BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3202

Length=1747
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008442393.1|  PREDICTED: proliferation-associated protein ...    647   0.0      Cucumis melo [Oriental melon]
ref|XP_004137704.1|  PREDICTED: proliferation-associated protein ...    646   0.0      Cucumis sativus [cucumbers]
ref|XP_009789408.1|  PREDICTED: proliferation-associated protein ...    643   0.0      Nicotiana sylvestris
ref|XP_009599246.1|  PREDICTED: proliferation-associated protein ...    642   0.0      Nicotiana tomentosiformis
ref|XP_006344058.1|  PREDICTED: proliferation-associated protein ...    638   0.0      Solanum tuberosum [potatoes]
ref|XP_007205303.1|  hypothetical protein PRUPE_ppa006778mg             638   0.0      
ref|XP_006344057.1|  PREDICTED: proliferation-associated protein ...    638   0.0      Solanum tuberosum [potatoes]
ref|XP_004240407.1|  PREDICTED: proliferation-associated protein ...    635   0.0      Solanum lycopersicum
ref|XP_009599304.1|  PREDICTED: proliferation-associated protein ...    635   0.0      Nicotiana tomentosiformis
ref|XP_010321752.1|  PREDICTED: proliferation-associated protein ...    635   0.0      Solanum lycopersicum
emb|CDP09213.1|  unnamed protein product                                634   0.0      Coffea canephora [robusta coffee]
ref|XP_009599303.1|  PREDICTED: proliferation-associated protein ...    634   0.0      Nicotiana tomentosiformis
ref|XP_009773246.1|  PREDICTED: proliferation-associated protein ...    632   0.0      Nicotiana sylvestris
ref|XP_004242516.1|  PREDICTED: proliferation-associated protein ...    632   0.0      Solanum lycopersicum
ref|XP_002530504.1|  proliferation-associated 2g4, putative             632   0.0      Ricinus communis
ref|XP_012089820.1|  PREDICTED: proliferation-associated protein 2G4    632   0.0      Jatropha curcas
ref|XP_007026646.1|  Metallopeptidase M24 family protein isoform 1      631   0.0      
ref|NP_001275188.1|  EBP1                                               629   0.0      Solanum tuberosum [potatoes]
gb|EYU26681.1|  hypothetical protein MIMGU_mgv1a007877mg                629   0.0      Erythranthe guttata [common monkey flower]
ref|XP_009376423.1|  PREDICTED: proliferation-associated protein ...    627   0.0      Pyrus x bretschneideri [bai li]
gb|KDO56711.1|  hypothetical protein CISIN_1g016183mg                   627   0.0      Citrus sinensis [apfelsine]
gb|ABF66654.1|  EBP1                                                    627   0.0      Ammopiptanthus mongolicus
gb|EPS71863.1|  hypothetical protein M569_02886                         626   0.0      Genlisea aurea
ref|XP_008464212.1|  PREDICTED: proliferation-associated protein ...    629   0.0      Cucumis melo [Oriental melon]
ref|XP_009376419.1|  PREDICTED: proliferation-associated protein ...    626   0.0      Pyrus x bretschneideri [bai li]
ref|XP_006429434.1|  hypothetical protein CICLE_v10011909mg             626   0.0      
ref|XP_010037691.1|  PREDICTED: proliferation-associated protein 2G4    625   0.0      Eucalyptus grandis [rose gum]
ref|XP_011019082.1|  PREDICTED: proliferation-associated protein ...    625   0.0      Populus euphratica
gb|ABK95017.1|  unknown                                                 625   0.0      Populus trichocarpa [western balsam poplar]
ref|XP_008362268.1|  PREDICTED: proliferation-associated protein ...    624   0.0      Malus domestica [apple tree]
ref|XP_008388269.1|  PREDICTED: proliferation-associated protein ...    624   0.0      Malus domestica [apple tree]
ref|XP_010264591.1|  PREDICTED: proliferation-associated protein ...    624   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_003623305.1|  Proliferation-associated protein 2G4               624   0.0      Medicago truncatula
ref|XP_008388270.1|  PREDICTED: proliferation-associated protein ...    623   0.0      
ref|XP_003516956.1|  PREDICTED: proliferation-associated protein 2G4    622   0.0      Glycine max [soybeans]
gb|ACJ85304.1|  unknown                                                 622   0.0      Medicago truncatula
ref|XP_003529167.1|  PREDICTED: proliferation-associated protein 2G4    622   0.0      Glycine max [soybeans]
ref|XP_002262986.2|  PREDICTED: proliferation-associated protein 2G4    622   0.0      Vitis vinifera
gb|KHN42848.1|  Proliferation-associated protein 2G4                    621   0.0      Glycine soja [wild soybean]
ref|XP_008805004.1|  PREDICTED: proliferation-associated protein ...    621   0.0      Phoenix dactylifera
ref|NP_001241588.1|  uncharacterized protein LOC100781302               620   0.0      Glycine max [soybeans]
ref|XP_011046861.1|  PREDICTED: proliferation-associated protein ...    620   0.0      Populus euphratica
ref|XP_006576221.1|  PREDICTED: uncharacterized protein LOC100784...    620   0.0      
gb|KHN39558.1|  Proliferation-associated protein 2G4                    620   0.0      Glycine soja [wild soybean]
ref|XP_011095038.1|  PREDICTED: proliferation-associated protein ...    619   0.0      Sesamum indicum [beniseed]
ref|XP_007140242.1|  hypothetical protein PHAVU_008G095800g             619   0.0      Phaseolus vulgaris [French bean]
gb|EYU41925.1|  hypothetical protein MIMGU_mgv1a007938mg                619   0.0      Erythranthe guttata [common monkey flower]
ref|XP_010937887.1|  PREDICTED: proliferation-associated protein ...    619   0.0      Elaeis guineensis
gb|KJB17053.1|  hypothetical protein B456_002G262700                    618   0.0      Gossypium raimondii
ref|XP_007140243.1|  hypothetical protein PHAVU_008G095900g             618   0.0      Phaseolus vulgaris [French bean]
gb|AEY75257.1|  putative DNA binding protein                            618   0.0      Atriplex canescens [shadscale]
ref|XP_010920808.1|  PREDICTED: proliferation-associated protein ...    618   0.0      Elaeis guineensis
gb|KHG25370.1|  Proliferation-associated 2G4                            617   0.0      Gossypium arboreum [tree cotton]
ref|XP_009384793.1|  PREDICTED: proliferation-associated protein ...    617   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011077533.1|  PREDICTED: proliferation-associated protein ...    617   0.0      Sesamum indicum [beniseed]
ref|XP_009402229.1|  PREDICTED: proliferation-associated protein ...    617   0.0      Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004492468.1|  PREDICTED: proliferation-associated protein ...    616   0.0      Cicer arietinum [garbanzo]
ref|NP_001242070.1|  uncharacterized protein LOC100784176               616   0.0      
ref|XP_006843644.2|  PREDICTED: proliferation-associated protein 2G4    616   0.0      Amborella trichopoda
ref|XP_004489059.1|  PREDICTED: proliferation-associated protein ...    615   0.0      Cicer arietinum [garbanzo]
gb|KEH38647.1|  proliferation-associated 2G4-like protein               615   0.0      Medicago truncatula
gb|KHG01253.1|  Proliferation-associated 2G4                            615   0.0      Gossypium arboreum [tree cotton]
ref|XP_002308228.2|  hypothetical protein POPTR_0006s10320g             615   0.0      
ref|XP_010907411.1|  PREDICTED: proliferation-associated protein ...    614   0.0      Elaeis guineensis
ref|XP_002322994.2|  hypothetical protein POPTR_0016s12720g             613   0.0      
gb|KJB36944.1|  hypothetical protein B456_006G183700                    613   0.0      Gossypium raimondii
ref|XP_010676777.1|  PREDICTED: proliferation-associated protein 2G4    612   0.0      Beta vulgaris subsp. vulgaris [field beet]
gb|KJB36946.1|  hypothetical protein B456_006G183700                    612   0.0      Gossypium raimondii
ref|XP_008792800.1|  PREDICTED: proliferation-associated protein ...    612   0.0      Phoenix dactylifera
ref|XP_004489058.1|  PREDICTED: proliferation-associated protein ...    615   0.0      
ref|XP_010650887.1|  PREDICTED: proliferation-associated protein ...    608   0.0      
ref|XP_002278744.2|  PREDICTED: proliferation-associated protein ...    608   0.0      Vitis vinifera
ref|XP_008789134.1|  PREDICTED: proliferation-associated protein ...    608   0.0      Phoenix dactylifera
ref|XP_002440927.1|  hypothetical protein SORBIDRAFT_09g016610          606   0.0      Sorghum bicolor [broomcorn]
ref|NP_001149216.1|  proliferation-associated protein 2G4               606   0.0      Zea mays [maize]
ref|XP_010920804.1|  PREDICTED: proliferation-associated protein ...    607   0.0      
gb|ADK78215.1|  methionine aminopeptiase                                605   0.0      Hordeum vulgare [barley]
ref|XP_004962368.1|  PREDICTED: proliferation-associated protein ...    604   0.0      Setaria italica
gb|AHA84129.1|  DNA-binding protein GBP16                               602   0.0      Phaseolus vulgaris [French bean]
ref|XP_010553237.1|  PREDICTED: proliferation-associated protein ...    601   0.0      Tarenaya hassleriana [spider flower]
gb|AFG29445.1|  Erb3 binding protein                                    602   0.0      Nervilia fordii
ref|XP_010092793.1|  Proliferation-associated protein 2G4               601   0.0      
ref|XP_010253797.1|  PREDICTED: proliferation-associated protein ...    600   0.0      Nelumbo nucifera [Indian lotus]
ref|XP_003568643.1|  PREDICTED: proliferation-associated protein 2G4    599   0.0      Brachypodium distachyon [annual false brome]
ref|XP_004302550.1|  PREDICTED: proliferation-associated protein 2G4    599   0.0      Fragaria vesca subsp. vesca
gb|AAF91445.1|AF281652_1  putative DNA binding protein                  598   0.0      Atriplex hortensis
gb|EMT31637.1|  Proliferation-associated protein 2G4                    600   0.0      
gb|AGV54689.1|  proliferation-associated protein 2G4-like protein       595   0.0      Phaseolus vulgaris [French bean]
ref|XP_010529897.1|  PREDICTED: proliferation-associated protein ...    595   0.0      Tarenaya hassleriana [spider flower]
gb|ABK24337.1|  unknown                                                 594   0.0      Picea sitchensis
gb|EMS60472.1|  Proliferation-associated protein 2G4                    598   0.0      Triticum urartu
gb|EAY97646.1|  hypothetical protein OsI_19569                          592   0.0      Oryza sativa Indica Group [Indian rice]
ref|NP_001055274.1|  Os05g0350500                                       591   0.0      
ref|XP_006654286.1|  PREDICTED: proliferation-associated protein ...    588   0.0      Oryza brachyantha
ref|XP_002988189.1|  hypothetical protein SELMODRAFT_127648             581   0.0      
ref|XP_002963479.1|  hypothetical protein SELMODRAFT_79780              581   0.0      
gb|AAB80919.1|  DNA-binding protein GBP16                               579   0.0      Oryza sativa Japonica Group [Japonica rice]
gb|KFK34423.1|  hypothetical protein AALP_AA5G142900                    577   0.0      Arabis alpina [alpine rockcress]
ref|XP_001779761.1|  predicted protein                                  574   0.0      
emb|CDX73690.1|  BnaC08g23130D                                          573   0.0      
ref|XP_009115883.1|  PREDICTED: proliferation-associated protein ...    573   0.0      Brassica rapa
ref|XP_009115882.1|  PREDICTED: proliferation-associated protein ...    573   0.0      Brassica rapa
ref|XP_009123761.1|  PREDICTED: proliferation-associated protein ...    573   0.0      Brassica rapa
ref|XP_008792832.1|  PREDICTED: proliferation-associated protein ...    571   0.0      
emb|CDX78041.1|  BnaA09g32360D                                          572   0.0      
emb|CDY33263.1|  BnaA01g19300D                                          570   0.0      Brassica napus [oilseed rape]
ref|NP_001190060.1|  putative nuclear DNA-binding protein G2p           570   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDY16291.1|  BnaC01g23260D                                          570   0.0      Brassica napus [oilseed rape]
ref|NP_190748.1|  putative nuclear DNA-binding protein G2p              569   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_002877825.1|  hypothetical protein ARALYDRAFT_906530             569   0.0      Arabidopsis lyrata subsp. lyrata
dbj|BAH19507.1|  AT3G51800                                              567   0.0      Arabidopsis thaliana [mouse-ear cress]
gb|AAK25936.1|AF360226_1  putative nuclear DNA-binding protein G2p      568   0.0      Arabidopsis thaliana [mouse-ear cress]
ref|XP_006403880.1|  hypothetical protein EUTSA_v10010435mg             566   0.0      Eutrema salsugineum [saltwater cress]
ref|XP_001769950.1|  predicted protein                                  563   0.0      
ref|XP_010920806.1|  PREDICTED: proliferation-associated protein ...    564   0.0      
ref|NP_850679.1|  putative nuclear DNA-binding protein G2p              560   0.0      Arabidopsis thaliana [mouse-ear cress]
emb|CDX90633.1|  BnaA03g41480D                                          559   0.0      
ref|XP_009136636.1|  PREDICTED: proliferation-associated protein ...    559   0.0      Brassica rapa
gb|KJB36945.1|  hypothetical protein B456_006G183700                    556   0.0      Gossypium raimondii
emb|CDY29047.1|  BnaC07g32530D                                          551   0.0      Brassica napus [oilseed rape]
ref|XP_010515611.1|  PREDICTED: proliferation-associated protein ...    550   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010426749.1|  PREDICTED: proliferation-associated protein ...    550   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_010503881.1|  PREDICTED: proliferation-associated protein ...    547   0.0      Camelina sativa [gold-of-pleasure]
ref|XP_009799003.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    540   0.0      Nicotiana sylvestris
gb|ERN05319.1|  hypothetical protein AMTR_s00007p00167240               538   0.0      Amborella trichopoda
ref|XP_008366899.1|  PREDICTED: proliferation-associated protein ...    539   0.0      
ref|XP_006291295.1|  hypothetical protein CARUB_v10017431mg             531   0.0      
gb|EEE63363.1|  hypothetical protein OsJ_18175                          519   1e-177   Oryza sativa Japonica Group [Japonica rice]
gb|KHN22549.1|  Proliferation-associated protein 2G4                    513   7e-176   Glycine soja [wild soybean]
ref|XP_001765994.1|  predicted protein                                  503   4e-171   
ref|XP_010907413.1|  PREDICTED: proliferation-associated protein ...    489   5e-166   
ref|XP_007026647.1|  Metallopeptidase M24 family protein isoform 2      480   1e-163   
gb|KJB17056.1|  hypothetical protein B456_002G262700                    476   5e-162   Gossypium raimondii
ref|XP_006381246.1|  hypothetical protein POPTR_0006s10320g             473   6e-161   
gb|KHN20329.1|  Proliferation-associated protein 2G4                    431   3e-144   Glycine soja [wild soybean]
gb|ACU22749.1|  unknown                                                 422   5e-141   Glycine max [soybeans]
gb|KJB36949.1|  hypothetical protein B456_006G183700                    418   3e-139   Gossypium raimondii
ref|XP_005650680.1|  proliferation-associated protein 1                 409   7e-134   Coccomyxa subellipsoidea C-169
ref|XP_002947167.1|  hypothetical protein VOLCADRAFT_79596              401   4e-131   Volvox carteri f. nagariensis
ref|XP_001699126.1|  hypothetical protein CHLREDRAFT_139416             390   5e-127   Chlamydomonas reinhardtii
gb|KIZ00762.1|  hypothetical protein MNEG_7198                          387   7e-126   Monoraphidium neglectum
gb|ABR26103.1|  proliferation-associated protein 2g4                    370   2e-121   Oryza sativa Indica Group [Indian rice]
gb|ACU19222.1|  unknown                                                 368   1e-120   Glycine max [soybeans]
ref|XP_002508417.1|  predicted protein                                  369   6e-119   Micromonas commoda
ref|XP_010040429.1|  PREDICTED: proliferation-associated protein ...    358   1e-116   
gb|KCW45226.1|  hypothetical protein EUGRSUZ_L01140                     358   3e-115   Eucalyptus grandis [rose gum]
ref|XP_003062941.1|  predicted protein                                  355   2e-113   Micromonas pusilla CCMP1545
ref|XP_011653701.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    348   6e-113   Cucumis sativus [cucumbers]
ref|XP_003084394.1|  putative DNA-binding protein GBP16 (ISS)           347   2e-110   
emb|CEG00817.1|  Peptidase M24, methionine aminopeptidase               347   3e-110   Ostreococcus tauri
ref|XP_011400941.1|  Proliferation-associated protein A                 342   7e-109   Auxenochlorella protothecoides
ref|XP_006629280.1|  PREDICTED: proliferation-associated protein ...    342   6e-108   Lepisosteus oculatus
ref|XP_009041985.1|  hypothetical protein AURANDRAFT_55591              341   1e-107   Aureococcus anophagefferens
ref|XP_004544946.1|  PREDICTED: proliferation-associated protein ...    340   5e-107   Maylandia zebra
ref|XP_005311138.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    339   5e-107   Chrysemys picta bellii
ref|XP_007253393.1|  PREDICTED: proliferation-associated protein ...    339   6e-107   Astyanax mexicanus [blind cave fish]
ref|XP_006807648.1|  PREDICTED: proliferation-associated protein ...    338   1e-106   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005741395.1|  PREDICTED: proliferation-associated protein ...    338   2e-106   Pundamilia nyererei
ref|NP_001002070.1|  proliferation-associated 2G4, a                    338   2e-106   Danio rerio [leopard danio]
ref|XP_008294311.1|  PREDICTED: proliferation-associated protein 2G4    337   2e-106   Stegastes partitus
ref|XP_010747198.1|  PREDICTED: proliferation-associated protein 2G4    337   4e-106   Larimichthys crocea [croceine croaker]
ref|XP_004085494.1|  PREDICTED: proliferation-associated protein ...    336   5e-106   Oryzias latipes [Japanese rice fish]
ref|WP_028832180.1|  hypothetical protein                               336   7e-106   
ref|XP_003441515.1|  PREDICTED: proliferation-associated protein ...    336   8e-106   Oreochromis niloticus
ref|XP_008318205.1|  PREDICTED: proliferation-associated protein ...    334   3e-105   Cynoglossus semilaevis [half-smooth tongue sole]
gb|AAH44287.1|  Pa2g4 protein                                           334   3e-105   Xenopus laevis [clawed frog]
ref|XP_003223249.1|  PREDICTED: proliferation-associated protein 2G4    334   5e-105   Anolis carolinensis [Carolina anole]
emb|CAJ82581.1|  proliferation-associated 2G4                           333   5e-105   Xenopus tropicalis [western clawed frog]
ref|XP_008877833.1|  DNA-binding protein, 42 kDa                        334   7e-105   Aphanomyces invadans
ref|XP_001363571.1|  PREDICTED: proliferation-associated protein 2G4    333   8e-105   Monodelphis domestica
ref|NP_001008439.1|  ErbB3-binding protein 1                            333   1e-104   Xenopus tropicalis [western clawed frog]
gb|ELR50756.1|  Proliferation-associated protein 2G4                    333   1e-104   Bos mutus
ref|XP_009039553.1|  hypothetical protein AURANDRAFT_54512              333   1e-104   Aureococcus anophagefferens
ref|XP_005876787.1|  PREDICTED: proliferation-associated protein 2G4    333   1e-104   Myotis brandtii
ref|XP_008619458.1|  hypothetical protein SDRG_15074                    333   1e-104   Saprolegnia diclina VS20
gb|KDO19442.1|  DNA-binding protein                                     333   1e-104   Saprolegnia parasitica CBS 223.65
ref|XP_005371237.1|  PREDICTED: proliferation-associated protein 2G4    333   2e-104   Microtus ochrogaster [prairie voles]
ref|XP_005335677.1|  PREDICTED: proliferation-associated protein 2G4    332   2e-104   Ictidomys tridecemlineatus
ref|XP_006908945.1|  PREDICTED: proliferation-associated protein 2G4    332   4e-104   Pteropus alecto
gb|ADX97052.1|  proliferation-associated protein 2g4                    332   4e-104   Perca flavescens
ref|XP_005799891.1|  PREDICTED: proliferation-associated protein ...    331   7e-104   Xiphophorus maculatus
ref|NP_001029871.1|  proliferation-associated protein 2G4               331   7e-104   Bos taurus [bovine]
ref|XP_007533407.1|  PREDICTED: proliferation-associated protein 2G4    331   7e-104   Erinaceus europaeus [common hedgehog]
ref|NP_001083993.1|  proliferation-associated 2G4, 38kD                 331   8e-104   Xenopus laevis [clawed frog]
ref|XP_008279469.1|  PREDICTED: proliferation-associated protein ...    331   9e-104   Stegastes partitus
ref|XP_010764812.1|  PREDICTED: proliferation-associated protein 2G4    330   1e-103   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_004006644.1|  PREDICTED: proliferation-associated protein 2G4    330   2e-103   
ref|NP_001085830.1|  ErbB3-binding protein 1                            330   2e-103   Xenopus laevis [clawed frog]
ref|XP_003448224.1|  PREDICTED: proliferation-associated protein ...    329   3e-103   Oreochromis niloticus
ref|XP_001504854.1|  PREDICTED: proliferation-associated protein ...    329   4e-103   
ref|XP_002163189.2|  PREDICTED: proliferation-associated protein ...    329   5e-103   Hydra vulgaris
ref|XP_006179892.1|  PREDICTED: proliferation-associated protein 2G4    329   5e-103   Camelus ferus
ref|XP_003405168.1|  PREDICTED: proliferation-associated protein 2G4    328   5e-103   Loxodonta africana [African bush elephant]
emb|CAG06775.1|  unnamed protein product                                328   6e-103   Tetraodon nigroviridis
ref|XP_005801435.1|  PREDICTED: proliferation-associated protein ...    328   6e-103   Xiphophorus maculatus
emb|CDQ74715.1|  unnamed protein product                                328   7e-103   Oncorhynchus mykiss
gb|ACI33868.1|  Proliferation-associated protein 2G4                    328   9e-103   Salmo salar
ref|XP_004558839.1|  PREDICTED: proliferation-associated protein ...    328   1e-102   Maylandia zebra
ref|NP_001004206.1|  proliferation-associated protein 2G4               328   1e-102   Rattus norvegicus [brown rat]
gb|AAH03777.1|  Pa2g4 protein                                           327   1e-102   Mus musculus [mouse]
ref|XP_007559711.1|  PREDICTED: proliferation-associated protein 2G4    328   1e-102   Poecilia formosa
ref|XP_007953297.1|  PREDICTED: proliferation-associated protein 2G4    327   2e-102   Orycteropus afer afer
ref|XP_008846918.1|  PREDICTED: proliferation-associated protein 2G4    327   2e-102   
ref|NP_035249.1|  proliferation-associated protein 2G4                  327   2e-102   Mus musculus [mouse]
dbj|BAF84485.1|  unnamed protein product                                327   2e-102   Homo sapiens [man]
ref|XP_004379999.1|  PREDICTED: proliferation-associated protein 2G4    327   2e-102   Trichechus manatus latirostris
ref|XP_002752647.1|  PREDICTED: proliferation-associated protein 2G4    327   2e-102   Callithrix jacchus [common marmoset]
ref|XP_006859475.1|  PREDICTED: proliferation-associated protein 2G4    327   2e-102   Chrysochloris asiatica
dbj|BAE25986.1|  unnamed protein product                                327   2e-102   Mus musculus [mouse]
ref|XP_002711114.1|  PREDICTED: proliferation-associated protein 2G4    327   2e-102   Oryctolagus cuniculus [domestic rabbit]
gb|AAH32111.1|  PA2G4 protein                                           327   2e-102   Homo sapiens [man]
ref|XP_008408124.1|  PREDICTED: proliferation-associated protein 2G4    327   2e-102   Poecilia reticulata
ref|XP_003506238.1|  PREDICTED: proliferation-associated protein 2G4    327   2e-102   Cricetulus griseus [Chinese hamsters]
ref|NP_001271715.1|  uncharacterized protein LOC101867185               327   2e-102   Macaca fascicularis [crab eating macaque]
ref|XP_008411912.1|  PREDICTED: proliferation-associated protein ...    327   3e-102   Poecilia reticulata
ref|XP_005397344.1|  PREDICTED: proliferation-associated protein 2G4    327   3e-102   Chinchilla lanigera
ref|XP_007556640.1|  PREDICTED: proliferation-associated protein ...    327   3e-102   Poecilia formosa
ref|XP_004274221.1|  PREDICTED: proliferation-associated protein 2G4    327   3e-102   
ref|XP_010348255.1|  PREDICTED: proliferation-associated protein 2G4    327   3e-102   Saimiri boliviensis boliviensis
ref|XP_003476243.1|  PREDICTED: proliferation-associated protein 2G4    327   3e-102   Cavia porcellus [guinea pig]
ref|NP_006182.2|  proliferation-associated protein 2G4                  327   3e-102   Homo sapiens [man]
pdb|2Q8K|A  Chain A, The Crystal Structure Of Ebp1                      327   4e-102   Homo sapiens [man]
ref|XP_004589712.1|  PREDICTED: proliferation-associated protein 2G4    327   4e-102   Ochotona princeps [southern American pika]
ref|XP_003973252.1|  PREDICTED: proliferation-associated protein 2G4    326   4e-102   
emb|CDQ89185.1|  unnamed protein product                                327   4e-102   Oncorhynchus mykiss
ref|XP_004700624.1|  PREDICTED: proliferation-associated protein 2G4    327   4e-102   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_010643016.1|  PREDICTED: proliferation-associated protein 2G4    327   4e-102   Fukomys damarensis [Damara mole rat]
ref|XP_009179195.1|  PREDICTED: proliferation-associated protein 2G4    326   4e-102   
ref|XP_010879916.1|  PREDICTED: proliferation-associated protein ...    326   5e-102   Esox lucius
gb|ADT71645.1|  proliferation associated 2G4                            326   5e-102   Mesocricetus auratus [Syrian golden hamster]
gb|EHH20847.1|  Cell cycle protein p38-2G4-like protein                 326   6e-102   Macaca mulatta [rhesus macaque]
ref|XP_008317097.1|  PREDICTED: proliferation-associated protein ...    326   6e-102   Cynoglossus semilaevis [half-smooth tongue sole]
gb|AAB91536.1|  cell cycle protein p38-2G4 homolog                      326   7e-102   Homo sapiens [man]
gb|AFM86347.1|  proliferation-associated 2G4                            325   7e-102   Callorhinchus milii [Australian ghost shark]
gb|ACI33074.1|  Proliferation-associated protein 2G4                    326   8e-102   Salmo salar
ref|XP_001422365.1|  predicted protein                                  325   8e-102   Ostreococcus lucimarinus CCE9901
ref|XP_004093117.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    325   9e-102   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_004601656.1|  PREDICTED: proliferation-associated protein 2G4    325   9e-102   Sorex araneus [Eurasian shrew]
ref|XP_006165654.1|  PREDICTED: proliferation-associated protein 2G4    325   1e-101   Tupaia chinensis
ref|XP_004692692.1|  PREDICTED: proliferation-associated protein 2G4    325   1e-101   Condylura cristata
ref|NP_001279838.1|  proliferation-associated 2G4, 38kDa                325   2e-101   Callorhinchus milii [Australian ghost shark]
ref|XP_002423336.1|  Proliferation-associated protein 2G4, putative     324   2e-101   Pediculus humanus corporis [human body lice]
ref|XP_009839077.1|  DNA-binding protein, 42 kDa                        324   3e-101   Aphanomyces astaci
ref|XP_008066667.1|  PREDICTED: proliferation-associated protein 2G4    323   3e-101   
emb|CDQ85755.1|  unnamed protein product                                324   3e-101   Oncorhynchus mykiss
gb|ACO10060.1|  Proliferation-associated protein 2G4                    323   6e-101   Osmerus mordax
ref|XP_010865536.1|  PREDICTED: proliferation-associated protein ...    323   7e-101   Esox lucius
gb|AFM85909.1|  proliferation-associated 2G4                            322   7e-101   Callorhinchus milii [Australian ghost shark]
ref|XP_010782747.1|  PREDICTED: proliferation-associated protein ...    323   8e-101   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_003963121.1|  PREDICTED: proliferation-associated protein ...    323   9e-101   Takifugu rubripes [tiger puffer]
ref|XP_004070502.1|  PREDICTED: proliferation-associated protein ...    322   2e-100   Oryzias latipes [Japanese rice fish]
ref|NP_997806.1|  proliferation-associated 2G4-like                     322   2e-100   Danio rerio [leopard danio]
ref|XP_006897700.1|  PREDICTED: proliferation-associated protein 2G4    322   2e-100   Elephantulus edwardii [Cape long-eared elephant shrew]
pdb|2V6C|A  Chain A, Crystal Structure Of Erbb3 Binding Protein 1...    320   3e-100   Mus musculus [mouse]
ref|NP_001124717.1|  proliferation-associated protein 2G4               322   3e-100   Pongo abelii [orang utan]
gb|AFK36627.1|  unknown                                                 314   4e-100   Lotus japonicus
ref|XP_004931156.1|  PREDICTED: proliferation-associated protein ...    321   4e-100   Bombyx mori [silk moth]
gb|AAC34392.1|  PAS1                                                    321   5e-100   Takifugu rubripes [tiger puffer]
ref|XP_010745944.1|  PREDICTED: proliferation-associated protein ...    321   5e-100   Larimichthys crocea [croceine croaker]
ref|XP_004649070.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    321   5e-100   Octodon degus
ref|XP_009533169.1|  methionine aminopeptidase, merops subfamily M24    320   1e-99    Phytophthora sojae
ref|XP_004466155.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    320   2e-99    
ref|XP_002734317.1|  PREDICTED: proliferation-associated protein ...    319   3e-99    Saccoglossus kowalevskii
gb|AAH19222.1|  PA2G4 protein                                           319   3e-99    Homo sapiens [man]
emb|CDQ78322.1|  unnamed protein product                                320   3e-99    Oncorhynchus mykiss
gb|EFX72560.1|  hypothetical protein DAPPUDRAFT_308181                  318   5e-99    Daphnia pulex
ref|XP_009011773.1|  hypothetical protein HELRODRAFT_156370             318   8e-99    Helobdella robusta
gb|ELT99251.1|  hypothetical protein CAPTEDRAFT_152656                  317   1e-98    Capitella teleta
gb|ETL29090.1|  DNA-binding protein, 42 kDa                             317   1e-98    Phytophthora parasitica
ref|XP_008912890.1|  DNA-binding protein, 42 kDa                        317   1e-98    Phytophthora parasitica INRA-310
gb|KFO54080.1|  Proliferation-associated protein 2G4                    315   2e-98    Corvus brachyrhynchos
ref|XP_969584.1|  PREDICTED: proliferation-associated protein 2G4       316   2e-98    Tribolium castaneum [rust-red flour beetle]
ref|XP_001647519.1|  predicted protein                                  316   3e-98    Nematostella vectensis
ref|XP_011551308.1|  PREDICTED: proliferation-associated protein 2G4    316   4e-98    Plutella xylostella [cabbage moth]
emb|CBK24689.2|  unnamed protein product                                315   9e-98    Blastocystis hominis
ref|XP_006131250.1|  PREDICTED: proliferation-associated protein 2G4    314   1e-97    Pelodiscus sinensis [Chinese softshell turtle]
gb|ELK15270.1|  Proliferation-associated protein 2G4                    328   1e-97    Pteropus alecto
gb|KDR23244.1|  Proliferation-associated protein 2G4                    315   1e-97    Zootermopsis nevadensis
ref|XP_002900555.1|  proliferation-associated protein, metallopro...    315   2e-97    Phytophthora infestans T30-4
ref|XP_006291296.1|  hypothetical protein CARUB_v10017431mg             310   2e-97    
ref|XP_011173347.1|  PREDICTED: proliferation-associated protein 2G4    314   2e-97    
ref|XP_011704584.1|  PREDICTED: proliferation-associated protein 2G4    314   2e-97    
ref|XP_005705833.1|  DNA binding protein                                315   2e-97    
gb|KGL81710.1|  Proliferation-associated protein 2G4                    312   3e-97    
gb|KFP07640.1|  Proliferation-associated protein 2G4                    312   3e-97    
gb|KFQ91587.1|  Proliferation-associated protein 2G4                    312   3e-97    
gb|EFZ09337.1|  hypothetical protein SINV_15911                         314   4e-97    
gb|KFV87572.1|  Proliferation-associated protein 2G4                    311   5e-97    
gb|KFM08039.1|  Proliferation-associated protein 2G4                    311   6e-97    
ref|XP_011209005.1|  PREDICTED: proliferation-associated protein 2G4    313   7e-97    
ref|XP_009468808.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    312   8e-97    
gb|KFP09829.1|  Proliferation-associated protein 2G4                    310   1e-96    
ref|XP_011643853.1|  PREDICTED: proliferation-associated protein 2G4    312   1e-96    
gb|KFO08279.1|  Proliferation-associated protein 2G4                    310   1e-96    
ref|XP_011306002.1|  PREDICTED: proliferation-associated protein 2G4    312   1e-96    
ref|XP_009278316.1|  PREDICTED: proliferation-associated protein 2G4    311   1e-96    
gb|KFP66746.1|  Proliferation-associated protein 2G4                    310   1e-96    
ref|XP_012062548.1|  PREDICTED: proliferation-associated protein 2G4    311   2e-96    
gb|KGL92866.1|  Proliferation-associated protein 2G4                    310   2e-96    
ref|XP_002047403.1|  GJ11948                                            312   2e-96    
gb|EQB77766.1|  hypothetical protein CB1_000449019                      325   2e-96    
ref|XP_011263181.1|  PREDICTED: proliferation-associated protein 2G4    311   2e-96    
gb|KFV99294.1|  Proliferation-associated protein 2G4                    310   2e-96    
ref|XP_011340977.1|  PREDICTED: proliferation-associated protein 2G4    311   3e-96    
ref|XP_011180648.1|  PREDICTED: proliferation-associated protein 2G4    311   3e-96    
ref|XP_423059.4|  PREDICTED: proliferation-associated protein 2G4       310   3e-96    
ref|XP_003703942.1|  PREDICTED: proliferation-associated protein 2G4    311   4e-96    
ref|XP_009586223.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    310   4e-96    
ref|XP_009701955.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    310   4e-96    
ref|XP_010282642.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    310   4e-96    
ref|XP_006267753.1|  PREDICTED: proliferation-associated protein 2G4    310   5e-96    
gb|KFV16945.1|  Proliferation-associated protein 2G4                    309   5e-96    
ref|XP_009921703.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    310   6e-96    
ref|XP_006035312.1|  PREDICTED: proliferation-associated protein 2G4    310   6e-96    
ref|XP_009882846.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    310   6e-96    
ref|XP_011059200.1|  PREDICTED: proliferation-associated protein 2G4    310   7e-96    
gb|EHB06549.1|  Proliferation-associated protein 2G4                    308   7e-96    
ref|XP_001984453.1|  GH15010                                            310   7e-96    
gb|KFR05935.1|  Proliferation-associated protein 2G4                    308   8e-96    
gb|KFV11001.1|  Proliferation-associated protein 2G4                    308   9e-96    
gb|KFQ63630.1|  Proliferation-associated protein 2G4                    308   1e-95    
ref|XP_003772221.1|  PREDICTED: proliferation-associated protein 2G4    311   1e-95    
ref|XP_004890349.1|  PREDICTED: proliferation-associated protein 2G4    309   1e-95    
gb|KFO24578.1|  Proliferation-associated protein 2G4                    323   1e-95    
ref|XP_780193.1|  PREDICTED: proliferation-associated protein 2G4       310   2e-95    
ref|XP_004525166.1|  PREDICTED: proliferation-associated protein ...    310   2e-95    
gb|KFU89768.1|  Proliferation-associated protein 2G4                    307   2e-95    
ref|XP_002007862.1|  GI13173                                            309   2e-95    
gb|EOA93068.1|  Proliferation-associated protein 2G4                    306   3e-95    
gb|KCW45224.1|  hypothetical protein EUGRSUZ_L01138                     302   3e-95    
ref|XP_005826372.1|  hypothetical protein GUITHDRAFT_96731              308   4e-95    
ref|XP_011865080.1|  PREDICTED: proliferation-associated protein 2G4    307   7e-95    
gb|KDD75813.1|  hypothetical protein H632_c489p2                        306   9e-95    
ref|XP_003741970.1|  PREDICTED: proliferation-associated protein ...    306   1e-94    
ref|XP_002116398.1|  hypothetical protein TRIADDRAFT_64279              306   2e-94    
ref|XP_003689614.1|  PREDICTED: proliferation-associated protein ...    305   3e-94    
ref|XP_009641743.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    308   5e-94    
gb|ACO12262.1|  Proliferation-associated protein 2G4                    305   7e-94    
ref|XP_011154366.1|  PREDICTED: proliferation-associated protein 2G4    305   8e-94    
gb|EHJ70953.1|  hypothetical protein KGM_14785                          304   1e-93    
ref|XP_005533908.1|  PREDICTED: proliferation-associated protein 2G4    305   1e-93    
ref|XP_006615964.1|  PREDICTED: proliferation-associated protein ...    304   1e-93    
ref|XP_005184671.1|  PREDICTED: proliferation-associated protein 2G4    304   1e-93    
ref|XP_006560659.1|  PREDICTED: proliferation-associated protein ...    304   2e-93    
ref|XP_002141587.1|  proliferation-associated protein 2G4               303   2e-93    
gb|AAV36985.2|  LD30448p                                                303   2e-93    
ref|XP_002062021.1|  GK16873                                            303   3e-93    
ref|XP_001957516.1|  GF10449                                            303   3e-93    
ref|NP_647984.1|  CG10576, isoform A                                    303   4e-93    
ref|XP_005793747.1|  proliferation-associated protein 2G4               302   4e-93    
ref|XP_002093823.1|  GE20541                                            301   1e-92    
dbj|BAM19228.1|  proliferation-associated 2g4                           301   1e-92    
ref|XP_003485618.1|  PREDICTED: proliferation-associated protein ...    300   3e-92    
ref|XP_003383390.1|  PREDICTED: proliferation-associated protein ...    300   3e-92    
ref|XP_003394756.1|  PREDICTED: proliferation-associated protein ...    300   3e-92    
emb|CCA18784.1|  proliferationassociated protein putative               300   3e-92    
ref|XP_002035467.1|  GM13901                                            300   4e-92    
ref|XP_011419861.1|  PREDICTED: proliferation-associated protein ...    300   4e-92    
ref|XP_002083760.1|  GD13178                                            300   4e-92    
emb|CCI48095.1|  unnamed protein product                                300   4e-92    
gb|ENN76413.1|  hypothetical protein YQE_07074                          300   5e-92    
emb|CAG07405.1|  unnamed protein product                                301   5e-92    
ref|XP_007423593.1|  PREDICTED: proliferation-associated protein 2G4    298   5e-92    
ref|XP_005431428.1|  PREDICTED: proliferation-associated protein ...    298   5e-92    
gb|AEE62360.1|  unknown                                                 300   7e-92    
ref|XP_001134549.1|  proliferation associated protein                   299   8e-92    
gb|EFA84439.1|  proliferation associated protein                        299   1e-91    
tpg|DAA34047.1|  TPA: metallopeptidase                                  298   1e-91    
ref|XP_008549132.1|  PREDICTED: proliferation-associated protein 2G4    299   1e-91    
ref|XP_001972015.1|  GG14116                                            298   2e-91    
ref|XP_005769829.1|  proliferation-associated protein 2G4               300   3e-91    
ref|XP_626802.1|  proliferation-associated protein 2G4 metallopro...    298   3e-91    
gb|ETE68956.1|  Proliferation-associated protein 2G4                    297   3e-91    
ref|XP_008641741.1|  PREDICTED: proliferation-associated protein 2G4    296   4e-91    
ref|XP_008472310.1|  PREDICTED: proliferation-associated protein 2G4    298   4e-91    
gb|AAB03665.1|  PrlA                                                    297   5e-91    
emb|CAA59260.1|  p38-2G4                                                296   5e-91    
gb|AAD00646.1|  erbB3 binding protein EBP1                              295   7e-91    
ref|XP_007508742.1|  predicted protein                                  297   8e-91    
ref|XP_007064970.1|  PREDICTED: proliferation-associated protein 2G4    295   2e-90    
ref|XP_005095772.1|  PREDICTED: proliferation-associated protein ...    296   2e-90    
dbj|GAM23516.1|  hypothetical protein SAMD00019534_066910               296   2e-90    
ref|XP_001913309.1|  proliferation-associated protein 1                 295   3e-90    
ref|XP_666677.1|  nuclear DNA-binding protein G2p -related              295   3e-90    
ref|XP_003880798.1|  methionine aminopeptidase,related                  296   3e-90    
ref|XP_011502791.1|  PREDICTED: proliferation-associated protein 2G4    295   3e-90    
gb|EWM29247.1|  proliferation-associated protein 2g4                    306   5e-90    
ref|XP_001353865.1|  GA10407                                            295   6e-90    
ref|XP_010219357.1|  PREDICTED: proliferation-associated protein 2G4    293   8e-90    
ref|XP_008500839.1|  PREDICTED: proliferation-associated protein 2G4    292   1e-89    
ref|XP_006987432.1|  PREDICTED: proliferation-associated protein 2G4    293   1e-89    
ref|XP_009685364.1|  PREDICTED: proliferation-associated protein 2G4    292   1e-89    
ref|XP_004029906.1|  hypothetical protein IMG5_170920                   293   1e-89    
ref|XP_009485967.1|  PREDICTED: proliferation-associated protein 2G4    291   2e-89    
ref|XP_001865752.1|  proliferation-associated 2g4                       295   2e-89    
ref|XP_009557265.1|  PREDICTED: proliferation-associated protein 2G4    291   3e-89    
ref|XP_005235817.1|  PREDICTED: proliferation-associated protein 2G4    291   4e-89    
ref|XP_005499208.1|  PREDICTED: proliferation-associated protein 2G4    291   4e-89    
ref|XP_010725225.1|  PREDICTED: proliferation-associated protein 2G4    290   6e-89    
ref|XP_313985.4|  AGAP005108-PA                                         292   9e-89    
ref|XP_009983110.1|  PREDICTED: proliferation-associated protein 2G4    289   1e-88    
ref|XP_002775231.1|  proliferation-associated protein 2G4 metallo...    291   1e-88    
ref|XP_005031270.1|  PREDICTED: proliferation-associated protein 2G4    289   2e-88    
ref|XP_001010313.1|  metallopeptidase family M24 containing protein     290   2e-88    
ref|XP_003284133.1|  hypothetical protein DICPUDRAFT_52698              290   2e-88    
ref|XP_009996179.1|  PREDICTED: proliferation-associated protein 2G4    289   2e-88    
ref|XP_009929445.1|  PREDICTED: proliferation-associated protein 2G4    289   3e-88    
ref|XP_006815930.1|  PREDICTED: proliferation-associated protein ...    288   4e-88    
ref|XP_002290444.1|  DNA-binding protein                                287   9e-88    
gb|KFB44440.1|  AGAP005108-PA-like protein                              290   1e-87    
ref|XP_008887722.1|  proliferation-associated protein 2G4, putative     291   1e-87    
ref|XP_009052849.1|  hypothetical protein LOTGIDRAFT_115903             288   1e-87    
gb|KHN18039.1|  Proliferation-associated protein 2G4                    281   2e-87    
emb|CDW84742.1|  proliferation-associated protein 2g4                   288   3e-87    
ref|XP_005537086.1|  probable DNA binding protein                       289   3e-87    
ref|XP_002371979.1|  proliferation-associated protein 2G4, putative     289   7e-87    
gb|EPR57248.1|  putative proliferation-associated protein 2G4           289   7e-87    
ref|XP_009512308.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    283   9e-87    
gb|ERL94099.1|  hypothetical protein D910_11381                         298   1e-86    
ref|XP_002182273.1|  predicted protein                                  285   4e-86    
ref|XP_001662411.1|  AAEL012312-PA                                      286   5e-86    
ref|XP_004355743.1|  proliferation associated protein                   284   6e-86    
gb|KFH72903.1|  hypothetical protein MVEG_00128                         284   7e-86    
gb|ETN66740.1|  proliferation-associated 2g4                            285   8e-86    
ref|XP_001113953.2|  PREDICTED: receptor tyrosine-protein kinase ...    303   8e-86    
ref|XP_003790559.1|  PREDICTED: receptor tyrosine-protein kinase ...    302   1e-85    
ref|XP_002772849.1|  proliferation-associated protein 2G4 metallo...    283   2e-85    
gb|KFO74722.1|  Proliferation-associated protein 2G4                    280   2e-85    
gb|ACO15498.1|  Proliferation-associated protein 2G4                    281   4e-85    
ref|XP_005853761.1|  proliferation-associated protein 2g4               282   5e-85    
gb|EMP31026.1|  Proliferation-associated protein 2G4                    290   9e-85    
ref|XP_004348044.1|  proliferation-associated 2G4,b                     280   2e-84    
gb|EJK49958.1|  hypothetical protein THAOC_31113                        282   3e-84    
gb|KFW82865.1|  Proliferation-associated protein 2G4                    278   4e-84    
gb|EJY79371.1|  Metallopeptidase family M24 containing protein          278   1e-83    
ref|XP_007869056.1|  proliferation-associated protein 1                 278   2e-83    
ref|XP_007362719.1|  proliferation-associated protein 1                 277   3e-83    
ref|XP_004031065.1|  hypothetical protein IMG5_148130                   274   2e-82    
gb|ERG85130.1|  proliferation-associated protein 2g4                    275   2e-82    
emb|CCM00103.1|  predicted protein                                      275   3e-82    
gb|EMD34055.1|  hypothetical protein CERSUDRAFT_117563                  275   3e-82    
ref|XP_006011099.1|  PREDICTED: proliferation-associated protein ...    275   3e-82    
ref|XP_005710371.1|  unnamed protein product                            274   6e-82    
ref|XP_009338145.1|  PREDICTED: proliferation-associated protein ...    265   7e-82    
gb|EPZ31276.1|  Peptidase M24, structural domain-containing protein     272   8e-82    
emb|CDO70649.1|  hypothetical protein BN946_scf184756.g16               273   1e-81    
ref|XP_002128302.1|  PREDICTED: proliferation-associated protein 2G4    272   3e-81    
ref|XP_002675553.1|  methionyl aminopeptidase                           271   3e-81    
gb|EFX84375.1|  hypothetical protein DAPPUDRAFT_46898                   272   3e-81    
ref|XP_001894006.1|  DNA-binding protein, 42 kDa containing protein     273   5e-81    
ref|XP_002634083.1|  Hypothetical protein CBG01629                      270   2e-80    
ref|XP_008350687.1|  PREDICTED: proliferation-associated protein ...    263   3e-80    
ref|XP_007318509.1|  hypothetical protein SERLADRAFT_467890             270   3e-80    
gb|KIK41978.1|  hypothetical protein CY34DRAFT_805412                   269   4e-80    
emb|CAX83116.1|  Proliferation-associated protein 2G4                   268   5e-80    
gb|AAX27414.2|  SJCHGC05984 protein                                     268   5e-80    
gb|EFX83265.1|  hypothetical protein DAPPUDRAFT_315717                  268   6e-80    
emb|CAX74794.1|  Proliferation-associated protein 2G4                   268   8e-80    
gb|EUC64968.1|  42 kDa curved DNA-binding protein                       268   9e-80    
gb|KDQ24453.1|  hypothetical protein PLEOSDRAFT_1067285                 268   1e-79    
ref|XP_002605416.1|  hypothetical protein BRAFLDRAFT_278505             267   1e-79    
gb|KEP52663.1|  42 kDa curved DNA-binding protein                       268   1e-79    
gb|EFX62733.1|  hypothetical protein DAPPUDRAFT_67763                   268   2e-79    
dbj|BAJ87032.1|  predicted protein                                      268   2e-79    
gb|KDQ57326.1|  hypothetical protein JAAARDRAFT_35952                   267   2e-79    
ref|XP_003143613.1|  DNA-binding protein                                268   2e-79    
gb|EPT01440.1|  hypothetical protein FOMPIDRAFT_1023315                 266   5e-79    
ref|XP_001951269.1|  PREDICTED: proliferation-associated protein 2G4    266   5e-79    
ref|XP_007393682.1|  hypothetical protein PHACADRAFT_252626             266   6e-79    
ref|XP_001880628.1|  predicted protein                                  266   6e-79    
dbj|GAA35285.2|  metalloprotease ARX1                                   265   8e-79    
emb|CDJ02959.1|  Proliferation associated protein 2G4                   265   1e-78    
ref|XP_007299448.1|  proliferation-associated protein 1                 265   1e-78    
emb|CDW52768.1|  proliferation associated protein 2g4                   265   1e-78    
gb|KIK63001.1|  hypothetical protein GYMLUDRAFT_41305                   265   3e-78    
emb|CDS15413.1|  Proliferation associated protein 2G4                   264   3e-78    
gb|KIM73267.1|  hypothetical protein PILCRDRAFT_829280                  264   3e-78    
ref|XP_004992055.1|  proliferation-associated protein 2G4               262   7e-78    
emb|CBJ31951.1|  conserved unknown protein                              263   8e-78    
gb|KII85040.1|  hypothetical protein PLICRDRAFT_45151                   263   9e-78    
ref|XP_003108289.1|  hypothetical protein CRE_10205                     263   9e-78    
ref|XP_008039729.1|  proliferation-associated protein 1                 263   1e-77    
ref|XP_007383044.1|  proliferation-associated protein 1                 262   2e-77    
ref|XP_007845989.1|  pa2g4 protein                                      261   5e-77    
ref|XP_008924453.1|  PREDICTED: proliferation-associated protein 2G4    258   7e-77    
gb|EGT46940.1|  hypothetical protein CAEBREN_29895                      260   8e-77    
ref|XP_001423745.1|  hypothetical protein                               259   8e-77    
ref|XP_008656355.1|  PREDICTED: proliferation-associated protein ...    253   1e-76    
ref|XP_001452356.1|  hypothetical protein                               258   2e-76    
gb|KIO15241.1|  hypothetical protein M404DRAFT_120195                   259   2e-76    
gb|EGT53148.1|  hypothetical protein CAEBREN_04692                      259   2e-76    
gb|KIY43987.1|  proliferation-associated protein 1                      259   2e-76    
emb|CCF73397.1|  unnamed protein product                                258   6e-76    
ref|XP_009545456.1|  Metallo peptidase M24                              258   7e-76    
gb|KIK10054.1|  hypothetical protein K443DRAFT_81565                    258   8e-76    
gb|KIJ52591.1|  hypothetical protein M422DRAFT_26168                    258   9e-76    
gb|ETN87016.1|  DNA-binding protein                                     258   1e-75    
ref|XP_007262711.1|  proliferation-associated protein 1                 257   1e-75    
ref|NP_500311.1|  Protein W08E12.7                                      257   1e-75    
gb|EYC11494.1|  hypothetical protein Y032_0050g1942                     258   1e-75    



