSLVNVARPGDRIVALHVLDYSLEGSTSLISLVRSFDTMLGVYESFCNL  93

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+V RG  ARK+L +E K+  AT LIVG+S   H +RS  S+AKYCARN+ K +
Sbjct  94   KQVDLKLKVFRGKSARKVLVQEIKSCGATSLIVGSSRRHHTIRSSASLAKYCARNLSKDV  153

Query  665  SVLAVNNGKVAFQSEPN  715
            SV AV +GK+ F+  P+
Sbjct  154  SVFAVKSGKIMFRRVPS  170



>ref|XP_006829313.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Amborella trichopoda]
 gb|ERM96729.1| hypothetical protein AMTR_s00202p00019370 [Amborella trichopoda]
Length=753

 Score =   155 bits (391),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 100/138 (72%), Gaps = 5/138 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD----TDKSEMLRLVKTFDSVLAAYEGF  475
            K+DS S+ELLTWALVKVA+ GDR++ALHVL          S +L L K FDS+LA YEGF
Sbjct  17   KLDSHSRELLTWALVKVAEPGDRVVALHVLKNSEVRSNGTSSVLCLAKAFDSILAVYEGF  76

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLKQVDLK+++CRGS  RK++  EAK   AT  IVG +   +A+ S VS+AK+CA+ + 
Sbjct  77   CNLKQVDLKVKICRGSSIRKVMVEEAKCSGATSFIVGIT-RNNALSSSVSLAKFCAKKLS  135

Query  656  KSISVLAVNNGKVAFQSE  709
            +  SVLAVNNGKV FQ E
Sbjct  136  QECSVLAVNNGKVVFQRE  153



>ref|XP_010444315.1| PREDICTED: putative proline-rich receptor-like protein kinase 
PERK11 isoform X1 [Camelina sativa]
Length=713

 Score =   154 bits (390),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/137 (55%), Positives = 101/137 (74%), Gaps = 1/137 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNL  484
            K D  S+E+LTW+LV VA+ GDRI+ALHVLD   + S  ++ LV++FD++L  YE FCNL
Sbjct  34   KPDEWSREVLTWSLVNVARPGDRIVALHVLDYSLEGSTSLISLVRSFDTMLGVYESFCNL  93

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+V RG  ARK+L +E K+  AT LIVG+S   H +RS  S+AKYCARN+ K +
Sbjct  94   KQVDLKLKVFRGKSARKVLVQEIKSCGATSLIVGSSRRHHTIRSSASLAKYCARNLSKDV  153

Query  665  SVLAVNNGKVAFQSEPN  715
            SV AV +GK+ F+  P+
Sbjct  154  SVFAVKSGKIMFRRVPS  170



>ref|XP_009130425.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X1 [Brassica rapa]
Length=691

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = +2

Query  314  DSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNLKQ  490
            D RS+E+LTW+LV V + GDRIIALHVLD   + S  ++ LVKTFD++L  YE FCNLKQ
Sbjct  25   DERSREVLTWSLVNVTRPGDRIIALHVLDYSLEGSTSLISLVKTFDTMLGVYESFCNLKQ  84

Query  491  VDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSISV  670
            VDLKL+  RG  ARK+L +E K+  AT LIVG+S   H +RS  S+AKYCAR++ K +SV
Sbjct  85   VDLKLKFLRGKSARKVLVQEVKSCGATSLIVGSSKRHHTIRSSASLAKYCARSLAKDVSV  144

Query  671  LAVNNGKVAFQSEPN  715
             AV +GK+ F+  P+
Sbjct  145  FAVKSGKIMFRRVPS  159



>ref|XP_009130426.1| PREDICTED: proline-rich receptor-like protein kinase PERK13 isoform 
X2 [Brassica rapa]
Length=686

 Score =   154 bits (389),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = +2

Query  314  DSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNLKQ  490
            D RS+E+LTW+LV V + GDRIIALHVLD   + S  ++ LVKTFD++L  YE FCNLKQ
Sbjct  25   DERSREVLTWSLVNVTRPGDRIIALHVLDYSLEGSTSLISLVKTFDTMLGVYESFCNLKQ  84

Query  491  VDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSISV  670
            VDLKL+  RG  ARK+L +E K+  AT LIVG+S   H +RS  S+AKYCAR++ K +SV
Sbjct  85   VDLKLKFLRGKSARKVLVQEVKSCGATSLIVGSSKRHHTIRSSASLAKYCARSLAKDVSV  144

Query  671  LAVNNGKVAFQSEPN  715
             AV +GK+ F+  P+
Sbjct  145  FAVKSGKIMFRRVPS  159



>ref|XP_012092538.1| PREDICTED: proline-rich receptor-like protein kinase PERK14 isoform 
X2 [Jatropha curcas]
Length=699

 Score =   153 bits (387),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/134 (57%), Positives = 96/134 (72%), Gaps = 13/134 (10%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            K D+ S+ELLTWAL++VA+ G               + +L LVK FDS+LA YEGFCNLK
Sbjct  31   KFDAESRELLTWALMQVAKPGG-------------TASLLSLVKAFDSLLAVYEGFCNLK  77

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            QVDLK++VCRGS A+KIL REAK+  A  +IVGTS + H + S  SVAKYCARN+ KS+S
Sbjct  78   QVDLKIQVCRGSSAKKILVREAKSSSAAKVIVGTSKAHHKIHSSTSVAKYCARNLSKSLS  137

Query  668  VLAVNNGKVAFQSE  709
            V AV+NGK+ FQ E
Sbjct  138  VFAVSNGKIIFQRE  151



>ref|XP_010930690.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Elaeis guineensis]
Length=793

 Score =   153 bits (386),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 101/144 (70%), Gaps = 10/144 (7%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL--------DPDTDK-SEMLRLVKTFDSVLA  460
            KMD++S+ELLTWALVKVA  GDR++ALH+L        DPD +  S +L LVK FDSVLA
Sbjct  42   KMDAQSRELLTWALVKVASPGDRVLALHILGSPAADVSDPDGNSPSSLLSLVKAFDSVLA  101

Query  461  AYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVG-TSGSRHAVRSPVSVAKY  637
             YEGFCNLKQ+DLKL++CR S   K L RE  +  A+ LI+G T  +R    S  S+AKY
Sbjct  102  VYEGFCNLKQIDLKLKLCRASSIGKGLVREVNSCAASKLILGVTKNNRSFGSSSTSIAKY  161

Query  638  CARNVDKSISVLAVNNGKVAFQSE  709
            CA+ + +  SVLAVNNGK+ FQ E
Sbjct  162  CAKKLSRDCSVLAVNNGKIVFQRE  185



>ref|XP_010093102.1| Receptor-like cytosolic serine/threonine-protein kinase RBK2 
[Morus notabilis]
 gb|EXB53540.1| Receptor-like cytosolic serine/threonine-protein kinase RBK2 
[Morus notabilis]
Length=743

 Score =   151 bits (381),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 81/135 (60%), Positives = 99/135 (73%), Gaps = 1/135 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRL-VKTFDSVLAAYEGFCNL  484
            K+DSRSKELLTWALVKVA  G ++IALHVLD  T+ +  L   + TFDSVL+ YEGFCNL
Sbjct  36   KLDSRSKELLTWALVKVALPGHQVIALHVLDSSTESTSSLLSLINTFDSVLSVYEGFCNL  95

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQVDLKL+VCRG   RKIL REAK+Y +  L+VG S + H +RS  SVAK+CA  + +  
Sbjct  96   KQVDLKLKVCRGKSVRKILVREAKSYPSATLVVGVSKTNHRIRSSASVAKHCAAKLSRCF  155

Query  665  SVLAVNNGKVAFQSE  709
             V AV+N KV F+ E
Sbjct  156  GVFAVDNSKVVFKRE  170



>ref|XP_006416287.1| hypothetical protein EUTSA_v10006893mg [Eutrema salsugineum]
 gb|ESQ34640.1| hypothetical protein EUTSA_v10006893mg [Eutrema salsugineum]
Length=754

 Score =   150 bits (379),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 95/138 (69%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD----TDKSEMLRLVKTFDSVLAAYEGF  475
            K D+ S ELL WALVKVA+ GD +IALH+L  D       S ++ LVK FDSVL  YEGF
Sbjct  23   KFDATSSELLDWALVKVAEPGDTVIALHILSNDIVDRAGSSSLISLVKAFDSVLEVYEGF  82

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            C LKQVDLKL++ RGS  RK L REAK   A++++VG S S H + S VSVAKY AR + 
Sbjct  83   CKLKQVDLKLKLIRGSSTRKTLVREAKLCYASNVVVGISKSYHTIHSSVSVAKYLARKLS  142

Query  656  KSISVLAVNNGKVAFQSE  709
            K   VLAV+NGKV FQ +
Sbjct  143  KDCWVLAVDNGKVLFQKD  160



>ref|XP_008781626.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Phoenix dactylifera]
Length=804

 Score =   150 bits (380),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 99/145 (68%), Gaps = 10/145 (7%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDP---------DTDKSEMLRLVKTFDSVLA  460
            KMD+ S+ELLTWALVKVA  GDR++ALHVL           +   S +L LVK FDS+LA
Sbjct  50   KMDAESRELLTWALVKVASPGDRVLALHVLPSSAADVSHHNENSPSTLLSLVKAFDSMLA  109

Query  461  AYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVG-TSGSRHAVRSPVSVAKY  637
             YEGFCNLKQ+DLKL++ RGS  RK L RE  +  A+ LI+G T  +R    S  S+AKY
Sbjct  110  VYEGFCNLKQIDLKLKLSRGSSIRKDLVREVNSSAASKLILGITKNNRSFGSSSTSIAKY  169

Query  638  CARNVDKSISVLAVNNGKVAFQSEP  712
            CA+ + +  SVLAVNNGK+ F+ EP
Sbjct  170  CAKKLSRDCSVLAVNNGKIVFRREP  194



>emb|CDX84466.1| BnaC03g50340D [Brassica napus]
Length=701

 Score =   149 bits (375),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 100/140 (71%), Gaps = 4/140 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNL  484
            K D  S+E+LTW+LV VA+ GDRI+ALHVLD   + S  ++ LV+TFD++L  YE FCNL
Sbjct  29   KPDEWSREVLTWSLVNVARPGDRIVALHVLDYSLEGSTSLVSLVRTFDTMLGVYESFCNL  88

Query  485  KQ---VDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            KQ   VDLKL+V RG  ARK+L +E K+  A  LIVG+S   H +RS  S+AKYCARN+ 
Sbjct  89   KQACFVDLKLKVFRGKSARKVLVQEVKSSGAASLIVGSSKRHHTIRSSASLAKYCARNLA  148

Query  656  KSISVLAVNNGKVAFQSEPN  715
            K +SV AV +GK+ F+  P+
Sbjct  149  KDVSVFAVKSGKIMFRRVPS  168



>ref|XP_010498614.1| PREDICTED: probable receptor protein kinase TMK1 [Camelina sativa]
Length=744

 Score =   149 bits (375),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 95/138 (69%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD----TDKSEMLRLVKTFDSVLAAYEGF  475
            K D  S ELL WALVKVA+ GD +IALH+L  +     D S ++ LVK FDSVL  YEGF
Sbjct  20   KFDELSNELLDWALVKVAEPGDTVIALHILGNEIVDRADNSSLISLVKNFDSVLEVYEGF  79

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            C LKQV+LKL++ RGS +RKIL REAK   A+ ++VG S   H + S VSVAKY AR V 
Sbjct  80   CQLKQVELKLKLSRGSSSRKILVREAKLCSASKVVVGISKRYHTIHSSVSVAKYLARKVS  139

Query  656  KSISVLAVNNGKVAFQSE  709
            K+  VLAV+ GKV FQ +
Sbjct  140  KNCCVLAVDKGKVMFQKD  157



>ref|XP_008783316.1| PREDICTED: LOW QUALITY PROTEIN: serine/threonine-protein kinase 
STE20-like [Phoenix dactylifera]
Length=801

 Score =   148 bits (374),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 102/143 (71%), Gaps = 11/143 (8%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL--------DP--DTDKSEMLRLVKTFDSVL  457
            KMD++S+ELLTWALVKVA TGDR++ALHVL        +P  + +   ++ L K F+++L
Sbjct  61   KMDTQSRELLTWALVKVAATGDRVVALHVLTSRSSSTSEPQGEGEPPAVVSLAKGFEAML  120

Query  458  AAYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVR-SPVSVAK  634
              YEGFCNLKQ+DLKL++C+GS  RK+LAREA  + A+ LI+G +    A+  S +S+AK
Sbjct  121  TVYEGFCNLKQIDLKLKICKGSSVRKVLAREANEFAASKLILGVAKHSRAIGLSSLSIAK  180

Query  635  YCARNVDKSISVLAVNNGKVAFQ  703
            YCA+ +    SV AVNNGK+ FQ
Sbjct  181  YCAKKLHFDCSVFAVNNGKIVFQ  203



>ref|XP_009149675.1| PREDICTED: receptor like protein kinase S.2-like [Brassica rapa]
Length=747