>ref|XP_008442393.1| PREDICTED: proliferation-associated protein 2G4-like [Cucumis 
melo]
Length=396

 Score =   647 bits (1668),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 321/354 (91%), Positives = 345/354 (97%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSDEEREEKELDL+SPEVVTKYKSAAEI NKAL+LV+S+CKP  ++VDICEKGD+FIREQ
Sbjct  2     MSDEEREEKELDLTSPEVVTKYKSAAEIANKALQLVISECKPKTKIVDICEKGDSFIREQ  61

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCISVNNT+CHFSPLS+D+TVLEEGDMVKID+GCHIDGFIA
Sbjct  62    TGNMYKNVKKKIERGVAFPTCISVNNTICHFSPLSSDETVLEEGDMVKIDLGCHIDGFIA  121

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH+LQEGPVTGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAA+YDCKIV
Sbjct  122   VVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAASYDCKIV  181

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKVVLSV+NPETRVDEAEFEENEVYSIDIVTSTGEGKPK+LDEKQ
Sbjct  182   EGVLSHQLKQFVIDGNKVVLSVANPETRVDEAEFEENEVYSIDIVTSTGEGKPKLLDEKQ  241

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVD+NY+LKMKASRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNHDLLQP
Sbjct  242   TTIYKRAVDRNYHLKMKASRFIFSEITQKFPIMPFTARALEEKRARLGLVECVNHDLLQP  301

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDR+T+HPLQDL  TK IDDPEIKAWLAL
Sbjct  302   YPVLHEKPGDFVAHIKFTVLLMPNGSDRVTSHPLQDLQPTKTIDDPEIKAWLAL  355



>ref|XP_004137704.1| PREDICTED: proliferation-associated protein 2G4-like [Cucumis 
sativus]
 gb|KGN58739.1| EBP1 [Cucumis sativus]
Length=393

 Score =   646 bits (1667),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 320/354 (90%), Positives = 346/354 (98%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSDEEREEKELDL+SPEVVTKYKSAAEI NKAL+LV+S+CKP A++VDICEKGD+FIREQ
Sbjct  2     MSDEEREEKELDLTSPEVVTKYKSAAEIANKALQLVISECKPKAKIVDICEKGDSFIREQ  61

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCISVNNT+CHFSPLS+D+TVLEEGDMVKID+GCHIDGFIA
Sbjct  62    TGNMYKNVKKKIERGVAFPTCISVNNTICHFSPLSSDETVLEEGDMVKIDLGCHIDGFIA  121

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH+LQEGPVTGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAA+YDCKIV
Sbjct  122   VVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAASYDCKIV  181

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKVVLSV+NPETRVDEAEFEENEVYSIDIVTSTGEGKPK+LDEKQ
Sbjct  182   EGVLSHQLKQFVIDGNKVVLSVANPETRVDEAEFEENEVYSIDIVTSTGEGKPKLLDEKQ  241

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVD+NY+LKMKASRFI+SEI+QK+P+MPFTAR LEEKRARLGLVECVNHDLLQP
Sbjct  242   TTIYKRAVDRNYHLKMKASRFIFSEITQKYPIMPFTARALEEKRARLGLVECVNHDLLQP  301

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDR+T+HPLQDL  TK IDDPEIKAWL+L
Sbjct  302   YPVLHEKPGDFVAHIKFTVLLMPNGSDRVTSHPLQDLQPTKTIDDPEIKAWLSL  355



>ref|XP_009789408.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
Length=394

 Score =   643 bits (1659),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 345/394 (88%), Positives = 376/394 (95%), Gaps = 1/394 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYK+AAEI+NKAL+LVVS+CKP A++VD+CEKGDAFI+EQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKNAAEIVNKALQLVVSECKPKAKIVDLCEKGDAFIKEQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLS+D+TVLEEGDMVKIDMGCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETVLEEGDMVKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VV HTH+LQEGPVTGRAADV+AAANTAAEVA+RLVRPG+KNSDVTEAIQKVAAAYDCKIV
Sbjct  121   VVGHTHVLQEGPVTGRAADVVAAANTAAEVALRLVRPGRKNSDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLSVSNPETRVD+AEFEENEVYSIDIVTSTGEGKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDDAEFEENEVYSIDIVTSTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+YNLKMKASRFI+SEISQKFP+MPFTARDLEEKRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYNLKMKASRFIFSEISQKFPVMPFTARDLEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALPtktk  1319
             YPVLHEKPGDLVAHIKFTVLLMPNGSDRIT H LQ+L   K I D+PEIK WLALP K+K
Sbjct  301   YPVLHEKPGDLVAHIKFTVLLMPNGSDRITTHTLQELKPAKTIEDEPEIKTWLALPVKSK  360

Query  1320  kkgggkkkkgkkgekteeAPQTEPTDEATNKSKS  1421
             KKGGGKKKK KKGEKTE++ Q EP +  +N ++S
Sbjct  361   KKGGGKKKKAKKGEKTEDSSQAEPMEGESNGAES  394



>ref|XP_009599246.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
tomentosiformis]
Length=394

 Score =   642 bits (1655),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 344/394 (87%), Positives = 376/394 (95%), Gaps = 1/394 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYK AAEI+NKAL+LVVS+CKP +++VD+CEKGDAFI+EQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKGAAEIVNKALQLVVSECKPKSKIVDLCEKGDAFIKEQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLS+D+TVLEEGD+VKIDMGCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETVLEEGDIVKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VV HTH+LQEGPVTGRAADV+AAANTAAEVA+RLVRPG+KNSDVTEAIQKVAAAYDCKIV
Sbjct  121   VVGHTHVLQEGPVTGRAADVVAAANTAAEVALRLVRPGRKNSDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLSVSNPETRVD+AEFEENEVYSIDIVTSTGEGKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDDAEFEENEVYSIDIVTSTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+YNLKMKASRFI+SEISQKFP+MPFTARDLEEKRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYNLKMKASRFIFSEISQKFPVMPFTARDLEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLALPtktk  1319
             YPVLHEKPGDLVAHIKFTVLLMPNGSDRIT H LQ+L  TK +D +PEIK WLALP KTK
Sbjct  301   YPVLHEKPGDLVAHIKFTVLLMPNGSDRITTHALQELKPTKTVDEEPEIKTWLALPVKTK  360

Query  1320  kkgggkkkkgkkgekteeAPQTEPTDEATNKSKS  1421
             KKGGGKKKK KKGEKTE++ Q EP +  +N ++S
Sbjct  361   KKGGGKKKKAKKGEKTEDSSQAEPMEGESNGAES  394



>ref|XP_006344058.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Solanum tuberosum]
Length=390

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/356 (89%), Positives = 346/356 (97%), Gaps = 1/356 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+S EVVTKYK AAEI+NKAL+LVVS+CKP A++VD+CEKGDAFI+EQ
Sbjct  1     MSDDEREEKELDLTSSEVVTKYKGAAEIVNKALQLVVSECKPKAKIVDLCEKGDAFIKEQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLS+D+T+LEEGDMVKIDMGCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETILEEGDMVKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH++Q GPVTGRAADV+AAANTAAEVA+RLVRPG+KNSDVTEAIQKVAAAYDCKIV
Sbjct  121   VVAHTHVVQGGPVTGRAADVLAAANTAAEVALRLVRPGRKNSDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLSVSNP+TRVD+AEFEENEVYSIDIVTSTG+GKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYSIDIVTSTGDGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+YNLKMKASRFI+SEISQKFP+MPFTARDLEEKRARLGLVECVNHDLLQP
Sbjct  241   TTIYKRAVDKSYNLKMKASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHDLLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALP  1307
             YPVLHEKPGDLVAHIKFTVLLMPNGSDRIT+H LQ+L + K I D+PEIK WLALP
Sbjct  301   YPVLHEKPGDLVAHIKFTVLLMPNGSDRITSHALQELTLAKTIEDEPEIKTWLALP  356



>ref|XP_007205303.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
 ref|XP_007205304.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
 ref|XP_008243362.1| PREDICTED: proliferation-associated protein 2G4 [Prunus mume]
 gb|EMJ06502.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
 gb|EMJ06503.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
Length=395

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/393 (86%), Positives = 374/393 (95%), Gaps = 0/393 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDLSSPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGD++IREQ
Sbjct  1     MSDDEREEKELDLSSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDSYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPL++D+TVLEEGD++KID+GCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLASDETVLEEGDILKIDLGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             +VAHTH LQ GPVTG+AADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIV
Sbjct  121   IVAHTHALQAGPVTGKAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKV+LS SNP+TRVDEAEFEENEVYSIDIVTSTGEGKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVILSASNPDTRVDEAEFEENEVYSIDIVTSTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TT+YKRAVDKNY+LKMKASRFI+SEI +KFP+MPFTAR LEEKRARLGL+ECVNH+LLQP
Sbjct  241   TTVYKRAVDKNYHLKMKASRFIFSEIREKFPIMPFTARALEEKRARLGLLECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkk  1322
             YPVLHEKPGDLVAHIKFTVLLMPNGSDRIT+HPLQ+L  TK IDDPEIKAWLAL TKTKK
Sbjct  301   YPVLHEKPGDLVAHIKFTVLLMPNGSDRITSHPLQELQPTKQIDDPEIKAWLALGTKTKK  360

Query  1323  kgggkkkkgkkgekteeAPQTEPTDEATNKSKS  1421
             KGGGKKKKGKK +K EE+ + EP D  TN ++S
Sbjct  361   KGGGKKKKGKKSDKAEESTEAEPMDATTNGAES  393



>ref|XP_006344057.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Solanum tuberosum]
Length=391

 Score =   638 bits (1645),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/356 (89%), Positives = 346/356 (97%), Gaps = 1/356 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+S EVVTKYK AAEI+NKAL+LVVS+CKP A++VD+CEKGDAFI+EQ
Sbjct  1     MSDDEREEKELDLTSSEVVTKYKGAAEIVNKALQLVVSECKPKAKIVDLCEKGDAFIKEQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLS+D+T+LEEGDMVKIDMGCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETILEEGDMVKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH++Q GPVTGRAADV+AAANTAAEVA+RLVRPG+KNSDVTEAIQKVAAAYDCKIV
Sbjct  121   VVAHTHVVQGGPVTGRAADVLAAANTAAEVALRLVRPGRKNSDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLSVSNP+TRVD+AEFEENEVYSIDIVTSTG+GKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYSIDIVTSTGDGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+YNLKMKASRFI+SEISQKFP+MPFTARDLEEKRARLGLVECVNHDLLQP
Sbjct  241   TTIYKRAVDKSYNLKMKASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHDLLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALP  1307
             YPVLHEKPGDLVAHIKFTVLLMPNGSDRIT+H LQ+L + K I D+PEIK WLALP
Sbjct  301   YPVLHEKPGDLVAHIKFTVLLMPNGSDRITSHALQELTLAKTIEDEPEIKTWLALP  356



>ref|XP_004240407.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Solanum lycopersicum]
Length=390

 Score =   635 bits (1639),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/356 (89%), Positives = 345/356 (97%), Gaps = 1/356 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYK AAEI+NKAL+LVVS+CK  A++VD+CEKGDAFI+EQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKGAAEIVNKALQLVVSECKAKAKIVDLCEKGDAFIKEQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLS+D+TVLEEGD+VKIDMGCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETVLEEGDIVKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH++Q GPVTGRAADV+AAANTAAEVA+RLVRPG+KNSDVTEAIQKVAAAYDCKIV
Sbjct  121   VVAHTHVVQGGPVTGRAADVLAAANTAAEVALRLVRPGRKNSDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLSVSNP+TRVD+AEFEENEVYS+DIVTSTGEGKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYSVDIVTSTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+YNLKMKASRFI+SEISQKFP+MPFTARDLEEKRARLGLVECVNHDLLQP
Sbjct  241   TTIYKRAVDKSYNLKMKASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHDLLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDD-PEIKAWLALP  1307
             YPVLHEKPGDLVAHIKFT LLMPNGSDRIT+H LQ+L+  K IDD PEIK WLALP
Sbjct  301   YPVLHEKPGDLVAHIKFTALLMPNGSDRITSHALQELSPAKTIDDEPEIKTWLALP  356



>ref|XP_009599304.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009599305.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Nicotiana tomentosiformis]
Length=387

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/356 (89%), Positives = 345/356 (97%), Gaps = 1/356 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREE+ELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFI+EQ
Sbjct  1     MSDDEREERELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIKEQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLS+D+T LEEGD++KIDMGCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETSLEEGDILKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VV HTH+L EGPVTGR ADVIAAANTAAEVA+RLVRPGKKNSDVTEAIQKVAAAYDCKIV
Sbjct  121   VVGHTHVLHEGPVTGRPADVIAAANTAAEVALRLVRPGKKNSDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLSV+NPETRVDEAEFEENEVYSIDIVTSTGEGKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSVTNPETRVDEAEFEENEVYSIDIVTSTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+YNLKMKASRFI+SEISQKFP+MPFTARDLEEKRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYNLKMKASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALP  1307
             YPVLHEKPGDLVAHIKFTVLLMPNGSDRIT+H LQ+L   K I ++PEIKAWLALP
Sbjct  301   YPVLHEKPGDLVAHIKFTVLLMPNGSDRITSHALQELKPAKTIENEPEIKAWLALP  356



>ref|XP_010321752.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Solanum lycopersicum]
Length=391

 Score =   635 bits (1637),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/356 (89%), Positives = 345/356 (97%), Gaps = 1/356 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYK AAEI+NKAL+LVVS+CK  A++VD+CEKGDAFI+EQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKGAAEIVNKALQLVVSECKAKAKIVDLCEKGDAFIKEQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLS+D+TVLEEGD+VKIDMGCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETVLEEGDIVKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH++Q GPVTGRAADV+AAANTAAEVA+RLVRPG+KNSDVTEAIQKVAAAYDCKIV
Sbjct  121   VVAHTHVVQGGPVTGRAADVLAAANTAAEVALRLVRPGRKNSDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLSVSNP+TRVD+AEFEENEVYS+DIVTSTGEGKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYSVDIVTSTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+YNLKMKASRFI+SEISQKFP+MPFTARDLEEKRARLGLVECVNHDLLQP
Sbjct  241   TTIYKRAVDKSYNLKMKASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHDLLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDD-PEIKAWLALP  1307
             YPVLHEKPGDLVAHIKFT LLMPNGSDRIT+H LQ+L+  K IDD PEIK WLALP
Sbjct  301   YPVLHEKPGDLVAHIKFTALLMPNGSDRITSHALQELSPAKTIDDEPEIKTWLALP  356



>emb|CDP09213.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   634 bits (1636),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 337/390 (86%), Positives = 374/390 (96%), Gaps = 1/390 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREE+ELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP  ++VD+CEKGDAFI+EQ
Sbjct  1     MSDDEREERELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPATKIVDLCEKGDAFIKEQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCISVNNTVCH SPL++D+ VL++GD+VKIDMGCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCISVNNTVCHVSPLASDEAVLQQGDIVKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH+LQ+GPVTGRAADVIAAANTAAEVA+RLVRPGKKN +V EAIQKVAAAYDC+IV
Sbjct  121   VVAHTHVLQDGPVTGRAADVIAAANTAAEVALRLVRPGKKNQEVAEAIQKVAAAYDCRIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVL+VS+PE RVD+AEFEENEVY+IDIVTSTG+GKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLNVSSPEMRVDDAEFEENEVYAIDIVTSTGDGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNYNLKMKASRFI+SEISQKFP+MPFTARDLEEKRARLGLVECVNHDLLQP
Sbjct  241   TTIYKRAVDKNYNLKMKASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHDLLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLALPtktk  1319
             YPVLHEKPGDLVAHIKFTVLLMPNGSDRIT+H LQ+LN TK +D DPEIKAWL+LP KTK
Sbjct  301   YPVLHEKPGDLVAHIKFTVLLMPNGSDRITSHSLQELNPTKTVDSDPEIKAWLSLPIKTK  360

Query  1320  kkgggkkkkgkkgekteeAPQTEPTDEATN  1409
             KKGGGKKKKGKKG+K E++ QTEP DEA N
Sbjct  361   KKGGGKKKKGKKGDKAEDSMQTEPVDEAAN  390



>ref|XP_009599303.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Nicotiana tomentosiformis]
Length=427

 Score =   634 bits (1635),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 318/356 (89%), Positives = 345/356 (97%), Gaps = 1/356 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREE+ELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFI+EQ
Sbjct  41    MSDDEREERELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIKEQ  100

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLS+D+T LEEGD++KIDMGCHIDGFIA
Sbjct  101   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETSLEEGDILKIDMGCHIDGFIA  160

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VV HTH+L EGPVTGR ADVIAAANTAAEVA+RLVRPGKKNSDVTEAIQKVAAAYDCKIV
Sbjct  161   VVGHTHVLHEGPVTGRPADVIAAANTAAEVALRLVRPGKKNSDVTEAIQKVAAAYDCKIV  220

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLSV+NPETRVDEAEFEENEVYSIDIVTSTGEGKPK+LDEKQ
Sbjct  221   EGVLSHQMKQFVIDGNKVVLSVTNPETRVDEAEFEENEVYSIDIVTSTGEGKPKLLDEKQ  280

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+YNLKMKASRFI+SEISQKFP+MPFTARDLEEKRARLGLVECVNH+LLQP
Sbjct  281   TTIYKRAVDKSYNLKMKASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHELLQP  340

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALP  1307
             YPVLHEKPGDLVAHIKFTVLLMPNGSDRIT+H LQ+L   K I ++PEIKAWLALP
Sbjct  341   YPVLHEKPGDLVAHIKFTVLLMPNGSDRITSHALQELKPAKTIENEPEIKAWLALP  396