 Score =   148 bits (373),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 98/138 (71%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD-TDK---SEMLRLVKTFDSVLAAYEGF  475
            K D+ S ELL WALVKVA+ GD +IALH+L  + TD+   S +L LVKT DSV   YEG 
Sbjct  17   KFDTSSSELLDWALVKVAEPGDTVIALHILTNEITDQAVNSSLLSLVKTLDSVREVYEGL  76

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            C LKQV+LKL++CRGS +RK+L REAK   A+ ++VG S S H + S VSVAKY AR + 
Sbjct  77   CKLKQVELKLKLCRGSSSRKVLVREAKLCNASKVVVGVSKSYHTIHSSVSVAKYLARKLS  136

Query  656  KSISVLAVNNGKVAFQSE  709
            K   V+AV+NGKV FQ +
Sbjct  137  KDCWVMAVDNGKVMFQKD  154



>gb|KEH40498.1| adenine nucleotide alpha hydrolase-like domain kinase [Medicago 
truncatula]
Length=701

 Score =   147 bits (371),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 94/135 (70%), Gaps = 7/135 (5%)
 Frame = +2

Query  314  DSRSKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAYEGFC  478
            +S S ELLTW+LV VAQ GD I+ALHVL  D       KS +  LVK FDSVL+ YEGFC
Sbjct  23   NSHSTELLTWSLVNVAQPGDLILALHVLRNDEIVNRDGKSSLFSLVKAFDSVLSGYEGFC  82

Query  479  NLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDK  658
            NLKQVDLKL++CRGS  R+IL REA  Y AT +IVG   S+  +R  +S+ +YCA+ + K
Sbjct  83   NLKQVDLKLKICRGSSVRRILVREANEYCATHVIVGK--SQGLIRPTISLPRYCAKKLSK  140

Query  659  SISVLAVNNGKVAFQ  703
               V AV+NGKV F+
Sbjct  141  DCWVFAVDNGKVVFK  155



>emb|CDY08194.1| BnaA06g15320D [Brassica napus]
Length=750

 Score =   147 bits (372),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 97/138 (70%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD-TDK---SEMLRLVKTFDSVLAAYEGF  475
            K D+ S ELL WALVKVA+ GD IIALH+L  + TD+   S  L LVKT DSV   YEG 
Sbjct  20   KFDTSSSELLDWALVKVAEPGDTIIALHILTNEITDQAVNSTFLSLVKTLDSVREVYEGL  79

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            C LKQV+LKL++CRGS +RK+L REAK   A+ ++VG S S H + S VSVAKY AR + 
Sbjct  80   CKLKQVELKLKLCRGSSSRKVLVREAKLCNASKVVVGVSKSYHTIHSSVSVAKYLARKLS  139

Query  656  KSISVLAVNNGKVAFQSE  709
            K   V+AV+NGKV FQ +
Sbjct  140  KDCWVMAVDNGKVMFQKD  157



>emb|CDY04652.1| BnaC05g16900D [Brassica napus]
Length=738

 Score =   147 bits (371),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 78/138 (57%), Positives = 98/138 (71%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD-TDK---SEMLRLVKTFDSVLAAYEGF  475
            K+D+ S ELL WALVKVA+ GD +IALH+L  + TD+   S  L LVKT DSV   YEG 
Sbjct  20   KLDASSSELLDWALVKVAEPGDTVIALHILTNEITDQAGNSSFLSLVKTLDSVREVYEGL  79

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            C LKQV+LKL++CRGS +RK+L REAK   A+ ++VG S S H + S VSVAKY AR + 
Sbjct  80   CKLKQVELKLKLCRGSSSRKVLVREAKLCNASKVVVGVSKSYHTIHSSVSVAKYLARKLA  139

Query  656  KSISVLAVNNGKVAFQSE  709
            K   V+AV+NGKV FQ +
Sbjct  140  KDCWVMAVDNGKVMFQKD  157



>ref|XP_009406141.1| PREDICTED: putative receptor protein kinase CRINKLY4 isoform 
X2 [Musa acuminata subsp. malaccensis]
Length=706

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 98/143 (69%), Gaps = 9/143 (6%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL--------DPDTDKSEMLRLVKTFDSVLAA  463
            KMD+ S+ELLTW+LVK+A  GDR+ ALHVL        D     S +L +VK F+++LA 
Sbjct  30   KMDADSRELLTWSLVKIADAGDRVFALHVLPSTPYDSSDASLGCSSLLSIVKAFEAMLAV  89

Query  464  YEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAV-RSPVSVAKYC  640
            YEGFCNLKQVDLK+++ RGS  RK+L  EA  Y A+ L+VG + + H +  S  S+AKYC
Sbjct  90   YEGFCNLKQVDLKMKIARGSSIRKVLVSEAIAYGASSLVVGVAKNSHGIGYSSTSIAKYC  149

Query  641  ARNVDKSISVLAVNNGKVAFQSE  709
            ARN+ +  SV AV+NGK  F+ E
Sbjct  150  ARNLPRVCSVFAVSNGKTLFKRE  172



>ref|XP_009406140.1| PREDICTED: probable serine/threonine-protein kinase roco5 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=738

 Score =   147 bits (370),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 98/143 (69%), Gaps = 9/143 (6%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL--------DPDTDKSEMLRLVKTFDSVLAA  463
            KMD+ S+ELLTW+LVK+A  GDR+ ALHVL        D     S +L +VK F+++LA 
Sbjct  30   KMDADSRELLTWSLVKIADAGDRVFALHVLPSTPYDSSDASLGCSSLLSIVKAFEAMLAV  89

Query  464  YEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAV-RSPVSVAKYC  640
            YEGFCNLKQVDLK+++ RGS  RK+L  EA  Y A+ L+VG + + H +  S  S+AKYC
Sbjct  90   YEGFCNLKQVDLKMKIARGSSIRKVLVSEAIAYGASSLVVGVAKNSHGIGYSSTSIAKYC  149

Query  641  ARNVDKSISVLAVNNGKVAFQSE  709
            ARN+ +  SV AV+NGK  F+ E
Sbjct  150  ARNLPRVCSVFAVSNGKTLFKRE  172



>ref|XP_006303211.1| hypothetical protein CARUB_v10011454mg [Capsella rubella]
 gb|EOA36109.1| hypothetical protein CARUB_v10011454mg [Capsella rubella]
Length=752

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 94/138 (68%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD----TDKSEMLRLVKTFDSVLAAYEGF  475
            K D  S ELL WALVKVA+ GD +IALH+L  +     D S ++ L+K FDSVL  YEGF
Sbjct  20   KFDESSHELLDWALVKVAEPGDTVIALHILGNEIVDRADNSSLISLIKNFDSVLEVYEGF  79

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            C LKQV LKL++ RGS +RKIL REAK   A+ ++VG S   H + S VSVAK+ AR V 
Sbjct  80   CKLKQVQLKLKLTRGSSSRKILLREAKLCSASKVVVGISRRYHTIHSSVSVAKFLARKVP  139

Query  656  KSISVLAVNNGKVAFQSE  709
            K   VLA++NGKV FQ +
Sbjct  140  KDCCVLAIDNGKVMFQKD  157



>ref|XP_004498354.1| PREDICTED: uncharacterized protein LOC101490391 [Cicer arietinum]
Length=728

 Score =   146 bits (369),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 97/139 (70%), Gaps = 7/139 (5%)
 Frame = +2

Query  308  KMDSR--SKELLTWALVKVAQTGDRIIALHVLDPDT-----DKSEMLRLVKTFDSVLAAY  466
            KM+S   S +LLTW+LV VA+ GD ++ALHVL  D       KS +  LVK FDSVL+AY
Sbjct  16   KMESHTHSIQLLTWSLVNVARPGDLLLALHVLRNDEIVNRDGKSSLFSLVKAFDSVLSAY  75

Query  467  EGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCAR  646
            EGFCNLKQVDLKL++CRGS  R+IL REA  Y A+ +IVG       +R  +S+A+YCA+
Sbjct  76   EGFCNLKQVDLKLKICRGSSVRRILVREANEYCASHVIVGKPQGLSKIRPSISIARYCAK  135

Query  647  NVDKSISVLAVNNGKVAFQ  703
             + K   VLAV+NGKV F+
Sbjct  136  KLSKDCCVLAVDNGKVVFK  154



>ref|XP_010459867.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Camelina sativa]
Length=752

 Score =   146 bits (368),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 93/136 (68%), Gaps = 4/136 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD----TDKSEMLRLVKTFDSVLAAYEGF  475
            K D  S ELL WALVKVA+ GD +IALH+L  +     D S ++ +VK FDS L  YEGF
Sbjct  20   KFDESSNELLDWALVKVAEPGDTVIALHILGNEIVDRADNSSLISIVKNFDSFLEVYEGF  79

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            C LKQV+LKL++ RGS +RKIL REAK   A+ ++VG S   H + S VSVAKY AR V 
Sbjct  80   CTLKQVELKLKLSRGSSSRKILVREAKLCSASKVVVGISKRYHTIHSSVSVAKYLARKVS  139

Query  656  KSISVLAVNNGKVAFQ  703
            K+  VLAV+ GKV FQ
Sbjct  140  KNCCVLAVDKGKVMFQ  155



>ref|XP_002893177.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69436.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=757

 Score =   144 bits (364),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 93/139 (67%), Gaps = 5/139 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD----TDKSEMLRLVKTFDSVLAAYEGF  475
            K D  S ELL WALVKVA+ GD +IALHVL  +     D S ++ LVK FDSVL  YEG 
Sbjct  19   KFDESSNELLDWALVKVAEPGDTVIALHVLGNEIVDRADNSSLISLVKNFDSVLQVYEGL  78

Query  476  CNLKQVDLKLRVCRGSPA-RKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNV  652
            C LKQV+LKL++ RGS   RKIL REAK   A+ L+VG S   H + S VSVAKY AR V
Sbjct  79   CKLKQVELKLKLSRGSSTTRKILVREAKLCSASKLVVGISRRFHTIHSSVSVAKYLARKV  138

Query  653  DKSISVLAVNNGKVAFQSE  709
             K   VLAV+NGKV FQ +
Sbjct  139  SKDCLVLAVDNGKVMFQKD  157



>ref|XP_010911250.1| PREDICTED: proline-rich receptor-like protein kinase PERK9 [Elaeis 
guineensis]
 ref|XP_010911254.1| PREDICTED: proline-rich receptor-like protein kinase PERK9 [Elaeis 
guineensis]
Length=736

 Score =   143 bits (361),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/144 (50%), Positives = 100/144 (69%), Gaps = 11/144 (8%)
 Frame = +2

Query  311  MDSRSKELLTWALVKVAQTGDRIIALHVL----------DPDTDKSEMLRLVKTFDSVLA  460
            MD++S+ELLTWALVKVA  GDR++ALHVL          + + + + ++ L K FD ++A
Sbjct  1    MDAQSRELLTWALVKVAAPGDRVVALHVLTSRSSSTSNPEGEGEPTAVVSLAKDFDDMVA  60

Query  461  AYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSG-SRHAVRSPVSVAKY  637
             YEGFCNLKQ+DLKL++C+GS  RK+LARE   + A+ LI+G +  SR    S  S+AKY
Sbjct  61   VYEGFCNLKQIDLKLKICKGSSVRKVLAREVNEFAASKLILGVAKRSRTIGLSSFSIAKY  120

Query  638  CARNVDKSISVLAVNNGKVAFQSE  709
            CA+ +  +  VLAVNNGK+ FQ +
Sbjct  121  CAKKLHFNCLVLAVNNGKIVFQKQ  144



>emb|CDX96584.1| BnaA08g21270D [Brassica napus]
Length=531

 Score =   140 bits (353),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 94/134 (70%), Gaps = 3/134 (2%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            K D+ S ELL WALVKVA+ GD +IALH+L    D S  + LVKTFDSVL AYE FC LK
Sbjct  21   KFDAASSELLDWALVKVAEPGDTVIALHILTNAGD-SSFVSLVKTFDSVLEAYEDFCKLK  79

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            QV+LKL++CRGSP RK+L REAK    + ++VG   S+    S +SVAKY A+ + K   
Sbjct  80   QVELKLKLCRGSPTRKVLVREAKLCYGSKVVVGV--SKTCSHSSLSVAKYLAKKLPKDSW  137

Query  668  VLAVNNGKVAFQSE  709
            V+AV+NGKV FQ +
Sbjct  138  VMAVDNGKVMFQKD  151



>ref|XP_009410684.1| PREDICTED: serine/threonine-protein kinase PAK 6 [Musa acuminata 
subsp. malaccensis]
Length=753

 Score =   139 bits (350),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 99/147 (67%), Gaps = 13/147 (9%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL------------DPDTDKSEMLRLVKTFDS  451
            +MDS+S+ELLTWALVK A +GD ++ALHVL            DP      +  + K  D+
Sbjct  47   RMDSQSRELLTWALVKAAASGDLVVALHVLSSSGGGSAAAAKDPGGQPVAVFSVAKELDA  106

Query  452  VLAAYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVG-TSGSRHAVRSPVSV  628
            +LA YEGFCNLKQ+DLKL++C+GS  RK+L +EAK + A+ LI+G T  SR    S VS+
Sbjct  107  MLAVYEGFCNLKQIDLKLKICKGSSIRKVLVKEAKAFAASLLILGVTKNSRAIGSSWVSI  166