>ref|XP_009773246.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
 ref|XP_009773247.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
 ref|XP_009773248.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
Length=387

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/356 (88%), Positives = 344/356 (97%), Gaps = 1/356 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREE+E DL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFI+EQ
Sbjct  1     MSDDEREEREFDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIKEQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLS+D+TVLEEGD++KIDMGCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETVLEEGDILKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VV HTH+L EGPVTGRAADVIAAANTAAEVA+RLVRPGKKNSDVTEAIQKVAAAYDC IV
Sbjct  121   VVGHTHVLHEGPVTGRAADVIAAANTAAEVALRLVRPGKKNSDVTEAIQKVAAAYDCNIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLSV+NPETRVDEAEFEENEVYSID+VTSTGEGKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSVTNPETRVDEAEFEENEVYSIDVVTSTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+YNLKMKASRFI+SEISQKFP+MPFT RDLEEKRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYNLKMKASRFIFSEISQKFPIMPFTTRDLEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALP  1307
             YPVLHEKPGDLVAHIKFTVLLMPNGSDR+T+H LQ+L   K I ++PEIKAWLALP
Sbjct  301   YPVLHEKPGDLVAHIKFTVLLMPNGSDRVTSHALQELKPAKTIENEPEIKAWLALP  356



>ref|XP_004242516.1| PREDICTED: proliferation-associated protein 2G4-like [Solanum 
lycopersicum]
Length=387

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 316/356 (89%), Positives = 346/356 (97%), Gaps = 1/356 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFI+EQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIKEQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPL++D+TV+EEGD++KIDMGCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLASDETVVEEGDILKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VV HTH+L  GPVTGRAADVIAAANTAAEVA+RLVRPGKKNSDVTEAIQKVAAAYDCKIV
Sbjct  121   VVGHTHVLHNGPVTGRAADVIAAANTAAEVALRLVRPGKKNSDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLSVSNP+TRVDEAEFEENEVYSIDIVTSTG+GKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSVSNPDTRVDEAEFEENEVYSIDIVTSTGDGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+YNLKMKASRFI+SEISQKFP+MPFTARDLEEKRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYNLKMKASRFIFSEISQKFPIMPFTARDLEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALP  1307
             YPVLHEKPGDLVAHIKFTVLLMPNGSDR+T+H LQ+L  TK   ++PEIKAWLALP
Sbjct  301   YPVLHEKPGDLVAHIKFTVLLMPNGSDRVTSHSLQELQPTKSTENEPEIKAWLALP  356



>ref|XP_002530504.1| proliferation-associated 2g4, putative [Ricinus communis]
 gb|EEF31888.1| proliferation-associated 2g4, putative [Ricinus communis]
Length=394

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/354 (89%), Positives = 343/354 (97%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFIREQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDAFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTC+SVNNTVCH SPL++D+T+LEEGD+VKIDMGCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCVSVNNTVCHCSPLASDETLLEEGDVVKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VV HTH+LQ GPVTGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIV
Sbjct  121   VVGHTHVLQAGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKV+LSVSNPETRVD+AEFEENEVY+IDIVT+TGEGKPK+LDEK 
Sbjct  181   EGVLSHQLKQFVIDGNKVILSVSNPETRVDDAEFEENEVYAIDIVTTTGEGKPKLLDEKH  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVECVNHDLLQP
Sbjct  241   TTIYKRAVDKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECVNHDLLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD+VAHIKFTVLLMPNGSDRIT+H LQ+L  TK IDDPEIKAWLAL
Sbjct  301   YPVLHEKPGDIVAHIKFTVLLMPNGSDRITSHSLQELQPTKTIDDPEIKAWLAL  354



>ref|XP_012089820.1| PREDICTED: proliferation-associated protein 2G4 [Jatropha curcas]
 gb|KDP22867.1| hypothetical protein JCGZ_00454 [Jatropha curcas]
Length=396

 Score =   632 bits (1629),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/354 (88%), Positives = 344/354 (97%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S CKP A++VD+CEKGD +IREQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISGCKPKAKIVDLCEKGDTYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTC+SVNNTVCHFSPL++D++VLE+GD+VKIDMGCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCVSVNNTVCHFSPLASDESVLEDGDIVKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH++Q GPVTG+AADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIV
Sbjct  121   VVAHTHVIQSGPVTGKAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKV+LSV+NPETRVD+AEFEENEVY+IDIVTSTGEGKPK+LDEK 
Sbjct  181   EGVLSHQLKQFVIDGNKVILSVTNPETRVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKH  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVECVNHDLLQP
Sbjct  241   TTIYKRAVDKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECVNHDLLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGDLVAHIKFTVLLMPNGSDRIT+HPLQ+L  TK I+DPEIKAWLAL
Sbjct  301   YPVLHEKPGDLVAHIKFTVLLMPNGSDRITSHPLQELQPTKTIEDPEIKAWLAL  354



>ref|XP_007026646.1| Metallopeptidase M24 family protein isoform 1 [Theobroma cacao]
 gb|EOY07148.1| Metallopeptidase M24 family protein isoform 1 [Theobroma cacao]
Length=393

 Score =   631 bits (1628),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/393 (84%), Positives = 369/393 (94%), Gaps = 0/393 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LVV  CKP A++VDICEKGD FIREQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVVKDCKPKAKIVDICEKGDVFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVK+KIERGVAFPTCISVNNTVCH SPL++D + LEEGDMVKID+GCHIDGFIA
Sbjct  61    TGNMYKNVKRKIERGVAFPTCISVNNTVCHISPLASDTSELEEGDMVKIDLGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             +VAHTH++Q+GP+TGR ADV+AA NTAAEVA+RLVRPGKKN DVT+AIQKVAAAYDCKIV
Sbjct  121   IVAHTHVVQDGPITGRQADVVAAVNTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKV+LSVSNP+TRVD+AEFEENEVY++DIV STGEGKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMK SRFI+SEI+QKFP++PFTAR LEEKRARLGLVECVNHDLLQP
Sbjct  241   TTIYKRAVDKNYHLKMKTSRFIFSEINQKFPILPFTARALEEKRARLGLVECVNHDLLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkk  1322
             YPVLHEKPGD VAHIKFTVLLMPNGSDR+T+HPLQ+L  TK IDDPEIKAWLAL TKTKK
Sbjct  301   YPVLHEKPGDYVAHIKFTVLLMPNGSDRVTSHPLQELQPTKTIDDPEIKAWLALGTKTKK  360

Query  1323  kgggkkkkgkkgekteeAPQTEPTDEATNKSKS  1421
             KGGGKKKKGKKG+K EE+ + EP DEATN + S
Sbjct  361   KGGGKKKKGKKGDKAEESAEAEPMDEATNGATS  393



>ref|NP_001275188.1| EBP1 [Solanum tuberosum]
 gb|ABJ97690.1| EBP1 [Solanum tuberosum]
Length=387

 Score =   629 bits (1623),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 314/356 (88%), Positives = 346/356 (97%), Gaps = 1/356 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP  ++VD+CEKGDAFI+EQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKVKIVDLCEKGDAFIKEQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPL++D+T++EEGD++KIDMGCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLASDETIVEEGDILKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VV HTH+L EGPVTGRAADVIAAANTAAEVA+RLVRPGKKNSDVTEAIQKVAAAYDCKIV
Sbjct  121   VVGHTHVLHEGPVTGRAADVIAAANTAAEVALRLVRPGKKNSDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLSVSNP+TRVDEAEFEENEVYSIDIVTSTG+GKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSVSNPDTRVDEAEFEENEVYSIDIVTSTGDGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+YNLKMKASRFI+SEI+QKFP+MPFTARDLEEKRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYNLKMKASRFIFSEINQKFPIMPFTARDLEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALP  1307
             YPVLHEKPGDLVAHIKFTVLLMPNGSDR+T+H LQ+L  TK   ++PEIKAWLALP
Sbjct  301   YPVLHEKPGDLVAHIKFTVLLMPNGSDRVTSHXLQELQPTKTTENEPEIKAWLALP  356



>gb|EYU26681.1| hypothetical protein MIMGU_mgv1a007877mg [Erythranthe guttata]
Length=392

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 312/354 (88%), Positives = 342/354 (97%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSDE+ EEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGD +IRE 
Sbjct  1     MSDEDMEEKELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDVYIREH  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             +GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPL++D+TVLE+GD++KIDMGCHIDGFIA
Sbjct  61    SGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLASDETVLEDGDILKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH+LQ+GPVTGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIV
Sbjct  121   VVAHTHVLQQGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLSVS  +TRVDE+EFEENEVYSIDIVTSTGEGKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSVSGTDTRVDESEFEENEVYSIDIVTSTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQP
Sbjct  241   TTIYKRAVDKNYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGDLVAHIKFTVLLMPNGSDR+T HPLQ+L  TK +DDPEIKAWLAL
Sbjct  301   YPVLHEKPGDLVAHIKFTVLLMPNGSDRVTTHPLQELQPTKTVDDPEIKAWLAL  354



>ref|XP_009376423.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Pyrus 
x bretschneideri]
Length=387

 Score =   627 bits (1616),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/354 (86%), Positives = 344/354 (97%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++V++CEKGD++IREQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVELCEKGDSYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPL++D++VLEEGD++KID+GCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLASDESVLEEGDILKIDLGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             +VAHTH+LQ GPVTGRAADVIAAANTAAEVA+RLVRPG+KN DVTEAIQKVAAAYDCKIV
Sbjct  121   IVAHTHVLQAGPVTGRAADVIAAANTAAEVALRLVRPGRKNKDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKV+LS SNPETRVDEAEFEENEVY++DIV STGEGKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVILSASNPETRVDEAEFEENEVYAVDIVASTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGL+ECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLLECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDRIT+HP+Q+L  TK +DDPEIKAWL+L
Sbjct  301   YPVLHEKPGDFVAHIKFTVLLMPNGSDRITSHPVQELQPTKQVDDPEIKAWLSL  354



>gb|KDO56711.1| hypothetical protein CISIN_1g016183mg [Citrus sinensis]
 gb|KDO56712.1| hypothetical protein CISIN_1g016183mg [Citrus sinensis]
Length=394

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/354 (87%), Positives = 344/354 (97%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI NKAL+LVVS+CKP  ++VD+CEKGD+FIREQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIANKALQLVVSECKPGVKIVDLCEKGDSFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFP+C+SVNNT+CHFSPL++D+TVL+EGDM+KID+GCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPSCVSVNNTLCHFSPLASDETVLQEGDMIKIDLGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH+LQ+GPVTGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAA+DCKIV
Sbjct  121   VVAHTHVLQDGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAHDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKVVLSVSNP+TRVD+AEFEENEVY++DIVTSTG+GKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYAVDIVTSTGDGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMKASRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKNYHLKMKASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDRIT+H LQ++  TK IDDPEIKAWLAL
Sbjct  301   YPVLHEKPGDYVAHIKFTVLLMPNGSDRITSHTLQEIQSTKTIDDPEIKAWLAL  354



>gb|ABF66654.1| EBP1 [Ammopiptanthus mongolicus]
 gb|ABQ23586.1| EBP1 [Ammopiptanthus mongolicus]
Length=395

 Score =   627 bits (1617),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/354 (87%), Positives = 342/354 (97%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDLSSPEVVTKYK+AAEI+NKAL+LV+S+CKP A++VD+CEKGD++IREQ
Sbjct  1     MSDDEREEKELDLSSPEVVTKYKTAAEIVNKALKLVISECKPKAKIVDLCEKGDSYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGN+YKNVK+KIERGVAFPTCISVNNTVCHFSPL++D+TVLEEGD++KIDM CHIDGFIA
Sbjct  61    TGNVYKNVKRKIERGVAFPTCISVNNTVCHFSPLASDETVLEEGDILKIDMACHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
              VAHTH+L+EGPVTGRAADVI AANTAAEVA+RLVRPGKKN DVT+AIQKVAAAYDCKIV
Sbjct  121   AVAHTHVLEEGPVTGRAADVITAANTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLS SNP+TRVDEAEFEENEVY+IDIVTSTGEGKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSASNPDTRVDEAEFEENEVYAIDIVTSTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQ FP+MPF+AR LEEKRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSEISQNFPIMPFSARALEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDR+T++PLQ+L  TK IDDPEIKAWLAL
Sbjct  301   YPVLHEKPGDYVAHIKFTVLLMPNGSDRVTSYPLQELQPTKTIDDPEIKAWLAL  354



>gb|EPS71863.1| hypothetical protein M569_02886, partial [Genlisea aurea]
Length=369

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/354 (87%), Positives = 341/354 (96%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSDEEREEKELDL+S EVV KYKSAAEI+N+AL+ V+S+CKP A++VD+CEKGD+FIREQ
Sbjct  1     MSDEEREEKELDLTSSEVVMKYKSAAEIVNRALQSVLSECKPKAKIVDLCEKGDSFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             +GNMYKN KKKIERGVAFPTCISVNNTVCHFSPL++D+T LE GD++KIDMGCHIDGFIA
Sbjct  61    SGNMYKNAKKKIERGVAFPTCISVNNTVCHFSPLASDETTLEAGDILKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH+LQEGPV+GRAADVIAAANTAAEVA+RLVRPGKKN DV EAIQKVAAAYDCKIV
Sbjct  121   VVAHTHVLQEGPVSGRAADVIAAANTAAEVALRLVRPGKKNKDVAEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLS+SNP+TRVDEAEFEENEVYS+DIVTSTGEGKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSISNPDTRVDEAEFEENEVYSVDIVTSTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGDL+AHIKFTVLLMPNGSDR+T+HPLQ+L  TK +DDPEIKAWL+L
Sbjct  301   YPVLHEKPGDLLAHIKFTVLLMPNGSDRVTSHPLQELQTTKTVDDPEIKAWLSL  354



>ref|XP_008464212.1| PREDICTED: proliferation-associated protein 2G4-like [Cucumis 
melo]
Length=454

 Score =   629 bits (1622),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/353 (89%), Positives = 343/353 (97%), Gaps = 0/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+EREE ELDLSSP+VVTKYKSAAEI+NKAL+LV+SQCKP A++VDICEKGD+FIREQT
Sbjct  60    SDDEREEMELDLSSPDVVTKYKSAAEIINKALQLVISQCKPKAKIVDICEKGDSFIREQT  119

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             GNMYKNVKKKIERGVAFPTCISVNNTV HFSPL++D+TV+EEGD++KIDMGCHIDGFIAV
Sbjct  120   GNMYKNVKKKIERGVAFPTCISVNNTVGHFSPLASDETVMEEGDILKIDMGCHIDGFIAV  179

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             VAHTH+LQEGPVTGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIVE
Sbjct  180   VAHTHVLQEGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIVE  239

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSHQ+KQFVIDGNKV+LSVSNPETRVD+AEFEENE+Y+IDIVTSTGEGKPK+LDEKQT
Sbjct  240   GVLSHQLKQFVIDGNKVILSVSNPETRVDDAEFEENEIYAIDIVTSTGEGKPKLLDEKQT  299

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             TIYKRAVDKNY+LKMKASRFI+SEISQKFP++PFTAR LEEKRARLGLVECVNHDLLQP+
Sbjct  300   TIYKRAVDKNYHLKMKASRFIFSEISQKFPILPFTARALEEKRARLGLVECVNHDLLQPF  359

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVLHEKPGD VAHIKFTVLLMPNGSDRIT+H LQ+L  TK ID+PEIKAWLAL
Sbjct  360   PVLHEKPGDYVAHIKFTVLLMPNGSDRITSHALQELQPTKTIDNPEIKAWLAL  412



>ref|XP_009376419.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009376420.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Pyrus 
x bretschneideri]
Length=394

 Score =   626 bits (1615),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/354 (86%), Positives = 344/354 (97%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++V++CEKGD++IREQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVELCEKGDSYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPL++D++VLEEGD++KID+GCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLASDESVLEEGDILKIDLGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             +VAHTH+LQ GPVTGRAADVIAAANTAAEVA+RLVRPG+KN DVTEAIQKVAAAYDCKIV
Sbjct  121   IVAHTHVLQAGPVTGRAADVIAAANTAAEVALRLVRPGRKNKDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKV+LS SNPETRVDEAEFEENEVY++DIV STGEGKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVILSASNPETRVDEAEFEENEVYAVDIVASTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGL+ECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLLECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDRIT+HP+Q+L  TK +DDPEIKAWL+L
Sbjct  301   YPVLHEKPGDFVAHIKFTVLLMPNGSDRITSHPVQELQPTKQVDDPEIKAWLSL  354



>ref|XP_006429434.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
 ref|XP_006429435.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
 ref|XP_006481067.1| PREDICTED: proliferation-associated protein 2G4-like [Citrus 
sinensis]
 gb|ESR42674.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
 gb|ESR42675.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
Length=394

 Score =   626 bits (1614),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/354 (87%), Positives = 343/354 (97%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI NKAL+LVVS+CKP  ++VD+CEKGD+FIREQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIANKALQLVVSECKPGVKIVDLCEKGDSFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFP+C+SVNNT+CHFSPL++D+TVL+EGDM+KID+GCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPSCVSVNNTLCHFSPLASDETVLQEGDMIKIDLGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH+LQ+ PVTGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIV
Sbjct  121   VVAHTHVLQDEPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKVVLSVSNP+TRVD+AEFEENEVY++DIVTSTG+GKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYAVDIVTSTGDGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMKASRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKNYHLKMKASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDRIT+H LQ++  TK IDDPEIKAWLAL
Sbjct  301   YPVLHEKPGDYVAHIKFTVLLMPNGSDRITSHTLQEIQSTKTIDDPEIKAWLAL  354



>ref|XP_010037691.1| PREDICTED: proliferation-associated protein 2G4 [Eucalyptus grandis]
 gb|KCW49439.1| hypothetical protein EUGRSUZ_K02971 [Eucalyptus grandis]
Length=392

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 322/393 (82%), Positives = 361/393 (92%), Gaps = 3/393 (1%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SP+VVTKYKSAAEI+NKAL+LV+S+CKP A+VVD+CEKGD+FIREQ
Sbjct  1     MSDDEREEKELDLTSPDVVTKYKSAAEIVNKALQLVISECKPKAKVVDVCEKGDSFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPL++D+TVLEEGD++KIDMGCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLASDETVLEEGDILKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH+LQEGPVTGRAADVIAAANTAAEVA+RLVRPGK N DVTEAI KVAAAYDCKIV
Sbjct  121   VVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLVRPGKNNKDVTEAINKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKV++SVSNP+T+VDE EFEENEVY+IDIVTSTGEGKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVIISVSNPDTKVDEFEFEENEVYAIDIVTSTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TT+YKRAVDKNY+LKMKASRFI+SEI+QKFP++PF+AR LEEKRARLGLVECVNH+LLQP
Sbjct  241   TTVYKRAVDKNYHLKMKASRFIFSEINQKFPILPFSARALEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkk  1322
             YPVLHEKPGD  AHIKFTVLLMPNGSDRIT+H LQ+L  TK IDDPEIKAWLAL     K
Sbjct  301   YPVLHEKPGDYAAHIKFTVLLMPNGSDRITSHSLQELQPTKTIDDPEIKAWLAL---GTK  357

Query  1323  kgggkkkkgkkgekteeAPQTEPTDEATNKSKS  1421
                    K KKG+K  E+ +TEP D  TN ++S
Sbjct  358   TKKKGGGKKKKGKKGTESAETEPMDATTNGAES  390



>ref|XP_011019082.1| PREDICTED: proliferation-associated protein 2G4-like [Populus 
euphratica]
Length=396

 Score =   625 bits (1612),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 325/388 (84%), Positives = 365/388 (94%), Gaps = 0/388 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+EREE+ELDL+S EVVTKYKSAAEI+NKAL+LV+S+CKP A++VDICEKGD+FIREQ+
Sbjct  3     SDDEREERELDLTSSEVVTKYKSAAEIVNKALQLVISECKPKAKIVDICEKGDSFIREQS  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             GNMYKNVKKKIERGVAFPTC+SVNNT+CHFSPL++D+TVLEEGD+VKID+GCHIDGFIAV
Sbjct  63    GNMYKNVKKKIERGVAFPTCVSVNNTICHFSPLASDETVLEEGDIVKIDLGCHIDGFIAV  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             V HTH LQ GPVTGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIVE
Sbjct  123   VGHTHALQSGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSHQ+KQFVIDGNKV+LSVSNP+TRVD+AEFEENEVY++DIVTSTGEGKPK+LDEK T
Sbjct  183   GVLSHQLKQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVTSTGEGKPKLLDEKNT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             TIYKRAVDKNY+LKMK+SRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNHDLLQPY
Sbjct  243   TIYKRAVDKNYHLKMKSSRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHDLLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkk  1325
             PVLHEKPGD VAHIKFT+LLMPNGSDRIT+H LQ+L  +K IDDPEIKAWLAL TKTKKK
Sbjct  303   PVLHEKPGDYVAHIKFTLLLMPNGSDRITSHSLQELQPSKTIDDPEIKAWLALGTKTKKK  362

Query  1326  gggkkkkgkkgekteeAPQTEPTDEATN  1409
             GGGKKKK +K  +  E+ + EP D +TN
Sbjct  363   GGGKKKKARKSGEKAESTEAEPMDASTN  390



>gb|ABK95017.1| unknown [Populus trichocarpa]
Length=396

 Score =   625 bits (1611),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 326/392 (83%), Positives = 367/392 (94%), Gaps = 0/392 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+EREE+ELDL+SPEV+TKYKSAAEI+NKAL+LV+S+CKP A++VDICEKGD+FIREQT
Sbjct  3     SDDEREERELDLTSPEVITKYKSAAEIVNKALQLVISECKPKAKIVDICEKGDSFIREQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             GNMYKNVKKKIERGVAFPTC+SVNNT+CHFSPL++D++VLEEGD+VKID+GCHIDGFIAV
Sbjct  63    GNMYKNVKKKIERGVAFPTCVSVNNTICHFSPLASDESVLEEGDIVKIDLGCHIDGFIAV  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             V HTH LQ GPVTGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIVE
Sbjct  123   VGHTHALQSGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSHQ+KQFVIDGNKV+LSVSNP+TRVD+AEFEENEVY++DIVTSTGEGKPK+LDEK T
Sbjct  183   GVLSHQLKQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVTSTGEGKPKLLDEKST  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             TIYKRAVDKNY+LKMK+SRFI+SEI+QKFP+MPFTAR LEEKRARLGL+ECVNHDLLQPY
Sbjct  243   TIYKRAVDKNYHLKMKSSRFIFSEINQKFPIMPFTARALEEKRARLGLLECVNHDLLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkk  1325
             PVLHEKPGD VAHIKFTVLLMPNGSDRIT+H LQ+L  +K IDDPEIKAWLAL TKTKKK
Sbjct  303   PVLHEKPGDYVAHIKFTVLLMPNGSDRITSHSLQELQPSKTIDDPEIKAWLALGTKTKKK  362

Query  1326  gggkkkkgkkgekteeAPQTEPTDEATNKSKS  1421
             GGGKKKK KK  +  E+ + EP D  TN + +
Sbjct  363   GGGKKKKAKKSGEKAESTEAEPMDATTNGAAA  394



>ref|XP_008362268.1| PREDICTED: proliferation-associated protein 2G4-like [Malus domestica]
Length=394

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/354 (86%), Positives = 343/354 (97%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++V++CEKGD++IREQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVELCEKGDSYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKN KKKIERGVAFPTCISVNNTVCHFSPL++D++VLEEGD++KID+GCHIDGFIA
Sbjct  61    TGNMYKNAKKKIERGVAFPTCISVNNTVCHFSPLASDESVLEEGDILKIDLGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             +VAHTH+LQ GPVTGRAADVIAAANTAAEVA+RLVRPG+KN DVTEAIQKVAAAYDCKIV
Sbjct  121   IVAHTHVLQAGPVTGRAADVIAAANTAAEVALRLVRPGRKNKDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKV+LS SNPETRVDEAEFEENEVY++DIV STGEGKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVILSASNPETRVDEAEFEENEVYAVDIVASTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGL+ECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLLECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFT+LLMPNGSDRIT+HP+Q+L  TK +DDPEIKAWL+L
Sbjct  301   YPVLHEKPGDFVAHIKFTILLMPNGSDRITSHPVQELQPTKQVDDPEIKAWLSL  354



>ref|XP_008388269.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Malus domestica]
Length=395

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/354 (86%), Positives = 342/354 (97%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGD++IREQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDSYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKN KKKIERGVAFPTCISVNNTVCHFSPL +D++VLEEGD++KID+GCHIDGFIA
Sbjct  61    TGNMYKNAKKKIERGVAFPTCISVNNTVCHFSPLGSDESVLEEGDILKIDLGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             +VAHTH+LQ GPVTGRAADVIAAANTAAEVA+RLVRPG+KN DVTEAIQKVAAAYDCKIV
Sbjct  121   IVAHTHVLQAGPVTGRAADVIAAANTAAEVALRLVRPGRKNKDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKV+LSVSNPETRVD+AEFEENEVY++DIV STGEGKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVILSVSNPETRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGL+ECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLLECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VA IKFTVLLMPNGSDRIT+HP+Q+L  TK +DDPEIKAWL+L
Sbjct  301   YPVLHEKPGDFVARIKFTVLLMPNGSDRITSHPVQELQPTKQVDDPEIKAWLSL  354



>ref|XP_010264591.1| PREDICTED: proliferation-associated protein 2G4-like [Nelumbo 
nucifera]
Length=397

 Score =   624 bits (1610),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 334/395 (85%), Positives = 375/395 (95%), Gaps = 2/395 (1%)
 Frame = +3

Query  243   MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
             MSDEE +EEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFIRE
Sbjct  1     MSDEETKEEKELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIRE  60

Query  420   QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFI  599
             QTGNMYKNVK+KIERGVAFPTCISVNNTVCHFSPL++D+TVLEEGDM+KIDMGCHIDGFI
Sbjct  61    QTGNMYKNVKRKIERGVAFPTCISVNNTVCHFSPLASDETVLEEGDMLKIDMGCHIDGFI  120

Query  600   AVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKI  779
             AVVAHT +LQEGPVTGRAADVIAAANTAAEVA+RLVRPG+KN DVTEA+QKVAAAYDCKI
Sbjct  121   AVVAHTRVLQEGPVTGRAADVIAAANTAAEVALRLVRPGRKNKDVTEAVQKVAAAYDCKI  180

Query  780   VEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEK  959
             VEGVLSHQ+KQFVIDGNKV+LSV++PETRVD+AEFEENEVY+IDIVTSTG+GKPK+LDEK
Sbjct  181   VEGVLSHQLKQFVIDGNKVILSVTSPETRVDDAEFEENEVYAIDIVTSTGDGKPKLLDEK  240

Query  960   QTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQ  1139
             QTTIYKRAVDKNY+LKMK+SRFI+SEI+QKFP+MPF+AR LEEKRARLGLVECVNHDLLQ
Sbjct  241   QTTIYKRAVDKNYHLKMKSSRFIFSEINQKFPIMPFSARALEEKRARLGLVECVNHDLLQ  300

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALPtkt  1316
             PYPVLHEKPGD VAHIKFTVLLMPNGSDRIT+H LQ+L  TK I DDPEIKAWLAL TKT
Sbjct  301   PYPVLHEKPGDFVAHIKFTVLLMPNGSDRITSHALQELQPTKKIDDDPEIKAWLALGTKT  360

Query  1317  kkkgggkkkkgkkgekteeAPQTEPTDEATNKSKS  1421
             KKKGGGKKKKGKK +K +E+ + EP D  +N++ S
Sbjct  361   KKKGGGKKKKGKKADKVDESIEAEPMDATSNEAAS  395



>ref|XP_003623305.1| Proliferation-associated protein 2G4 [Medicago truncatula]
 gb|AES79523.1| proliferation-associated 2G4-like protein [Medicago truncatula]
Length=394

 Score =   624 bits (1608),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/354 (86%), Positives = 344/354 (97%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SP+VVTKYK+AAEI+NKAL+LV+S+CKP A+VVDICEKGD+FIREQ
Sbjct  1     MSDDEREEKELDLTSPDVVTKYKTAAEIVNKALKLVISECKPKAKVVDICEKGDSFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             T N+YKNVKKKIERGVAFPTCISVNNT+CHFSPL++D+TVL+EGD+VKID+ CHIDGFIA
Sbjct  61    TSNVYKNVKKKIERGVAFPTCISVNNTICHFSPLASDETVLDEGDIVKIDLACHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
              VAHTH+LQEGPVTGRAADVIAAANTAAEVA+RLVRPGKKN DV++AIQKVAAAYDCKIV
Sbjct  121   AVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVSDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKVVLS+SNP+TRVD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVVLSISNPDTRVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVEC+NH+LLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECMNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDR+T+HPLQ+L  TK IDDPEIKAWLAL
Sbjct  301   YPVLHEKPGDFVAHIKFTVLLMPNGSDRVTSHPLQELQPTKTIDDPEIKAWLAL  354



>ref|XP_008388270.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Malus domestica]
Length=388

 Score =   623 bits (1606),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/354 (86%), Positives = 342/354 (97%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGD++IREQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDSYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKN KKKIERGVAFPTCISVNNTVCHFSPL +D++VLEEGD++KID+GCHIDGFIA
Sbjct  61    TGNMYKNAKKKIERGVAFPTCISVNNTVCHFSPLGSDESVLEEGDILKIDLGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             +VAHTH+LQ GPVTGRAADVIAAANTAAEVA+RLVRPG+KN DVTEAIQKVAAAYDCKIV
Sbjct  121   IVAHTHVLQAGPVTGRAADVIAAANTAAEVALRLVRPGRKNKDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKV+LSVSNPETRVD+AEFEENEVY++DIV STGEGKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVILSVSNPETRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGL+ECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLLECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VA IKFTVLLMPNGSDRIT+HP+Q+L  TK +DDPEIKAWL+L
Sbjct  301   YPVLHEKPGDFVARIKFTVLLMPNGSDRITSHPVQELQPTKQVDDPEIKAWLSL  354



>ref|XP_003516956.1| PREDICTED: proliferation-associated protein 2G4 [Glycine max]
Length=390

 Score =   622 bits (1605),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/354 (86%), Positives = 341/354 (96%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP  ++VD+CEKGD++IREQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKTKIVDLCEKGDSYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVK+KIERGVAFPTC+SVNNTVCHFSPL++D+TVLE+GD+VKIDM CHIDGFIA
Sbjct  61    TGNMYKNVKRKIERGVAFPTCVSVNNTVCHFSPLASDETVLEDGDIVKIDMACHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
              VAHTH+L EGPVTGRAAD IAAANTAAEVA+RLVRPG+KN DVTEAIQKVAAAYDCKIV
Sbjct  121   AVAHTHVLHEGPVTGRAADAIAAANTAAEVALRLVRPGRKNKDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLSVSNP+TRVD+AEFEENEVY+IDIV STG+GKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYAIDIVASTGDGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDR+T+HPLQ+L  TK IDDPEIKAWLAL
Sbjct  301   YPVLHEKPGDDVAHIKFTVLLMPNGSDRVTSHPLQELQPTKTIDDPEIKAWLAL  354



>gb|ACJ85304.1| unknown [Medicago truncatula]
 gb|AFK40979.1| unknown [Medicago truncatula]
Length=394

 Score =   622 bits (1604),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/354 (86%), Positives = 343/354 (97%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SP+VVTKYK+AAEI+NKAL+LV+S+CKP A+VVDICEKGD+FIREQ
Sbjct  1     MSDDEREEKELDLTSPDVVTKYKTAAEIVNKALKLVISECKPKAKVVDICEKGDSFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             T N+YKNVKKKIERGVAFPTCISVNNT+CHFSPL++D+TVL+EGD+VKID+ CHIDGFIA
Sbjct  61    TSNVYKNVKKKIERGVAFPTCISVNNTICHFSPLASDETVLDEGDIVKIDLACHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
              VAHTH+LQEGPVTGRAADVIAAANTAAEVA+RLVRPGKKN DV++AIQKVAAAYDCKIV
Sbjct  121   AVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVSDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKVVLS+SNP+TRVD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVVLSISNPDTRVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKR RLGLVEC+NH+LLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRVRLGLVECMNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDR+T+HPLQ+L  TK IDDPEIKAWLAL
Sbjct  301   YPVLHEKPGDFVAHIKFTVLLMPNGSDRVTSHPLQELQPTKTIDDPEIKAWLAL  354



>ref|XP_003529167.1| PREDICTED: proliferation-associated protein 2G4 [Glycine max]
Length=394

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/354 (87%), Positives = 342/354 (97%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD++IREQ
Sbjct  1     MSDDEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDICEKGDSYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGN+YKNVK+KIERGVAFPTC+SVNN VCHFSPL++D+ VLEEGD++KIDM CHIDGFIA
Sbjct  61    TGNVYKNVKRKIERGVAFPTCLSVNNVVCHFSPLASDEAVLEEGDILKIDMACHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
              VAHTH+LQEGPVTGRAADVIAAANTAAEVA+RLVRPGKKN DV++AIQKVAAAYDCKIV
Sbjct  121   AVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVSDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLS+SNP+TRVDEAEFEENEVY+IDIVTSTG+GKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSLSNPDTRVDEAEFEENEVYAIDIVTSTGDGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGDLVAHIKFTVLLMPNGSDRIT HPLQ+L  TK IDDP+IKAWLAL
Sbjct  301   YPVLHEKPGDLVAHIKFTVLLMPNGSDRITTHPLQELQPTKTIDDPDIKAWLAL  354



>ref|XP_002262986.2| PREDICTED: proliferation-associated protein 2G4 [Vitis vinifera]
 ref|XP_010653323.1| PREDICTED: proliferation-associated protein 2G4 [Vitis vinifera]
 emb|CBI18248.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   622 bits (1603),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/389 (85%), Positives = 369/389 (95%), Gaps = 0/389 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI NKAL+LV+S+CKP A++VDICEKGD+FIREQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIANKALQLVLSECKPKAKIVDICEKGDSFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPL++D+TVLE+GDM+KID+GCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLASDETVLEDGDMLKIDLGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH+LQ GPV GRAADV+AAANTAAEVA+RLVRPG+KN DVTEAIQKVAAAYDCKIV
Sbjct  121   VVAHTHVLQGGPVMGRAADVLAAANTAAEVALRLVRPGRKNKDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKVVLSV +PETRV++AEFEENEVY++DIVTSTG+GKP++LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVVLSVPSPETRVEDAEFEENEVYAVDIVTSTGDGKPRLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkk  1322
             YPVLHEKPGD VAHIKFTVLLMPNGSDRIT+H LQ+L  TK  DDPEIKAWLAL TKTKK
Sbjct  301   YPVLHEKPGDYVAHIKFTVLLMPNGSDRITSHSLQELQPTKTTDDPEIKAWLALGTKTKK  360

Query  1323  kgggkkkkgkkgekteeAPQTEPTDEATN  1409
             KGGGKKKKGKKG+K EE+ + EP D  TN
Sbjct  361   KGGGKKKKGKKGDKPEESAEAEPMDATTN  389



>gb|KHN42848.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=390

 Score =   621 bits (1602),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/354 (86%), Positives = 341/354 (96%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+ERE+KELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP  ++VD+CEKGD++IREQ
Sbjct  1     MSDDEREKKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKTKIVDLCEKGDSYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVK+KIERGVAFPTC+SVNNTVCHFSPL++D+TVLE+GD+VKIDM CHIDGFIA
Sbjct  61    TGNMYKNVKRKIERGVAFPTCVSVNNTVCHFSPLASDETVLEDGDIVKIDMACHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
              VAHTH+L EGPVTGRAAD IAAANTAAEVA+RLVRPG+KN DVTEAIQKVAAAYDCKIV
Sbjct  121   AVAHTHVLHEGPVTGRAADAIAAANTAAEVALRLVRPGRKNKDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLS+SNP+TRVDEAEFEENEVY+IDIV STG+GKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSLSNPDTRVDEAEFEENEVYAIDIVASTGDGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDR+T+HPLQ+L  TK IDDPEIKAWLAL
Sbjct  301   YPVLHEKPGDDVAHIKFTVLLMPNGSDRVTSHPLQELQPTKTIDDPEIKAWLAL  354



>ref|XP_008805004.1| PREDICTED: proliferation-associated protein 2G4-like [Phoenix 
dactylifera]
 ref|XP_008805005.1| PREDICTED: proliferation-associated protein 2G4-like [Phoenix 
dactylifera]
Length=396

 Score =   621 bits (1601),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/390 (85%), Positives = 365/390 (94%), Gaps = 1/390 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+E +E+ELDL+S +VVTKYKSAAEI+NKAL+LV+S+CKP A++VDICEKGDAFIREQ
Sbjct  1     MSDDEAKEEELDLTSSDVVTKYKSAAEIVNKALQLVLSECKPKAKIVDICEKGDAFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
              GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPL+ D+TVLEE D+VKID+GCHIDGFIA
Sbjct  61    AGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLAGDETVLEENDIVKIDIGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH+LQEGPVTGRAADVIAA+NTAAEVA+RLVRPGKKN DVTEAIQKVAA YDCKIV
Sbjct  121   VVAHTHVLQEGPVTGRAADVIAASNTAAEVALRLVRPGKKNKDVTEAIQKVAATYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKVVLSVSN E RVDEAEFEENEVY++DIVTSTGEGKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVVLSVSNSEARVDEAEFEENEVYAVDIVTSTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMK+SRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKNYHLKMKSSRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLALPtktk  1319
             YPVLHEKPGDLVAHIKFTVLLMPNGSDRIT+HPLQ L  TK ID DPEIKAWL+L TKTK
Sbjct  301   YPVLHEKPGDLVAHIKFTVLLMPNGSDRITSHPLQQLQPTKTIDNDPEIKAWLSLGTKTK  360

Query  1320  kkgggkkkkgkkgekteeAPQTEPTDEATN  1409
             KKGGGKKKKGKKG   ++  +TEP D  +N
Sbjct  361   KKGGGKKKKGKKGGARDDTAETEPMDATSN  390



>ref|NP_001241588.1| uncharacterized protein LOC100781302 [Glycine max]
 gb|ACU19677.1| unknown [Glycine max]
Length=394

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/354 (86%), Positives = 342/354 (97%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD++IREQ
Sbjct  1     MSDDEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDICEKGDSYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGN+YKNVK+KIERGVAFPTC+S+NN VCHFSPL++D+ VLEEGD++KIDM CHIDGFIA
Sbjct  61    TGNVYKNVKRKIERGVAFPTCLSINNVVCHFSPLASDEAVLEEGDILKIDMACHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH+LQEGPVTGRAADVIAAANTAAEVA+RLVRPGKKN DV++AIQKVAAAYDCKIV
Sbjct  121   VVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVSDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLS+SNP+TRVDEAEFEENEVY+IDIVTSTG+GKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSLSNPDTRVDEAEFEENEVYAIDIVTSTGDGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDRIT HPLQ+L  TK IDDP+IKAWLAL
Sbjct  301   YPVLHEKPGDFVAHIKFTVLLMPNGSDRITTHPLQELQPTKTIDDPDIKAWLAL  354



>ref|XP_011046861.1| PREDICTED: proliferation-associated protein 2G4-like [Populus 
euphratica]
Length=396

 Score =   620 bits (1600),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/353 (86%), Positives = 341/353 (97%), Gaps = 0/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+EREE+ELDL+SPEVVTKYKSAAEI+NKAL+L +S+CKP A++VDICEKGD++IREQ+
Sbjct  3     SDDEREERELDLTSPEVVTKYKSAAEIVNKALQLAISECKPKAKIVDICEKGDSYIREQS  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             GNMYKNVKKKIERGVAFPTC+SVNNTVCHFSPL++D++VLEEGD+VKIDMGCHIDGFIAV
Sbjct  63    GNMYKNVKKKIERGVAFPTCVSVNNTVCHFSPLASDESVLEEGDIVKIDMGCHIDGFIAV  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             V HTH+LQ GPVTGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIVE
Sbjct  123   VGHTHVLQSGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSHQ+KQFVIDGNKV+LSVSNP+TRVD+AEFEENEVY++DI+TSTGEGKPK+LDEK T
Sbjct  183   GVLSHQLKQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIITSTGEGKPKLLDEKTT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             TIYKRAVDKNY+LKMK+SRFI+SEI+QKFP+MPF+AR LEEKRARLGLVEC+NHDLLQPY
Sbjct  243   TIYKRAVDKNYHLKMKSSRFIFSEINQKFPIMPFSARALEEKRARLGLVECMNHDLLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVLHEKPGD VAHIKFTVLLMPNGSDRIT+H LQ+L  TK IDDPEIKAWLAL
Sbjct  303   PVLHEKPGDCVAHIKFTVLLMPNGSDRITSHALQELQPTKTIDDPEIKAWLAL  355



>ref|XP_006576221.1| PREDICTED: uncharacterized protein LOC100784176 isoform X1 [Glycine 
max]
Length=390

 Score =   620 bits (1599),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/354 (85%), Positives = 342/354 (97%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI+N+AL+LV+S+CKP A++VD+CEKGD++IREQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIVNRALQLVISECKPKAKIVDLCEKGDSYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TG+MYKNVK+KIERGVAFPTC+SVNNTVCHFSPL++D+TVLE+GD+VKIDM CHIDGFIA
Sbjct  61    TGSMYKNVKRKIERGVAFPTCVSVNNTVCHFSPLASDETVLEDGDIVKIDMACHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
              VAHTH+LQEGPVTGRAAD +AAANTAAEVA+RLVRPG+KN DVTEAIQK+AAAYDCKIV
Sbjct  121   AVAHTHVLQEGPVTGRAADALAAANTAAEVALRLVRPGRKNKDVTEAIQKIAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVV+SVSNP+TRVD+AEFEENEVY+IDIV STG+GKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVVSVSNPDTRVDDAEFEENEVYAIDIVASTGDGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDR+T+H LQ+L  TK IDDPEIKAWLAL
Sbjct  301   YPVLHEKPGDYVAHIKFTVLLMPNGSDRVTSHSLQELQPTKTIDDPEIKAWLAL  354



>gb|KHN39558.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=394

 Score =   620 bits (1598),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/354 (86%), Positives = 342/354 (97%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD++IREQ
Sbjct  1     MSDDEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDICEKGDSYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGN+YKNVK+KIERGVAFPTC+SVNN VCHFSPL++D+ VLEEGD++KIDM CHIDGFIA
Sbjct  61    TGNVYKNVKRKIERGVAFPTCLSVNNVVCHFSPLASDEAVLEEGDILKIDMACHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
              VAHTH+LQEGPVTGRAADVIAAANTAAEVA+RLVRPGKKN DV++AIQKVAAAYDCKIV
Sbjct  121   AVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVSDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLS+SNP+TRVDEAEFEENEVY+IDIVTSTG+GKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSLSNPDTRVDEAEFEENEVYAIDIVTSTGDGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPF+AR LE+KRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFSARALEDKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGDLVAHIKFTVLLMPNGSDRIT HPLQ+L  TK IDDP+IKAWLAL
Sbjct  301   YPVLHEKPGDLVAHIKFTVLLMPNGSDRITTHPLQELQPTKTIDDPDIKAWLAL  354



>ref|XP_011095038.1| PREDICTED: proliferation-associated protein 2G4-like [Sesamum 
indicum]
Length=394

 Score =   619 bits (1597),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 307/342 (90%), Positives = 333/342 (97%), Gaps = 0/342 (0%)
 Frame = +3

Query  282   SSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKKIE  461
             +SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGDAFIREQTGNMYKNVKKKIE
Sbjct  14    TSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDVCEKGDAFIREQTGNMYKNVKKKIE  73

Query  462   RGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVVAHTHLLQEGPV  641
             RGVAFPTCISVNNTVCHFSPL++D+TVL++ D+VKIDMGCHIDGFIAVVAHTH++Q+GPV
Sbjct  74    RGVAFPTCISVNNTVCHFSPLASDETVLQDEDIVKIDMGCHIDGFIAVVAHTHVIQQGPV  133

Query  642   TGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEGVLSHQMKQFVI  821
             TGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIVEGVLSHQMKQFVI
Sbjct  134   TGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIVEGVLSHQMKQFVI  193

Query  822   DGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAVDKNYN  1001
             DGNKVVLSVS P+TRVDEAEFEENEVYSIDIVTSTGEGKPK+LDEKQTTIYKRAVDKNY+
Sbjct  194   DGNKVVLSVSGPDTRVDEAEFEENEVYSIDIVTSTGEGKPKLLDEKQTTIYKRAVDKNYH  253

Query  1002  LKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVA  1181
             LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVA
Sbjct  254   LKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVA  313

Query  1182  HIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALP  1307
             HIKFTVLLMPNGSDRIT HPLQ+L  TK +DDPEIKAWLALP
Sbjct  314   HIKFTVLLMPNGSDRITTHPLQELQPTKTVDDPEIKAWLALP  355



>ref|XP_007140242.1| hypothetical protein PHAVU_008G095800g [Phaseolus vulgaris]
 gb|ESW12236.1| hypothetical protein PHAVU_008G095800g [Phaseolus vulgaris]
Length=394

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/354 (86%), Positives = 342/354 (97%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A+VVDICEKGD++IREQ
Sbjct  1     MSDDEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKVVDICEKGDSYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGN+YKNVK+KIERG+AFPTC+SVNN +CHFSPL++D+ VLEEGD++KIDM CHIDGFIA
Sbjct  61    TGNVYKNVKRKIERGIAFPTCLSVNNVICHFSPLASDEAVLEEGDILKIDMACHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
              VAHTH+LQEGP+TGRAADVIAAANTAAEVA+RLVRPGKKN DV+EAIQKVAAAYDCKIV
Sbjct  121   AVAHTHVLQEGPITGRAADVIAAANTAAEVALRLVRPGKKNKDVSEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLS+SNPETRVDEAEFEENEVY+IDIVTSTG+GKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSLSNPETRVDEAEFEENEVYAIDIVTSTGDGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+S+ISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSDISQKFPIMPFSARALEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDR+T+HPLQ+L  TK IDDP+IKAWLAL
Sbjct  301   YPVLHEKPGDYVAHIKFTVLLMPNGSDRVTSHPLQELQPTKAIDDPDIKAWLAL  354



>gb|EYU41925.1| hypothetical protein MIMGU_mgv1a007938mg [Erythranthe guttata]
Length=390

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 311/355 (88%), Positives = 341/355 (96%), Gaps = 1/355 (0%)
 Frame = +3

Query  243   MSDEEREE-KELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
             M+DE REE +ELDLSSPEVVTKYKSAAEI+NKAL+LV+SQCKP  ++VD+CE GDAFIRE
Sbjct  1     MADEIREENEELDLSSPEVVTKYKSAAEIVNKALQLVLSQCKPKVKIVDLCEAGDAFIRE  60

Query  420   QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFI  599
             QTGNMYKNVKKKIE+GVAFPTC+SVNNTVCHFSPL++D++VLE+GD+VKIDMGCHIDGFI
Sbjct  61    QTGNMYKNVKKKIEKGVAFPTCVSVNNTVCHFSPLASDESVLEDGDIVKIDMGCHIDGFI  120

Query  600   AVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKI  779
             AVVAHTH+LQEGPVTGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKI
Sbjct  121   AVVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKI  180

Query  780   VEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEK  959
             VEGVLSHQMKQFVIDGNKVVLSVS P+T+VDEAEFEENEVYSIDIVTSTGEGKPK+LDEK
Sbjct  181   VEGVLSHQMKQFVIDGNKVVLSVSAPDTKVDEAEFEENEVYSIDIVTSTGEGKPKLLDEK  240

Query  960   QTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQ  1139
             QTTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQ
Sbjct  241   QTTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQ  300

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PY VLHEKPGDLVAHIKFTVLLMPNGSDR+T+H LQ+L  TK +DD EIKAWLAL
Sbjct  301   PYSVLHEKPGDLVAHIKFTVLLMPNGSDRVTSHALQELQPTKTVDDDEIKAWLAL  355



>ref|XP_010937887.1| PREDICTED: proliferation-associated protein 2G4-like [Elaeis 
guineensis]
Length=397

 Score =   619 bits (1596),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 331/395 (84%), Positives = 371/395 (94%), Gaps = 2/395 (1%)
 Frame = +3

Query  243   MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
             MSD+E REEKELDL+SP+VVTKYK AAEILNKAL+LVVS+CKP A +VDICEKGDAFI+E
Sbjct  1     MSDDEAREEKELDLTSPDVVTKYKCAAEILNKALQLVVSECKPKANIVDICEKGDAFIKE  60

Query  420   QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFI  599
             QTGN+YKNVKKKIE+G+AFPTCISVNNTVCHFSPL  D+TVLEE D+VKIDMGCHIDGFI
Sbjct  61    QTGNVYKNVKKKIEKGIAFPTCISVNNTVCHFSPLGGDETVLEENDVVKIDMGCHIDGFI  120

Query  600   AVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKI  779
             A+ AHTH+L++GP+TGRAADVIAAANTAAEVA+RLVRPGKKN DV EAIQKVA+AYDCK+
Sbjct  121   AIAAHTHVLRDGPITGRAADVIAAANTAAEVALRLVRPGKKNKDVAEAIQKVASAYDCKV  180

Query  780   VEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEK  959
             VEGVLSHQ+KQFVIDGNKV+LS+SNPETRVD+AEFEENEVY+IDIVTSTGEGKPK+LDEK
Sbjct  181   VEGVLSHQLKQFVIDGNKVILSISNPETRVDDAEFEENEVYAIDIVTSTGEGKPKLLDEK  240

Query  960   QTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQ  1139
             QTTIYKRAVDK+Y+LKMKASRFI+SEI+QKFP++PFTAR L+EKRARLGLVECVNHDLLQ
Sbjct  241   QTTIYKRAVDKSYHLKMKASRFIFSEINQKFPILPFTARALDEKRARLGLVECVNHDLLQ  300

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDD-PEIKAWLALPtkt  1316
             PYPVLHEKPGDLVAHIKFTVLLMPNGSDRIT+HPLQ+L  TK IDD PEIKAWLAL TKT
Sbjct  301   PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITSHPLQELKPTKSIDDNPEIKAWLALGTKT  360

Query  1317  kkkgggkkkkgkkgekteeAPQTEPTDEATNKSKS  1421
             KKKGGGKKKKGKK E  ++A + EP DEA+N + S
Sbjct  361   KKKGGGKKKKGKKAEAKDDAVEAEPMDEASNDAAS  395



>gb|KJB17053.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
 gb|KJB17054.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
 gb|KJB17055.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
Length=393

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/354 (86%), Positives = 338/354 (95%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDLSS EVVTKYK AAEI+NKAL+LVV +CKP A++VDICEKGDAFIREQ
Sbjct  1     MSDDEREEKELDLSSSEVVTKYKGAAEIVNKALQLVVKECKPKAKIVDICEKGDAFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKN KKKIERGVAFPTC+SVNNTVCHFSPL++D + LEEGDMVKIDMGCHIDGFIA
Sbjct  61    TGNMYKNSKKKIERGVAFPTCLSVNNTVCHFSPLASDTSELEEGDMVKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH++Q GP+TG+ ADV+AAANTAAEVA+RLVRPGKKN DV++AIQKVAAAYDCKIV
Sbjct  121   VVAHTHVVQSGPITGKQADVVAAANTAAEVALRLVRPGKKNKDVSDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKV+LSVSNP+TRVD+AEFEENEVY++DIV STGEGKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMKASRFI+SEI+Q+FP++PFTAR LEEKRARLGLVECVNHDLLQP
Sbjct  241   TTIYKRAVDKNYHLKMKASRFIFSEINQRFPILPFTARALEEKRARLGLVECVNHDLLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVL+EKPGD VAHIKFTVLLMPNGSDRIT+HPLQ+L  TK IDDPEIKAWLAL
Sbjct  301   YPVLYEKPGDYVAHIKFTVLLMPNGSDRITSHPLQELQPTKTIDDPEIKAWLAL  354



>ref|XP_007140243.1| hypothetical protein PHAVU_008G095900g [Phaseolus vulgaris]
 gb|ESW12237.1| hypothetical protein PHAVU_008G095900g [Phaseolus vulgaris]
Length=392

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/354 (86%), Positives = 341/354 (96%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSDEEREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VD+CEKGD++IREQ
Sbjct  1     MSDEEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDLCEKGDSYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGN+YKNVK+KIERGVAFPTC+SVNN VCHFSPL++D+ VLEEGD++KIDM CHIDGFIA
Sbjct  61    TGNVYKNVKRKIERGVAFPTCLSVNNLVCHFSPLASDEAVLEEGDILKIDMACHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
              VAHTH+LQEGPV+GRAADVIAAANTAAEVA+RLVRPGKKN DVT+AIQKVAAAYDCKIV
Sbjct  121   AVAHTHVLQEGPVSGRAADVIAAANTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLS+SNP+TRVDEAEFEENEVY+IDIVTSTG+GKPK+ DEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSLSNPDTRVDEAEFEENEVYAIDIVTSTGDGKPKLFDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDR+T+HPLQ+L  TK IDDP+IKAWLAL
Sbjct  301   YPVLHEKPGDYVAHIKFTVLLMPNGSDRVTSHPLQELQPTKTIDDPDIKAWLAL  354



>gb|AEY75257.1| putative DNA binding protein [Atriplex canescens]
Length=396

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/354 (85%), Positives = 338/354 (95%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDLS PEVVTKYKSAA+I+N+AL+LVV++CKP A++VD+CEKGD FIREQ
Sbjct  1     MSDDEREEKELDLSYPEVVTKYKSAADIVNRALQLVVAECKPKAKIVDLCEKGDNFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTC+S+NN VCHFSPL++DD+VLEEGD+VKIDMGCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCLSINNVVCHFSPLASDDSVLEEGDLVKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH++QEGPVTGR ADV+AA NTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIV
Sbjct  121   VVAHTHVIQEGPVTGRKADVLAATNTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLSVS+P+ RVD+AEFEENEVYS+DI  STGEGKP++LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSVSSPDVRVDDAEFEENEVYSVDIAVSTGEGKPRMLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMKASRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECV+HDL+QP
Sbjct  241   TTIYKRAVDKNYHLKMKASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVSHDLVQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVL+EKPGD VAHIKFTVLLMPNGSDR+T++PLQ+L  TK +D PEIKAWLAL
Sbjct  301   YPVLYEKPGDYVAHIKFTVLLMPNGSDRVTSYPLQELQPTKTVDHPEIKAWLAL  354



>ref|XP_010920808.1| PREDICTED: proliferation-associated protein 2G4 isoform X3 [Elaeis 
guineensis]
Length=397

 Score =   618 bits (1594),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 332/395 (84%), Positives = 371/395 (94%), Gaps = 2/395 (1%)
 Frame = +3

Query  243   MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
             MSD+E +EEKELDLS P+VVTKYK AAEILNKAL+LVVS+CKP A++VDICEKGD FI+E
Sbjct  1     MSDDEAKEEKELDLSFPDVVTKYKCAAEILNKALQLVVSECKPKAKIVDICEKGDTFIKE  60

Query  420   QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFI  599
             Q+GN+YKNVKKKIERGVAFPTCISVNNTVCHFSPLS D+ VLEE D+VKIDMGCHIDGFI
Sbjct  61    QSGNVYKNVKKKIERGVAFPTCISVNNTVCHFSPLSGDEAVLEENDVVKIDMGCHIDGFI  120

Query  600   AVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKI  779
             AVVAHTH+LQEGP+TGRAADVIAAANTAA+VA+RLVRPG+KN DVTEAIQKVA AYDCKI
Sbjct  121   AVVAHTHVLQEGPITGRAADVIAAANTAADVALRLVRPGRKNKDVTEAIQKVAGAYDCKI  180

Query  780   VEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEK  959
             VEGVLSHQ+KQFVIDGNK+++SVSNPETRVD+AEFEENEVY+IDIVTSTGEGKPK+LDEK
Sbjct  181   VEGVLSHQLKQFVIDGNKIIISVSNPETRVDDAEFEENEVYAIDIVTSTGEGKPKLLDEK  240

Query  960   QTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQ  1139
              TTIYKRAVDKNY+LKMKASRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQ
Sbjct  241   HTTIYKRAVDKNYHLKMKASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQ  300

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLALPtkt  1316
             PYPVLHEKPGDLVAHIKFTVLLMPNGSDRIT+HPLQ+L  TK ID +PEIKAWL+L TKT
Sbjct  301   PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITSHPLQELKPTKSIDNNPEIKAWLSLGTKT  360

Query  1317  kkkgggkkkkgkkgekteeAPQTEPTDEATNKSKS  1421
             KKKGGGKKKKGKKGE  +++ + EP DEA+N + S
Sbjct  361   KKKGGGKKKKGKKGEAKDDSAEAEPMDEASNGAAS  395



>gb|KHG25370.1| Proliferation-associated 2G4 [Gossypium arboreum]
Length=393

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/354 (86%), Positives = 338/354 (95%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+S EVVTKYKSAAEI+NKAL+LVV +CKP  ++VDICEKGDAFIREQ
Sbjct  1     MSDDEREEKELDLTSSEVVTKYKSAAEIVNKALQLVVKECKPKVKIVDICEKGDAFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKN KKKIERGVAFPTC+SVNNTVCHFSPL++D + LEEGDMVKIDMGCHIDGFIA
Sbjct  61    TGNMYKNSKKKIERGVAFPTCLSVNNTVCHFSPLASDTSELEEGDMVKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH++Q GP+TG+ ADV+AAANTAAEVA+RLVRPGKKN DV++AIQKVAAAYDCKIV
Sbjct  121   VVAHTHVVQSGPITGKQADVVAAANTAAEVALRLVRPGKKNKDVSDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKV+LSVSNP+TRVD+AEFEENEVY++DIV STGEGKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMKASRFI+SEI+Q+FP++PFTAR LEEKRARLGLVECVNHDLLQP
Sbjct  241   TTIYKRAVDKNYHLKMKASRFIFSEINQRFPILPFTARALEEKRARLGLVECVNHDLLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVL+EKPGD VAHIKFTVLLMPNGSDRIT+HPLQ+L  TK IDDPEIKAWLAL
Sbjct  301   YPVLYEKPGDYVAHIKFTVLLMPNGSDRITSHPLQELQPTKTIDDPEIKAWLAL  354



>ref|XP_009384793.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384794.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
Length=395

 Score =   617 bits (1592),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/356 (87%), Positives = 341/356 (96%), Gaps = 2/356 (1%)
 Frame = +3

Query  243   MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
             MSD+E REEKELDL+SP+VVTKYKSAAEI+NKAL+LVVS+CKP A++VD+CEKGDAFIRE
Sbjct  1     MSDDEAREEKELDLTSPDVVTKYKSAAEIVNKALQLVVSECKPKAKIVDLCEKGDAFIRE  60

Query  420   QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFI  599
             QTGNMYKNVK+KIERGV FPTC+SVNNTVCHFSPL +D+ VLE  D+VKIDMGCHIDGFI
Sbjct  61    QTGNMYKNVKRKIERGVGFPTCVSVNNTVCHFSPLGSDEAVLEANDIVKIDMGCHIDGFI  120

Query  600   AVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKI  779
             AVVAHTH++QEGPVTGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKI
Sbjct  121   AVVAHTHVIQEGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKI  180

Query  780   VEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEK  959
             VEGVLSHQ+KQFVIDGNKV++SV+NPETRVDE EFEENEVY+IDIVTSTGEGKPK+LDEK
Sbjct  181   VEGVLSHQLKQFVIDGNKVIISVTNPETRVDEVEFEENEVYAIDIVTSTGEGKPKLLDEK  240

Query  960   QTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQ  1139
             QTTIYKRAVDK+Y+LKMK+SRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQ
Sbjct  241   QTTIYKRAVDKSYHLKMKSSRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQ  300

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDD-PEIKAWLAL  1304
             PYPVLHEKPGDLVAHIKFT+LLMPNGSDR+T+HPLQ L  TK IDD PEIKAWLAL
Sbjct  301   PYPVLHEKPGDLVAHIKFTLLLMPNGSDRVTSHPLQQLQPTKTIDDNPEIKAWLAL  356



>ref|XP_011077533.1| PREDICTED: proliferation-associated protein 2G4-like [Sesamum 
indicum]
Length=394

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/341 (90%), Positives = 334/341 (98%), Gaps = 0/341 (0%)
 Frame = +3

Query  282   SSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKKIE  461
             +SPEVVTKYKSAA+I+NKAL+LVVS+CKP A++VD+CEKGDAFIREQTGNMYKNVKKKIE
Sbjct  14    TSPEVVTKYKSAADIVNKALQLVVSECKPKAKIVDLCEKGDAFIREQTGNMYKNVKKKIE  73

Query  462   RGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVVAHTHLLQEGPV  641
             +GVAFPTCISVNNTVCHFSPL++D+TVLE+GD++KIDMGCHIDGFIAVVAHTH+L++GPV
Sbjct  74    KGVAFPTCISVNNTVCHFSPLASDETVLEDGDILKIDMGCHIDGFIAVVAHTHVLKQGPV  133

Query  642   TGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEGVLSHQMKQFVI  821
             TGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIVEGVLSHQMKQFVI
Sbjct  134   TGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIVEGVLSHQMKQFVI  193

Query  822   DGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAVDKNYN  1001
             DGNKVVLSVS P+TRVDEAEFEENEVYS+DIVTSTGEGKPK+LDEKQTTIYKRAVDKNY+
Sbjct  194   DGNKVVLSVSGPDTRVDEAEFEENEVYSVDIVTSTGEGKPKLLDEKQTTIYKRAVDKNYH  253

Query  1002  LKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVA  1181
             LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVA
Sbjct  254   LKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVA  313

Query  1182  HIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             HIKFTVLLMPNGSDRIT+HPLQDL  TK +DDPEIKAWLAL
Sbjct  314   HIKFTVLLMPNGSDRITSHPLQDLQPTKTVDDPEIKAWLAL  354



>ref|XP_009402229.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402230.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
Length=395

 Score =   617 bits (1591),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/395 (84%), Positives = 371/395 (94%), Gaps = 2/395 (1%)
 Frame = +3

Query  243   MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
             MSD+E REEKELDL+SP+VVTKYKSAAEI+NKAL+LV S+CKP A++VD+CE+GDAFIRE
Sbjct  1     MSDDEAREEKELDLTSPDVVTKYKSAAEIVNKALQLVTSKCKPKAKIVDLCEQGDAFIRE  60

Query  420   QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFI  599
             Q GN+YKNVK+KIERGVAFPTCISVNNTVCHFSPL++DD VLEE D+VKIDMGCHIDGFI
Sbjct  61    QAGNIYKNVKRKIERGVAFPTCISVNNTVCHFSPLASDDAVLEENDIVKIDMGCHIDGFI  120

Query  600   AVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKI  779
             AVV HTH++QEGPVTGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKI
Sbjct  121   AVVGHTHVIQEGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKI  180

Query  780   VEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEK  959
             VEGVLSHQ+KQFVIDGNKV++SV+NPETRVDE EFEENEVY+ID+VTSTGEGKPK+LDEK
Sbjct  181   VEGVLSHQLKQFVIDGNKVIISVTNPETRVDEFEFEENEVYAIDVVTSTGEGKPKLLDEK  240

Query  960   QTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQ  1139
             QTTIYKRAVDKNY+LKMK+SRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNHDLLQ
Sbjct  241   QTTIYKRAVDKNYHLKMKSSRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHDLLQ  300

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDD-PEIKAWLALPtkt  1316
             PYPVLHEKPGDLVAHIKFTVLLMPNGSDRIT+HPLQ L  +K IDD  EIKAW+AL TKT
Sbjct  301   PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITSHPLQQLLPSKMIDDNAEIKAWMALGTKT  360

Query  1317  kkkgggkkkkgkkgekteeAPQTEPTDEATNKSKS  1421
             KKKGGGKKKKGKKG+  ++A ++EP D A+N + +
Sbjct  361   KKKGGGKKKKGKKGDAQDDAVESEPKDSASNSTAA  395



>ref|XP_004492468.1| PREDICTED: proliferation-associated protein 2G4-like [Cicer arietinum]
Length=394

 Score =   616 bits (1589),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/354 (86%), Positives = 341/354 (96%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD+FIREQ
Sbjct  1     MSDDEREEKELDLSSSEVVTKYKTAAEIVNKALKLVISECKPKAKIVDICEKGDSFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             T N+YKNVKKKIERGVAFPTCISVNNT+CHFSPL++D+TVLEEGD+VKID+ CHIDGFIA
Sbjct  61    TSNVYKNVKKKIERGVAFPTCISVNNTICHFSPLASDETVLEEGDIVKIDLACHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
              VAHTH+LQEGPVTGRAADVIAAANTAAEVA+RLVRPGKKN DVT+AIQKVAAAYDCKIV
Sbjct  121   AVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKVVLS++NP+TRVD+ EFEENEVY+IDIVTSTG+GKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVVLSITNPDTRVDDTEFEENEVYAIDIVTSTGDGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVEC+NH+LLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECMNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDR+T+HPLQ+L  TK I+DPEI AWLAL
Sbjct  301   YPVLHEKPGDFVAHIKFTVLLMPNGSDRVTSHPLQELQPTKTIEDPEINAWLAL  354



>ref|NP_001242070.1| uncharacterized protein LOC100784176 [Glycine max]
 gb|ACU23134.1| unknown [Glycine max]
Length=390

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/354 (85%), Positives = 341/354 (96%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI+N+AL+LV+S+CKP A++VD+CEKGD++IREQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIVNRALQLVISECKPKAKIVDLCEKGDSYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TG+MYKNVK+KIERGVAFPTC+SVNNTVCHFSPL++D+TVLE+GD+VKIDM CHIDGFIA
Sbjct  61    TGSMYKNVKRKIERGVAFPTCVSVNNTVCHFSPLASDETVLEDGDIVKIDMACHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
              VAHTH+LQEGPVTGRAAD +AAANTAAEVA+RLVRPG+KN DVTEAIQK+AAAYDCKIV
Sbjct  121   AVAHTHVLQEGPVTGRAADALAAANTAAEVALRLVRPGRKNKDVTEAIQKIAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLSVSNP+TRVD+AEFEENEVY+IDIV STG+GKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYAIDIVASTGDGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDR+T+H LQ+L  TK IDDPEIKA LAL
Sbjct  301   YPVLHEKPGDYVAHIKFTVLLMPNGSDRVTSHSLQELQPTKTIDDPEIKACLAL  354



>ref|XP_006843644.2| PREDICTED: proliferation-associated protein 2G4 [Amborella trichopoda]
Length=392

 Score =   616 bits (1588),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 308/355 (87%), Positives = 344/355 (97%), Gaps = 1/355 (0%)
 Frame = +3

Query  243   MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
             MSD+E +EE+ELDL+SP+VVTKYK+AAEILNKAL+LVVS+CKP A+VVDICEKGDAFIRE
Sbjct  1     MSDDEAKEERELDLTSPDVVTKYKTAAEILNKALQLVVSECKPKAKVVDICEKGDAFIRE  60

Query  420   QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFI  599
             QTG++YKN KKKIERGVAFPTCISVNNTVCHFSPL++D+T L E DMVKIDMGCHIDGFI
Sbjct  61    QTGSVYKNAKKKIERGVAFPTCISVNNTVCHFSPLASDETTLVENDMVKIDMGCHIDGFI  120

Query  600   AVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKI  779
             AVVAHTH+LQEGPVTGRAADVIAAANTAAEVA+RLVRPG+KN DVTEAIQKVAAAYDCKI
Sbjct  121   AVVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLVRPGRKNKDVTEAIQKVAAAYDCKI  180

Query  780   VEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEK  959
             VEGVLSHQ+KQFVIDGNKV+L+VSNPETRVD+AEFEENEVY+IDIVTSTG+GKPK+LDEK
Sbjct  181   VEGVLSHQLKQFVIDGNKVILNVSNPETRVDDAEFEENEVYAIDIVTSTGDGKPKLLDEK  240

Query  960   QTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQ  1139
             QTTIYKRAVDKNY+LKMK+SRFI+SEI+Q+FP+MPFTAR LEEKRARLGLVECVNH+LLQ
Sbjct  241   QTTIYKRAVDKNYHLKMKSSRFIFSEINQRFPIMPFTARVLEEKRARLGLVECVNHELLQ  300

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PYPVLHEKPGDLVAHIKFTVLL+P+GSDRIT+HPLQDL  +K I+DPEIKAWLAL
Sbjct  301   PYPVLHEKPGDLVAHIKFTVLLLPSGSDRITSHPLQDLQPSKQIEDPEIKAWLAL  355