Query  629  AKYCARNVDKSISVLAVNNGKVAFQSE  709
            AK+CA+ +    SV+A+++GK+ FQ E
Sbjct  167  AKHCAKKLPNDCSVVALSDGKIVFQRE  193



>ref|XP_009110180.1| PREDICTED: proline-rich receptor-like protein kinase PERK15 [Brassica 
rapa]
Length=710

 Score =   138 bits (348),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 93/134 (69%), Gaps = 4/134 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            K D+ S ELL WALVKVA+ GD +IALH+L      S  + LVKTFDSVL AYE FC LK
Sbjct  21   KFDAASSELLDWALVKVAEPGDTVIALHILT--NGDSSSVSLVKTFDSVLEAYEDFCKLK  78

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            QV+LKL++CRGSP RK+L REAK    + ++VG   S+    S +SVAKY A+ + K   
Sbjct  79   QVELKLKLCRGSPTRKVLVREAKLCYGSKVVVGV--SKTCSHSSLSVAKYLAKKLPKDSW  136

Query  668  VLAVNNGKVAFQSE  709
            V+AV+NGKV FQ +
Sbjct  137  VMAVDNGKVMFQKD  150



>ref|XP_009404967.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Musa acuminata subsp. malaccensis]
Length=788

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/146 (47%), Positives = 96/146 (66%), Gaps = 14/146 (10%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL-------------DPDTDKSEMLRLVKTFD  448
            +MDS+S+ELLTWALVK    GDR++ALHVL             DP    + +  L K  D
Sbjct  50   RMDSQSRELLTWALVKATAPGDRVLALHVLSSSSSAGGPPPAVDPGGQPAAVFSLAKELD  109

Query  449  SVLAAYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVG-TSGSRHAVRSPVS  625
            ++LA YEGFCNLKQ+DLKL++C+GS  RK+L  E K++ A+ LI+G T  +R      +S
Sbjct  110  AMLAVYEGFCNLKQIDLKLKICKGSSIRKLLVSETKSFAASQLILGVTKNNRTMGSYSIS  169

Query  626  VAKYCARNVDKSISVLAVNNGKVAFQ  703
            VAKYCA+ +    SV+A+++GK+ FQ
Sbjct  170  VAKYCAKKLPSYCSVVALSDGKIVFQ  195



>emb|CAN81737.1| hypothetical protein VITISV_043580 [Vitis vinifera]
Length=738

 Score =   133 bits (335),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 87/133 (65%), Gaps = 18/133 (14%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            K+D RSKELLTWALV   Q G              KS +L L  TF ++LAAYEGFCNLK
Sbjct  59   KLDQRSKELLTWALV---QGG--------------KSSLLSLFDTFKTLLAAYEGFCNLK  101

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAV-RSPVSVAKYCARNVDKSI  664
            QV+LKL+VCRGS   KIL REAK++    +IVG S + H + R P  VAKYCAR +  + 
Sbjct  102  QVELKLKVCRGSSVPKILVREAKSHANVKVIVGISRTNHTIWRXPAWVAKYCARKLSSNF  161

Query  665  SVLAVNNGKVAFQ  703
            SV AV+NGK+ FQ
Sbjct  162  SVFAVDNGKIVFQ  174



>emb|CDY38812.1| BnaC08g19860D [Brassica napus]
Length=704

 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/134 (56%), Positives = 91/134 (68%), Gaps = 3/134 (2%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            K D+ S ELL WALVKVA+ GD +IALH+L    D S  + LVKTFDSVL AYE FC LK
Sbjct  18   KFDAASSELLDWALVKVAEPGDTVIALHILTNAGDSSS-VSLVKTFDSVLEAYEDFCKLK  76

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            QV+LKL++CRGS  RKIL +EAK    + ++VG S S        SVAKY AR + K   
Sbjct  77   QVELKLKLCRGSSTRKILVKEAKLCYGSKVVVGVSRSCSHSSL--SVAKYLARKLSKDCW  134

Query  668  VLAVNNGKVAFQSE  709
            V+AV+NGKV FQ +
Sbjct  135  VMAVDNGKVMFQKD  148



>ref|XP_010905327.1| PREDICTED: uncharacterized protein LOC105032560 [Elaeis guineensis]
Length=802

 Score =   131 bits (330),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 68/145 (47%), Positives = 97/145 (67%), Gaps = 12/145 (8%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL--------DPDTDKSEM--LRLVKTFDSVL  457
            K +++S+ELLTWALVKVA  GDR++A+HVL        DP+ +      + L K  D++L
Sbjct  61   KTEAQSRELLTWALVKVAAPGDRVVAIHVLTSRSSSSSDPEGEGEPAAPVSLAKALDAML  120

Query  458  AAYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVR-SPVSVAK  634
            A Y GFCNLKQ+DLKL++C+G+  RK+LARE   + A+ LI+G +     +R S  S+AK
Sbjct  121  AVYRGFCNLKQIDLKLKICKGAAVRKVLAREVSEFAASKLILGVAKHGRTIRLSSFSIAK  180

Query  635  YCARNVDKSISVLAVNNGKVAFQSE  709
            YCA+ +    SV AV+NGK+ FQ +
Sbjct  181  YCAKKL-PFCSVFAVSNGKIVFQRQ  204



>gb|AAF87904.1|AC015447_14 Similar to protein kinases [Arabidopsis thaliana]
Length=705

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 94/138 (68%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD----TDKSEMLRLVKTFDSVLAAYEGF  475
            K D  S ELL WALVKVA+ GD +IALHVL  +     D S ++ +VK FDSVL  YEGF
Sbjct  19   KFDESSNELLDWALVKVAEPGDTVIALHVLGNEIVDRADNSSLVSIVKNFDSVLEVYEGF  78

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            C LKQ++LKL++ RGS  RKIL +EAK   A+ ++VG S   H + S VSVAKY AR V 
Sbjct  79   CKLKQLELKLKLSRGSSTRKILVKEAKMCSASKVVVGISRRFHTIHSSVSVAKYLARKVA  138

Query  656  KSISVLAVNNGKVAFQSE  709
            K   VLAV+NGKV FQ +
Sbjct  139  KDCWVLAVDNGKVMFQKD  156



>emb|CDY31344.1| BnaA02g33970D [Brassica napus]
Length=677

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 92/135 (68%), Gaps = 11/135 (8%)
 Frame = +2

Query  314  DSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNLKQ  490
            D RS+E+LTW+LV VA+ GDRIIALHVLD   + S  ++ LVKTFD++L           
Sbjct  26   DERSREVLTWSLVNVARPGDRIIALHVLDYSLEGSTSLISLVKTFDTMLG----------  75

Query  491  VDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSISV  670
            VDLKL+  RG  ARK+L +E K+  AT LIVG+S   H +RS  S+AKYCAR++ K +SV
Sbjct  76   VDLKLKFLRGKSARKVLVQEVKSCGATSLIVGSSKRHHTIRSSASLAKYCARSLAKDVSV  135

Query  671  LAVNNGKVAFQSEPN  715
             AV +GK+ F+  P+
Sbjct  136  FAVKSGKIMFRRVPS  150



>ref|NP_173578.2| putative protein kinase [Arabidopsis thaliana]
 gb|AAL57632.1| At1g21590/F24J8_9 [Arabidopsis thaliana]
 gb|AAM98263.1| At1g21590/F24J8_9 [Arabidopsis thaliana]
 gb|AEE30121.1| adenine nucleotide alpha hydrolases-domain containing protein 
kinase [Arabidopsis thaliana]
Length=756

 Score =   129 bits (323),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 94/138 (68%), Gaps = 4/138 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPD----TDKSEMLRLVKTFDSVLAAYEGF  475
            K D  S ELL WALVKVA+ GD +IALHVL  +     D S ++ +VK FDSVL  YEGF
Sbjct  19   KFDESSNELLDWALVKVAEPGDTVIALHVLGNEIVDRADNSSLVSIVKNFDSVLEVYEGF  78

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            C LKQ++LKL++ RGS  RKIL +EAK   A+ ++VG S   H + S VSVAKY AR V 
Sbjct  79   CKLKQLELKLKLSRGSSTRKILVKEAKMCSASKVVVGISRRFHTIHSSVSVAKYLARKVA  138

Query  656  KSISVLAVNNGKVAFQSE  709
            K   VLAV+NGKV FQ +
Sbjct  139  KDCWVLAVDNGKVMFQKD  156



>emb|CDY39836.1| BnaC02g42820D [Brassica napus]
Length=679

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 89/131 (68%), Gaps = 11/131 (8%)
 Frame = +2

Query  314  DSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS-EMLRLVKTFDSVLAAYEGFCNLKQ  490
            D  S+E+LTW+LV VA+ GDRIIALHVLD   + S  ++ LVKTFD++L           
Sbjct  29   DEWSREVLTWSLVNVARPGDRIIALHVLDYSLEGSTSLISLVKTFDTMLG----------  78

Query  491  VDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSISV  670
            VDLKL+  RG  ARK+L +E K+  AT LIVG+S   H +RS  S+AKYCARN+ K +SV
Sbjct  79   VDLKLKFLRGKSARKVLVQEVKSCGATSLIVGSSKRHHTIRSSASLAKYCARNLAKDVSV  138

Query  671  LAVNNGKVAFQ  703
             AV +GK+ F+
Sbjct  139  FAVKSGKIMFR  149



>ref|XP_010237868.1| PREDICTED: putative L-type lectin-domain containing receptor 
kinase V.2 isoform X2 [Brachypodium distachyon]
Length=742

 Score =   127 bits (318),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 89/138 (64%), Gaps = 6/138 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTD-----KSEMLRLVKTFDSVLAAYEG  472
            + D+ S+ELLTWALVKVA  GDR++ALHV             E      +  +VLA Y+G
Sbjct  55   RRDAASRELLTWALVKVANAGDRVVALHVAAGGGGGGGAGSEEKGEAADSLATVLAVYDG  114

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTS-GSRHAVRSPVSVAKYCARN  649
            FCNLKQ++L+L+VCRGS  RK L +EA +  A  LI+G +  SR    S  SVAKYCAR 
Sbjct  115  FCNLKQINLELKVCRGSSIRKTLVKEAASCGAAHLILGVAKNSRPFGSSSPSVAKYCARR  174

Query  650  VDKSISVLAVNNGKVAFQ  703
            V  S SVLAVNNGK+ +Q
Sbjct  175  VPTSCSVLAVNNGKIIYQ  192



>ref|XP_010237867.1| PREDICTED: putative L-type lectin-domain containing receptor 
kinase V.2 isoform X1 [Brachypodium distachyon]
Length=741

 Score =   127 bits (318),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 89/138 (64%), Gaps = 6/138 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTD-----KSEMLRLVKTFDSVLAAYEG  472
            + D+ S+ELLTWALVKVA  GDR++ALHV             E      +  +VLA Y+G
Sbjct  55   RRDAASRELLTWALVKVANAGDRVVALHVAAGGGGGGGAGSEEKGEAADSLATVLAVYDG  114

Query  473  FCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTS-GSRHAVRSPVSVAKYCARN  649
            FCNLKQ++L+L+VCRGS  RK L +EA +  A  LI+G +  SR    S  SVAKYCAR 
Sbjct  115  FCNLKQINLELKVCRGSSIRKTLVKEAASCGAAHLILGVAKNSRPFGSSSPSVAKYCARR  174

Query  650  VDKSISVLAVNNGKVAFQ  703
            V  S SVLAVNNGK+ +Q
Sbjct  175  VPTSCSVLAVNNGKIIYQ  192



>gb|AFW67031.1| putative protein kinase superfamily protein, partial [Zea mays]
Length=421

 Score =   120 bits (300),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 87/134 (65%), Gaps = 6/134 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            + D+ S+ LLTW LV VA   DR++A+HV  P   ++        FD++LA YEGFCNLK
Sbjct  60   RADAESRALLTWVLVNVAAPLDRVVAVHVAPPSAAEA------VDFDAMLAVYEGFCNLK  113

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            Q++L L++C+ S  RK L REA  + A  +++G +  R A+ S  SVAKYCA+ +    +
Sbjct  114  QINLNLKICKDSSVRKALVREASLFGAAKVVLGVAKKRRAISSSHSVAKYCAKKLPAKCA  173

Query  668  VLAVNNGKVAFQSE  709
            VLAV+NGK+ F+ E
Sbjct  174  VLAVSNGKIEFRRE  187



>gb|EMT19880.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=842

 Score =   122 bits (307),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 86/141 (61%), Gaps = 13/141 (9%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHV--------LDPDTDKSEMLRLVKTFDSVLAA  463
            + D+  +ELLTWAL K A  GDR++ALHV          PD    E  R   +  SVL A
Sbjct  32   RRDAAGRELLTWALAKAASAGDRVVALHVTTAGAADGFGPD----ERSRAADSLASVLGA  87

Query  464  YEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVG-TSGSRHAVRSPVSVAKYC  640
            Y+GFCNL Q++L+LRVC GS  ++ L  EA +Y A  LI+G T  SRH   S   VAKYC
Sbjct  88   YDGFCNLSQINLELRVCHGSSVKRALVNEAISYGAAQLILGITKNSRHLGLSATVVAKYC  147

Query  641  ARNVDKSISVLAVNNGKVAFQ  703
            A+ V +S +VLAV+NG V + 
Sbjct  148  AKRVPQSCTVLAVSNGAVVYH  168



>gb|EMT07237.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=1398

 Score =   122 bits (305),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 87/136 (64%), Gaps = 3/136 (2%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            + D+ S+ LLTWA V     GDR++A+HV+      +        FD +LA YEGFCNLK
Sbjct  32   RADAESRALLTWAFVNAVAAGDRVVAVHVV---LASAAEAAAAVDFDGMLAVYEGFCNLK  88

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            Q++LK+++C+GS  RK L REA  + A+ L++G +  +  + S +SVAKYCA+ +    +
Sbjct  89   QINLKVKICKGSSVRKALVREATLFGASKLVLGITKRKRTIGSSLSVAKYCAKKLPAKCA  148

Query  668  VLAVNNGKVAFQSEPN  715
            VLAVN GK+ ++ E N
Sbjct  149  VLAVNGGKIVYRRESN  164



>dbj|BAJ97602.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=733

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 71/136 (52%), Positives = 90/136 (66%), Gaps = 4/136 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDS---VLAAYEGFC  478
            + D+ S+ELLTWALVKVA  GDR++ALHV       + +    K  DS   VLA Y+GFC
Sbjct  44   RWDAASRELLTWALVKVANAGDRVVALHVAAGGGGGAGLEERRKAADSLASVLAVYDGFC  103

Query  479  NLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTS-GSRHAVRSPVSVAKYCARNVD  655
            NLKQ++L+L+VC GS  RK L +EA +  A  LI+G +  SR    S  SVAKYCA+ V 
Sbjct  104  NLKQINLELKVCGGSSIRKTLVKEAASCGAAHLILGVAKNSRSFGSSSTSVAKYCAKRVP  163

Query  656  KSISVLAVNNGKVAFQ  703
             S SVLAVNNGK+ +Q
Sbjct  164  TSCSVLAVNNGKIIYQ  179



>dbj|BAK04018.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=928

 Score =   120 bits (301),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/136 (42%), Positives = 87/136 (64%), Gaps = 3/136 (2%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            + D+ S+ LLTWA V     GDR++A+HV+      +        FD +LA YEGFCNLK
Sbjct  61   RADAESRALLTWAFVNAVAAGDRVVAVHVV---LASAAEAAAAVDFDGMLAVYEGFCNLK  117

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            Q++LK+++C+G+  RK L REA  + A+ L++G +  +  + S +SVAKYCA+ +    +
Sbjct  118  QINLKVKICKGASVRKALVREATLFGASKLVLGITKRKRTIGSSLSVAKYCAKKLPAKCA  177

Query  668  VLAVNNGKVAFQSEPN  715
            VLAVN GK+ ++ E N
Sbjct  178  VLAVNGGKIVYRRESN  193



>ref|XP_008644345.1| PREDICTED: uncharacterized protein LOC103625730 [Zea mays]
 gb|AFW67032.1| putative protein kinase superfamily protein [Zea mays]
Length=914

 Score =   120 bits (300),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 87/134 (65%), Gaps = 6/134 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            + D+ S+ LLTW LV VA   DR++A+HV  P   ++        FD++LA YEGFCNLK
Sbjct  60   RADAESRALLTWVLVNVAAPLDRVVAVHVAPPSAAEA------VDFDAMLAVYEGFCNLK  113

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            Q++L L++C+ S  RK L REA  + A  +++G +  R A+ S  SVAKYCA+ +    +
Sbjct  114  QINLNLKICKDSSVRKALVREASLFGAAKVVLGVAKKRRAISSSHSVAKYCAKKLPAKCA  173

Query  668  VLAVNNGKVAFQSE  709
            VLAV+NGK+ F+ E
Sbjct  174  VLAVSNGKIEFRRE  187



>gb|EAY92512.1| hypothetical protein OsI_14251 [Oryza sativa Indica Group]
Length=921

 Score =   120 bits (300),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 88/136 (65%), Gaps = 1/136 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            + D+ S+ LLTW  + VA  GDRI+A+HV+   +           FD++LA YEGFCNLK
Sbjct  50   RADAASRTLLTWTFINVAAPGDRIVAVHVV-LASAPVAAATTAVDFDTMLAVYEGFCNLK  108

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            Q++LKL++C+ S  RK L REA  + A+ +IVG +  +  + S  SVAKYC++ +    +
Sbjct  109  QINLKLKICKDSSVRKALVREANLFGASKVIVGIAKKKRGISSLHSVAKYCSKKLPAKCA  168

Query  668  VLAVNNGKVAFQSEPN  715
            VLAV++GK+ F+ E N
Sbjct  169  VLAVDSGKIVFRRESN  184



>ref|NP_001051845.1| Os03g0839900 [Oryza sativa Japonica Group]
 gb|AAT77004.1| putative protein kinase [Oryza sativa Japonica Group]
 gb|ABF99799.1| Protein kinase domain containing protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13759.1| Os03g0839900 [Oryza sativa Japonica Group]
Length=938

 Score =   120 bits (300),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 88/136 (65%), Gaps = 1/136 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            + D+ S+ LLTW  + VA  GDRI+A+HV+   +           FD++LA YEGFCNLK
Sbjct  67   RADAASRTLLTWTFINVAAPGDRIVAVHVV-LASAPVAAATTAVDFDTMLAVYEGFCNLK  125

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            Q++LKL++C+ S  RK L REA  + A+ +IVG +  +  + S  SVAKYC++ +    +
Sbjct  126  QINLKLKICKDSSVRKALVREANLFGASKVIVGIAKKKRGISSLHSVAKYCSKKLPAKCA  185

Query  668  VLAVNNGKVAFQSEPN  715
            VLAV++GK+ F+ E N
Sbjct  186  VLAVDSGKIVFRRESN  201



>gb|AAO41118.1| putative serine/threonine kinase [Oryza sativa Japonica Group]
 gb|EAZ29240.1| hypothetical protein OsJ_13303 [Oryza sativa Japonica Group]
Length=921

 Score =   120 bits (300),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 88/136 (65%), Gaps = 1/136 (1%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            + D+ S+ LLTW  + VA  GDRI+A+HV+   +           FD++LA YEGFCNLK
Sbjct  50   RADAASRTLLTWTFINVAAPGDRIVAVHVV-LASAPVAAATTAVDFDTMLAVYEGFCNLK  108

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            Q++LKL++C+ S  RK L REA  + A+ +IVG +  +  + S  SVAKYC++ +    +
Sbjct  109  QINLKLKICKDSSVRKALVREANLFGASKVIVGIAKKKRGISSLHSVAKYCSKKLPAKCA  168

Query  668  VLAVNNGKVAFQSEPN  715
            VLAV++GK+ F+ E N
Sbjct  169  VLAVDSGKIVFRRESN  184



>tpg|DAA52403.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=676

 Score =   119 bits (297),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 87/134 (65%), Gaps = 6/134 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            + D+ S+ LLTW LV VA   DR++A+HV  P   ++        FD++LA Y+GFCNLK
Sbjct  59   RADAESRALLTWVLVNVAAPLDRVVAVHVALPSAAEA------PDFDAMLAVYQGFCNLK  112

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            Q++LKL++C+ S  RK L REA    A  +++G +  R A+ S  SVAKYCA+ +    +
Sbjct  113  QINLKLKICKDSSVRKALVREASLLGAAKVVLGVAKKRRAISSSHSVAKYCAKKLPAKCA  172

Query  668  VLAVNNGKVAFQSE  709
            VLAV+NGK+ F+ E
Sbjct  173  VLAVSNGKIEFRRE  186



>ref|XP_009413128.1| PREDICTED: proline-rich receptor-like protein kinase PERK5 isoform 
X1 [Musa acuminata subsp. malaccensis]
Length=621

 Score =   118 bits (296),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 62/133 (47%), Positives = 89/133 (67%), Gaps = 2/133 (2%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL-DPDTDKSEMLRLVKTFDSVLAAYEGFCNL  484
            +M++  +ELL WA+ +VA+ GDR++A+HV  D D   +  L L++  D  LAAYEGFCNL
Sbjct  16   QMNANGRELLDWAISRVAEEGDRVVAVHVCRDSDLKTTTTLSLIEMLDDHLAAYEGFCNL  75

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQV L  RV RG+  RKIL +EAK   A  ++VG +   +++    S+AKYCA+ +  + 
Sbjct  76   KQVALVGRVSRGNSIRKILVKEAKHRDAFKVVVGAN-KYYSLGGSASLAKYCAKKLPPTT  134

Query  665  SVLAVNNGKVAFQ  703
            SV+AV NGKV F+
Sbjct  135  SVIAVQNGKVLFE  147



>ref|XP_006652004.1| PREDICTED: serine/threonine-protein kinase pakF-like [Oryza brachyantha]
Length=890

 Score =   119 bits (298),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/136 (43%), Positives = 88/136 (65%), Gaps = 3/136 (2%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            + D+ S+ LLTW  + VA  GDRI+A+HV+      +        FD++LA YEGFCNLK
Sbjct  16   QADAASRTLLTWTFINVAAPGDRIVAVHVV---LASAPGAATAVDFDTMLAVYEGFCNLK  72

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            Q++LKL++C+ S  RK L REA  + A+ +IVG +  +  + S  SVAKYC++ +    +
Sbjct  73   QINLKLKICKDSSVRKALVREANLFGASKVIVGIAKKKRGISSVHSVAKYCSKKLPAKCA  132

Query  668  VLAVNNGKVAFQSEPN  715
            VLAV++GK+ F+ E N
Sbjct  133  VLAVDSGKIVFRRESN  148



>ref|XP_008665759.1| PREDICTED: uncharacterized protein LOC100191422 isoform X1 [Zea 
mays]
Length=884

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 87/134 (65%), Gaps = 6/134 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            + D+ S+ LLTW LV VA   DR++A+HV  P   ++        FD++LA Y+GFCNLK
Sbjct  59   RADAESRALLTWVLVNVAAPLDRVVAVHVALPSAAEA------PDFDAMLAVYQGFCNLK  112

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            Q++LKL++C+ S  RK L REA    A  +++G +  R A+ S  SVAKYCA+ +    +
Sbjct  113  QINLKLKICKDSSVRKALVREASLLGAAKVVLGVAKKRRAISSSHSVAKYCAKKLPAKCA  172

Query  668  VLAVNNGKVAFQSE  709
            VLAV+NGK+ F+ E
Sbjct  173  VLAVSNGKIEFRRE  186



>tpg|DAA52404.1| TPA: putative protein kinase superfamily protein [Zea mays]
Length=917

 Score =   119 bits (297),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/134 (45%), Positives = 87/134 (65%), Gaps = 6/134 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            + D+ S+ LLTW LV VA   DR++A+HV  P   ++        FD++LA Y+GFCNLK
Sbjct  59   RADAESRALLTWVLVNVAAPLDRVVAVHVALPSAAEA------PDFDAMLAVYQGFCNLK  112

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            Q++LKL++C+ S  RK L REA    A  +++G +  R A+ S  SVAKYCA+ +    +
Sbjct  113  QINLKLKICKDSSVRKALVREASLLGAAKVVLGVAKKRRAISSSHSVAKYCAKKLPAKCA  172

Query  668  VLAVNNGKVAFQSE  709
            VLAV+NGK+ F+ E
Sbjct  173  VLAVSNGKIEFRRE  186



>gb|AAX96058.1| At5g63940 [Oryza sativa Japonica Group]
 gb|EAZ17716.1| hypothetical protein OsJ_33259 [Oryza sativa Japonica Group]
Length=745

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 96/162 (59%), Gaps = 32/162 (20%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHV--------------------LDPDTDKSEML  427
            + D+ S+ELLTWALVKVA  GDRI+ALHV                    L+  +D +E  
Sbjct  42   RRDAASRELLTWALVKVANAGDRIVALHVAAAAAAAAGGGGGGGGGAVGLEERSDAAE--  99

Query  428  RLVKTFDSVLAAYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGS--R  601
                +  SVLA Y+GFCNLKQ++L+L+VC GS  RK L +EA +Y A  LI+G + +   
Sbjct  100  ---DSLVSVLAVYDGFCNLKQINLELKVCGGSSIRKTLVKEAASYGAAHLILGVAKNSLS  156

Query  602  HAVRSPVSVAKYCARNVDKSISVLAVNNGKVAF-----QSEP  712
             +  S +SVAKYCA+ V    SVLAVNNGK+ F     Q EP
Sbjct  157  FSRSSSISVAKYCAKRVPTGCSVLAVNNGKILFHKDAVQQEP  198



>ref|XP_010236761.1| PREDICTED: uncharacterized protein LOC100842077 [Brachypodium 
distachyon]
Length=927