>ref|XP_004489059.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Cicer arietinum]
Length=394

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/354 (86%), Positives = 338/354 (95%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SP+VVTKYKSAAEI+NKAL+L++S+CKP  +VV+ICEKGD+FIREQ
Sbjct  1     MSDDEREEKELDLTSPDVVTKYKSAAEIVNKALQLIISECKPKVKVVEICEKGDSFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCIS+NNTVCHFSPL++D+TVLEEGD++KID+ CHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCISINNTVCHFSPLASDETVLEEGDILKIDLACHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
              VAHTH+LQEGPVTGRAADVIAAANTAAEVA+RLVRPGKKN DVT+AIQKVAAAYDCKIV
Sbjct  121   AVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVID NKVVLSVSNP+TRVD+AEFEENEVY+IDIV STGEGKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDANKVVLSVSNPDTRVDDAEFEENEVYAIDIVASTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVD++Y+LKMKASRFIYSEI+Q FP+MPF+AR LEEKRARLGLVEC+NH+LLQP
Sbjct  241   TTIYKRAVDRSYHLKMKASRFIYSEITQNFPIMPFSARALEEKRARLGLVECMNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEK GD VAHIKFTVLLMPNGSDRIT H LQ+L  TK +DDPEIKAWLAL
Sbjct  301   YPVLHEKAGDYVAHIKFTVLLMPNGSDRITTHSLQELQPTKTVDDPEIKAWLAL  354



>gb|KEH38647.1| proliferation-associated 2G4-like protein [Medicago truncatula]
Length=391

 Score =   615 bits (1586),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/354 (85%), Positives = 340/354 (96%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+ER+EKELDL+SP+VVTKYKSAAEI+NKAL+LV+S+CKP+ ++VDICEKGD+FIREQ
Sbjct  1     MSDDERDEKELDLTSPDVVTKYKSAAEIVNKALQLVISECKPDVKIVDICEKGDSFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TG +YKNVKKKIERGVAFPTCISVNNTVCHFSPL++D+TVLE GD++KIDM CHIDGFIA
Sbjct  61    TGKLYKNVKKKIERGVAFPTCISVNNTVCHFSPLASDETVLEVGDILKIDMACHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
              VAHTH+L+EGPVTGRAADVIAAANTAAEVA+RLV+PGKKN DVT+AIQKVAAAYDC+IV
Sbjct  121   AVAHTHVLREGPVTGRAADVIAAANTAAEVALRLVKPGKKNQDVTDAIQKVAAAYDCRIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVID NKVVLSVSNP+TRVD+AEFEENEVY+IDIV STGEGKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDANKVVLSVSNPDTRVDDAEFEENEVYAIDIVASTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVD++YNLKMKASRFIYSEISQ FP+MPF+AR LEEKRARLGLVEC+NH+LLQP
Sbjct  241   TTIYKRAVDRSYNLKMKASRFIYSEISQNFPIMPFSARALEEKRARLGLVECMNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDRIT+HPLQ++  TK +DDPEIKAWLAL
Sbjct  301   YPVLHEKPGDYVAHIKFTVLLMPNGSDRITSHPLQEIQPTKTVDDPEIKAWLAL  354



>gb|KHG01253.1| Proliferation-associated 2G4 [Gossypium arboreum]
Length=392

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/354 (86%), Positives = 334/354 (94%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LVV +CKP  ++VDICEKGDAFIREQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVVKECKPKTKIVDICEKGDAFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKN K+KIERGVAFPTC+SVNN VCHFSPL++D + L+EGDMVKIDMGCHIDGFIA
Sbjct  61    TGNMYKNAKRKIERGVAFPTCLSVNNIVCHFSPLASDTSELQEGDMVKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH++QEGPV  R ADVIAAANTAAEVA+RLVRPGKKN DVT+AIQKVAAAYDCKIV
Sbjct  121   VVAHTHVVQEGPVNDRKADVIAAANTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKV+LSVSNP+TRVD+AEFEENEVY++DIV STGEGKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMK SRFI+SEI+QKFP++PFTAR LEEKRARLGLVECVNHDLLQP
Sbjct  241   TTIYKRAVDKNYHLKMKTSRFIFSEINQKFPILPFTARALEEKRARLGLVECVNHDLLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDRIT HPLQ+L  TK IDDPEIK WLAL
Sbjct  301   YPVLHEKPGDYVAHIKFTVLLMPNGSDRITLHPLQELQPTKTIDDPEIKGWLAL  354



>ref|XP_002308228.2| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
 gb|EEE91751.2| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
Length=398

 Score =   615 bits (1585),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 324/394 (82%), Positives = 365/394 (93%), Gaps = 2/394 (1%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+EREE+ELDL+SPEV+TKYKSAAEI+NKAL+LV+S+CKP A++VDICEKGD+FIREQT
Sbjct  3     SDDEREERELDLTSPEVITKYKSAAEIVNKALQLVISECKPKAKIVDICEKGDSFIREQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             GNMYKNVKKKIERGVAFPTC+SVNNT+CHFSPL++D++VLEEGD+VKID+GCHIDGFIAV
Sbjct  63    GNMYKNVKKKIERGVAFPTCVSVNNTICHFSPLASDESVLEEGDIVKIDLGCHIDGFIAV  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             V HTH LQ GPVTGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIVE
Sbjct  123   VGHTHALQSGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIVE  182

Query  786   GVLSH--QMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEK  959
             GVL    Q+KQFVIDGNKV+LSVSNP+TRVD+AEFEENEVY++DIVTSTGEGKPK+LDEK
Sbjct  183   GVLRQELQLKQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVTSTGEGKPKLLDEK  242

Query  960   QTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQ  1139
              TTIYKRAVDKNY+LKMK+SRFI+SEI+QKFP+MPFTAR LEEKRARLGL+ECVNHDLLQ
Sbjct  243   STTIYKRAVDKNYHLKMKSSRFIFSEINQKFPIMPFTARALEEKRARLGLLECVNHDLLQ  302

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktk  1319
             PYPVLHEKPGD VAHIKFTVLLMPNGSDRIT+H LQ+L  +K IDDPEIKAWLAL TKTK
Sbjct  303   PYPVLHEKPGDYVAHIKFTVLLMPNGSDRITSHSLQELQPSKTIDDPEIKAWLALGTKTK  362

Query  1320  kkgggkkkkgkkgekteeAPQTEPTDEATNKSKS  1421
             KKGGGKKKK KK  +  E+ + EP D  TN + +
Sbjct  363   KKGGGKKKKAKKSGEKAESTEAEPMDATTNGAAA  396



>ref|XP_010907411.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010907412.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Elaeis guineensis]
Length=394

 Score =   614 bits (1584),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 309/355 (87%), Positives = 339/355 (95%), Gaps = 1/355 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+E +E+ELDL+SP+VVTKYKSAA+I++KAL+L VS+CKP A++VDICEKGDAFIREQ
Sbjct  1     MSDDEAKEEELDLTSPDVVTKYKSAADIVSKALQLAVSECKPKAKIVDICEKGDAFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
              GN+YKNVKKKIERG+AFPTCISVNN VCHFSPL+ D+TVLEE D+VKIDMGCHIDGFIA
Sbjct  61    AGNIYKNVKKKIERGLAFPTCISVNNIVCHFSPLAGDETVLEENDIVKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH+LQEGPVTGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIV
Sbjct  121   VVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKVVLSVSNPE RVDEAEFEENEVY++DIVTSTGEGKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVVLSVSNPEARVDEAEFEENEVYAVDIVTSTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMK+SRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKNYHLKMKSSRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLAL  1304
             YPVLHEK GDLVAHIKFTVLLMPNGSDRIT+HPLQ L  TK ID DPEIKAWLAL
Sbjct  301   YPVLHEKLGDLVAHIKFTVLLMPNGSDRITSHPLQQLQPTKTIDNDPEIKAWLAL  355



>ref|XP_002322994.2| hypothetical protein POPTR_0016s12720g [Populus trichocarpa]
 gb|EEF04755.2| hypothetical protein POPTR_0016s12720g [Populus trichocarpa]
Length=375

 Score =   613 bits (1581),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/353 (86%), Positives = 338/353 (96%), Gaps = 0/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+EREE+ELDL+SPEVVTKYKSAAEI+NKAL+L +S+CKP  ++VDICEK D++IREQ+
Sbjct  3     SDDEREERELDLTSPEVVTKYKSAAEIVNKALQLAISECKPKVKIVDICEKADSYIREQS  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             GNMYKNVKKKIERGVAFPTC+SVNNTVCHFSPL++D++VLEEGD+VKIDMGCHIDGFIAV
Sbjct  63    GNMYKNVKKKIERGVAFPTCVSVNNTVCHFSPLASDESVLEEGDVVKIDMGCHIDGFIAV  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             V HTH+LQ GPVTGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIVE
Sbjct  123   VGHTHVLQLGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSHQ+KQFVIDGNKV+LSVSNP+TRVD+AEFEENEVY++DI TSTGEGKPK+LDEK T
Sbjct  183   GVLSHQLKQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIFTSTGEGKPKLLDEKTT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             TIYKRAVDKNY+LKMK+SRFI+SEI+QKFP+MPF+AR LEEKRARLGLVECVNHDLLQPY
Sbjct  243   TIYKRAVDKNYHLKMKSSRFIFSEINQKFPIMPFSARALEEKRARLGLVECVNHDLLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVLHEKPGD VAHIKFTVLLMPNGSDRIT+H LQ+L  TK IDDPEIKAWLAL
Sbjct  303   PVLHEKPGDCVAHIKFTVLLMPNGSDRITSHALQELQPTKTIDDPEIKAWLAL  355



>gb|KJB36944.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
 gb|KJB36947.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
 gb|KJB36948.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
Length=392

 Score =   613 bits (1580),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/354 (86%), Positives = 333/354 (94%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LVV +CKP  ++VDICEKGDAFIREQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVVKECKPKTKIVDICEKGDAFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKN K+KIERGVAFPTC+SVNNTVCHFSPL++D + L+EGDMVKIDMGCHIDGFIA
Sbjct  61    TGNMYKNAKRKIERGVAFPTCLSVNNTVCHFSPLASDTSELQEGDMVKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH++QEG V  R ADVIAAANTAAEVA+RLVRPGKKN DVT+AIQKVAAAYDCKIV
Sbjct  121   VVAHTHVVQEGLVNDRKADVIAAANTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKV+LSVSNP+TRVD+AEFEENEVY++DIV STGEGKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMK SRFI+SEI+QKFP++PFTAR LEEKRARLGLVECVNHDLLQP
Sbjct  241   TTIYKRAVDKNYHLKMKTSRFIFSEINQKFPILPFTARALEEKRARLGLVECVNHDLLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDRIT HPLQ L  TK IDDPEIK WLAL
Sbjct  301   YPVLHEKPGDYVAHIKFTVLLMPNGSDRITLHPLQKLQPTKTIDDPEIKGWLAL  354



>ref|XP_010676777.1| PREDICTED: proliferation-associated protein 2G4 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/354 (85%), Positives = 339/354 (96%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREE+ELDL+ PEVVTKYKSAA+I+N+AL+LVV++CKP A++VDICEKGD++IREQ
Sbjct  1     MSDDEREEQELDLTYPEVVTKYKSAADIVNRALQLVVAECKPKAKIVDICEKGDSYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             +GNMYKNVKKKIERGVAFPTCISVNN VCHFSPL++D++VLE+GD+VKID+GCHIDGFIA
Sbjct  61    SGNMYKNVKKKIERGVAFPTCISVNNVVCHFSPLASDESVLEDGDVVKIDLGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
              VAHTH++QEG VTGR ADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIV
Sbjct  121   AVAHTHVIQEGAVTGRKADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKVVLSVS+P+ RVD+AEFEENEVYSIDI  STGEGKP++LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVVLSVSSPDVRVDDAEFEENEVYSIDIAASTGEGKPRMLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMKASRFI+SEI+QK+P+MPFTAR LEEKRARLGLVECVNHDLLQP
Sbjct  241   TTIYKRAVDKNYHLKMKASRFIFSEINQKYPIMPFTARALEEKRARLGLVECVNHDLLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDR+T+HPLQ+L  TK I+DPEIKAWLAL
Sbjct  301   YPVLHEKPGDYVAHIKFTVLLMPNGSDRVTSHPLQELQPTKTIEDPEIKAWLAL  354



>gb|KJB36946.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
Length=371

 Score =   612 bits (1577),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 304/354 (86%), Positives = 333/354 (94%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LVV +CKP  ++VDICEKGDAFIREQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVVKECKPKTKIVDICEKGDAFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKN K+KIERGVAFPTC+SVNNTVCHFSPL++D + L+EGDMVKIDMGCHIDGFIA
Sbjct  61    TGNMYKNAKRKIERGVAFPTCLSVNNTVCHFSPLASDTSELQEGDMVKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH++QEG V  R ADVIAAANTAAEVA+RLVRPGKKN DVT+AIQKVAAAYDCKIV
Sbjct  121   VVAHTHVVQEGLVNDRKADVIAAANTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKV+LSVSNP+TRVD+AEFEENEVY++DIV STGEGKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMK SRFI+SEI+QKFP++PFTAR LEEKRARLGLVECVNHDLLQP
Sbjct  241   TTIYKRAVDKNYHLKMKTSRFIFSEINQKFPILPFTARALEEKRARLGLVECVNHDLLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDRIT HPLQ L  TK IDDPEIK WLAL
Sbjct  301   YPVLHEKPGDYVAHIKFTVLLMPNGSDRITLHPLQKLQPTKTIDDPEIKGWLAL  354



>ref|XP_008792800.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008792807.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008792815.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008792823.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
Length=397

 Score =   612 bits (1579),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 330/395 (84%), Positives = 371/395 (94%), Gaps = 2/395 (1%)
 Frame = +3

Query  243   MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
             MSD+E +EEKELDL+ P+VVTKYK  AEI+NKAL+LV+S+CKP A++ DICEKGDAFI+E
Sbjct  1     MSDDEAKEEKELDLTFPDVVTKYKCNAEIVNKALQLVISECKPKAKIADICEKGDAFIKE  60

Query  420   QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFI  599
             Q+GN+YKNVKKKIERGVAFPTCISVNNTVCHFSPLS+D+TVLEE D+VKIDMGCHIDGFI
Sbjct  61    QSGNVYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETVLEENDVVKIDMGCHIDGFI  120

Query  600   AVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKI  779
             AVVAHTH+L EGP+TGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKV AAYDCKI
Sbjct  121   AVVAHTHVLHEGPITGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVVAAYDCKI  180

Query  780   VEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEK  959
             +EGVLSHQ+KQFVIDGNKV+LSVSNPETRVD+AEFEENEVY+IDIVTSTGEGKPK+LDE+
Sbjct  181   IEGVLSHQLKQFVIDGNKVILSVSNPETRVDDAEFEENEVYAIDIVTSTGEGKPKLLDER  240

Query  960   QTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQ  1139
              TTIYKRA+DKNY+LKMKASRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQ
Sbjct  241   HTTIYKRAMDKNYHLKMKASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQ  300

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLALPtkt  1316
             PYPVLHEKPGDLVAHIKFTVLLMPNGSDRIT+HPLQ+L  TK ID +PEIKAWLAL TKT
Sbjct  301   PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITSHPLQELKPTKSIDNNPEIKAWLALGTKT  360

Query  1317  kkkgggkkkkgkkgekteeAPQTEPTDEATNKSKS  1421
             KKKGGGKKKKGKKGE  +++ + EP DEA+N + S
Sbjct  361   KKKGGGKKKKGKKGEAKDDSAEAEPMDEASNGAPS  395



>ref|XP_004489058.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Cicer arietinum]
Length=482

 Score =   615 bits (1587),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/354 (86%), Positives = 338/354 (95%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SP+VVTKYKSAAEI+NKAL+L++S+CKP  +VV+ICEKGD+FIREQ
Sbjct  1     MSDDEREEKELDLTSPDVVTKYKSAAEIVNKALQLIISECKPKVKVVEICEKGDSFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTCIS+NNTVCHFSPL++D+TVLEEGD++KID+ CHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCISINNTVCHFSPLASDETVLEEGDILKIDLACHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
              VAHTH+LQEGPVTGRAADVIAAANTAAEVA+RLVRPGKKN DVT+AIQKVAAAYDCKIV
Sbjct  121   AVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVID NKVVLSVSNP+TRVD+AEFEENEVY+IDIV STGEGKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDANKVVLSVSNPDTRVDDAEFEENEVYAIDIVASTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVD++Y+LKMKASRFIYSEI+Q FP+MPF+AR LEEKRARLGLVEC+NH+LLQP
Sbjct  241   TTIYKRAVDRSYHLKMKASRFIYSEITQNFPIMPFSARALEEKRARLGLVECMNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEK GD VAHIKFTVLLMPNGSDRIT H LQ+L  TK +DDPEIKAWLAL
Sbjct  301   YPVLHEKAGDYVAHIKFTVLLMPNGSDRITTHSLQELQPTKTVDDPEIKAWLAL  354



>ref|XP_010650887.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Vitis 
vinifera]
Length=384

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/355 (85%), Positives = 343/355 (97%), Gaps = 1/355 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREE+ELDL+SPEVVTKYK+AAEI+NKAL++V+S+CKP A++VD+CEKGDAFIREQ
Sbjct  1     MSDDEREERELDLTSPEVVTKYKTAAEIVNKALQVVLSECKPKAKIVDVCEKGDAFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGN+YKNVKKKIERGVAFPTCISVNNTVCHFSPLS+D+T+LE GD++KIDMGCHIDGFIA
Sbjct  61    TGNVYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETLLEAGDILKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH+LQ+GPVTGRAADVIAAANTAAEVA+RL+RPG+KN +VT+AIQKVAAAYDCKIV
Sbjct  121   VVAHTHVLQDGPVTGRAADVIAAANTAAEVALRLLRPGRKNKEVTDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKVVLSV + ETRVD+AEFEENEVY++DIV S+G+GKP++LDE+Q
Sbjct  181   EGVLSHQLKQFVIDGNKVVLSVPSGETRVDDAEFEENEVYAVDIVISSGDGKPRLLDERQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMK+SRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNHDLLQP
Sbjct  241   TTIYKRAVDKNYHLKMKSSRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHDLLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDRIT+HPLQ+L  TK ID DPEIKAWLAL
Sbjct  301   YPVLHEKPGDFVAHIKFTVLLMPNGSDRITSHPLQELRPTKTIDNDPEIKAWLAL  355



>ref|XP_002278744.2| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Vitis 
vinifera]
 emb|CBI15928.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 301/355 (85%), Positives = 343/355 (97%), Gaps = 1/355 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREE+ELDL+SPEVVTKYK+AAEI+NKAL++V+S+CKP A++VD+CEKGDAFIREQ
Sbjct  1     MSDDEREERELDLTSPEVVTKYKTAAEIVNKALQVVLSECKPKAKIVDVCEKGDAFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGN+YKNVKKKIERGVAFPTCISVNNTVCHFSPLS+D+T+LE GD++KIDMGCHIDGFIA
Sbjct  61    TGNVYKNVKKKIERGVAFPTCISVNNTVCHFSPLSSDETLLEAGDILKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH+LQ+GPVTGRAADVIAAANTAAEVA+RL+RPG+KN +VT+AIQKVAAAYDCKIV
Sbjct  121   VVAHTHVLQDGPVTGRAADVIAAANTAAEVALRLLRPGRKNKEVTDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKVVLSV + ETRVD+AEFEENEVY++DIV S+G+GKP++LDE+Q
Sbjct  181   EGVLSHQLKQFVIDGNKVVLSVPSGETRVDDAEFEENEVYAVDIVISSGDGKPRLLDERQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMK+SRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNHDLLQP
Sbjct  241   TTIYKRAVDKNYHLKMKSSRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHDLLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDRIT+HPLQ+L  TK ID DPEIKAWLAL
Sbjct  301   YPVLHEKPGDFVAHIKFTVLLMPNGSDRITSHPLQELRPTKTIDNDPEIKAWLAL  355



>ref|XP_008789134.1| PREDICTED: proliferation-associated protein 2G4-like [Phoenix 
dactylifera]
Length=397

 Score =   608 bits (1569),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/356 (86%), Positives = 341/356 (96%), Gaps = 2/356 (1%)
 Frame = +3

Query  243   MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
             MSD+E REEKELDL+SP+VVTKYK AAEI+NKAL+LVVS+CKP A++VDICEKGDAFI+E
Sbjct  1     MSDDEAREEKELDLTSPDVVTKYKCAAEIVNKALQLVVSECKPKAKIVDICEKGDAFIKE  60

Query  420   QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFI  599
             QTG +YKNVKKKIE+G+AFPTCISVNNTVCHFSPL +D+TVLE  D+VKIDMGCHIDGF+
Sbjct  61    QTGTVYKNVKKKIEKGIAFPTCISVNNTVCHFSPLGSDETVLEANDVVKIDMGCHIDGFV  120

Query  600   AVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKI  779
             AVVAHTH+LQ+G +TGRAADVIAAANTAAEVA+RLVRPGKKN DV EAIQKVAAAYDCK+
Sbjct  121   AVVAHTHVLQDGSITGRAADVIAAANTAAEVALRLVRPGKKNKDVAEAIQKVAAAYDCKV  180

Query  780   VEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEK  959
             VEGVLSHQ+KQFVIDGNKVVLSVSNP+TRVD+AEFEENEVY+IDIVTSTGEGKP++LDEK
Sbjct  181   VEGVLSHQIKQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYAIDIVTSTGEGKPRLLDEK  240

Query  960   QTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQ  1139
             QTTIYKRAVDKNY+LKMKASRFI+SEI+QKFP++PFTAR LEEKRARLGLVECVNHDLLQ
Sbjct  241   QTTIYKRAVDKNYHLKMKASRFIFSEINQKFPILPFTARALEEKRARLGLVECVNHDLLQ  300

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDD-PEIKAWLAL  1304
             PYPVLHEKPGDLVAHIKFTVLLMPNGSDRIT+HPLQ+L  T+ IDD PEIKAWLAL
Sbjct  301   PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITSHPLQELKPTRSIDDNPEIKAWLAL  356



>ref|XP_002440927.1| hypothetical protein SORBIDRAFT_09g016610 [Sorghum bicolor]
 gb|EES19357.1| hypothetical protein SORBIDRAFT_09g016610 [Sorghum bicolor]
Length=392

 Score =   606 bits (1563),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/353 (86%), Positives = 335/353 (95%), Gaps = 1/353 (0%)
 Frame = +3

Query  249   DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
             DE REEKELDLSS +VVTKYK+AAEILN AL+LVVS+CKP A++VD+CEKGD+FIREQTG
Sbjct  5     DEVREEKELDLSSNDVVTKYKAAAEILNNALKLVVSECKPKAKIVDLCEKGDSFIREQTG  64

Query  429   NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVV  608
             N+YKN K+KIERG+AFPTC+SVNNTVCHFSPL+ DD VLEE DMVKIDMGCHIDGFIAVV
Sbjct  65    NVYKNAKRKIERGIAFPTCVSVNNTVCHFSPLATDDAVLEENDMVKIDMGCHIDGFIAVV  124

Query  609   AHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
             AHTH++  GPVTGRAADV+AAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIVEG
Sbjct  125   AHTHVITSGPVTGRAADVLAAANTAAEVAVRLVRPGKKNKDVTEAIQKVAAAYDCKIVEG  184

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTT  968
             VLSHQ+KQFVIDGNKVVLSVSN +T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTT
Sbjct  185   VLSHQLKQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTT  244

Query  969   IYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYP  1148
             IYKRAVDKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYP
Sbjct  245   IYKRAVDKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYP  304

Query  1149  VLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLAL  1304
             VLHEKPGDLVAHIKFTVLLMPNGSD+IT+HPLQ+L  TK I D+ EIKAWLAL
Sbjct  305   VLHEKPGDLVAHIKFTVLLMPNGSDKITSHPLQELKPTKSIEDNAEIKAWLAL  357



>ref|NP_001149216.1| proliferation-associated protein 2G4 [Zea mays]
 gb|ACG34597.1| proliferation-associated protein 2G4 [Zea mays]
 gb|ACR36319.1| unknown [Zea mays]
 gb|AFW77740.1| hypothetical protein ZEAMMB73_275925 [Zea mays]
Length=394

 Score =   606 bits (1562),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 313/392 (80%), Positives = 350/392 (89%), Gaps = 5/392 (1%)
 Frame = +3

Query  249   DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
             DE REEKELDLSS +VVTKYK+AAEILN AL++VVSQCKP  ++VD+CEKGD+FIREQTG
Sbjct  5     DEVREEKELDLSSNDVVTKYKAAAEILNNALKIVVSQCKPKVKIVDLCEKGDSFIREQTG  64

Query  429   NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVV  608
             N+YKN K+KIERG+AFPTC+SVN+TVCHFSPL+ DD VLEE DMVKIDMGCHIDGFIAVV
Sbjct  65    NVYKNAKRKIERGIAFPTCVSVNDTVCHFSPLATDDAVLEENDMVKIDMGCHIDGFIAVV  124

Query  609   AHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
             AHTH++  GPVTGRA DV+AAANTAAEVAMRLVRPGKKN DVTEAIQKVAAAYDCKIVEG
Sbjct  125   AHTHVITNGPVTGRAGDVLAAANTAAEVAMRLVRPGKKNKDVTEAIQKVAAAYDCKIVEG  184

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTT  968
             VLSHQ+KQFVIDGNKVVLSVSN +T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTT
Sbjct  185   VLSHQLKQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTT  244

Query  969   IYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYP  1148
             IYKRAVDKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYP
Sbjct  245   IYKRAVDKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYP  304

Query  1149  VLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALPtktkkk  1325
             VLHEKPGDLVAHIKFTVLLMPNGSD+IT+HPLQ+L  TK I D+ EIKAWLAL      K
Sbjct  305   VLHEKPGDLVAHIKFTVLLMPNGSDKITSHPLQELKPTKSIEDNAEIKAWLAL----GTK  360

Query  1326  gggkkkkgkkgekteeAPQTEPTDEATNKSKS  1421
                K    KK  K  +A + +P +EATN + S
Sbjct  361   SKKKGGGKKKKGKKGDAAEADPMEEATNGATS  392



>ref|XP_010920804.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Elaeis 
guineensis]
 ref|XP_010920805.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Elaeis 
guineensis]
Length=431

 Score =   607 bits (1565),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/355 (86%), Positives = 339/355 (95%), Gaps = 2/355 (1%)
 Frame = +3

Query  243   MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
             MSD+E +EEKELDLS P+VVTKYK AAEILNKAL+LVVS+CKP A++VDICEKGD FI+E
Sbjct  1     MSDDEAKEEKELDLSFPDVVTKYKCAAEILNKALQLVVSECKPKAKIVDICEKGDTFIKE  60

Query  420   QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFI  599
             Q+GN+YKNVKKKIERGVAFPTCISVNNTVCHFSPLS D+ VLEE D+VKIDMGCHIDGFI
Sbjct  61    QSGNVYKNVKKKIERGVAFPTCISVNNTVCHFSPLSGDEAVLEENDVVKIDMGCHIDGFI  120

Query  600   AVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKI  779
             AVVAHTH+LQEGP+TGRAADVIAAANTAA+VA+RLVRPG+KN DVTEAIQKVA AYDCKI
Sbjct  121   AVVAHTHVLQEGPITGRAADVIAAANTAADVALRLVRPGRKNKDVTEAIQKVAGAYDCKI  180

Query  780   VEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEK  959
             VEGVLSHQ+KQFVIDGNK+++SVSNPETRVD+AEFEENEVY+IDIVTSTGEGKPK+LDEK
Sbjct  181   VEGVLSHQLKQFVIDGNKIIISVSNPETRVDDAEFEENEVYAIDIVTSTGEGKPKLLDEK  240

Query  960   QTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQ  1139
              TTIYKRAVDKNY+LKMKASRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQ
Sbjct  241   HTTIYKRAVDKNYHLKMKASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQ  300

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLA  1301
             PYPVLHEKPGDLVAHIKFTVLLMPNGSDRIT+HPLQ+L  TK ID +PEIKAWL+
Sbjct  301   PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITSHPLQELKPTKSIDNNPEIKAWLS  355



>gb|ADK78215.1| methionine aminopeptiase [Hordeum vulgare]
Length=394

 Score =   605 bits (1559),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/355 (86%), Positives = 336/355 (95%), Gaps = 2/355 (1%)
 Frame = +3

Query  246   SDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             SDEE REEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD FI EQ
Sbjct  3     SDEEVREEKELDLSSNEVVTKYKTAAEIINKALKLVLSECKPKAKIVDICEKGDNFITEQ  62

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGN+YKNVK+KIERG+AFPTC+SVNNTVCHFSPL+ DD+VLEE DMVKIDM CHIDGFIA
Sbjct  63    TGNVYKNVKRKIERGIAFPTCVSVNNTVCHFSPLATDDSVLEENDMVKIDMACHIDGFIA  122

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH+++ GPVTGRAADV+AAANTAAEVAMRLVRPGKKN DVTEAIQKVAAAYDCKIV
Sbjct  123   VVAHTHVIKAGPVTGRAADVLAAANTAAEVAMRLVRPGKKNKDVTEAIQKVAAAYDCKIV  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKVVLSVSN +T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQ
Sbjct  183   EGVLSHQLKQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQ  242

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQP
Sbjct  243   TTIYKRAVDKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQP  302

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLAL  1304
             YPVLHEK GDLVAHIKFTVLLMPNGSD+IT+HPLQ L  +K I DD EIKAWLAL
Sbjct  303   YPVLHEKQGDLVAHIKFTVLLMPNGSDKITSHPLQQLEPSKSIEDDAEIKAWLAL  357



>ref|XP_004962368.1| PREDICTED: proliferation-associated protein 2G4-like [Setaria 
italica]
Length=401

 Score =   604 bits (1557),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 315/398 (79%), Positives = 355/398 (89%), Gaps = 7/398 (2%)
 Frame = +3

Query  249   DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
             DE REEKELDLSS +VVTKYK+AAEILN AL+LVVS+CKP A++VD+CEKGD+FIREQTG
Sbjct  5     DEVREEKELDLSSNDVVTKYKAAAEILNNALKLVVSECKPKAKIVDLCEKGDSFIREQTG  64

Query  429   NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVV  608
             N+YKN K+KIERG+AFPTC+SVNNTVCHFSPL+ D+ VLEE DMVKIDMGCHIDGFIAVV
Sbjct  65    NVYKNAKRKIERGIAFPTCVSVNNTVCHFSPLATDEAVLEENDMVKIDMGCHIDGFIAVV  124

Query  609   AHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
             AHTH++  GPVTGRAADV+AAANTAAEVAMRLVRPGKKN DVTEAIQKVAAAYDCKIVEG
Sbjct  125   AHTHVITNGPVTGRAADVLAAANTAAEVAMRLVRPGKKNKDVTEAIQKVAAAYDCKIVEG  184

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTT  968
             VLSHQ+KQFVIDGNKVVLSVSN +T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTT
Sbjct  185   VLSHQLKQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTT  244

Query  969   IYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYP  1148
             IYKRAVDKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYP
Sbjct  245   IYKRAVDKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYP  304

Query  1149  VLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLALPtktkkk  1325
             VLHEKPGDLVAHIKFTVLLMPNGSD++T+H LQ+L  TK I D+ EIKAWLAL       
Sbjct  305   VLHEKPGDLVAHIKFTVLLMPNGSDKVTSHQLQELQPTKSIEDNAEIKAWLAL------G  358

Query  1326  gggkkkkgkkgekteeAPQTEPTDEATNKSKS*RNASY  1439
                KKK G K +K ++    EP +EATN + S  N+ +
Sbjct  359   TKSKKKGGGKKKKGKKGDAAEPMEEATNGAPSQNNSDF  396



>gb|AHA84129.1| DNA-binding protein GBP16 [Phaseolus vulgaris]
Length=394

 Score =   602 bits (1553),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/354 (84%), Positives = 337/354 (95%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSDEEREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VD+CEKGD++IREQ
Sbjct  1     MSDEEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDLCEKGDSYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGN+YKNVK+KIERGVAFPTC+SVNN VCHFSPL++D+ VLEEGD++KIDM CHIDGFIA
Sbjct  61    TGNVYKNVKRKIERGVAFPTCLSVNNLVCHFSPLASDEAVLEEGDILKIDMACHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
              VAHTH+LQEGPV+GRAADVIAAANTAAEVA+RLVRPGKKN DVT+AIQKVAAAYDCKIV
Sbjct  121   AVAHTHVLQEGPVSGRAADVIAAANTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGV +H MKQFV++GNKVVLS+SNP+TRVDEAEFEEN+VY+IDIVTSTG+GKPK+ DEKQ
Sbjct  181   EGVSTHPMKQFVMNGNKVVLSLSNPDTRVDEAEFEENQVYAIDIVTSTGDGKPKLFDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPF AR LEEKRARLGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFFARALEEKRARLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VAHIKFTVLLMPNGSDR+T+H LQ+L  TK IDDP+IKAWLAL
Sbjct  301   YPVLHEKPGDYVAHIKFTVLLMPNGSDRVTSHTLQELQPTKTIDDPDIKAWLAL  354



>ref|XP_010553237.1| PREDICTED: proliferation-associated protein 2G4-like [Tarenaya 
hassleriana]
Length=389

 Score =   601 bits (1550),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/354 (86%), Positives = 335/354 (95%), Gaps = 1/354 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+EREEKELDL+S +VVTKYKSAAEI+NKAL LVVS+CKP A++VDICEKGDAFIREQT
Sbjct  3     SDDEREEKELDLTSSDVVTKYKSAAEIINKALHLVVSECKPKAKIVDICEKGDAFIREQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             GNMYKNVKKKIERG+AFPTCISVNNTVCHFSPL++D+TVLEEGDMVKIDMGCHIDGFIAV
Sbjct  63    GNMYKNVKKKIERGLAFPTCISVNNTVCHFSPLASDETVLEEGDMVKIDMGCHIDGFIAV  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             VA T +LQEGP+TGR ADVIAAANTAAEVA+RLVRPGKKN +V+EAIQKVA AYDCKIVE
Sbjct  123   VAQTIVLQEGPITGRKADVIAAANTAAEVALRLVRPGKKNQEVSEAIQKVAEAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSHQMKQFVIDGNKVVLSVSNPETRV++ EFEENEVYSIDIVTSTG+GKPK+LDEKQT
Sbjct  183   GVLSHQMKQFVIDGNKVVLSVSNPETRVEDVEFEENEVYSIDIVTSTGDGKPKLLDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             T+YKR+ D++Y+LKMKASRFI+SEI+Q +P  PF+AR LEEKRARLGLVECVNHDLL+PY
Sbjct  243   TVYKRSPDRSYHLKMKASRFIFSEINQNYPHFPFSARVLEEKRARLGLVECVNHDLLEPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDD-PEIKAWLAL  1304
             PVLHEKPGD VAHIKFTVLLMPNGSDRIT+HPLQ+L  TK IDD PEIKAWLAL
Sbjct  303   PVLHEKPGDFVAHIKFTVLLMPNGSDRITSHPLQELQPTKTIDDAPEIKAWLAL  356