 Score =   117 bits (293),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 86/136 (63%), Gaps = 3/136 (2%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            + D+ S+ LLTW  V     GDR++A+HV+               FDS+LA YEGFCNLK
Sbjct  46   RADAESRALLTWTFVNAVAAGDRVVAVHVV---LASGAEAAAAVDFDSMLAVYEGFCNLK  102

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            Q++LK+++C+ S  RK L REA  + A+ +++G +  + A+ S +S AKYCA+ +    +
Sbjct  103  QINLKVKICKDSSVRKALVREATLFGASKVVLGITKKKRAIASSLSAAKYCAKKLPAKCA  162

Query  668  VLAVNNGKVAFQSEPN  715
            +LAVN+GK+ ++ E N
Sbjct  163  ILAVNSGKIVYRREAN  178



>emb|CDY43771.1| BnaA06g23070D [Brassica napus]
Length=679

 Score =   116 bits (290),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 84/136 (62%), Gaps = 18/136 (13%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            K D  S+E+LTW+LV VA+ GDRI+ALHVLD   + S  L                  + 
Sbjct  29   KPDEWSREVLTWSLVNVARPGDRIVALHVLDYSLEGSTSL------------------VS  70

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
             VDLKL+V RG  ARK+L +E K+  AT LIVG+S   H +RS  S+AKYCARN+ K +S
Sbjct  71   LVDLKLKVFRGKSARKVLVQEVKSSGATSLIVGSSKRHHTIRSSASLAKYCARNLAKDVS  130

Query  668  VLAVNNGKVAFQSEPN  715
            V AV +GK+ F+  P+
Sbjct  131  VFAVKSGKIMFRRVPS  146



>ref|XP_009398916.1| PREDICTED: proline-rich receptor-like protein kinase PERK3 [Musa 
acuminata subsp. malaccensis]
Length=631

 Score =   114 bits (285),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/136 (43%), Positives = 89/136 (65%), Gaps = 4/136 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL-DPDTDKSEMLRLVKTFDSVLAAYEGFCNL  484
            +MD+  KELL WA+ +VA+ GDR++A+HV  D D   +  L L++  D  LAAY+GFC  
Sbjct  23   QMDANGKELLNWAMSRVAEQGDRVMAVHVCRDSDLKNTTTLSLIRQLDGYLAAYDGFCEF  82

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRH-AVRSPVSVAKYCARNVDKS  661
            KQV L  RV RG+  RK++ +EAK   A  ++VG   ++H A+    S+AKYCA+ +  +
Sbjct  83   KQVVLVGRVSRGNSIRKVMVKEAKLCDAMKVVVGV--NQHCALVGSASLAKYCAKKLPPT  140

Query  662  ISVLAVNNGKVAFQSE  709
             +V+A+ +GK+ F+ E
Sbjct  141  TAVIAIQDGKIVFERE  156



>ref|XP_008679652.1| PREDICTED: probable receptor-like protein kinase At1g49730 [Zea 
mays]
 gb|AFW65490.1| putative protein kinase superfamily protein [Zea mays]
Length=739

 Score =   114 bits (284),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 91/141 (65%), Gaps = 7/141 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRL------VKTFDSVLAAYE  469
            + D+ S+ELLTWALVKVA  GDR++ALHV         ++RL        +  SVLA Y+
Sbjct  45   RRDAASRELLTWALVKVANAGDRVVALHVATAAAADGLLVRLDERSRAADSLASVLAVYD  104

Query  470  GFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVG-TSGSRHAVRSPVSVAKYCAR  646
            GFCNLKQ++L+L+VC GS  RK L +EA    A  LI+G T+ SR    S  SVAKYC++
Sbjct  105  GFCNLKQINLELKVCGGSSIRKTLVKEAAACGAAHLILGVTNNSRSFGSSLTSVAKYCSK  164

Query  647  NVDKSISVLAVNNGKVAFQSE  709
             V  S SVLAVNNGKV +  +
Sbjct  165  RVPASCSVLAVNNGKVVYHKD  185



>ref|XP_004981112.1| PREDICTED: uncharacterized protein LOC101777140 [Setaria italica]
Length=934

 Score =   114 bits (285),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 86/136 (63%), Gaps = 3/136 (2%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            + D  S+ LLTW LV  A  GDR++A+HV+               FD++L  YEGFCNLK
Sbjct  62   RADIESRALLTWVLVNAAAPGDRVVAVHVV---VASGAEAAAAVDFDAMLGVYEGFCNLK  118

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            Q++LK+++C+ S  RK L REA+ + A+ L++G +  R A+ SP SVAKYCA+ +    +
Sbjct  119  QINLKVKICKDSSVRKALVREARLFEASALVLGLAKKRRAMLSPHSVAKYCAKKLPAKCA  178

Query  668  VLAVNNGKVAFQSEPN  715
            V AVNNGK+ F  E N
Sbjct  179  VFAVNNGKIEFSRESN  194



>ref|XP_006664395.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670-like [Oryza brachyantha]
Length=727

 Score =   112 bits (281),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 89/149 (60%), Gaps = 19/149 (13%)
 Frame = +2

Query  314  DSRSKELLTWALVKVAQTGDRIIALHVLDPD----------TDKSEMLRLVKTFDSVLAA  463
            D + +ELLTWAL  VA  GDR++ALHV  P           T  +E +R   +  ++L  
Sbjct  29   DGQGRELLTWALAMVASAGDRVVALHVTTPAAAAGGGKGVLTKMAERIRATDSLAALLRV  88

Query  464  YEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVG-TSGSRHAVRS--------  616
            Y+GFC+L Q+ L+LR+C GS  +K LA EA +Y A  LI+G T+ SR  +R         
Sbjct  89   YDGFCDLNQISLELRICHGSSIKKALANEASSYGAAHLILGVTNNSRSHLRQSSSSSSAA  148

Query  617  PVSVAKYCARNVDKSISVLAVNNGKVAFQ  703
              +VAKYCA+ V +S SVLAV NG+V ++
Sbjct  149  AAAVAKYCAKRVPQSCSVLAVGNGRVVYR  177



>ref|XP_007041840.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 7 [Theobroma cacao]
 ref|XP_007041841.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 7 [Theobroma cacao]
 gb|EOX97671.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 7 [Theobroma cacao]
 gb|EOX97672.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 7 [Theobroma cacao]
Length=500

 Score =   110 bits (276),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 86/132 (65%), Gaps = 4/132 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            ++DS+S++LL+WALVKVA+ GD ++A+HV          LR     +  L  YEG C++K
Sbjct  13   RIDSQSRDLLSWALVKVAEPGDCVVAVHV---SRSSDHALREKLLLEGYLDVYEGLCSVK  69

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            QVDLK ++ +GS  RK+L REA+ Y A  L+VG S    A+    S A+YCA+ +  + +
Sbjct  70   QVDLKGQIFKGSSTRKVLIREARNYEAVALVVGIS-KHSALGGWTSTARYCAKRLPTTTN  128

Query  668  VLAVNNGKVAFQ  703
            VLA++NGK+ F+
Sbjct  129  VLAISNGKIIFR  140



>ref|XP_007041838.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 5, partial [Theobroma cacao]
 gb|EOX97669.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 5, partial [Theobroma cacao]
Length=561

 Score =   110 bits (276),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 86/132 (65%), Gaps = 4/132 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            ++DS+S++LL+WALVKVA+ GD ++A+HV          LR     +  L  YEG C++K
Sbjct  13   RIDSQSRDLLSWALVKVAEPGDCVVAVHV---SRSSDHALREKLLLEGYLDVYEGLCSVK  69

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            QVDLK ++ +GS  RK+L REA+ Y A  L+VG S    A+    S A+YCA+ +  + +
Sbjct  70   QVDLKGQIFKGSSTRKVLIREARNYEAVALVVGIS-KHSALGGWTSTARYCAKRLPTTTN  128

Query  668  VLAVNNGKVAFQ  703
            VLA++NGK+ F+
Sbjct  129  VLAISNGKIIFR  140



>ref|XP_008805891.1| PREDICTED: LOW QUALITY PROTEIN: cyclin-dependent kinase 12-like 
[Phoenix dactylifera]
Length=812

 Score =   112 bits (279),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 90/143 (63%), Gaps = 15/143 (10%)
 Frame = +2

Query  314  DSRSKELLTWALVKVAQTGDRIIALHV--------LDPDTDKSE--MLRLVKTFDSVLAA  463
            D +S++LLTWALV  A  GDR++ALHV         DP+ +  +  ++ L K  D++LA 
Sbjct  86   DVQSRQLLTWALVTAAAPGDRVVALHVHTSRSSSSSDPEGEDEQAAVVSLAKDLDAMLAV  145

Query  464  YEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRH---AVRSPVSVAK  634
            Y GFCNLKQ+ LK ++C+G+  RK+LARE     A+ LI+G   ++H      S +S+ K
Sbjct  146  YXGFCNLKQIYLKWKICKGTSVRKVLAREVNELAASKLILGV--AKHSRSIRLSSLSIVK  203

Query  635  YCARNVDKSISVLAVNNGKVAFQ  703
            YCA+ +    SV AV+NGK+ FQ
Sbjct  204  YCAKKLPFDCSVFAVSNGKIVFQ  226



>ref|XP_006432125.1| hypothetical protein CICLE_v10000480mg [Citrus clementina]
 gb|ESR45365.1| hypothetical protein CICLE_v10000480mg [Citrus clementina]
Length=607

 Score =   111 bits (277),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +2

Query  452  VLAAYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVA  631
            +L+ YEGFCNLKQVDLKL+VCRG+  +KI+ +EAK+Y    +IVG S +   +RS VSVA
Sbjct  1    MLSVYEGFCNLKQVDLKLKVCRGTSVKKIIVKEAKSYGEAKVIVGISKTHRTIRSSVSVA  60

Query  632  KYCARNVDKSISVLAVNNGKVAFQSE  709
            KYCAR + K+  V AV NGK+ FQ E
Sbjct  61   KYCARKLSKNFGVFAVENGKIVFQRE  86



>ref|XP_007041837.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 4 [Theobroma cacao]
 gb|EOX97668.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 4 [Theobroma cacao]
Length=607

 Score =   110 bits (276),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 86/132 (65%), Gaps = 4/132 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            ++DS+S++LL+WALVKVA+ GD ++A+HV          LR     +  L  YEG C++K
Sbjct  13   RIDSQSRDLLSWALVKVAEPGDCVVAVHV---SRSSDHALREKLLLEGYLDVYEGLCSVK  69

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            QVDLK ++ +GS  RK+L REA+ Y A  L+VG S    A+    S A+YCA+ +  + +
Sbjct  70   QVDLKGQIFKGSSTRKVLIREARNYEAVALVVGIS-KHSALGGWTSTARYCAKRLPTTTN  128

Query  668  VLAVNNGKVAFQ  703
            VLA++NGK+ F+
Sbjct  129  VLAISNGKIIFR  140



>ref|XP_007041839.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 6 [Theobroma cacao]
 gb|EOX97670.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 6 [Theobroma cacao]
Length=632

 Score =   110 bits (276),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 86/132 (65%), Gaps = 4/132 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            ++DS+S++LL+WALVKVA+ GD ++A+HV          LR     +  L  YEG C++K
Sbjct  13   RIDSQSRDLLSWALVKVAEPGDCVVAVHV---SRSSDHALREKLLLEGYLDVYEGLCSVK  69

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            QVDLK ++ +GS  RK+L REA+ Y A  L+VG S    A+    S A+YCA+ +  + +
Sbjct  70   QVDLKGQIFKGSSTRKVLIREARNYEAVALVVGIS-KHSALGGWTSTARYCAKRLPTTTN  128

Query  668  VLAVNNGKVAFQ  703
            VLA++NGK+ F+
Sbjct  129  VLAISNGKIIFR  140



>ref|XP_007041834.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 ref|XP_007041835.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 ref|XP_007041836.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 gb|EOX97665.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 gb|EOX97666.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
 gb|EOX97667.1| Kinase protein with adenine nucleotide alpha hydrolases-like 
domain, putative isoform 1 [Theobroma cacao]
Length=683

 Score =   110 bits (276),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 86/132 (65%), Gaps = 4/132 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            ++DS+S++LL+WALVKVA+ GD ++A+HV          LR     +  L  YEG C++K
Sbjct  13   RIDSQSRDLLSWALVKVAEPGDCVVAVHV---SRSSDHALREKLLLEGYLDVYEGLCSVK  69

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            QVDLK ++ +GS  RK+L REA+ Y A  L+VG S    A+    S A+YCA+ +  + +
Sbjct  70   QVDLKGQIFKGSSTRKVLIREARNYEAVALVVGIS-KHSALGGWTSTARYCAKRLPTTTN  128

Query  668  VLAVNNGKVAFQ  703
            VLA++NGK+ F+
Sbjct  129  VLAISNGKIIFR  140



>ref|XP_010028727.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Eucalyptus grandis]
 gb|KCW55526.1| hypothetical protein EUGRSUZ_I01415 [Eucalyptus grandis]
Length=687

 Score =   110 bits (275),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 82/132 (62%), Gaps = 6/132 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            ++D RS+ELL+WA+VKVA+ GDR++A+HV   D       R     D+ L  YEG CN K
Sbjct  19   RLDGRSRELLSWAIVKVAEPGDRVLAIHVCRDDAS-----RDASILDNYLEVYEGLCNAK  73

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            +V L  +  +GS  RK+L REAK Y A  L+VG    + A+    + AKYCA+ +  S  
Sbjct  74   KVTLTGQALKGSSFRKVLVREAKNYAAVALLVGID-KQGALGVHTATAKYCAKRLPSSTD  132

Query  668  VLAVNNGKVAFQ  703
            VLA++NGK+ F+
Sbjct  133  VLAIHNGKIVFR  144



>gb|EAY82471.1| hypothetical protein OsI_37688 [Oryza sativa Indica Group]
Length=629

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 90/149 (60%), Gaps = 19/149 (13%)
 Frame = +2

Query  314  DSRSKELLTWALVKVAQTGDRIIALHVLDPDT----DKSEMLRL-------VKTFDSVLA  460
            D+  +ELLTWAL  VA  GDR++ALHV  P      D+   +R+        ++  ++L 
Sbjct  32   DAEGRELLTWALAMVAFAGDRVVALHVATPAAAAGADQEGAMRMAARRIRATESLAALLR  91

Query  461  AYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVG-TSGSRHAVR-------S  616
            AY+GFC+L Q+ L+LR+C GS  +K L  EA +Y A  LI+G T+ SR  +R       S
Sbjct  92   AYDGFCDLNQISLELRICHGSSIKKALVNEASSYGAAHLILGVTNNSRSHLRPSSSPSSS  151

Query  617  PVSVAKYCARNVDKSISVLAVNNGKVAFQ  703
              +VAKYCA+ V  S SVLAV NG+V ++
Sbjct  152  SAAVAKYCAKRVPPSCSVLAVGNGRVVYR  180



>ref|XP_009402096.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Musa acuminata subsp. malaccensis]
Length=817

 Score =   108 bits (271),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 88/140 (63%), Gaps = 5/140 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL-DPDTDKSEMLRLVKTFDSVLAAYEGFCNL  484
            +M+++ KELL WA+ KVA+ GDR++A+HV  D D  K+  L L  T D  LA+Y+G C+L
Sbjct  170  QMNAKGKELLDWAIHKVAEQGDRVMAVHVCRDSDLKKTTTLSLASTLDDHLASYQGICSL  229

Query  485  KQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSI  664
            KQV L  R+ RGS  R+ L +EAK   A  ++VG        RS   +AKYCA+N+  + 
Sbjct  230  KQVVLAGRIARGSSIRRALVKEAKQCAAIKVVVGMKKKSSFFRS-APLAKYCAKNLPPTT  288

Query  665  SVLAVNNGKVAFQ---SEPN  715
            +++AV  G V F+   +EP+
Sbjct  289  ALIAVRKGNVVFERGAAEPS  308



>gb|ABA95941.1| Protein kinase domain containing protein [Oryza sativa Japonica 
Group]
Length=738

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 90/149 (60%), Gaps = 19/149 (13%)
 Frame = +2

Query  314  DSRSKELLTWALVKVAQTGDRIIALHVLDPDT----DKSEMLRL-------VKTFDSVLA  460
            D+  +ELLTWAL  VA  GDR++ALHV  P      D+   +R+        ++  ++L 
Sbjct  32   DAEGRELLTWALAMVAFAGDRVVALHVATPAAAAGADQEGAMRMAARRIRATESLAALLR  91

Query  461  AYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVG-TSGSRHAVR-------S  616
            AY+GFC+L Q+ L+LR+C GS  +K L  EA +Y A  LI+G T+ SR  +R       S
Sbjct  92   AYDGFCDLNQISLELRICHGSSIKKALVNEASSYGAAHLILGVTNNSRSHLRPSSSPSSS  151

Query  617  PVSVAKYCARNVDKSISVLAVNNGKVAFQ  703
              +VAKYCA+ V  S SVLAV NG+V ++
Sbjct  152  SAAVAKYCAKRVPPSCSVLAVGNGRVVYR  180



>gb|EAZ19847.1| hypothetical protein OsJ_35432 [Oryza sativa Japonica Group]
Length=928

 Score =   108 bits (270),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 64/149 (43%), Positives = 90/149 (60%), Gaps = 19/149 (13%)
 Frame = +2

Query  314  DSRSKELLTWALVKVAQTGDRIIALHVLDPDT----DKSEMLRL-------VKTFDSVLA  460
            D+  +ELLTWAL  VA  GDR++ALHV  P      D+   +R+        ++  ++L 
Sbjct  32   DAEGRELLTWALAMVAFAGDRVVALHVATPAAAAGADQEGAMRMAARRIRATESLAALLR  91

Query  461  AYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVG-TSGSRHAVR-------S  616
            AY+GFC+L Q+ L+LR+C GS  +K L  EA +Y A  LI+G T+ SR  +R       S
Sbjct  92   AYDGFCDLNQISLELRICHGSSIKKALVNEASSYGAAHLILGVTNNSRSHLRPSSSPSSS  151

Query  617  PVSVAKYCARNVDKSISVLAVNNGKVAFQ  703
              +VAKYCA+ V  S SVLAV NG+V ++
Sbjct  152  SAAVAKYCAKRVPPSCSVLAVGNGRVVYR  180



>ref|XP_004978901.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
isoform X2 [Setaria italica]
Length=754

 Score =   108 bits (269),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 88/142 (62%), Gaps = 10/142 (7%)
 Frame = +2

Query  314  DSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS---------EMLRLVKTFDSVLAAY  466
            D+ S+ELLTWALVKVA  GDR++ALHV       +         E  R   +  SVLA Y
Sbjct  53   DAASRELLTWALVKVANAGDRVVALHVAAQHVAAAADGLLMGLDERSRAADSLASVLAVY  112

Query  467  EGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTS-GSRHAVRSPVSVAKYCA  643
            +GFCNLKQ++L+L+VC GS  RK L +EA +  A  LI+G +  SR    S  SVAKYC+
Sbjct  113  DGFCNLKQINLELKVCGGSSIRKTLVKEAASCGAAHLILGVAKNSRSFGSSSTSVAKYCS  172

Query  644  RNVDKSISVLAVNNGKVAFQSE  709
            + V    SVLAVNNGKV +  +
Sbjct  173  KRVPVGCSVLAVNNGKVVYHKD  194



>ref|XP_004978900.1| PREDICTED: L-type lectin-domain containing receptor kinase IV.2-like 
isoform X1 [Setaria italica]
Length=784

 Score =   108 bits (269),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 88/142 (62%), Gaps = 10/142 (7%)
 Frame = +2

Query  314  DSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKS---------EMLRLVKTFDSVLAAY  466
            D+ S+ELLTWALVKVA  GDR++ALHV       +         E  R   +  SVLA Y
Sbjct  53   DAASRELLTWALVKVANAGDRVVALHVAAQHVAAAADGLLMGLDERSRAADSLASVLAVY  112

Query  467  EGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTS-GSRHAVRSPVSVAKYCA  643
            +GFCNLKQ++L+L+VC GS  RK L +EA +  A  LI+G +  SR    S  SVAKYC+
Sbjct  113  DGFCNLKQINLELKVCGGSSIRKTLVKEAASCGAAHLILGVAKNSRSFGSSSTSVAKYCS  172

Query  644  RNVDKSISVLAVNNGKVAFQSE  709
            + V    SVLAVNNGKV +  +
Sbjct  173  KRVPVGCSVLAVNNGKVVYHKD  194



>ref|XP_006422602.1| hypothetical protein CICLE_v10027936mg [Citrus clementina]
 gb|ESR35842.1| hypothetical protein CICLE_v10027936mg [Citrus clementina]
Length=689

 Score =   107 bits (268),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 84/132 (64%), Gaps = 4/132 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            ++DS S++LL+WALVKVA+ GD +IA+HV       S+   L+   DS L  YEG C++ 
Sbjct  16   RIDSHSRDLLSWALVKVAEPGDSVIAIHVCRNADHASKDKSLL---DSYLEVYEGLCSVN  72

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            QV L  ++  GS  R++L REAK Y A  L+VGTS  + A+    S AKYC + +  +  
Sbjct  73   QVGLAGQIMAGSSVRRVLVREAKNYAAAALVVGTS-KKSALGGRCSTAKYCFKKLPPTTD  131

Query  668  VLAVNNGKVAFQ  703
            VLA+NNG++ F+
Sbjct  132  VLAINNGRIVFR  143



>gb|KDO80468.1| hypothetical protein CISIN_1g004174mg [Citrus sinensis]
Length=696

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/78 (69%), Positives = 62/78 (79%), Gaps = 7/78 (9%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL------DPDTDKSEMLRLVKTFDSVLAAYE  469
            K+D+ S+ELLTWALVKVAQ GD +IALHVL      D D  KS +L LVK FDSVLA YE
Sbjct  24   KLDTHSRELLTWALVKVAQPGDTVIALHVLANNAIVDRDG-KSSLLSLVKAFDSVLAVYE  82

Query  470  GFCNLKQVDLKLRVCRGS  523
            GFCNLKQVDLKL++CRG+
Sbjct  83   GFCNLKQVDLKLKICRGT  100



>ref|XP_010107667.1| putative receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXC16578.1| putative receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=682

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 89/132 (67%), Gaps = 4/132 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            +++S S+E+L+WALVKVA+ GD +IA++V  P +D +  LR   T D  L  Y+G C++K
Sbjct  25   RINSESREVLSWALVKVAEPGDSVIAIYV-RPSSDHA--LREKPTLDDYLDVYQGLCSVK  81

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            +V+L  ++  GS  R++L REAK Y A  L++G S  +  + S +S AKYCA+ +  +  
Sbjct  82   KVELIGQIMTGSSVRRVLVREAKNYDAVALVLGIS-KQTTLGSRISTAKYCAKRLSSTTD  140

Query  668  VLAVNNGKVAFQ  703
            V+A++NGK+ F+
Sbjct  141  VVAIHNGKIVFR  152



>gb|EAY82477.1| hypothetical protein OsI_37694 [Oryza sativa Indica Group]
Length=209

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 87/153 (57%), Gaps = 21/153 (14%)
 Frame = +2

Query  314  DSRSKELLTWALVKVAQTGDRIIALHVLDPD--TDKSEMLRL-------VKTFDSVLAAY  466
            D+  +ELLTWAL  VA  GDR++ALHV  P    D+   +R+        ++  ++L AY
Sbjct  33   DAEGRELLTWALAMVASAGDRVVALHVATPPAAADQEGAMRMAARRIRATESLAALLRAY  92

Query  467  EGFCNLKQV-------DLKLRVCRGSPARKILAREAKTYRATDLIVGTSGS-----RHAV  610
              FC+L QV        L+LR+C GS  +K L  EA +Y A  LI+G + +     R + 
Sbjct  93   HDFCDLNQVPAHRPHISLELRICHGSSIKKALVNEASSYGAAHLILGVTNNSRSHLRPSS  152

Query  611  RSPVSVAKYCARNVDKSISVLAVNNGKVAFQSE  709
             S  ++AKYCA+ V  S SVLAV NG+V ++ +
Sbjct  153  SSSATIAKYCAKRVPPSCSVLAVGNGRVVYRRD  185



>ref|XP_010266827.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Nelumbo 
nucifera]
 ref|XP_010266828.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Nelumbo 
nucifera]
 ref|XP_010266829.1| PREDICTED: probable receptor-like protein kinase At5g15080 [Nelumbo 
nucifera]
Length=680

 Score =   106 bits (264),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 60/136 (44%), Positives = 89/136 (65%), Gaps = 12/136 (9%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL---DPDT-DKSEMLRLVKTFDSVLAAYEGF  475
            ++D  S++LL+WALVKVA+ GDR++A++V    DP + DKS       + D  L  Y+G 
Sbjct  19   RIDGYSRDLLSWALVKVAEPGDRVVAVNVSRNSDPHSKDKS-------SLDDYLQVYKGL  71

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            C++KQVDL   + RG+  RK L REAK   A  ++VG +   HA+   VS+AKYCA+ + 
Sbjct  72   CDVKQVDLTGYISRGNSVRKALVREAKQCAAIAVVVGIN-RHHALGGWVSMAKYCAKCLP  130

Query  656  KSISVLAVNNGKVAFQ  703
             + ++LAV+NGKV F+
Sbjct  131  PNTAILAVHNGKVVFE  146



>ref|XP_006359697.1| PREDICTED: proline-rich receptor-like protein kinase PERK12-like 
[Solanum tuberosum]
Length=688

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 82/133 (62%), Gaps = 6/133 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            + D   +ELL WA VKVA+ GDR+IALHV     +   +  +  + D+ L  Y+G CN K
Sbjct  19   RFDGHIRELLNWATVKVAEPGDRVIALHVC---RNAESIANVKSSLDTYLYDYDGLCNKK  75

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHA-VRSPVSVAKYCARNVDKSI  664
            QVDL   V  GS  R++L REAK Y A  +IVGT   +H+ +    S+AKYCA+ +  + 
Sbjct  76   QVDLISVVTEGSSIRRVLVREAKNYAALAVIVGT--CKHSTLGGWTSIAKYCAKKLPTTT  133