>gb|AFG29445.1| Erb3 binding protein [Nervilia fordii]
Length=395

 Score =   602 bits (1551),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/356 (85%), Positives = 336/356 (94%), Gaps = 2/356 (1%)
 Frame = +3

Query  243   MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
             MSD+E +EE ELDL+S +VVTKYK+A+EI+NKAL+LVVS CKP A++VDICEKGDAFIRE
Sbjct  1     MSDDEAKEEIELDLTSSDVVTKYKAASEIVNKALQLVVSGCKPKAKIVDICEKGDAFIRE  60

Query  420   QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFI  599
             Q G+MYKNVKKKIERGVAFPTCISVNNTVCHFSP+++DDTVLEE D+VKIDMGCHIDGFI
Sbjct  61    QAGSMYKNVKKKIERGVAFPTCISVNNTVCHFSPMASDDTVLEENDIVKIDMGCHIDGFI  120

Query  600   AVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKI  779
             AVVAHTH+LQEGPV+GR ADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKI
Sbjct  121   AVVAHTHVLQEGPVSGRVADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKI  180

Query  780   VEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEK  959
             VEGVLSHQ+KQFVIDGNKV+LSV NPETRVDEAEFEENEVY++DIV STG+GKPK+ DEK
Sbjct  181   VEGVLSHQLKQFVIDGNKVILSVGNPETRVDEAEFEENEVYAVDIVMSTGDGKPKLFDEK  240

Query  960   QTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQ  1139
             QTTIYKRAVDKNY+LKMKASRFI+SEISQK+P+MPF+AR LEEKRARLGLVECVNHDLLQ
Sbjct  241   QTTIYKRAVDKNYHLKMKASRFIFSEISQKYPIMPFSARALEEKRARLGLVECVNHDLLQ  300

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLAL  1304
             PYPVLHEKPGD VAHIKFTVLLMPNGSDRIT+HP+Q L  +  I +DPEIKAWLAL
Sbjct  301   PYPVLHEKPGDFVAHIKFTVLLMPNGSDRITSHPVQQLLPSISIENDPEIKAWLAL  356



>ref|XP_010092793.1| Proliferation-associated protein 2G4 [Morus notabilis]
 gb|EXB52379.1| Proliferation-associated protein 2G4 [Morus notabilis]
Length=424

 Score =   601 bits (1549),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 333/422 (79%), Positives = 377/422 (89%), Gaps = 29/422 (7%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILN--------------KALELVVSQCKPNARV  380
             MSD+EREEKELDL+SPEVVTKYKSAAEI+N              +AL+LV+S+CKP A++
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIVNSIFVVYNLGIGKNEEALQLVLSECKPKAKI  60

Query  381   VDICEKGDAFIREQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDM  560
             VD+CEKGD++IREQTGNMYKNVKKKIERGVAFPTC+SVNNTVCHFSPL++D++VLE+GD+
Sbjct  61    VDLCEKGDSYIREQTGNMYKNVKKKIERGVAFPTCVSVNNTVCHFSPLASDESVLEDGDI  120

Query  561   VKIDMGCHIDGFIAVVAHTHLLQEGPVTGRaadviaaantaaevaMRL---VRPGK----  719
             VKIDMGCHIDGFIA+VAHTH+LQEGPVTGRAADVIAAANTAAEVA+RL   V   K    
Sbjct  121   VKIDMGCHIDGFIAIVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLHILVVSEKLRVE  180

Query  720   --------KNSDVTEAIQKVAAAYDCKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVDE  875
                     +N DVTEAIQKVAAAYDCKIVEGVLSHQ+KQFVIDGNKVVLSVSNP+TRVD+
Sbjct  181   IWFDGNFAENKDVTEAIQKVAAAYDCKIVEGVLSHQLKQFVIDGNKVVLSVSNPDTRVDD  240

Query  876   AEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFP  1055
             AEFEENE+Y+IDIVTSTG+GKP++LDEKQTTIYKRAVDKNY+LKMKASRFI+SEI+QKFP
Sbjct  241   AEFEENEIYAIDIVTSTGDGKPRLLDEKQTTIYKRAVDKNYHLKMKASRFIFSEINQKFP  300

Query  1056  LMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITA  1235
             +MPFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRIT+
Sbjct  301   IMPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITS  360

Query  1236  HPLQDLNVTKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekteeAPQTEPTDEATNKS  1415
             HPLQ+L  TK I+DPEIK+WLAL  KTKKKGGGKKKKGKKGEKTE++ + EP D ATN +
Sbjct  361   HPLQELQPTKIIEDPEIKSWLALGIKTKKKGGGKKKKGKKGEKTEDSTEAEPMDAATNGA  420

Query  1416  KS  1421
             +S
Sbjct  421   ES  422



>ref|XP_010253797.1| PREDICTED: proliferation-associated protein 2G4-like [Nelumbo 
nucifera]
Length=397

 Score =   600 bits (1546),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/342 (87%), Positives = 332/342 (97%), Gaps = 1/342 (0%)
 Frame = +3

Query  282   SSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKKIE  461
             +SPEVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGDAFIREQTGNMYKNVK+KIE
Sbjct  15    TSPEVVTKYKNAAEIVNKALQLVLSECKPKAKIVDICEKGDAFIREQTGNMYKNVKRKIE  74

Query  462   RGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVVAHTHLLQEGPV  641
             RGVAFPTCISVNNTVCHFSPL++D+TVLEEGDM+KIDMGCHIDGFI VVAHTH+L+EGPV
Sbjct  75    RGVAFPTCISVNNTVCHFSPLASDETVLEEGDMLKIDMGCHIDGFITVVAHTHVLKEGPV  134

Query  642   TGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEGVLSHQMKQFVI  821
             TGRAADV+AAANTAAEVA+RLVRPG+KN DVT+AIQKVAAAYDCKIVEGVLSHQ+KQFVI
Sbjct  135   TGRAADVMAAANTAAEVALRLVRPGRKNKDVTDAIQKVAAAYDCKIVEGVLSHQLKQFVI  194

Query  822   DGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAVDKNYN  1001
             DGNKV+L+VS+PETRVD+AEFEENEVY+IDIVTSTG+GKPK+LDE+QTTIYKRAVDKNY+
Sbjct  195   DGNKVILNVSSPETRVDDAEFEENEVYAIDIVTSTGDGKPKLLDERQTTIYKRAVDKNYH  254

Query  1002  LKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVA  1181
             LKMK+SRFI+SEI+QKFP+MPF+AR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD VA
Sbjct  255   LKMKSSRFIFSEINQKFPIMPFSARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDFVA  314

Query  1182  HIKFTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLAL  1304
             HIKFTVLLMPNGSDRIT+H LQ+L  TK I DDPEIKAWLAL
Sbjct  315   HIKFTVLLMPNGSDRITSHALQELQPTKTIDDDPEIKAWLAL  356



>ref|XP_003568643.1| PREDICTED: proliferation-associated protein 2G4 [Brachypodium 
distachyon]
Length=394

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/353 (85%), Positives = 333/353 (94%), Gaps = 1/353 (0%)
 Frame = +3

Query  249   DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
             DE REEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD FI EQTG
Sbjct  5     DEVREEKELDLSSNEVVTKYKTAAEIINKALKLVLSECKPKAKIVDICEKGDNFITEQTG  64

Query  429   NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVV  608
             N+YKNVKKKIERG+AFPTC+SVNNTVCHFSPL+ DD +LEE DMVKIDMGCHIDGFIAVV
Sbjct  65    NVYKNVKKKIERGIAFPTCLSVNNTVCHFSPLATDDAILEENDMVKIDMGCHIDGFIAVV  124

Query  609   AHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
             AHTH++++GPVTGRAADV+AAANTAAEVAMRLVRPGK N DVTEAIQKVA AYDCKIVEG
Sbjct  125   AHTHVIKDGPVTGRAADVLAAANTAAEVAMRLVRPGKNNKDVTEAIQKVATAYDCKIVEG  184

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTT  968
             VLSHQ+KQFVIDGNKVVLSVSN +T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTT
Sbjct  185   VLSHQLKQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTT  244

Query  969   IYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYP  1148
             IYKRAVDKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYP
Sbjct  245   IYKRAVDKNYHLKMKASRFIFSEISQKFPIMPFTARVLEEKRARLGLVECMNHELLQPYP  304

Query  1149  VLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLAL  1304
             VLHEKPGDLVAHIKFTVLLMPNGSDR+T+H LQ+L  +K I D+ EIK WLAL
Sbjct  305   VLHEKPGDLVAHIKFTVLLMPNGSDRVTSHSLQELQPSKSIEDNAEIKGWLAL  357



>ref|XP_004302550.1| PREDICTED: proliferation-associated protein 2G4 [Fragaria vesca 
subsp. vesca]
Length=395

 Score =   599 bits (1544),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 305/353 (86%), Positives = 336/353 (95%), Gaps = 0/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+ V+++CKP A++VD+CE GD+FIREQT
Sbjct  3     SDDEREEKELDLTSPEVVTKYKSAAEIVNKALQRVIAECKPKAKIVDVCEIGDSFIREQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             GNMYK+ KKKIERGVAFPT ISVNNTVCHFSPL+ D+TV EEGD+VKIDMGCHIDGFIA+
Sbjct  63    GNMYKSAKKKIERGVAFPTSISVNNTVCHFSPLATDETVFEEGDIVKIDMGCHIDGFIAI  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             VAHTH LQ GP+TGRAADVIAAANTAAEVA+RLV+PGKKN DVTEAIQKVAAAYDCKIVE
Sbjct  123   VAHTHALQTGPITGRAADVIAAANTAAEVALRLVKPGKKNKDVTEAIQKVAAAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSHQMKQFVID NKV+LS+SNPETRV+EAEFEENEVY+IDIV STGEGKPK+LDEKQT
Sbjct  183   GVLSHQMKQFVIDANKVILSISNPETRVEEAEFEENEVYAIDIVASTGEGKPKLLDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             TIYKRAVDKNY+LKMKASRFI+SEI+QKFPLMPFTAR LEEKRARLGL ECVNHDLLQPY
Sbjct  243   TIYKRAVDKNYHLKMKASRFIFSEITQKFPLMPFTARALEEKRARLGLFECVNHDLLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVLHEKPGD+VAHIKFTVLLMPNGSDRIT+HPLQ+L  TK +DDPEIKAWLAL
Sbjct  303   PVLHEKPGDIVAHIKFTVLLMPNGSDRITSHPLQELQPTKQVDDPEIKAWLAL  355



>gb|AAF91445.1|AF281652_1 putative DNA binding protein [Atriplex hortensis]
Length=397

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 294/355 (83%), Positives = 330/355 (93%), Gaps = 1/355 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDLS PEVVTKYKSAA+I+N+AL+LVV +CKP A++VD+CEKGD FIREQ
Sbjct  1     MSDDEREEKELDLSYPEVVTKYKSAADIVNRALQLVVGECKPKAKIVDLCEKGDNFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVKKKIERGVAFPTC+S+NN VCHFSPL++DD+VLEEGD+VKIDMGCHIDGFIA
Sbjct  61    TGNMYKNVKKKIERGVAFPTCLSINNVVCHFSPLASDDSVLEEGDLVKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTE-AIQKVAAAYDCKI  779
             VVAHTH++QEGPVTGR ADV+AA NTAAEVA+RLVRPGK      +   QK AAAYDCKI
Sbjct  121   VVAHTHVIQEGPVTGRKADVLAATNTAAEVALRLVRPGKNQYRCNQKQSQKXAAAYDCKI  180

Query  780   VEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEK  959
             VEGVLSHQMKQFVIDGNKVVLSVS+P+ RVD+AEFEENEVYS+DI  STGEGKP++LDEK
Sbjct  181   VEGVLSHQMKQFVIDGNKVVLSVSSPDVRVDDAEFEENEVYSVDIAASTGEGKPRMLDEK  240

Query  960   QTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQ  1139
             QTTIYKRAVDKNY+LKMKASRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNHDLLQ
Sbjct  241   QTTIYKRAVDKNYHLKMKASRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHDLLQ  300

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PYPVL+EKPGD VAHIKFTVLLMPNGSDR+T++P+Q+L  TK IDDPEIKAWLAL
Sbjct  301   PYPVLYEKPGDYVAHIKFTVLLMPNGSDRVTSYPVQELQPTKSIDDPEIKAWLAL  355



>gb|EMT31637.1| Proliferation-associated protein 2G4 [Aegilops tauschii]
Length=482

 Score =   600 bits (1548),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/355 (85%), Positives = 336/355 (95%), Gaps = 2/355 (1%)
 Frame = +3

Query  246   SDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             SDEE REEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD FI EQ
Sbjct  71    SDEEVREEKELDLSSNEVVTKYKTAAEIINKALKLVLSECKPKAKIVDICEKGDNFITEQ  130

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGN+YKNVK+KIERG+AFPTC+SVNNTVCHFSPL+ DD+VLEE DMVKIDM CHIDGFIA
Sbjct  131   TGNVYKNVKRKIERGIAFPTCVSVNNTVCHFSPLATDDSVLEENDMVKIDMACHIDGFIA  190

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH+++ GPVTGRAA+V+AAANTAAEVAMRLVRPGKKN DVTEAIQKVAAAYDCKIV
Sbjct  191   VVAHTHVIKGGPVTGRAANVLAAANTAAEVAMRLVRPGKKNKDVTEAIQKVAAAYDCKIV  250

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKVVLSVSN +T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQ
Sbjct  251   EGVLSHQLKQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQ  310

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQP
Sbjct  311   TTIYKRAVDKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQP  370

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLAL  1304
             YPVLHEK GDLVAHIKFTVLLMPNGSD+IT+HPLQ L  +K I+ D EIKAWLAL
Sbjct  371   YPVLHEKQGDLVAHIKFTVLLMPNGSDKITSHPLQQLEPSKSIEGDAEIKAWLAL  425



>gb|AGV54689.1| proliferation-associated protein 2G4-like protein [Phaseolus 
vulgaris]
Length=394

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 297/354 (84%), Positives = 334/354 (94%), Gaps = 0/354 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A+VVDICEKGD++IREQ
Sbjct  1     MSDDEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKVVDICEKGDSYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGN+YKNVK+KIERG+AFPTC+SVNN +CHFSPL++D+ VLEE D++KIDM CHIDGFIA
Sbjct  61    TGNVYKNVKRKIERGIAFPTCLSVNNVICHFSPLASDEAVLEERDILKIDMACHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
              VAHTH+LQEGP+TGRAADVIAAANTAAEVA+RLVRPGKKN DV+EAIQKVAAAYDCKIV
Sbjct  121   AVAHTHVLQEGPITGRAADVIAAANTAAEVALRLVRPGKKNKDVSEAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQMKQFVIDGNKVVLS+SNPETRVDEAEFEENEVY+IDIVTS G+GKPK+LDEKQ
Sbjct  181   EGVLSHQMKQFVIDGNKVVLSLSNPETRVDEAEFEENEVYAIDIVTSPGDGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKA RFI+S+ISQKFP+MPF AR LEEKRA LGLVECVNH+LLQP
Sbjct  241   TTIYKRAVDKSYHLKMKAFRFIFSDISQKFPIMPFFARALEEKRACLGLVECVNHELLQP  300

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VA IKF VLLMPNGSDR+T HPLQ+L  TK IDDP++KAWLAL
Sbjct  301   YPVLHEKPGDYVAPIKFPVLLMPNGSDRVTFHPLQELQPTKAIDDPDVKAWLAL  354



>ref|XP_010529897.1| PREDICTED: proliferation-associated protein 2G4-like [Tarenaya 
hassleriana]
Length=394

 Score =   595 bits (1535),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 300/354 (85%), Positives = 334/354 (94%), Gaps = 1/354 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+EREEKELDL+S EVVTKYKSAAEI+NKAL+LVVS+CKP A++VDICEKGDAFIREQT
Sbjct  3     SDDEREEKELDLTSSEVVTKYKSAAEIVNKALQLVVSECKPKAKIVDICEKGDAFIREQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             GNMYKNVKKKIERG+AFPTCISVNNTVCHFSPL++DDT+LEEGD++KIDMGCHIDGFIAV
Sbjct  63    GNMYKNVKKKIERGIAFPTCISVNNTVCHFSPLASDDTLLEEGDVMKIDMGCHIDGFIAV  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             VAHT +LQEGP+TGR ADVIAAANTAAEVA+RLVRPGKKN +V+EAIQKVA AYDCKIVE
Sbjct  123   VAHTVVLQEGPITGRKADVIAAANTAAEVALRLVRPGKKNQEVSEAIQKVAEAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSHQMK+FVIDGNKVVLSVSNPETRV++ EFEENEVYSIDIVTS+G+GKPK+LDEKQT
Sbjct  183   GVLSHQMKRFVIDGNKVVLSVSNPETRVEDVEFEENEVYSIDIVTSSGDGKPKLLDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             T+YKR+ D++Y+LKMKASRFI+SEI+Q F   PFTAR LEEKRARLGLVECVNHDLL+PY
Sbjct  243   TVYKRSPDRSYHLKMKASRFIFSEINQNFQHFPFTARVLEEKRARLGLVECVNHDLLEPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLAL  1304
             PVLHEKPGD VAHIKFTVLLMPNGSDRIT+H LQ+L  TK I DD EIKAWLAL
Sbjct  303   PVLHEKPGDFVAHIKFTVLLMPNGSDRITSHTLQELQPTKTIADDSEIKAWLAL  356



>gb|ABK24337.1| unknown [Picea sitchensis]
Length=394

 Score =   594 bits (1531),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 295/355 (83%), Positives = 334/355 (94%), Gaps = 1/355 (0%)
 Frame = +3

Query  243   MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
             MSD+E +EEKELDL+S +VVTKYK +AEI NKAL++V+S+CKP A+VVD+CEKGD++IRE
Sbjct  1     MSDDEAKEEKELDLTSHDVVTKYKLSAEIANKALQIVLSECKPKAKVVDLCEKGDSYIRE  60

Query  420   QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFI  599
             QTGN+YKN KKKIE+GVAFPTCISVN+TVCHFSPL+ D+TVLEE D+VKID+GCHIDGFI
Sbjct  61    QTGNVYKNAKKKIEKGVAFPTCISVNSTVCHFSPLAGDETVLEENDLVKIDLGCHIDGFI  120

Query  600   AVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKI  779
             +VVAHTH++QEGPV+GR ADVIAAANTAAEVA+RLV+PGKKN DVTEAIQKVAAAYDCKI
Sbjct  121   SVVAHTHVVQEGPVSGRVADVIAAANTAAEVALRLVKPGKKNKDVTEAIQKVAAAYDCKI  180

Query  780   VEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEK  959
              EGVLSHQMKQFVIDGNKVVL  SNPETRVD+AEFEENEVY+IDIVTSTGEGK K+LDEK
Sbjct  181   AEGVLSHQMKQFVIDGNKVVLGASNPETRVDDAEFEENEVYAIDIVTSTGEGKLKLLDEK  240

Query  960   QTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQ  1139
             +TTIYKRAVDKNY LKMKASR I++EI+QKFP+MPFTAR LE+KRARLGLVECVNH+LLQ
Sbjct  241   ETTIYKRAVDKNYQLKMKASRLIFTEINQKFPIMPFTARALEDKRARLGLVECVNHELLQ  300

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PYPVLHEKPG+LVAHIKFTVLLMPNGSD+IT HPLQ+LN TK IDDPEIK WLAL
Sbjct  301   PYPVLHEKPGELVAHIKFTVLLMPNGSDKITGHPLQELNPTKAIDDPEIKTWLAL  355



>gb|EMS60472.1| Proliferation-associated protein 2G4 [Triticum urartu]
Length=520

 Score =   598 bits (1543),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/355 (85%), Positives = 336/355 (95%), Gaps = 2/355 (1%)
 Frame = +3

Query  246   SDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             SDEE REEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD FI EQ
Sbjct  42    SDEEVREEKELDLSSNEVVTKYKTAAEIINKALKLVLSECKPKAKIVDICEKGDNFITEQ  101

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGN+YKNVK+KIERG+AFPTC+SVNNTVCHFSPL+ DD+VLEE DMVKIDM CHIDGFIA
Sbjct  102   TGNVYKNVKRKIERGIAFPTCVSVNNTVCHFSPLATDDSVLEENDMVKIDMACHIDGFIA  161

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH+++ GPVTGRAA+V+AAANTAAEVAMRLVRPGKKN DVTEAIQKVAAAYDCKIV
Sbjct  162   VVAHTHVIKAGPVTGRAANVLAAANTAAEVAMRLVRPGKKNKDVTEAIQKVAAAYDCKIV  221

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKVVLSVSN +T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQ
Sbjct  222   EGVLSHQLKQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQ  281

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQP
Sbjct  282   TTIYKRAVDKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQP  341

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLAL  1304
             YPVLHEK GDLVAHIKFTVLLMPNGSD+IT+HPLQ L  +K I+ D EIKAWLAL
Sbjct  342   YPVLHEKQGDLVAHIKFTVLLMPNGSDKITSHPLQQLEPSKSIEGDAEIKAWLAL  396



>gb|EAY97646.1| hypothetical protein OsI_19569 [Oryza sativa Indica Group]
Length=393

 Score =   592 bits (1525),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/353 (84%), Positives = 332/353 (94%), Gaps = 1/353 (0%)
 Frame = +3

Query  249   DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
             DE REEKELDLSS +VVTKYK AA+I+N AL+LVVS CKP A++VDICEKGD++IREQTG
Sbjct  5     DEVREEKELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICEKGDSYIREQTG  64

Query  429   NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVV  608
             N+YKNVK+KIERGVAFPTC+SVNNTVCHFSPL+ D+ VLEE DMVKIDMGCHIDGFIAVV
Sbjct  65    NIYKNVKRKIERGVAFPTCVSVNNTVCHFSPLATDEAVLEENDMVKIDMGCHIDGFIAVV  124

Query  609   AHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
             AHTH++ +G VTG+AADV+AAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIVEG
Sbjct  125   AHTHVIHDGAVTGKAADVLAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIVEG  184

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTT  968
             VLSHQ+KQFVIDGNKVVLSVSN +T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTT
Sbjct  185   VLSHQLKQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTT  244

Query  969   IYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYP  1148
             IYKRAVDKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYP
Sbjct  245   IYKRAVDKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYP  304

Query  1149  VLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLAL  1304
             VLHEKPGDLVAHIKFTVLL+P+GS R+T+H LQ+L  TK I D+ EIKAWLAL
Sbjct  305   VLHEKPGDLVAHIKFTVLLLPSGSQRVTSHSLQELQPTKSIEDNAEIKAWLAL  357



>ref|NP_001055274.1| Os05g0350500 [Oryza sativa Japonica Group]
 gb|AAV44069.1| putative DNA-binding protein GBP16 [Oryza sativa Japonica Group]
 dbj|BAF17188.1| Os05g0350500 [Oryza sativa Japonica Group]
 dbj|BAG88060.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95770.1| unnamed protein product [Oryza sativa Japonica Group]
Length=393

 Score =   591 bits (1524),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 296/353 (84%), Positives = 332/353 (94%), Gaps = 1/353 (0%)
 Frame = +3

Query  249   DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
             DE REEKELDLSS +VVTKYK AA+I+N AL+LVVS CKP A++VDICEKGD++IREQTG
Sbjct  5     DEVREEKELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICEKGDSYIREQTG  64

Query  429   NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVV  608
             N+YKNVK+KIERGVAFPTC+SVNNTVCHFSPL+ D+ VLEE DMVKIDMGCHIDGFIAVV
Sbjct  65    NIYKNVKRKIERGVAFPTCVSVNNTVCHFSPLATDEAVLEENDMVKIDMGCHIDGFIAVV  124

Query  609   AHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
             AHTH++ +G VTG+AADV+AAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIVEG
Sbjct  125   AHTHVIHDGAVTGKAADVLAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIVEG  184

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTT  968
             VLSHQ+KQFVIDGNKVVLSVSN +T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTT
Sbjct  185   VLSHQLKQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTT  244

Query  969   IYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYP  1148
             IYKRAVDKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYP
Sbjct  245   IYKRAVDKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYP  304

Query  1149  VLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLAL  1304
             VLHEKPGDLVAHIKFTVLL+P+GS R+T+H LQ+L  TK I D+ EIKAWLAL
Sbjct  305   VLHEKPGDLVAHIKFTVLLLPSGSQRVTSHSLQELQPTKSIEDNAEIKAWLAL  357



>ref|XP_006654286.1| PREDICTED: proliferation-associated protein 2G4-like [Oryza brachyantha]
Length=392

 Score =   588 bits (1517),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/352 (83%), Positives = 329/352 (93%), Gaps = 0/352 (0%)
 Frame = +3

Query  249   DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
             DE REEKELDLSS +VVTKYK AA+I+N AL+LVVS CKP A++VDICE+GD++IREQTG
Sbjct  5     DEVREEKELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICERGDSYIREQTG  64

Query  429   NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVV  608
             N+YKNVK+KIERG+AFPTC+SVNNTVCHFSPL+ D+ VLEE DMVKIDMGCHIDGFIAVV
Sbjct  65    NIYKNVKRKIERGIAFPTCLSVNNTVCHFSPLATDEAVLEENDMVKIDMGCHIDGFIAVV  124

Query  609   AHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
              HTH++ +GPVTGRAADV+AAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIVEG
Sbjct  125   GHTHVIHDGPVTGRAADVLAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIVEG  184

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTT  968
             VLSHQ+KQFVIDGNKVVLSVSN +T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTT
Sbjct  185   VLSHQLKQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTT  244

Query  969   IYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYP  1148
             IYKRAVDKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYP
Sbjct  245   IYKRAVDKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYP  304

Query  1149  VLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             VLHEKPGDLVAHIKFTVLL+P+GS R+T+HPLQ+       D+ EIKAWLAL
Sbjct  305   VLHEKPGDLVAHIKFTVLLLPSGSQRVTSHPLQEFQPKSIEDNAEIKAWLAL  356



>ref|XP_002988189.1| hypothetical protein SELMODRAFT_127648 [Selaginella moellendorffii]
 gb|EFJ10608.1| hypothetical protein SELMODRAFT_127648 [Selaginella moellendorffii]
Length=371

 Score =   581 bits (1498),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/352 (80%), Positives = 328/352 (93%), Gaps = 0/352 (0%)
 Frame = +3

Query  249   DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
             DE +EEKELDLSS +VVTKYK AAEI+NKAL+ V+++CK   +VV++C++GD++I+ QT 
Sbjct  4     DESKEEKELDLSSADVVTKYKLAAEIVNKALQAVLAECKAGTKVVELCDRGDSYIKTQTA  63

Query  429   NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVV  608
             ++YKN KKKI++GVAFPTC+S+NNTVCHFSPL+ D+T L EGD+VKID+GCHIDGF+AVV
Sbjct  64    SVYKNAKKKIDKGVAFPTCVSLNNTVCHFSPLAGDETALSEGDIVKIDLGCHIDGFVAVV  123

Query  609   AHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
             AHTH+LQEGPVTGRAADV+AAANTAAEVA+RLVRPGKK  DV+EAIQKVAAAYDCK+ EG
Sbjct  124   AHTHVLQEGPVTGRAADVLAAANTAAEVALRLVRPGKKTRDVSEAIQKVAAAYDCKVAEG  183

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTT  968
             VLSHQMKQFVIDGNKV+LSVSNPETRVDE+EFEENEVY+IDIVTSTGEGKPK+LDE+QTT
Sbjct  184   VLSHQMKQFVIDGNKVILSVSNPETRVDESEFEENEVYAIDIVTSTGEGKPKLLDERQTT  243

Query  969   IYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYP  1148
             +YKRAVDK+Y+LKMKASRFI+SEISQKFPLMPFTAR LEEKRARLGLVECVNH+LLQPYP
Sbjct  244   VYKRAVDKSYHLKMKASRFIFSEISQKFPLMPFTARQLEEKRARLGLVECVNHELLQPYP  303

Query  1149  VLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             VLHEK GDLVAHIKFTVLLMPNGSDRIT H +QD+  +  +DDPEIK+WLA+
Sbjct  304   VLHEKTGDLVAHIKFTVLLMPNGSDRITGHSVQDVQPSSTVDDPEIKSWLAM  355



>ref|XP_002963479.1| hypothetical protein SELMODRAFT_79780 [Selaginella moellendorffii]
 gb|EFJ35350.1| hypothetical protein SELMODRAFT_79780 [Selaginella moellendorffii]
Length=371

 Score =   581 bits (1497),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 280/352 (80%), Positives = 328/352 (93%), Gaps = 0/352 (0%)
 Frame = +3

Query  249   DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
             DE +EEKELDLSS +VVTKYK AAEI+NKAL+ V+++CK   +VV++C++GD++I+ QT 
Sbjct  4     DESKEEKELDLSSADVVTKYKLAAEIVNKALQAVLAECKAGTKVVELCDRGDSYIKTQTA  63

Query  429   NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVV  608
             ++YKN KKKI++GVAFPTC+S+NNTVCHFSPL+ D+T L EGD+VKID+GCHIDGF+AVV
Sbjct  64    SVYKNAKKKIDKGVAFPTCVSLNNTVCHFSPLAGDETALSEGDIVKIDLGCHIDGFVAVV  123

Query  609   AHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
             AHTH+LQEGPVTGRAADV+AAANTAAEVA+RLVRPGKK  DV+EAIQKVAAAYDCK+ EG
Sbjct  124   AHTHVLQEGPVTGRAADVLAAANTAAEVALRLVRPGKKTRDVSEAIQKVAAAYDCKVAEG  183

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTT  968
             VLSHQMKQFVIDGNKV+LSVSNPETRVDE+EFEENEVY+IDIVTSTGEGKPK+LDE+QTT
Sbjct  184   VLSHQMKQFVIDGNKVILSVSNPETRVDESEFEENEVYAIDIVTSTGEGKPKLLDERQTT  243

Query  969   IYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYP  1148
             +YKRAVDK+Y+LKMKASRFI+SEISQKFPLMPFTAR LEEKRARLGLVECVNH+LLQPYP
Sbjct  244   VYKRAVDKSYHLKMKASRFIFSEISQKFPLMPFTARQLEEKRARLGLVECVNHELLQPYP  303

Query  1149  VLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             VLHE+ GDLVAHIKFTVLLMPNGSDRIT H +QD+  +  +DDPEIK+WLA+
Sbjct  304   VLHERTGDLVAHIKFTVLLMPNGSDRITGHSVQDVQPSSTVDDPEIKSWLAM  355



>gb|AAB80919.1| DNA-binding protein GBP16 [Oryza sativa Japonica Group]
Length=393

 Score =   579 bits (1493),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 292/353 (83%), Positives = 327/353 (93%), Gaps = 1/353 (0%)
 Frame = +3

Query  249   DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
             DE REEKELDLSS +VVTKYK AA+I+N AL+LVVS CKP A++VDICEKGD++IREQTG
Sbjct  5     DEVREEKELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICEKGDSYIREQTG  64

Query  429   NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVV  608
             N+YKNVK+KIERGVAFPTC+SVNNTVCHFSPL+ D+ VLEE DMVKIDMGCHIDGFIAVV
Sbjct  65    NIYKNVKRKIERGVAFPTCVSVNNTVCHFSPLATDEAVLEENDMVKIDMGCHIDGFIAVV  124

Query  609   AHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
             AHTH++ +G VTG+AADV+AAANTAAEVA+R VRPGKKN DVTEAIQKVAAAYD   VEG
Sbjct  125   AHTHVIHDGAVTGKAADVLAAANTAAEVALRFVRPGKKNKDVTEAIQKVAAAYDSVSVEG  184

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTT  968
             VLSHQ+KQFVIDGNKVVLSVSN +T+VD+AEFEENEVY+IDIVTSTGEGKPK+LDEKQTT
Sbjct  185   VLSHQLKQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPKLLDEKQTT  244

Query  969   IYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYP  1148
             IYKRAVDKNY+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGLVEC+NH+LLQPYP
Sbjct  245   IYKRAVDKNYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLVECMNHELLQPYP  304

Query  1149  VLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDD-PEIKAWLAL  1304
             VLHEKPGDLVAHIKFTVLL+P+GS R+T+H LQ L  TK I+D  EIKAWLAL
Sbjct  305   VLHEKPGDLVAHIKFTVLLLPSGSQRVTSHSLQVLQPTKSIEDHAEIKAWLAL  357



>gb|KFK34423.1| hypothetical protein AALP_AA5G142900 [Arabis alpina]
Length=393

 Score =   577 bits (1487),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/353 (81%), Positives = 326/353 (92%), Gaps = 0/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+EK+LDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDIC+KGDAFI+EQT
Sbjct  3     SDDERDEKQLDLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICDKGDAFIKEQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             G+MYKN KKKI+RGVAFPTCISVNNTV HFSPL+ D+TVLEEGDMVKIDMGCHIDGFIA+
Sbjct  63    GSMYKNSKKKIDRGVAFPTCISVNNTVGHFSPLAGDETVLEEGDMVKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             VAHTH+LQ+GP+TGR ADVIAAANTAAEVA+RLVRPGKKN+DVTEAIQKVAAAYDCKIVE
Sbjct  123   VAHTHVLQQGPLTGRKADVIAAANTAAEVALRLVRPGKKNNDVTEAIQKVAAAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSHQ+KQ +IDG+K ++SVS+PETRVD+AEF ENEVY+IDIV STG+GKPK+LDEKQT
Sbjct  183   GVLSHQLKQKIIDGSKAIISVSSPETRVDDAEFLENEVYAIDIVASTGDGKPKLLDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             T+YK+    NY LKMKASRFI SEI+Q FP MPFTAR LEEKRARLGLVECVNH  LQPY
Sbjct  243   TVYKKDDSVNYQLKMKASRFIISEINQNFPYMPFTARSLEEKRARLGLVECVNHGHLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVL+EKPGD VA IKFTVLLMPNGSDRIT+H LQ+L  TK +DDPEIK WLAL
Sbjct  303   PVLYEKPGDFVAQIKFTVLLMPNGSDRITSHTLQELQTTKTVDDPEIKGWLAL  355



>ref|XP_001779761.1| predicted protein [Physcomitrella patens]
 gb|EDQ55445.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   574 bits (1479),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/355 (80%), Positives = 327/355 (92%), Gaps = 1/355 (0%)
 Frame = +3

Query  243   MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
             MSD+E +EEKELDL+SP+VVTKYK AAE+ NKAL+ V++ CKP A++VD+CEKGD+ IR+
Sbjct  1     MSDDEVKEEKELDLTSPDVVTKYKCAAEVANKALQAVLADCKPGAKIVDLCEKGDSSIRD  60

Query  420   QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFI  599
              T  MYKN KKKI++GVAFPTC+SVNNTVCHFSPL++D++VL   D+VKID+GCH+DGFI
Sbjct  61    LTALMYKNSKKKIDKGVAFPTCVSVNNTVCHFSPLASDESVLAANDIVKIDLGCHVDGFI  120

Query  600   AVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKI  779
             AVVAHTH+L EGPVTGRAADV+AAA+TAAEVA+RLVRPGKKN DVT+AIQKVAAAYDCKI
Sbjct  121   AVVAHTHVLSEGPVTGRAADVLAAAHTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCKI  180

Query  780   VEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEK  959
              EGVLSHQ+KQFVID NKV+LSVSNPETRVD+AEFEENEVY+IDIVTSTG+GKPK+LDEK
Sbjct  181   AEGVLSHQLKQFVIDANKVILSVSNPETRVDDAEFEENEVYAIDIVTSTGDGKPKLLDEK  240

Query  960   QTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQ  1139
             QTT+YKRAVDKNY+LKMKASRFI+SEI+ KFP+MPFTAR LEEKRARLG+VECVNH+LLQ
Sbjct  241   QTTVYKRAVDKNYHLKMKASRFIFSEINTKFPIMPFTARALEEKRARLGIVECVNHELLQ  300

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PYPVLHEKPGD VAHIKFTVLLMPNGSD+IT  PLQ+   TK  +DPEIKAWLAL
Sbjct  301   PYPVLHEKPGDCVAHIKFTVLLMPNGSDKITGLPLQECQSTKVPEDPEIKAWLAL  355



>emb|CDX73690.1| BnaC08g23130D [Brassica napus]
Length=391

 Score =   573 bits (1477),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 287/353 (81%), Positives = 321/353 (91%), Gaps = 0/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGDAFI EQ 
Sbjct  3     SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDAFINEQA  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             G+MYKNVKKKI+RGVAFPTC+SVNNTV HFSPL++D+TVLEEGDMVKIDMGCHIDGFIA+
Sbjct  63    GSMYKNVKKKIDRGVAFPTCVSVNNTVGHFSPLASDETVLEEGDMVKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             VAHTH++QEGPVTGR ADVIAAANTAAEVA+RLVRPGKKN  VTEAIQKVA AYDCKIVE
Sbjct  123   VAHTHVIQEGPVTGRKADVIAAANTAAEVALRLVRPGKKNHAVTEAIQKVAEAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GV+SHQMKQ VID +K  LSVS PETRVD+AEFEENEVY+IDIV STG+GKPK+LDEKQT
Sbjct  183   GVISHQMKQNVIDASKSFLSVSTPETRVDDAEFEENEVYAIDIVASTGDGKPKLLDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             T+YK+    NY LKMKASRFI SEI +KFP MPFTAR LEEKRARLGLVECVNH  LQPY
Sbjct  243   TVYKKDAAVNYQLKMKASRFIISEIKEKFPHMPFTARSLEEKRARLGLVECVNHGHLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVL+EKPGD VA IKFTVLLMPNGSDRIT+H LQ++  TK IDDPEIK WLAL
Sbjct  303   PVLYEKPGDFVAQIKFTVLLMPNGSDRITSHTLQEIQPTKTIDDPEIKGWLAL  355



>ref|XP_009115883.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Brassica rapa]
Length=390

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/353 (81%), Positives = 321/353 (91%), Gaps = 0/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGDAFI+EQ 
Sbjct  3     SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQA  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             G+MYKN KKKI+RGVAFPTC+SVNNTV HFSPL++D+TVLEEGDMVKIDMGCHIDGFIA+
Sbjct  63    GSMYKNAKKKIDRGVAFPTCVSVNNTVGHFSPLASDETVLEEGDMVKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             VAHTH++QEGPVTGR ADVIAAANTAAEVA+RLVRPGKKN  VTEAIQKVA AYDCKIVE
Sbjct  123   VAHTHVIQEGPVTGRKADVIAAANTAAEVALRLVRPGKKNHAVTEAIQKVAEAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GV+SHQMKQ VID +K  LSVS PETRVD+AEFE+NEVY+IDIV STGEGKPK++DEKQT
Sbjct  183   GVISHQMKQNVIDASKSFLSVSTPETRVDDAEFEDNEVYAIDIVASTGEGKPKLIDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             T+YK+    NY LKMKASRFI SEI +KFP MPFTAR LEEKRARLGLVECVNH  LQPY
Sbjct  243   TVYKKDAAVNYQLKMKASRFIISEIKEKFPHMPFTARSLEEKRARLGLVECVNHGHLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVL+EKPGD VA IKFTVLLMPNGSDRIT+H LQ+L  TK IDDPEIK WLAL
Sbjct  303   PVLYEKPGDFVAQIKFTVLLMPNGSDRITSHTLQELQPTKTIDDPEIKGWLAL  355



>ref|XP_009115882.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Brassica rapa]
Length=391

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/353 (81%), Positives = 321/353 (91%), Gaps = 0/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGDAFI+EQ 
Sbjct  3     SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQA  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             G+MYKN KKKI+RGVAFPTC+SVNNTV HFSPL++D+TVLEEGDMVKIDMGCHIDGFIA+
Sbjct  63    GSMYKNAKKKIDRGVAFPTCVSVNNTVGHFSPLASDETVLEEGDMVKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             VAHTH++QEGPVTGR ADVIAAANTAAEVA+RLVRPGKKN  VTEAIQKVA AYDCKIVE
Sbjct  123   VAHTHVIQEGPVTGRKADVIAAANTAAEVALRLVRPGKKNHAVTEAIQKVAEAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GV+SHQMKQ VID +K  LSVS PETRVD+AEFE+NEVY+IDIV STGEGKPK++DEKQT
Sbjct  183   GVISHQMKQNVIDASKSFLSVSTPETRVDDAEFEDNEVYAIDIVASTGEGKPKLIDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             T+YK+    NY LKMKASRFI SEI +KFP MPFTAR LEEKRARLGLVECVNH  LQPY
Sbjct  243   TVYKKDAAVNYQLKMKASRFIISEIKEKFPHMPFTARSLEEKRARLGLVECVNHGHLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVL+EKPGD VA IKFTVLLMPNGSDRIT+H LQ+L  TK IDDPEIK WLAL
Sbjct  303   PVLYEKPGDFVAQIKFTVLLMPNGSDRITSHTLQELQPTKTIDDPEIKGWLAL  355



>ref|XP_009123761.1| PREDICTED: proliferation-associated protein 2G4-like [Brassica 
rapa]
Length=393

 Score =   573 bits (1476),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/353 (81%), Positives = 322/353 (91%), Gaps = 0/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+S+CKP A++VDICEKGDAFI+EQT
Sbjct  3     SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLSECKPKAKIVDICEKGDAFIKEQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             G+MYKN KKKI+RGVAFPTC+SVNNTV HFSPL++D+T+LEEGDM+KIDMGCHIDGFIA+
Sbjct  63    GSMYKNAKKKIDRGVAFPTCVSVNNTVGHFSPLASDETLLEEGDMLKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             VAHTH+LQEGPVTGR ADVIAAANTAAEVA+RLVRPGKKN  VTEAIQKVA AYDCKIVE
Sbjct  123   VAHTHVLQEGPVTGRKADVIAAANTAAEVALRLVRPGKKNHAVTEAIQKVAEAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GV+SHQMKQ VIDG+K  LSVS PETRVD+AEF ENEVY+IDIV STG+GKPK+LDEKQT
Sbjct  183   GVISHQMKQNVIDGSKCFLSVSTPETRVDDAEFLENEVYAIDIVASTGDGKPKLLDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             T+YK+  D NY LKMKASRFI+SEI + FP MPFTAR LEEKRARLGLVECVNH  L PY
Sbjct  243   TVYKKDADVNYQLKMKASRFIFSEIKENFPHMPFTARSLEEKRARLGLVECVNHGHLLPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVL+EKPGD VA IKFTVLLMPNGSDRIT+H LQ+L  TK +DDPEIK WLAL
Sbjct  303   PVLYEKPGDFVAQIKFTVLLMPNGSDRITSHSLQELQPTKTVDDPEIKGWLAL  355



>ref|XP_008792832.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Phoenix 
dactylifera]
Length=376

 Score =   571 bits (1471),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 306/364 (84%), Positives = 343/364 (94%), Gaps = 1/364 (0%)
 Frame = +3

Query  333   KALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKKIERGVAFPTCISVNNTVCH  512
             ++L LV+S+CKP A++ DICEKGDAFI+EQ+GN+YKNVKKKIERGVAFPTCISVNNTVCH
Sbjct  11    RSLTLVISECKPKAKIADICEKGDAFIKEQSGNVYKNVKKKIERGVAFPTCISVNNTVCH  70

Query  513   FSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVVAHTHLLQEGPVTGRaadviaaantaaev  692
             FSPLS+D+TVLEE D+VKIDMGCHIDGFIAVVAHTH+L EGP+TGRAADVIAAANTAAEV
Sbjct  71    FSPLSSDETVLEENDVVKIDMGCHIDGFIAVVAHTHVLHEGPITGRAADVIAAANTAAEV  130

Query  693   aMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD  872
             A+RLVRPGKKN DVTEAIQKV AAYDCKI+EGVLSHQ+KQFVIDGNKV+LSVSNPETRVD
Sbjct  131   ALRLVRPGKKNKDVTEAIQKVVAAYDCKIIEGVLSHQLKQFVIDGNKVILSVSNPETRVD  190

Query  873   EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKF  1052
             +AEFEENEVY+IDIVTSTGEGKPK+LDE+ TTIYKRA+DKNY+LKMKASRFI+SEI+QKF
Sbjct  191   DAEFEENEVYAIDIVTSTGEGKPKLLDERHTTIYKRAMDKNYHLKMKASRFIFSEINQKF  250

Query  1053  PLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRIT  1232
             P+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRIT
Sbjct  251   PIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRIT  310

Query  1233  AHPLQDLNVTKPID-DPEIKAWLALPtktkkkgggkkkkgkkgekteeAPQTEPTDEATN  1409
             +HPLQ+L  TK ID +PEIKAWLAL TKTKKKGGGKKKKGKKGE  +++ + EP DEA+N
Sbjct  311   SHPLQELKPTKSIDNNPEIKAWLALGTKTKKKGGGKKKKGKKGEAKDDSAEAEPMDEASN  370

Query  1410  KSKS  1421
              + S
Sbjct  371   GAPS  374



>emb|CDX78041.1| BnaA09g32360D [Brassica napus]
Length=436

 Score =   572 bits (1475),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/353 (80%), Positives = 321/353 (91%), Gaps = 0/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGDAFI+EQ 
Sbjct  48    SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQA  107

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             G+MYKN KKKI+RGVAFPTC+SVNNTV HFSPL++D+T+LEEGDMVKIDMGCHIDGFIA+
Sbjct  108   GSMYKNAKKKIDRGVAFPTCVSVNNTVGHFSPLASDETLLEEGDMVKIDMGCHIDGFIAL  167

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             VAHTH++QEGPVTGR ADVIAAANTAAEVA+RLVRPGKKN  VTEAIQKVA AYDCKIVE
Sbjct  168   VAHTHVIQEGPVTGRKADVIAAANTAAEVALRLVRPGKKNHAVTEAIQKVAEAYDCKIVE  227

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GV+SHQMKQ VID +K  LSVS PETRVD+AEFEENEVY+IDIV STG+GKPK++DEKQT
Sbjct  228   GVISHQMKQNVIDASKSFLSVSTPETRVDDAEFEENEVYAIDIVASTGDGKPKLIDEKQT  287

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             T+YK+    NY LKMKASRFI SEI +KFP MPFTAR LEEKRARLGLVECVNH  LQPY
Sbjct  288   TVYKKDAAVNYQLKMKASRFIISEIKEKFPHMPFTARSLEEKRARLGLVECVNHGHLQPY  347

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVL+EKPGD VA IKFTVLLMPNGSDRIT+H LQ+L  TK +DDPEIK WLAL
Sbjct  348   PVLYEKPGDFVAQIKFTVLLMPNGSDRITSHALQELQPTKTVDDPEIKGWLAL  400



>emb|CDY33263.1| BnaA01g19300D [Brassica napus]
Length=393

 Score =   570 bits (1470),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 283/353 (80%), Positives = 322/353 (91%), Gaps = 0/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGDAFI+EQT
Sbjct  3     SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLTECKPKAKIVDICEKGDAFIKEQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             G+MYKN KKKI+RGVAFPTC+SVNNTV HFSPL++D+T+LEEGDM+KIDMGCHIDGFIA+
Sbjct  63    GSMYKNAKKKIDRGVAFPTCVSVNNTVGHFSPLASDETLLEEGDMLKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             VAHTH+LQ+GPVTGR ADV+AAANTAAEVA+RLVRPGKKN  VTEAIQKVA AYDCKIVE
Sbjct  123   VAHTHVLQDGPVTGRKADVLAAANTAAEVALRLVRPGKKNHAVTEAIQKVAEAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GV+SHQMKQ VIDG+K  LSVS PETRVD+AEF ENEVY+IDIV STG+GKPK+LDEKQT
Sbjct  183   GVISHQMKQNVIDGSKCFLSVSTPETRVDDAEFLENEVYAIDIVASTGDGKPKLLDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             T+YK+  D NY LKMKASRFI+SEI + FP MPFTAR LEEKRARLGLVECVNH  L PY
Sbjct  243   TVYKKDADVNYQLKMKASRFIFSEIKENFPHMPFTARSLEEKRARLGLVECVNHGHLLPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVL+EKPGD VA IKFTVLLMPNGSDRIT+H LQ+L  TK +DDPEIK WLAL
Sbjct  303   PVLYEKPGDFVAQIKFTVLLMPNGSDRITSHSLQELQPTKTVDDPEIKGWLAL  355



>ref|NP_001190060.1| putative nuclear DNA-binding protein G2p  [Arabidopsis thaliana]
 gb|AEE78846.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=385

 Score =   570 bits (1468),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/353 (81%), Positives = 322/353 (91%), Gaps = 1/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+EKEL L+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGD+FI+EQT
Sbjct  3     SDDERDEKELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIKEQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
              +MYKN KKKIERGVAFPTCISVNNTV HFSPL++D++VLE+GDMVKIDMGCHIDGFIA+
Sbjct  63    ASMYKNSKKKIERGVAFPTCISVNNTVGHFSPLASDESVLEDGDMVKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             V HTH+LQEGP++GR ADVIAAANTAA+VA+RLVRPGKKN+DVTEAIQKVAAAYDCKIVE
Sbjct  123   VGHTHVLQEGPLSGRKADVIAAANTAADVALRLVRPGKKNTDVTEAIQKVAAAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSHQ+KQ VIDGNKVVLSVS+PET VDE EFEENEVY+IDIV STG+GKPK+LDEKQT
Sbjct  183   GVLSHQLKQHVIDGNKVVLSVSSPETTVDEVEFEENEVYAIDIVASTGDGKPKLLDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             TIYK+    NY LKMKASRFI SEI Q FP MPFTAR LEEKRARLGLVECVNH  LQPY
Sbjct  243   TIYKKDESVNYQLKMKASRFIISEIKQNFPRMPFTARSLEEKRARLGLVECVNHGHLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVL+EKPGD VA IKFTVLLMPNGSDRIT+H LQ+L   K I+DPEIK WLAL
Sbjct  303   PVLYEKPGDFVAQIKFTVLLMPNGSDRITSHTLQELP-KKTIEDPEIKGWLAL  354



>emb|CDY16291.1| BnaC01g23260D [Brassica napus]
Length=393

 Score =   570 bits (1469),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/353 (80%), Positives = 322/353 (91%), Gaps = 0/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+S+CKP A++VDICEKGDAFI+EQT
Sbjct  3     SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLSECKPKAKIVDICEKGDAFIKEQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             G+MYK+ KKKI+RGVAFPTC+SVNNTV HFSPL++D+T+LEEGDM+KIDMGCHIDGFIA+
Sbjct  63    GSMYKSAKKKIDRGVAFPTCVSVNNTVGHFSPLASDETLLEEGDMLKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             VAHTH+LQ+GPVTGR ADVIAAANTAAEVA+RLVRPGKKN  VTEAIQKVA AYDCKIVE
Sbjct  123   VAHTHVLQDGPVTGRKADVIAAANTAAEVALRLVRPGKKNHAVTEAIQKVAEAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GV+SHQMKQ VIDG+K  LSVS PETRVD+AEF ENEVY+IDIV STG+GKPK+LDEKQT
Sbjct  183   GVISHQMKQNVIDGSKCFLSVSTPETRVDDAEFLENEVYAIDIVASTGDGKPKLLDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             T+YK+  D NY LKMKASRFI+SEI + FP MPFTAR LEEKRARLGLVECVNH  L PY
Sbjct  243   TVYKKDADVNYQLKMKASRFIFSEIKENFPHMPFTARSLEEKRARLGLVECVNHGHLLPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVL+EKPGD VA IKFTVLLMPNGSDRIT+H LQ+L  TK +DDPEIK WLAL
Sbjct  303   PVLYEKPGDFVAQIKFTVLLMPNGSDRITSHSLQELQPTKTVDDPEIKGWLAL  355



>ref|NP_190748.1| putative nuclear DNA-binding protein G2p  [Arabidopsis thaliana]
 gb|AAM46648.1|AF422841_1 cell cycle-related nuclear binding protein [Arabidopsis thaliana]
 gb|AAB18127.1| G2p [Arabidopsis thaliana]
 gb|AAC14407.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
 gb|AAL25197.1| nuclear DNA-binding protein [Arabidopsis thaliana]
 gb|AAL25198.1| nuclear DNA-binding protein [Arabidopsis thaliana]
 gb|AAN13085.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
 gb|AEE78844.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=392

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/388 (78%), Positives = 343/388 (88%), Gaps = 1/388 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+EKEL L+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGD+FI+EQT
Sbjct  3     SDDERDEKELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIKEQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
              +MYKN KKKIERGVAFPTCISVNNTV HFSPL++D++VLE+GDMVKIDMGCHIDGFIA+
Sbjct  63    ASMYKNSKKKIERGVAFPTCISVNNTVGHFSPLASDESVLEDGDMVKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             V HTH+LQEGP++GR ADVIAAANTAA+VA+RLVRPGKKN+DVTEAIQKVAAAYDCKIVE
Sbjct  123   VGHTHVLQEGPLSGRKADVIAAANTAADVALRLVRPGKKNTDVTEAIQKVAAAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSHQ+KQ VIDGNKVVLSVS+PET VDE EFEENEVY+IDIV STG+GKPK+LDEKQT
Sbjct  183   GVLSHQLKQHVIDGNKVVLSVSSPETTVDEVEFEENEVYAIDIVASTGDGKPKLLDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             TIYK+    NY LKMKASRFI SEI Q FP MPFTAR LEEKRARLGLVECVNH  LQPY
Sbjct  243   TIYKKDESVNYQLKMKASRFIISEIKQNFPRMPFTARSLEEKRARLGLVECVNHGHLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkk  1325
             PVL+EKPGD VA IKFTVLLMPNGSDRIT+H LQ+L   K I+DPEIK WLAL  K KK 
Sbjct  303   PVLYEKPGDFVAQIKFTVLLMPNGSDRITSHTLQELP-KKTIEDPEIKGWLALGIKKKKG  361

Query  1326  gggkkkkgkkgekteeAPQTEPTDEATN  1409
             GG KKK  K GEK E + + EP D ++N
Sbjct  362   GGKKKKAQKAGEKGEASTEAEPMDASSN  389



>ref|XP_002877825.1| hypothetical protein ARALYDRAFT_906530 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54084.1| hypothetical protein ARALYDRAFT_906530 [Arabidopsis lyrata subsp. 
lyrata]
Length=393

 Score =   569 bits (1467),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/353 (80%), Positives = 320/353 (91%), Gaps = 1/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+E+EL L+SPEVVTKYK+AAEI+NKAL++V+++CKP A++VDICEKGDAFI+EQT
Sbjct  3     SDDERDEQELSLTSPEVVTKYKTAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
              +MYKN KKKIERGVAFPTCISVNNTV HFSPL++D++VLE+GDMVKIDMGCHIDGFIA+
Sbjct  63    ASMYKNAKKKIERGVAFPTCISVNNTVGHFSPLASDESVLEDGDMVKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             V HTH+LQEGPVTGR ADVI AANTAA+VA+RLVRPGKKN++VTEAIQKVA AYDCKIVE
Sbjct  123   VGHTHVLQEGPVTGRKADVIRAANTAADVALRLVRPGKKNTEVTEAIQKVARAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSHQMKQ VIDGNKVVLSVS+PET VDE EFEENEVY+IDIV STG+GKPK+LDEKQT
Sbjct  183   GVLSHQMKQHVIDGNKVVLSVSSPETTVDEVEFEENEVYAIDIVASTGDGKPKLLDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             TIYK+    NY LKMKASRFI SEI Q FP MPFTAR LEEKRARLGLVECVNH  LQPY
Sbjct  243   TIYKKDESVNYQLKMKASRFIISEIKQNFPRMPFTARSLEEKRARLGLVECVNHGHLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVL+EKPGD VA IKFTVLLMPNGSDRIT+H LQ+L  TK  +DPEI+ WLAL
Sbjct  303   PVLYEKPGDFVAQIKFTVLLMPNGSDRITSHTLQELG-TKISEDPEIQGWLAL  354



>dbj|BAH19507.1| AT3G51800 [Arabidopsis thaliana]
Length=362

 Score =   567 bits (1462),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/353 (81%), Positives = 322/353 (91%), Gaps = 1/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+EKEL L+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGD+FI+EQT
Sbjct  3     SDDERDEKELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIKEQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
              +MYKN KKKIERGVAFPTCISVNNTV HFSPL++D++VLE+GDMVKIDMGCHIDGFIA+
Sbjct  63    ASMYKNSKKKIERGVAFPTCISVNNTVGHFSPLASDESVLEDGDMVKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             V HTH+LQEGP++GR ADVIAAANTAA+VA+RLVRPGKKN+DVTEAIQKVAAAYDCKIVE
Sbjct  123   VGHTHVLQEGPLSGRKADVIAAANTAADVALRLVRPGKKNTDVTEAIQKVAAAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSHQ+KQ VIDGNKVVLSVS+PET VDE EFEENEVY+IDIV STG+GKPK+LDEKQT
Sbjct  183   GVLSHQLKQHVIDGNKVVLSVSSPETTVDEVEFEENEVYAIDIVASTGDGKPKLLDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             TIYK+    NY LKMKASRFI SEI Q FP MPFTAR LEEKRARLGLVECVNH  LQPY
Sbjct  243   TIYKKDESVNYQLKMKASRFIISEIKQNFPRMPFTARSLEEKRARLGLVECVNHGHLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVL+EKPGD VA IKFTVLLMPNGSDRIT+H LQ+L   K I+DPEIK WLAL
Sbjct  303   PVLYEKPGDFVAQIKFTVLLMPNGSDRITSHTLQELP-KKTIEDPEIKGWLAL  354



>gb|AAK25936.1|AF360226_1 putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
 gb|AAK64125.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=392

 Score =   568 bits (1463),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 302/388 (78%), Positives = 343/388 (88%), Gaps = 1/388 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+EKEL L+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDIC+KGD+FI+EQT
Sbjct  3     SDDERDEKELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICDKGDSFIKEQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
              +MYKN KKKIERGVAFPTCISVNNTV HFSPL++D++VLE+GDMVKIDMGCHIDGFIA+
Sbjct  63    ASMYKNSKKKIERGVAFPTCISVNNTVGHFSPLASDESVLEDGDMVKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             V HTH+LQEGP++GR ADVIAAANTAA+VA+RLVRPGKKN+DVTEAIQKVAAAYDCKIVE
Sbjct  123   VGHTHVLQEGPLSGRKADVIAAANTAADVALRLVRPGKKNTDVTEAIQKVAAAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSHQ+KQ VIDGNKVVLSVS+PET VDE EFEENEVY+IDIV STG+GKPK+LDEKQT
Sbjct  183   GVLSHQLKQHVIDGNKVVLSVSSPETTVDEVEFEENEVYAIDIVASTGDGKPKLLDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             TIYK+    NY LKMKASRFI SEI Q FP MPFTAR LEEKRARLGLVECVNH  LQPY
Sbjct  243   TIYKKDESVNYQLKMKASRFIISEIKQNFPRMPFTARSLEEKRARLGLVECVNHGHLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkk  1325
             PVL+EKPGD VA IKFTVLLMPNGSDRIT+H LQ+L   K I+DPEIK WLAL  K KK 
Sbjct  303   PVLYEKPGDFVAQIKFTVLLMPNGSDRITSHTLQELP-KKTIEDPEIKGWLALGIKKKKG  361

Query  1326  gggkkkkgkkgekteeAPQTEPTDEATN  1409
             GG KKK  K GEK E + + EP D ++N
Sbjct  362   GGKKKKAQKAGEKGEASTEAEPMDASSN  389



>ref|XP_006403880.1| hypothetical protein EUTSA_v10010435mg [Eutrema salsugineum]
 gb|ESQ45333.1| hypothetical protein EUTSA_v10010435mg [Eutrema salsugineum]
Length=393

 Score =   566 bits (1459),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/353 (80%), Positives = 322/353 (91%), Gaps = 0/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+EKELDL+S EVVTKYKSAAEI+NKAL++V+++CKP  ++VDICEKGDAFI+EQT
Sbjct  3     SDDERDEKELDLTSSEVVTKYKSAAEIVNKALQVVLAECKPKTKIVDICEKGDAFIKEQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             G+MYKN KKKIERGVAFPTCISVNNTV HFSPL++D++VLEEGDMVKIDMGCHIDGFIA+
Sbjct  63    GSMYKNAKKKIERGVAFPTCISVNNTVGHFSPLASDESVLEEGDMVKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             V HTH+LQEGP++GR ADVIAAANTAAEVA+RLVRPGKKN+ VTEAIQKVA AYDCKIVE
Sbjct  123   VGHTHVLQEGPISGRKADVIAAANTAAEVALRLVRPGKKNNAVTEAIQKVAEAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSHQMKQ VIDG+K VLSVS+P+++VD+ EFEENEVY+IDIV STG+GKPK+LDEKQT
Sbjct  183   GVLSHQMKQMVIDGSKAVLSVSSPDSKVDDVEFEENEVYAIDIVASTGDGKPKLLDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             TIY++    NY LKMKASRFI SEI + FP MPFTAR LEEKRARLGLVEC+NH LLQPY
Sbjct  243   TIYRKDELVNYQLKMKASRFIISEIKENFPHMPFTARSLEEKRARLGLVECLNHGLLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVL+EKPGD VA IKFTVLLMPNGSDRIT+H LQ+L  TK I+DPEIK WL+L
Sbjct  303   PVLYEKPGDFVAQIKFTVLLMPNGSDRITSHSLQELQPTKTIEDPEIKGWLSL  355



>ref|XP_001769950.1| predicted protein [Physcomitrella patens]
 gb|EDQ65310.1| predicted protein [Physcomitrella patens]
Length=394

 Score =   563 bits (1452),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/355 (79%), Positives = 319/355 (90%), Gaps = 1/355 (0%)
 Frame = +3

Query  243   MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
             MSD+E +EEKELDL+SP+VVTKYK AAE+ NKAL+ V++ C P  ++VD+CEKGD+ IR+
Sbjct  1     MSDDEMKEEKELDLTSPDVVTKYKCAAEVANKALQAVLAACAPGFKIVDLCEKGDSVIRD  60

Query  420   QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFI  599
              T  MYKN KKKI+RGVAFPTC+SVNNTVCHFSPL+ D++ L   D+VKI +GCH+DGF+
Sbjct  61    LTAGMYKNFKKKIDRGVAFPTCVSVNNTVCHFSPLAGDESTLAANDLVKIHLGCHVDGFV  120

Query  600   AVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKI  779
             AVVAHTH+L EGP+TGRAADV+AAA+TAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKI
Sbjct  121   AVVAHTHVLCEGPITGRAADVLAAAHTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKI  180

Query  780   VEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEK  959
              EGVLSHQMKQFVID NKV+LS  N ETRVD+AEFEENEVY+IDIVTSTGEGKPK+LDEK
Sbjct  181   AEGVLSHQMKQFVIDANKVILSAGNAETRVDDAEFEENEVYAIDIVTSTGEGKPKLLDEK  240

Query  960   QTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQ  1139
             QTT+YKRAVDKNY+LKMKASRFI+SEI+ KFP+MPFTAR LEEKRARLGLVECVNH+LLQ
Sbjct  241   QTTVYKRAVDKNYHLKMKASRFIFSEINTKFPIMPFTARALEEKRARLGLVECVNHELLQ  300

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PYPVLHEKPGD VAHI+FTVLLMPNGSD+IT  PLQ L  TK  +DPEIKAWLAL
Sbjct  301   PYPVLHEKPGDFVAHIQFTVLLMPNGSDKITGLPLQALEPTKVPEDPEIKAWLAL  355



>ref|XP_010920806.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Elaeis 
guineensis]
 ref|XP_010920807.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Elaeis 
guineensis]
Length=406

 Score =   564 bits (1453),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 281/324 (87%), Positives = 311/324 (96%), Gaps = 1/324 (0%)
 Frame = +3

Query  333   KALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKKIERGVAFPTCISVNNTVCH  512
             KAL+LVVS+CKP A++VDICEKGD FI+EQ+GN+YKNVKKKIERGVAFPTCISVNNTVCH
Sbjct  7     KALQLVVSECKPKAKIVDICEKGDTFIKEQSGNVYKNVKKKIERGVAFPTCISVNNTVCH  66

Query  513   FSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVVAHTHLLQEGPVTGRaadviaaantaaev  692
             FSPLS D+ VLEE D+VKIDMGCHIDGFIAVVAHTH+LQEGP+TGRAADVIAAANTAA+V
Sbjct  67    FSPLSGDEAVLEENDVVKIDMGCHIDGFIAVVAHTHVLQEGPITGRAADVIAAANTAADV  126

Query  693   aMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD  872
             A+RLVRPG+KN DVTEAIQKVA AYDCKIVEGVLSHQ+KQFVIDGNK+++SVSNPETRVD
Sbjct  127   ALRLVRPGRKNKDVTEAIQKVAGAYDCKIVEGVLSHQLKQFVIDGNKIIISVSNPETRVD  186

Query  873   EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKF  1052
             +AEFEENEVY+IDIVTSTGEGKPK+LDEK TTIYKRAVDKNY+LKMKASRFI+SEI+QKF
Sbjct  187   DAEFEENEVYAIDIVTSTGEGKPKLLDEKHTTIYKRAVDKNYHLKMKASRFIFSEINQKF  246

Query  1053  PLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRIT  1232
             P+MPFTAR LEEKRARLGLVECVNH+LLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRIT
Sbjct  247   PIMPFTARALEEKRARLGLVECVNHELLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRIT  306

Query  1233  AHPLQDLNVTKPID-DPEIKAWLA  1301
             +HPLQ+L  TK ID +PEIKAWL+
Sbjct  307   SHPLQELKPTKSIDNNPEIKAWLS  330



>ref|NP_850679.1| putative nuclear DNA-binding protein G2p  [Arabidopsis thaliana]
 gb|AEE78845.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=401

 Score =   560 bits (1444),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/397 (76%), Positives = 343/397 (86%), Gaps = 10/397 (3%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+EKEL L+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGD+FI+EQT
Sbjct  3     SDDERDEKELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIKEQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
              +MYKN KKKIERGVAFPTCISVNNTV HFSPL++D++VLE+GDMVKIDMGCHIDGFIA+
Sbjct  63    ASMYKNSKKKIERGVAFPTCISVNNTVGHFSPLASDESVLEDGDMVKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             V HTH+LQEGP++GR ADVIAAANTAA+VA+RLVRPGKKN+DVTEAIQKVAAAYDCKIVE
Sbjct  123   VGHTHVLQEGPLSGRKADVIAAANTAADVALRLVRPGKKNTDVTEAIQKVAAAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSHQ+KQ VIDGNKVVLSVS+PET VDE EFEENEVY+IDIV STG+GKPK+LDEKQT
Sbjct  183   GVLSHQLKQHVIDGNKVVLSVSSPETTVDEVEFEENEVYAIDIVASTGDGKPKLLDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             TIYK+    NY LKMKASRFI SEI Q FP MPFTAR LEEKRARLGLVECVNH  LQPY
Sbjct  243   TIYKKDESVNYQLKMKASRFIISEIKQNFPRMPFTARSLEEKRARLGLVECVNHGHLQPY  302

Query  1146  PVLHEK---------PGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWL  1298
             PVL+EK         PGD VA IKFTVLLMPNGSDRIT+H LQ+L   K I+DPEIK WL
Sbjct  303   PVLYEKPGSCRFGFLPGDFVAQIKFTVLLMPNGSDRITSHTLQELP-KKTIEDPEIKGWL  361

Query  1299  ALPtktkkkgggkkkkgkkgekteeAPQTEPTDEATN  1409
             AL  K KK GG KKK  K GEK E + + EP D ++N
Sbjct  362   ALGIKKKKGGGKKKKAQKAGEKGEASTEAEPMDASSN  398