Query  665  SVLAVNNGKVAFQ  703
             V+A++NGKV F+
Sbjct  134  EVMAIDNGKVLFR  146



>ref|XP_010320789.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 isoform X2 [Solanum lycopersicum]
Length=606

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 49/73 (67%), Positives = 61/73 (84%), Gaps = 0/73 (0%)
 Frame = +2

Query  491  VDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSISV  670
            V LKL+VCRGSP RK+LAREAK   A +LI+GTSGS HA+RS VS+AKYCAR + K+ISV
Sbjct  8    VHLKLKVCRGSPVRKVLAREAKLESAINLIIGTSGSHHAIRSSVSLAKYCARKLTKNISV  67

Query  671  LAVNNGKVAFQSE  709
            +AV+NGK+ +Q E
Sbjct  68   IAVDNGKIVYQRE  80



>gb|EEE52871.1| hypothetical protein OsJ_35430 [Oryza sativa Japonica Group]
Length=719

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 85/144 (59%), Gaps = 14/144 (10%)
 Frame = +2

Query  314  DSRSKELLTWALVKVAQTGDRIIALHVLDPDT--DKSEMLRL-------VKTFDSVLAAY  466
            D+  +ELLTWA   VA  GDR++ALHV  P    D+   +R+        ++  ++L AY
Sbjct  33   DAEGRELLTWAFAMVASAGDRVVALHVATPPAAADQEGAMRMAARRIRATESLAALLRAY  92

Query  467  EGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGS-----RHAVRSPVSVA  631
              FC+L Q+ L+LR+C GS  +K L  EA +Y A  LI+G + +     R +  S  ++A
Sbjct  93   HDFCDLNQISLELRICHGSSIKKALVNEASSYGAAHLILGVTNNSRSHLRPSSSSSATIA  152

Query  632  KYCARNVDKSISVLAVNNGKVAFQ  703
            KYCA+ V  S SVLAV NG+V ++
Sbjct  153  KYCAKRVPPSCSVLAVGNGRVVYR  176



>ref|XP_010920120.1| PREDICTED: probable receptor-like protein kinase At5g56460 isoform 
X2 [Elaeis guineensis]
Length=647

 Score =   105 bits (262),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 85/138 (62%), Gaps = 10/138 (7%)
 Frame = +2

Query  311  MDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEM-----LRLVKTFDSVLAAYEGF  475
            +D+  +ELL WAL KVA+ GDR++A+HV      KSE+       L+K  D  LAAYEG 
Sbjct  24   LDADGRELLDWALSKVAKQGDRVVAVHV----CRKSELCNTSTFSLIKVLDDYLAAYEGL  79

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLK+V L  RV  GS  RK++ +EA    A  ++VG +   ++     S+AKYC + + 
Sbjct  80   CNLKKVVLVGRVSPGSSIRKVIVKEANLCAAMTVVVGVN-KNYSFGDSASLAKYCDKKLP  138

Query  656  KSISVLAVNNGKVAFQSE  709
             + +++AV+NGKV FQ E
Sbjct  139  PTTTLIAVHNGKVIFQRE  156



>ref|XP_010920119.1| PREDICTED: probable receptor-like protein kinase At5g56460 isoform 
X1 [Elaeis guineensis]
Length=669

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 85/138 (62%), Gaps = 10/138 (7%)
 Frame = +2

Query  311  MDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEM-----LRLVKTFDSVLAAYEGF  475
            +D+  +ELL WAL KVA+ GDR++A+HV      KSE+       L+K  D  LAAYEG 
Sbjct  24   LDADGRELLDWALSKVAKQGDRVVAVHV----CRKSELCNTSTFSLIKVLDDYLAAYEGL  79

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVD  655
            CNLK+V L  RV  GS  RK++ +EA    A  ++VG +   ++     S+AKYC + + 
Sbjct  80   CNLKKVVLVGRVSPGSSIRKVIVKEANLCAAMTVVVGVN-KNYSFGDSASLAKYCDKKLP  138

Query  656  KSISVLAVNNGKVAFQSE  709
             + +++AV+NGKV FQ E
Sbjct  139  PTTTLIAVHNGKVIFQRE  156



>gb|EEC78249.1| hypothetical protein OsI_17914 [Oryza sativa Indica Group]
Length=737

 Score =   105 bits (262),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 72/153 (47%), Positives = 95/153 (62%), Gaps = 23/153 (15%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL-----------DPDTDKSEMLRLVKTFDSV  454
            + D+ S+ELLTWALVKVA  GDR++ALHV            +  +D +E      +  SV
Sbjct  43   RRDAASRELLTWALVKVANAGDRVVALHVAAAAAAGGAVGLEERSDAAE-----DSLVSV  97

Query  455  LAAYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGS--RHAVRSPVSV  628
            LA Y+GFCNLKQ++L+L+VC GS  RK L +EA +Y A  LI+G + +    +  S +SV
Sbjct  98   LAVYDGFCNLKQINLELKVCGGSSIRKTLVKEAASYGAAHLILGVAKNSLSFSRSSSISV  157

Query  629  AKYCARNVDKSISVLAVNNGKVAF-----QSEP  712
            AKYCA+ V    SVLAVNNGK+ F     Q EP
Sbjct  158  AKYCAKRVPTGCSVLAVNNGKILFHKDAVQQEP  190



>ref|XP_008813513.1| PREDICTED: protein STRUBBELIG-RECEPTOR FAMILY 8-like [Phoenix 
dactylifera]
Length=667

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 84/134 (63%), Gaps = 2/134 (1%)
 Frame = +2

Query  311  MDSRSKELLTWALVKVAQTGDRIIALHVL-DPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            +D+  +ELL WAL KVA+  DR++A+HV  + +   +    L+K  D  LA YEG CNLK
Sbjct  24   LDANGRELLDWALSKVAKQDDRVVAVHVCRNSELCNTSTFSLIKVLDEYLAVYEGLCNLK  83

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            +V L  RV  GS  R++L +EAK   A  ++VG   + ++     S+AKYCA+ +  + +
Sbjct  84   KVALVGRVSPGSSIRRVLVKEAKLCGARTVVVGVH-NNYSFGGSASLAKYCAKKLPPTTN  142

Query  668  VLAVNNGKVAFQSE  709
            ++A++NGKV FQ E
Sbjct  143  LIAIHNGKVIFQRE  156



>ref|XP_009791612.1| PREDICTED: probable serine/threonine-protein kinase RLCKVII [Nicotiana 
sylvestris]
Length=687

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 88/137 (64%), Gaps = 14/137 (10%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL-DPDT---DKSEMLRLVKTFDSVLAAYEGF  475
            + D   +ELL WA+VKVA  GDR+IALHV  + D+   DKS         D+ L  Y+G 
Sbjct  19   RFDGHIRELLNWAIVKVANPGDRVIALHVCRNADSIAKDKS-------LLDTYLDDYDGL  71

Query  476  CNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHA-VRSPVSVAKYCARNV  652
            CN KQVD+   V +GS  R++L REAK + A  ++VGT  S+H+ + S +S++KYCA+ +
Sbjct  72   CNKKQVDIISLVLKGSSIRRVLVREAKNHAAVAVVVGT--SKHSTLGSWISISKYCAKRL  129

Query  653  DKSISVLAVNNGKVAFQ  703
              +  ++A++NGKV F+
Sbjct  130  PITTEIMAIDNGKVFFR  146



>ref|XP_010315381.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 [Solanum lycopersicum]
Length=689

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 82/133 (62%), Gaps = 6/133 (5%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            + D   +ELL WA+VKVA+ GDR+IALHV     +   +  +  + D+ L  Y+G CN K
Sbjct  19   RFDGHIRELLNWAIVKVAEPGDRVIALHVC---RNAESIANVKSSLDTYLYDYDGLCNKK  75

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHA-VRSPVSVAKYCARNVDKSI  664
            QVDL   V  GS  R++L REAK + A  +IVG    +H+ +    S+AKYCA+ +  + 
Sbjct  76   QVDLISLVTEGSSIRRVLVREAKNHDALAVIVGN--CKHSTLGGWTSIAKYCAKKLPTTT  133

Query  665  SVLAVNNGKVAFQ  703
             V+AV+NGKV F+
Sbjct  134  EVMAVDNGKVLFR  146



>ref|XP_002442921.1| hypothetical protein SORBIDRAFT_08g004940 [Sorghum bicolor]
 gb|EES16759.1| hypothetical protein SORBIDRAFT_08g004940 [Sorghum bicolor]
Length=725

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 83/150 (55%), Gaps = 15/150 (10%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHV---LDPDTDKSEMLRLVK-----------TF  445
            + D+  +ELLTWALVK A  GDR+IALHV      D    EM                + 
Sbjct  36   RRDAAGRELLTWALVKAAAAGDRVIALHVSTTAAGDPADGEMPAAAAAAEEEKARANDSL  95

Query  446  DSVLAAYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVG-TSGSRHAVRSPV  622
             SVL AY GFC   Q+DL+L++C GS  +K L  EA +  A  LIVG T  SR +  S  
Sbjct  96   ASVLGAYRGFCERNQIDLELKLCEGSSIKKALVAEATSCAAAHLIVGVTKSSRPSGSSAT  155

Query  623  SVAKYCARNVDKSISVLAVNNGKVAFQSEP  712
            +VA+YCA+ V  S  V AV+NG V ++ +P
Sbjct  156  AVARYCAKRVPASCMVTAVSNGAVVYRRDP  185



>ref|XP_002463556.1| hypothetical protein SORBIDRAFT_01g001890 [Sorghum bicolor]
 gb|EER90554.1| hypothetical protein SORBIDRAFT_01g001890 [Sorghum bicolor]
Length=945

 Score =   104 bits (259),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 81/132 (61%), Gaps = 7/132 (5%)
 Frame = +2

Query  314  DSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLKQV  493
            D+ S+ LLTW LV VA   DR++A          +     V  F+++   YEGFCNLKQ+
Sbjct  70   DAESRALLTWVLVNVAAPLDRVVA-------VHVAADAAAVVDFEAMRGVYEGFCNLKQI  122

Query  494  DLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSISVL  673
            DLKL++C+ S  RK L REA  + A  +++G +  R A+ S  SVAKYCA+ +    +VL
Sbjct  123  DLKLKICKDSSVRKALVREASLFGAAKVVLGVAKKRRAISSSHSVAKYCAKKLPAKCAVL  182

Query  674  AVNNGKVAFQSE  709
            AV+NGK+ F+ E
Sbjct  183  AVSNGKIEFRRE  194



>gb|KHG28516.1| Receptor-like cytosolic serine/threonine-protein kinase RBK1 
[Gossypium arboreum]
Length=682

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 87/132 (66%), Gaps = 4/132 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            ++DS S++LL+WALVKVA+ GD ++A+HV   ++D +   +L+   +  L AYEG C++K
Sbjct  14   RLDSESRDLLSWALVKVAEPGDCVVAIHVTR-NSDHALGQKLL--LEGYLEAYEGLCSIK  70

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            +VDLK ++ +G+  RK+L REA  Y A  L+VG    R  +    S A+YC + +  + +
Sbjct  71   KVDLKGQIYKGNSIRKVLIREAINYGAVALVVGID-KRSPLGGWTSTARYCTKRLPTTTN  129

Query  668  VLAVNNGKVAFQ  703
            V+A+N GK+ F+
Sbjct  130  VVAINKGKIVFE  141



>ref|XP_011046218.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X1 [Populus euphratica]
 ref|XP_011046226.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X1 [Populus euphratica]
 ref|XP_011046234.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670 isoform X1 [Populus euphratica]
Length=680

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 82/132 (62%), Gaps = 4/132 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            ++DS S+ELL+WA+ KVA+ GD ++A+HV          LR     DS L  Y G C++K
Sbjct  21   RIDSHSRELLSWAIAKVAEPGDCVVAVHVC---GSSDHALRDKPLLDSYLEVYNGLCSMK  77

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            +V L  ++ +G   R+ L REAK Y A  +IVG S S+ A+R   S AKYCA+ + ++  
Sbjct  78   KVGLSGQIAKGISVRRTLVREAKNYAAVAVIVGIS-SQAALRIWASTAKYCAKRLRRTTD  136

Query  668  VLAVNNGKVAFQ  703
            V+A++NGK  F+
Sbjct  137  VMAIHNGKFVFR  148



>ref|XP_006486742.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670-like isoform X1 [Citrus sinensis]
 ref|XP_006486743.1| PREDICTED: probable receptor-like serine/threonine-protein kinase 
At5g57670-like isoform X2 [Citrus sinensis]
Length=675

 Score =   103 bits (256),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 82/132 (62%), Gaps = 4/132 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            ++DS S++LL+WALVKVA+ GD +IA+HV       S+   L+   DS L  YEG C++ 
Sbjct  16   RIDSNSRDLLSWALVKVAEPGDSVIAIHVCRNADHASKDKSLL---DSYLEVYEGLCSVN  72

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            QV L  ++  GS  R++L REA  Y A  L+VG S  + A+    S AKYC + +  +  
Sbjct  73   QVGLAGQIMAGSSVRRVLVREAMNYAAAALVVGMS-KKSALGGRCSTAKYCLKKLPPTTD  131

Query  668  VLAVNNGKVAFQ  703
            VLA+NNG++ F+
Sbjct  132  VLAINNGRIVFR  143



>ref|XP_009384623.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Musa acuminata subsp. malaccensis]
 ref|XP_009384624.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Musa acuminata subsp. malaccensis]
 ref|XP_009384625.1| PREDICTED: receptor-like cytosolic serine/threonine-protein kinase 
RBK1 [Musa acuminata subsp. malaccensis]
Length=661

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 83/134 (62%), Gaps = 3/134 (2%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVL-DPDTDKS-EMLRLVKTFDSVLAAYEGFCN  481
            +MD+  KELL WA+ +V++ GDRI+A+HV  D D   +   L L+   D  LAAYEG C+
Sbjct  23   QMDANGKELLDWAIHRVSEQGDRIMAVHVCRDSDLRNTITTLSLITMLDEYLAAYEGACS  82

Query  482  LKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKS  661
            LKQ+ L  RV RG+  RK L +EAK   A  +IVG +    ++     +AKYCA+ +  +
Sbjct  83   LKQIVLVGRVARGNSIRKALVKEAKLCAAMKVIVGVN-KHSSIGGSAPLAKYCAKKLPSA  141

Query  662  ISVLAVNNGKVAFQ  703
             +V+AV NG + F+
Sbjct  142  TAVIAVQNGNIIFE  155



>ref|XP_002313708.1| hypothetical protein POPTR_0009s13710g [Populus trichocarpa]
 gb|EEE87663.1| hypothetical protein POPTR_0009s13710g [Populus trichocarpa]
Length=621

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 82/132 (62%), Gaps = 4/132 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            ++DS S+ELL+WA+ KVA+ GD ++A HV          LR     DS L  Y+G C++K
Sbjct  21   RIDSHSRELLSWAIAKVAEPGDCVVAAHVC---GSSGHALRDKPLLDSYLEVYDGLCSMK  77

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            +V L  ++ +G   R+ L REAK Y A  +IVG S S+ A+R   S AKYCA+ +  +  
Sbjct  78   KVRLSGQIAKGISVRRTLVREAKNYAAVAVIVGIS-SQAALRVWASTAKYCAKRLRPTTD  136

Query  668  VLAVNNGKVAFQ  703
            ++A++NGK+ F+
Sbjct  137  IMAIHNGKIVFR  148



>ref|XP_009626742.1| PREDICTED: proline-rich receptor-like protein kinase PERK12 isoform 
X1 [Nicotiana tomentosiformis]
Length=689

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 84/137 (61%), Gaps = 6/137 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            + D   +ELL WA+VK A  GDR++ALHV     +   + +     D+ L  Y+G CN K
Sbjct  19   RFDGHIRELLNWAIVKFANPGDRVVALHVC---RNSDSIAKDKSLLDTYLDDYDGLCNKK  75

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHA-VRSPVSVAKYCARNVDKSI  664
            QVD+   V +GS  R++L REAK + A  ++VGT  S+H+ + S  S++KYCA+ +  + 
Sbjct  76   QVDIISLVLKGSSIRRVLVREAKNHSAVAVVVGT--SKHSTLGSWTSISKYCAKRLPITT  133

Query  665  SVLAVNNGKVAFQSEPN  715
             ++A++NGKV F+   N
Sbjct  134  EIMAIDNGKVFFRRSSN  150



>ref|XP_009626743.1| PREDICTED: proline-rich receptor-like protein kinase PERK12 isoform 
X2 [Nicotiana tomentosiformis]
Length=688

 Score =   102 bits (254),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 84/137 (61%), Gaps = 6/137 (4%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            + D   +ELL WA+VK A  GDR++ALHV     +   + +     D+ L  Y+G CN K
Sbjct  19   RFDGHIRELLNWAIVKFANPGDRVVALHVC---RNSDSIAKDKSLLDTYLDDYDGLCNKK  75

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHA-VRSPVSVAKYCARNVDKSI  664
            QVD+   V +GS  R++L REAK + A  ++VGT  S+H+ + S  S++KYCA+ +  + 
Sbjct  76   QVDIISLVLKGSSIRRVLVREAKNHSAVAVVVGT--SKHSTLGSWTSISKYCAKRLPITT  133

Query  665  SVLAVNNGKVAFQSEPN  715
             ++A++NGKV F+   N
Sbjct  134  EIMAIDNGKVFFRRSSN  150



>ref|XP_002305520.1| kinase family protein [Populus trichocarpa]
 gb|EEE86031.1| kinase family protein [Populus trichocarpa]
Length=678

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 83/132 (63%), Gaps = 4/132 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            ++D++S+ELL+WA+VKVA+ GD +IA+HV          LR     DS L  Y+G C++K
Sbjct  20   RIDNQSRELLSWAIVKVAEPGDCVIAVHVC---GSSGHALREKPLLDSYLEVYDGLCSMK  76

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            +V L   + +G   R+ L REAK + +  ++VG S S+ A+R   S A+YCA+ +  +  
Sbjct  77   KVGLTGHIAKGISVRRTLVREAKNHASVAIVVGIS-SQGALRGWASTARYCAKRLRPTTD  135

Query  668  VLAVNNGKVAFQ  703
            VLA+ NGK+ F+
Sbjct  136  VLAIYNGKIVFR  147



>gb|KJB15813.1| hypothetical protein B456_002G197700 [Gossypium raimondii]
 gb|KJB15814.1| hypothetical protein B456_002G197700 [Gossypium raimondii]
Length=506

 Score =   100 bits (249),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 86/132 (65%), Gaps = 4/132 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            ++DS S++LL+WAL KVA+ GD ++A+HV   ++D +   +L+   +  L AYEG C++K
Sbjct  14   RLDSESRDLLSWALGKVAEPGDCVVAIHVTR-NSDHALGQKLL--LEGYLEAYEGLCSIK  70

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            +VDLK ++ +G+  RK+L REA  Y A  L+VG    R  +    S A+YC + +  + +
Sbjct  71   KVDLKGQIHKGNSIRKVLIREAINYGAVALVVGID-KRSPLGGWTSTARYCTKRLPTTTN  129

Query  668  VLAVNNGKVAFQ  703
            V+A+N GK+ F+
Sbjct  130  VVAINKGKIVFE  141



>ref|XP_011046681.1| PREDICTED: proline-rich receptor-like protein kinase PERK2 [Populus 
euphratica]
 ref|XP_011046682.1| PREDICTED: proline-rich receptor-like protein kinase PERK2 [Populus 
euphratica]
Length=679

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 82/132 (62%), Gaps = 4/132 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            ++DS+S+ELL+WA+VKVA+ GD +IA+HV     +    LR     DS L  Y+G C++K
Sbjct  20   RIDSQSRELLSWAIVKVAEPGDCVIAVHVCG---NSGHALRDKPLLDSYLEVYDGLCSMK  76

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            +V L     +G   R+ L REAK + A  ++VG S +  A+R   S A+YCA+ +  +  
Sbjct  77   KVGLTGHTAKGISVRRTLVREAKNHAAVAIVVGIS-NLGALRGWASTARYCAKRLRPTTD  135

Query  668  VLAVNNGKVAFQ  703
            VLA+ NGK+ F+
Sbjct  136  VLAIYNGKIVFR  147



>gb|KJB15815.1| hypothetical protein B456_002G197700 [Gossypium raimondii]
Length=571

 Score =   100 bits (249),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 86/132 (65%), Gaps = 4/132 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            ++DS S++LL+WAL KVA+ GD ++A+HV   ++D +   +L+   +  L AYEG C++K
Sbjct  14   RLDSESRDLLSWALGKVAEPGDCVVAIHVTR-NSDHALGQKLL--LEGYLEAYEGLCSIK  70

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            +VDLK ++ +G+  RK+L REA  Y A  L+VG    R  +    S A+YC + +  + +
Sbjct  71   KVDLKGQIHKGNSIRKVLIREAINYGAVALVVGID-KRSPLGGWTSTARYCTKRLPTTTN  129

Query  668  VLAVNNGKVAFQ  703
            V+A+N GK+ F+
Sbjct  130  VVAINKGKIVFE  141



>ref|XP_006663269.1| PREDICTED: proline-rich receptor-like protein kinase PERK13-like 
[Oryza brachyantha]
Length=667

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/93 (55%), Positives = 65/93 (70%), Gaps = 5/93 (5%)
 Frame = +2

Query  449  SVLAAYEGFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSV  628
            SVLA Y+GFCNLKQ++L+L+VC GS  RK L +EA +Y A  LI+G + +  + RS +SV
Sbjct  32   SVLAVYDGFCNLKQINLELKVCGGSSIRKTLVKEAASYGAAHLILGVAKNTLSFRSSISV  91

Query  629  AKYCARNVDKSISVLAVNNGKVAF-----QSEP  712
            AKYCA+ V    SVLAVNNGK+ F     Q EP
Sbjct  92   AKYCAKRVPVGCSVLAVNNGKIVFHKDAVQQEP  124



>gb|KJB15816.1| hypothetical protein B456_002G197700 [Gossypium raimondii]
Length=619

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 86/132 (65%), Gaps = 4/132 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            ++DS S++LL+WAL KVA+ GD ++A+HV   ++D +   +L+   +  L AYEG C++K
Sbjct  14   RLDSESRDLLSWALGKVAEPGDCVVAIHVTR-NSDHALGQKLL--LEGYLEAYEGLCSIK  70

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            +VDLK ++ +G+  RK+L REA  Y A  L+VG    R  +    S A+YC + +  + +
Sbjct  71   KVDLKGQIHKGNSIRKVLIREAINYGAVALVVGID-KRSPLGGWTSTARYCTKRLPTTTN  129

Query  668  VLAVNNGKVAFQ  703
            V+A+N GK+ F+
Sbjct  130  VVAINKGKIVFE  141



>gb|KJB15812.1| hypothetical protein B456_002G197700 [Gossypium raimondii]
Length=683

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 86/132 (65%), Gaps = 4/132 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            ++DS S++LL+WAL KVA+ GD ++A+HV   ++D +   +L+   +  L AYEG C++K
Sbjct  14   RLDSESRDLLSWALGKVAEPGDCVVAIHVTR-NSDHALGQKLL--LEGYLEAYEGLCSIK  70

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            +VDLK ++ +G+  RK+L REA  Y A  L+VG    R  +    S A+YC + +  + +
Sbjct  71   KVDLKGQIHKGNSIRKVLIREAINYGAVALVVGID-KRSPLGGWTSTARYCTKRLPTTTN  129

Query  668  VLAVNNGKVAFQ  703
            V+A+N GK+ F+
Sbjct  130  VVAINKGKIVFE  141



>ref|XP_008663832.1| PREDICTED: G-type lectin S-receptor-like serine/threonine-protein 
kinase SD2-2 [Zea mays]
Length=715

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 83/144 (58%), Gaps = 9/144 (6%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTD------KSEMLRLVKTFDSVLAAYE  469
            + D+  +ELLTWALVK A  GDR++ALHV     D      + +  R   +  SVL AY 
Sbjct  34   RRDAAGRELLTWALVKAAAAGDRVVALHVSTVAADGEMAAAEEDRTRASDSLASVLGAYR  93

Query  470  GFCNLKQVDLKLRVCRGSPARKILAREAKTYRATDLIVG-TSGSRHAVRS--PVSVAKYC  640
            GFC   Q+DL+L++C G   +K L  EA +  A  L++G T  SR +  S    +VA+YC
Sbjct  94   GFCERNQIDLELKLCEGPSIKKALVAEATSCAAAHLVLGVTRSSRPSGSSATATAVARYC  153

Query  641  ARNVDKSISVLAVNNGKVAFQSEP  712
            A+ V  S  V AV+NG V ++ +P
Sbjct  154  AKRVPPSCMVTAVSNGAVVYRRDP  177



>gb|KJB15811.1| hypothetical protein B456_002G197700 [Gossypium raimondii]
Length=684

 Score =   100 bits (249),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 86/132 (65%), Gaps = 4/132 (3%)
 Frame = +2

Query  308  KMDSRSKELLTWALVKVAQTGDRIIALHVLDPDTDKSEMLRLVKTFDSVLAAYEGFCNLK  487
            ++DS S++LL+WAL KVA+ GD ++A+HV   ++D +   +L+   +  L AYEG C++K
Sbjct  14   RLDSESRDLLSWALGKVAEPGDCVVAIHVTR-NSDHALGQKLL--LEGYLEAYEGLCSIK  70

Query  488  QVDLKLRVCRGSPARKILAREAKTYRATDLIVGTSGSRHAVRSPVSVAKYCARNVDKSIS  667
            +VDLK ++ +G+  RK+L REA  Y A  L+VG    R  +    S A+YC + +  + +
Sbjct  71   KVDLKGQIHKGNSIRKVLIREAINYGAVALVVGID-KRSPLGGWTSTARYCTKRLPTTTN  129

Query  668  VLAVNNGKVAFQ  703
            V+A+N GK+ F+
Sbjct  130  VVAINKGKIVFE  141



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1295251989378