>emb|CDX90633.1| BnaA03g41480D [Brassica napus]
Length=390

 Score =   559 bits (1441),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/353 (79%), Positives = 318/353 (90%), Gaps = 0/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+EKELDL+SPEVVTKYKSAAEI+NKAL++V+++CKP A++VDICEKGDAFI+EQT
Sbjct  3     SDDERDEKELDLTSPEVVTKYKSAAEIVNKALQVVLAECKPGAKIVDICEKGDAFIKEQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             G+MYKN KKKI+RGVAFPTC+SVNN V HFSPL+ D++VLEEGDMVKIDMGCHIDGFIA+
Sbjct  63    GSMYKNAKKKIDRGVAFPTCVSVNNVVGHFSPLAGDESVLEEGDMVKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             V HTH+LQEGPVTGR ADVIAAANTAAEVA+RLVRPGKKN  VTEAIQKV+ AYDCKIVE
Sbjct  123   VGHTHVLQEGPVTGRKADVIAAANTAAEVALRLVRPGKKNHAVTEAIQKVSEAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GV+SHQMKQ VIDG+K  LSVS PETRVD+AEFEENEVY+IDIV STG+GKPK+LDEKQT
Sbjct  183   GVISHQMKQNVIDGSKSFLSVSTPETRVDDAEFEENEVYAIDIVASTGDGKPKLLDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             TIY++    +Y LKMKASR + SE+ + FP MPFT+R LEEKRARLGLVECVNH  LQPY
Sbjct  243   TIYRKDESIHYQLKMKASRSLISEVKENFPHMPFTSRSLEEKRARLGLVECVNHGHLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVL+EKPGD VA IKFTVLLMPNGSD+IT+H LQ+L  TK IDDPEIK WLAL
Sbjct  303   PVLYEKPGDFVAQIKFTVLLMPNGSDKITSHTLQELQPTKTIDDPEIKGWLAL  355



>ref|XP_009136636.1| PREDICTED: proliferation-associated protein 2G4-like [Brassica 
rapa]
Length=390

 Score =   559 bits (1440),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 279/353 (79%), Positives = 318/353 (90%), Gaps = 0/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+EKELDL+SPEVVTK+KSAAEI+NKAL++V+++CKP A++VDICEKGDAFI+EQT
Sbjct  3     SDDERDEKELDLTSPEVVTKHKSAAEIVNKALQVVLAECKPGAKIVDICEKGDAFIKEQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             GNMYKN KKKI+RGVAFPTC+SVNN V HFSPL+ D++VLEEGDMVKIDMGCHIDGFIA+
Sbjct  63    GNMYKNAKKKIDRGVAFPTCVSVNNVVGHFSPLAGDESVLEEGDMVKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             V HTH+LQEGPVTGR ADVIAAANTAAEVA+RLVRPGKKN  VTEAIQKV+ AYDCKIVE
Sbjct  123   VGHTHVLQEGPVTGRKADVIAAANTAAEVALRLVRPGKKNHAVTEAIQKVSEAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GV+SHQMKQ VIDG+K  LSVS PETRVD+AEFEENEVY+IDIV STG+GKPK+LDEKQT
Sbjct  183   GVISHQMKQNVIDGSKSFLSVSTPETRVDDAEFEENEVYAIDIVASTGDGKPKLLDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             TIY++    +Y LKMKASR + SE+ + FP MPFT+R LEEKRARLGLVECVNH  LQPY
Sbjct  243   TIYRKDESIHYQLKMKASRSLISEVKENFPHMPFTSRSLEEKRARLGLVECVNHGHLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVL+EKPGD VA IKFTVLLMPNGSD+IT+H LQ+L  TK IDDPEIK WLAL
Sbjct  303   PVLYEKPGDFVAQIKFTVLLMPNGSDKITSHTLQELQPTKTIDDPEIKGWLAL  355



>gb|KJB36945.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
Length=371

 Score =   556 bits (1433),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/324 (85%), Positives = 303/324 (94%), Gaps = 0/324 (0%)
 Frame = +3

Query  333   KALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKKIERGVAFPTCISVNNTVCH  512
             +AL+LVV +CKP  ++VDICEKGDAFIREQTGNMYKN K+KIERGVAFPTC+SVNNTVCH
Sbjct  10    EALQLVVKECKPKTKIVDICEKGDAFIREQTGNMYKNAKRKIERGVAFPTCLSVNNTVCH  69

Query  513   FSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVVAHTHLLQEGPVTGRaadviaaantaaev  692
             FSPL++D + L+EGDMVKIDMGCHIDGFIAVVAHTH++QEG V  R ADVIAAANTAAEV
Sbjct  70    FSPLASDTSELQEGDMVKIDMGCHIDGFIAVVAHTHVVQEGLVNDRKADVIAAANTAAEV  129

Query  693   aMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD  872
             A+RLVRPGKKN DVT+AIQKVAAAYDCKIVEGVLSHQ+KQFVIDGNKV+LSVSNP+TRVD
Sbjct  130   ALRLVRPGKKNKDVTDAIQKVAAAYDCKIVEGVLSHQLKQFVIDGNKVILSVSNPDTRVD  189

Query  873   EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKF  1052
             +AEFEENEVY++DIV STGEGKPK+LDEKQTTIYKRAVDKNY+LKMK SRFI+SEI+QKF
Sbjct  190   DAEFEENEVYAVDIVASTGEGKPKLLDEKQTTIYKRAVDKNYHLKMKTSRFIFSEINQKF  249

Query  1053  PLMPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRIT  1232
             P++PFTAR LEEKRARLGLVECVNHDLLQPYPVLHEKPGD VAHIKFTVLLMPNGSDRIT
Sbjct  250   PILPFTARALEEKRARLGLVECVNHDLLQPYPVLHEKPGDYVAHIKFTVLLMPNGSDRIT  309

Query  1233  AHPLQDLNVTKPIDDPEIKAWLAL  1304
              HPLQ L  TK IDDPEIK WLAL
Sbjct  310   LHPLQKLQPTKTIDDPEIKGWLAL  333



>emb|CDY29047.1| BnaC07g32530D [Brassica napus]
Length=390

 Score =   551 bits (1420),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 276/353 (78%), Positives = 317/353 (90%), Gaps = 0/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER++KELDL+SPEVVTKYKSAAEI+NKAL++V++ CKP A++VDICEKGDAFI +QT
Sbjct  3     SDDERDDKELDLTSPEVVTKYKSAAEIVNKALQVVLAICKPGAKIVDICEKGDAFIIKQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             GNMYKN KKKI+RGVAFPTC+SVNN V HFSPL+ D++VLEEGDMVKIDMGCHIDGFIA+
Sbjct  63    GNMYKNAKKKIDRGVAFPTCVSVNNVVGHFSPLAGDESVLEEGDMVKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             V HTH++Q+GPVTGR ADVIAAANTAAEVA+RLVRPGKKN  VTEAIQKVA AYDCKIVE
Sbjct  123   VGHTHVIQKGPVTGRKADVIAAANTAAEVALRLVRPGKKNHAVTEAIQKVADAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GV+SH+MKQ VIDG+K  LSVS PETRVD+AEFEENEVY+IDIV STG+GKPK+LDEKQT
Sbjct  183   GVISHEMKQNVIDGSKSFLSVSTPETRVDDAEFEENEVYAIDIVASTGDGKPKLLDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             TIY++    +Y LKMKASR + SE+ ++FP MPFT+R LEEKRARLGLVECVNH  LQPY
Sbjct  243   TIYRKDESIHYQLKMKASRSLISEVKERFPHMPFTSRSLEEKRARLGLVECVNHGHLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVL+EKPGD VA IKFTVLLMPNGSD+IT+H LQ+L  TK IDDPEIK WLAL
Sbjct  303   PVLYEKPGDFVAQIKFTVLLMPNGSDKITSHTLQELQPTKTIDDPEIKGWLAL  355



>ref|XP_010515611.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Camelina sativa]
 ref|XP_010515612.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Camelina sativa]
Length=393

 Score =   550 bits (1418),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 303/388 (78%), Positives = 340/388 (88%), Gaps = 0/388 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+EKEL L+SPEVVTKYK AAEI+NKAL++V+++CKP A++VDICEKGDAFI+EQT
Sbjct  3     SDDERDEKELSLTSPEVVTKYKGAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             G+MYKN KKKIERGVAFPTCISVNNTV HFSPL++D+TVLEEGDMVKIDMGCHIDGFIA+
Sbjct  63    GSMYKNAKKKIERGVAFPTCISVNNTVGHFSPLASDETVLEEGDMVKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             V HTH+LQEG V+GR ADVI+AANTAAEVA+RLVRPGKKN+DVTEAIQKVAAAYDCKIVE
Sbjct  123   VGHTHVLQEGTVSGRKADVISAANTAAEVALRLVRPGKKNTDVTEAIQKVAAAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSHQMKQ VIDGNKVVLSV++PE  V+E EFEENEVY+IDIV STG+GKPK++DEKQT
Sbjct  183   GVLSHQMKQHVIDGNKVVLSVASPEATVEEVEFEENEVYAIDIVASTGDGKPKLIDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             TIYK+    NY LKMKASRFI SEI Q FP MPFTAR LEEKRARLGLVECVNH  LQPY
Sbjct  243   TIYKKDETVNYQLKMKASRFIISEIKQNFPHMPFTARSLEEKRARLGLVECVNHGHLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkk  1325
             PVL+EK GD VA IKFTVLLMPNGSDRIT+H LQ+L  TK I+DPEIK WLAL  K KK 
Sbjct  303   PVLYEKSGDFVAQIKFTVLLMPNGSDRITSHTLQELQPTKTIEDPEIKGWLALGIKKKKG  362

Query  1326  gggkkkkgkkgekteeAPQTEPTDEATN  1409
             GG KKK  K GEK E + + EP D  +N
Sbjct  363   GGKKKKAKKAGEKGESSTEAEPMDATSN  390



>ref|XP_010426749.1| PREDICTED: proliferation-associated protein 2G4-like [Camelina 
sativa]
Length=393

 Score =   550 bits (1416),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 285/353 (81%), Positives = 320/353 (91%), Gaps = 0/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+EKEL LSSPEVVTKYK AAEI+NKAL++V+++CKP A++VDICEKGD+FI+EQT
Sbjct  3     SDDERDEKELSLSSPEVVTKYKGAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIKEQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             G+MYKN KKKIERGVAFPTCISVNNTV HFSPL++D+TVLE+GDMVKIDMGCHIDGFIA+
Sbjct  63    GSMYKNAKKKIERGVAFPTCISVNNTVGHFSPLASDETVLEDGDMVKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             V HTH+LQ+GPV+GR ADVI AANTAAEVA+RLVRPGKKN+DVTEAIQKVAAAYDCKIVE
Sbjct  123   VGHTHVLQDGPVSGRKADVITAANTAAEVALRLVRPGKKNTDVTEAIQKVAAAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSHQMKQ VIDGNKVVLSV++PE  V+E EFEENEVY+IDIV STG+GKPK++DEKQT
Sbjct  183   GVLSHQMKQHVIDGNKVVLSVASPEATVEEVEFEENEVYAIDIVASTGDGKPKLIDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             TIYK+    NY LKMKASRFI SEI Q FP MPFTAR LEEKRARLGLVECVNH  LQPY
Sbjct  243   TIYKKDETVNYQLKMKASRFIISEIKQNFPHMPFTARSLEEKRARLGLVECVNHGHLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVL+EK GD VA IKFTVLLMPNGSDRIT+H LQ+L  TK I+DPEIK WLAL
Sbjct  303   PVLYEKSGDFVAQIKFTVLLMPNGSDRITSHTLQELQPTKTIEDPEIKGWLAL  355



>ref|XP_010503881.1| PREDICTED: proliferation-associated protein 2G4-like [Camelina 
sativa]
Length=393

 Score =   547 bits (1410),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 284/353 (80%), Positives = 319/353 (90%), Gaps = 0/353 (0%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+EKEL L+SPEVVTKYK AAEI+NKAL++V+++CKP A++VDICEKGDAFI+EQT
Sbjct  3     SDDERDEKELSLTSPEVVTKYKGAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
              +MYKN KKKIERGVAFPTCISVNNTV HFSPL++D+TVLE+GDMVKIDMGCHIDGFIA+
Sbjct  63    ASMYKNAKKKIERGVAFPTCISVNNTVGHFSPLASDETVLEDGDMVKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             V HTH+LQ+GPV+GR ADVI AANTAAEVA+RLVRPGKKN+DVTEAIQKVAAAYDCKIVE
Sbjct  123   VGHTHVLQDGPVSGRKADVITAANTAAEVALRLVRPGKKNTDVTEAIQKVAAAYDCKIVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSHQMKQ VIDGNKVVLSV++PE  V+E EFEENEVY+IDIV STG+GKPK++DEKQT
Sbjct  183   GVLSHQMKQHVIDGNKVVLSVASPEATVEEVEFEENEVYAIDIVASTGDGKPKLIDEKQT  242

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             TIYK+    NY LKMKASRFI SEI Q FP MPFTAR LEEKRARLGLVECVNH  LQPY
Sbjct  243   TIYKKDETVNYQLKMKASRFIISEIKQNFPHMPFTARSLEEKRARLGLVECVNHGHLQPY  302

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             PVL+EK GD VA IKFTVLLMPNGSDRIT+H LQ+L  TK I+DPEIK WLAL
Sbjct  303   PVLYEKSGDFVAQIKFTVLLMPNGSDRITSHTLQELQPTKTIEDPEIKGWLAL  355



>ref|XP_009799003.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4-like [Nicotiana sylvestris]
Length=361

 Score =   540 bits (1391),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 272/324 (84%), Positives = 302/324 (93%), Gaps = 1/324 (0%)
 Frame = +3

Query  339   LELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFS  518
             ++LVVS+CK  A++VD+CEKGDAFI+EQTGN+YKNVKKKIERGVAFPTCISVNNTVCHF 
Sbjct  1     MQLVVSECKTKAKIVDLCEKGDAFIKEQTGNIYKNVKKKIERGVAFPTCISVNNTVCHFX  60

Query  519   PLSNDDTVLEEGDMVKIDMGCHIDGFIAVVAHTHLLQEGPVTGRaadviaaantaaevaM  698
             PLS+D+TVLEEGDMVKIDMGCHIDGFIAVVAHTH++Q GP TGRAADV+AAANTAAEVA+
Sbjct  61    PLSSDETVLEEGDMVKIDMGCHIDGFIAVVAHTHVIQGGPATGRAADVVAAANTAAEVAV  120

Query  699   RLVRPGKKNSDVTEAIQKVAAAYDCKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEA  878
             RLV+PG+K SDVTEAIQKVAAAYDCKIVEGVLSHQMKQFVIDGNKVV SVSNP+TRVD+A
Sbjct  121   RLVKPGRKKSDVTEAIQKVAAAYDCKIVEGVLSHQMKQFVIDGNKVVSSVSNPDTRVDDA  180

Query  879   EFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPL  1058
             EFEENEVYS++IVTSTGEGKP +LD KQTTIYKR VDK+YNLKMKASR I+ EISQK P+
Sbjct  181   EFEENEVYSVNIVTSTGEGKPILLDGKQTTIYKRDVDKSYNLKMKASRVIFREISQKVPI  240

Query  1059  MPFTARDLEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAH  1238
             MPFTARDLEEKRAR+GLVECV H+LLQPYPVLHEKPGDLVAHIKFTVLLMPNG DRIT+H
Sbjct  241   MPFTARDLEEKRARVGLVECVKHELLQPYPVLHEKPGDLVAHIKFTVLLMPNGPDRITSH  300

Query  1239  PLQDLNVTKPID-DPEIKAWLALP  1307
              +Q+L   K ID +PEIK WLALP
Sbjct  301   AIQELTPAKTIDNEPEIKTWLALP  324



>gb|ERN05319.1| hypothetical protein AMTR_s00007p00167240 [Amborella trichopoda]
Length=318

 Score =   538 bits (1386),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 271/311 (87%), Positives = 303/311 (97%), Gaps = 1/311 (0%)
 Frame = +3

Query  243   MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
             MSD+E +EE+ELDL+SP+VVTKYK+AAEILNKAL+LVVS+CKP A+VVDICEKGDAFIRE
Sbjct  1     MSDDEAKEERELDLTSPDVVTKYKTAAEILNKALQLVVSECKPKAKVVDICEKGDAFIRE  60

Query  420   QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFI  599
             QTG++YKN KKKIERGVAFPTCISVNNTVCHFSPL++D+T L E DMVKIDMGCHIDGFI
Sbjct  61    QTGSVYKNAKKKIERGVAFPTCISVNNTVCHFSPLASDETTLVENDMVKIDMGCHIDGFI  120

Query  600   AVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKI  779
             AVVAHTH+LQEGPVTGRAADVIAAANTAAEVA+RLVRPG+KN DVTEAIQKVAAAYDCKI
Sbjct  121   AVVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLVRPGRKNKDVTEAIQKVAAAYDCKI  180

Query  780   VEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEK  959
             VEGVLSHQ+KQFVIDGNKV+L+VSNPETRVD+AEFEENEVY+IDIVTSTG+GKPK+LDEK
Sbjct  181   VEGVLSHQLKQFVIDGNKVILNVSNPETRVDDAEFEENEVYAIDIVTSTGDGKPKLLDEK  240

Query  960   QTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQ  1139
             QTTIYKRAVDKNY+LKMK+SRFI+SEI+Q+FP+MPFTAR LEEKRARLGLVECVNH+LLQ
Sbjct  241   QTTIYKRAVDKNYHLKMKSSRFIFSEINQRFPIMPFTARVLEEKRARLGLVECVNHELLQ  300

Query  1140  PYPVLHEKPGD  1172
             PYPVLHEKPG+
Sbjct  301   PYPVLHEKPGE  311



>ref|XP_008366899.1| PREDICTED: proliferation-associated protein 2G4-like [Malus domestica]
Length=352

 Score =   539 bits (1388),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 262/354 (74%), Positives = 297/354 (84%), Gaps = 43/354 (12%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LV+S+CKP A++VD+CEKGD++IREQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDSYIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKN KKKIERGVAFPTCISVNNTVCHFSPL +D++VLEEGD++KI  G     +I 
Sbjct  61    TGNMYKNAKKKIERGVAFPTCISVNNTVCHFSPLGSDESVLEEGDILKIPTG-----YIL  115

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             V+                                      N DVTEAIQKVAAAYDCKIV
Sbjct  116   VL--------------------------------------NKDVTEAIQKVAAAYDCKIV  137

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKV+LSVSNPETRVD+AEFEENEVY++DIV STGEGKPK+LDEKQ
Sbjct  138   EGVLSHQLKQFVIDGNKVILSVSNPETRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQ  197

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPFTAR LEEKRARLGL+ECVNH+LLQP
Sbjct  198   TTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFTARALEEKRARLGLLECVNHELLQP  257

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             YPVLHEKPGD VA IKFTVLLMPNGSDRIT+HP+Q+L  TK +DDPEIKAWL+L
Sbjct  258   YPVLHEKPGDFVARIKFTVLLMPNGSDRITSHPVQELQPTKQVDDPEIKAWLSL  311



>ref|XP_006291295.1| hypothetical protein CARUB_v10017431mg [Capsella rubella]
 gb|EOA24193.1| hypothetical protein CARUB_v10017431mg [Capsella rubella]
Length=381

 Score =   531 bits (1369),  Expect = 0.0, Method: Compositional matrix adjust.
 Identities = 286/388 (74%), Positives = 329/388 (85%), Gaps = 12/388 (3%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+ER+EKEL L+SPEVVTKYK AAEI+NKAL++V+++CKP A++VDICEKGDAFI+EQT
Sbjct  3     SDDERDEKELSLTSPEVVTKYKGAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
              +MYKN KKKIE+GVAFPTCISVNNTV HFSPL++D+TVLE+GD+VKIDMGCHIDGFIA+
Sbjct  63    ASMYKNSKKKIEKGVAFPTCISVNNTVGHFSPLASDETVLEDGDLVKIDMGCHIDGFIAL  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             V HTH+LQEGPV+G             EVA+RLVRPGKKN+DVTEAIQKVAAAYDCKIVE
Sbjct  123   VGHTHVLQEGPVSG------------PEVALRLVRPGKKNTDVTEAIQKVAAAYDCKIVE  170

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSHQMKQ VIDGNKVVLSV++PE  V+E EFEENEVY+IDIV STG+GKPK++DEKQT
Sbjct  171   GVLSHQMKQHVIDGNKVVLSVASPEATVEEVEFEENEVYAIDIVASTGDGKPKLIDEKQT  230

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             TIYK+    NY LK+KASRF  SEI++ FP MPFTAR LEEKRARLGLVECVNH  LQPY
Sbjct  231   TIYKKDETVNYQLKLKASRFTISEITKNFPHMPFTARSLEEKRARLGLVECVNHGHLQPY  290

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLALPtktkkk  1325
             PVL+EK GD VA IKFTVLLMPNGSDRIT+H LQ+L  TK I+DPEIK WLAL  K KK 
Sbjct  291   PVLYEKSGDFVAQIKFTVLLMPNGSDRITSHTLQELQPTKTIEDPEIKGWLALGIKKKKG  350

Query  1326  gggkkkkgkkgekteeAPQTEPTDEATN  1409
             GG KKK  K GEK E + + EP D ++N
Sbjct  351   GGKKKKAKKAGEKGEASTEAEPMDASSN  378



>gb|EEE63363.1| hypothetical protein OsJ_18175 [Oryza sativa Japonica Group]
Length=368

 Score =   519 bits (1337),  Expect = 1e-177, Method: Compositional matrix adjust.
 Identities = 271/353 (77%), Positives = 306/353 (87%), Gaps = 26/353 (7%)
 Frame = +3

Query  249   DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
             DE REEKELDLSS +VVTKYK AA+I+N AL+LVVS CKP A++VDICEK       QTG
Sbjct  5     DEVREEKELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICEK-------QTG  57

Query  429   NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVV  608
             N+YKNVK+KIERGVAFPTC+SVNNTVCHFSPL+ D+ VLEE DMVKIDMGCHIDGFIAVV
Sbjct  58    NIYKNVKRKIERGVAFPTCVSVNNTVCHFSPLATDEAVLEENDMVKIDMGCHIDGFIAVV  117

Query  609   AHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
             AHTH++ +G VTG+AADV+AAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIVEG
Sbjct  118   AHTHVIHDGAVTGKAADVLAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIVEG  177

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTT  968
             VLSHQ+KQFVIDGNKVVLSVSN +T+VD+AEFEENEVY+IDIVTSTGEGKP++LDEKQTT
Sbjct  178   VLSHQLKQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTGEGKPQLLDEKQTT  237

Query  969   IYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYP  1148
             IYKRA D+N++LKMKASR                   LEEKRARLGLVEC+NH+LLQPYP
Sbjct  238   IYKRAFDQNFHLKMKASRA------------------LEEKRARLGLVECMNHELLQPYP  279

Query  1149  VLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPI-DDPEIKAWLAL  1304
             VLHEKPGDLVAHIKFTVLL+P+GS R+T+H LQ+L  TK I D+ EIKAWLAL
Sbjct  280   VLHEKPGDLVAHIKFTVLLLPSGSQRVTSHSLQELQPTKSIEDNAEIKAWLAL  332



>gb|KHN22549.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=327

 Score =   513 bits (1321),  Expect = 7e-176, Method: Compositional matrix adjust.
 Identities = 254/291 (87%), Positives = 280/291 (96%), Gaps = 0/291 (0%)
 Frame = +3

Query  432   MYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVVA  611
             MYKNVK+KIERGVAFPTC+SVNNTVCHFSPL++D+TVLE+GD+VKIDM CHIDGFIA VA
Sbjct  1     MYKNVKRKIERGVAFPTCVSVNNTVCHFSPLASDETVLEDGDIVKIDMACHIDGFIAAVA  60

Query  612   HTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEGV  791
             HTH+LQEGPVTGRAAD +AAANTAAEVA+RLVRPG+KN DVTEAIQK+AAAYDCKIVEGV
Sbjct  61    HTHVLQEGPVTGRAADALAAANTAAEVALRLVRPGRKNKDVTEAIQKIAAAYDCKIVEGV  120

Query  792   LSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTI  971
             LSHQMKQFVIDGNKVVLSVSNP+TRVD+AEFEENEVY+IDIV STG+GKPK+LDEKQTTI
Sbjct  121   LSHQMKQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYAIDIVASTGDGKPKLLDEKQTTI  180

Query  972   YKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPV  1151
             YKRAVDK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLVECVNH+LLQPYPV
Sbjct  181   YKRAVDKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLVECVNHELLQPYPV  240

Query  1152  LHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             LHEKPGD VAHIKFTVLLMPNGSDR+T+H LQ+L  TK IDDPEIKAWLAL
Sbjct  241   LHEKPGDYVAHIKFTVLLMPNGSDRVTSHSLQELQPTKTIDDPEIKAWLAL  291



>ref|XP_001765994.1| predicted protein [Physcomitrella patens]
 gb|EDQ69315.1| predicted protein [Physcomitrella patens]
Length=378

 Score =   503 bits (1295),  Expect = 4e-171, Method: Compositional matrix adjust.
 Identities = 266/375 (71%), Positives = 306/375 (82%), Gaps = 35/375 (9%)
 Frame = +3

Query  243   MSDEE-REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
             MSD+E +EEKE DL SP+VVTKYK AAE+              N ++VD+CEKGD+ IRE
Sbjct  1     MSDDEMKEEKEPDLRSPDVVTKYKCAAEV-------------ANTKIVDLCEKGDSLIRE  47

Query  420   Q---TGN----MYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMG  578
             Q   TG+    +YKN KKKI++GVAFPTC+SVNNTVCHFSPL++D++VL   D+ K  +G
Sbjct  48    QKLFTGSQIALIYKNSKKKIDKGVAFPTCVSVNNTVCHFSPLASDESVLAANDIAKY-IG  106

Query  579   CHIDGFIAVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVA  758
             CH+DGF AVVAHTH+L EGPVTG AADV+AAA+TA EVA+RLVRPGKKN DVTEAIQKVA
Sbjct  107   CHVDGFTAVVAHTHVLSEGPVTGCAADVLAAAHTAVEVALRLVRPGKKNKDVTEAIQKVA  166

Query  759   AAYDCKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGK  938
             +AYDCKI EGVLSHQ+KQ VID NKV+LSVSNPETRVD+AEFEENEVY+IDIVTSTG+GK
Sbjct  167   SAYDCKIAEGVLSHQLKQLVIDTNKVILSVSNPETRVDDAEFEENEVYAIDIVTSTGDGK  226

Query  939   PKILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVEC  1118
             PK+LDEKQTT+YKRAVDKNY+LKMKAS+FI SEI+ +FPLMPFTAR LEEKRARLGLVEC
Sbjct  227   PKLLDEKQTTVYKRAVDKNYHLKMKASKFIRSEINSRFPLMPFTARSLEEKRARLGLVEC  286

Query  1119  VNHDLLQPYPVLHEKP-------------GDLVAHIKFTVLLMPNGSDRITAHPLQDLNV  1259
             VNH+LLQPYPVLHEK              GD VA IKFTVLLMPNGSD+IT  PLQ+   
Sbjct  287   VNHELLQPYPVLHEKSGITIFHQLSLILTGDFVARIKFTVLLMPNGSDKITGVPLQEYQQ  346

Query  1260  TKPIDDPEIKAWLAL  1304
             TK  DDPEIKAWL +
Sbjct  347   TKVPDDPEIKAWLGM  361



>ref|XP_010907413.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Elaeis guineensis]
Length=344

 Score =   489 bits (1258),  Expect = 5e-166, Method: Compositional matrix adjust.
 Identities = 264/355 (74%), Positives = 291/355 (82%), Gaps = 51/355 (14%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+E +E+ELDL+SP+VVTKYKSAA+I++KAL+L VS+CKP A++VDICEK        
Sbjct  1     MSDDEAKEEELDLTSPDVVTKYKSAADIVSKALQLAVSECKPKAKIVDICEK--------  52

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
                           G AF                            ++ DMGCHIDGFIA
Sbjct  53    --------------GDAF----------------------------IRDDMGCHIDGFIA  70

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH+LQEGPVTGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIV
Sbjct  71    VVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIV  130

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKVVLSVSNPE RVDEAEFEENEVY++DIVTSTGEGKPK+LDEKQ
Sbjct  131   EGVLSHQLKQFVIDGNKVVLSVSNPEARVDEAEFEENEVYAVDIVTSTGEGKPKLLDEKQ  190

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQP  1142
             TTIYKRAVDKNY+LKMK+SRFI+SEI+QKFP+MPFTAR LEEKRARLGLVECVNH+LLQP
Sbjct  191   TTIYKRAVDKNYHLKMKSSRFIFSEINQKFPIMPFTARALEEKRARLGLVECVNHELLQP  250

Query  1143  YPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPID-DPEIKAWLAL  1304
             YPVLHEK GDLVAHIKFTVLLMPNGSDRIT+HPLQ L  TK ID DPEIKAWLAL
Sbjct  251   YPVLHEKLGDLVAHIKFTVLLMPNGSDRITSHPLQQLQPTKTIDNDPEIKAWLAL  305



>ref|XP_007026647.1| Metallopeptidase M24 family protein isoform 2 [Theobroma cacao]
 gb|EOY07149.1| Metallopeptidase M24 family protein isoform 2 [Theobroma cacao]
Length=286

 Score =   480 bits (1236),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 235/280 (84%), Positives = 267/280 (95%), Gaps = 0/280 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDL+SPEVVTKYKSAAEI+NKAL+LVV  CKP A++VDICEKGD FIREQ
Sbjct  1     MSDDEREEKELDLTSPEVVTKYKSAAEIVNKALQLVVKDCKPKAKIVDICEKGDVFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKNVK+KIERGVAFPTCISVNNTVCH SPL++D + LEEGDMVKID+GCHIDGFIA
Sbjct  61    TGNMYKNVKRKIERGVAFPTCISVNNTVCHISPLASDTSELEEGDMVKIDLGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             +VAHTH++Q+GP+TGR ADV+AA NTAAEVA+RLVRPGKKN DVT+AIQKVAAAYDCKIV
Sbjct  121   IVAHTHVVQDGPITGRQADVVAAVNTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKV+LSVSNP+TRVD+AEFEENEVY++DIV STGEGKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDL  1082
             TTIYKRAVDKNY+LKMK SRFI+SEI+QKFP++PFTAR +
Sbjct  241   TTIYKRAVDKNYHLKMKTSRFIFSEINQKFPILPFTARSV  280



>gb|KJB17056.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
 gb|KJB17057.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
Length=286

 Score =   476 bits (1225),  Expect = 5e-162, Method: Compositional matrix adjust.
 Identities = 236/278 (85%), Positives = 267/278 (96%), Gaps = 0/278 (0%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+EREEKELDLSS EVVTKYK AAEI+NKAL+LVV +CKP A++VDICEKGDAFIREQ
Sbjct  1     MSDDEREEKELDLSSSEVVTKYKGAAEIVNKALQLVVKECKPKAKIVDICEKGDAFIREQ  60

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
             TGNMYKN KKKIERGVAFPTC+SVNNTVCHFSPL++D + LEEGDMVKIDMGCHIDGFIA
Sbjct  61    TGNMYKNSKKKIERGVAFPTCLSVNNTVCHFSPLASDTSELEEGDMVKIDMGCHIDGFIA  120

Query  603   VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VVAHTH++Q GP+TG+ ADV+AAANTAAEVA+RLVRPGKKN DV++AIQKVAAAYDCKIV
Sbjct  121   VVAHTHVVQSGPITGKQADVVAAANTAAEVALRLVRPGKKNKDVSDAIQKVAAAYDCKIV  180

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             EGVLSHQ+KQFVIDGNKV+LSVSNP+TRVD+AEFEENEVY++DIV STGEGKPK+LDEKQ
Sbjct  181   EGVLSHQLKQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVASTGEGKPKLLDEKQ  240

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTAR  1076
             TTIYKRAVDKNY+LKMKASRFI+SEI+Q+FP++PFTAR
Sbjct  241   TTIYKRAVDKNYHLKMKASRFIFSEINQRFPILPFTAR  278



>ref|XP_006381246.1| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
 gb|ERP59043.1| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
Length=284

 Score =   473 bits (1218),  Expect = 6e-161, Method: Compositional matrix adjust.
 Identities = 237/279 (85%), Positives = 269/279 (96%), Gaps = 2/279 (1%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD+EREE+ELDL+SPEV+TKYKSAAEI+NKAL+LV+S+CKP A++VDICEKGD+FIREQT
Sbjct  3     SDDEREERELDLTSPEVITKYKSAAEIVNKALQLVISECKPKAKIVDICEKGDSFIREQT  62

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
             GNMYKNVKKKIERGVAFPTC+SVNNT+CHFSPL++D++VLEEGD+VKID+GCHIDGFIAV
Sbjct  63    GNMYKNVKKKIERGVAFPTCVSVNNTICHFSPLASDESVLEEGDIVKIDLGCHIDGFIAV  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
             V HTH LQ GPVTGRAADVIAAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIVE
Sbjct  123   VGHTHALQSGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIVE  182

Query  786   GVLSH--QMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEK  959
             GVL    Q+KQFVIDGNKV+LSVSNP+TRVD+AEFEENEVY++DIVTSTGEGKPK+LDEK
Sbjct  183   GVLRQELQLKQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVTSTGEGKPKLLDEK  242

Query  960   QTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTAR  1076
              TTIYKRAVDKNY+LKMK+SRFI+SEI+QKFP+MPFTAR
Sbjct  243   STTIYKRAVDKNYHLKMKSSRFIFSEINQKFPIMPFTAR  281



>gb|KHN20329.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=284

 Score =   431 bits (1107),  Expect = 3e-144, Method: Compositional matrix adjust.
 Identities = 219/244 (90%), Positives = 236/244 (97%), Gaps = 0/244 (0%)
 Frame = +3

Query  573   MGCHIDGFIAVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQK  752
             M CHIDGFIAVVAHTH+LQEGPVTGRAADVIAAANTAAEVA+RLVRPGKKN DV++AIQK
Sbjct  1     MACHIDGFIAVVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVSDAIQK  60

Query  753   VAAAYDCKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGE  932
             VAAAYDCKIVEGVLSHQMKQFVIDGNKVVLS+SNP+TRVDEAEFEENEVY+IDIVTSTG+
Sbjct  61    VAAAYDCKIVEGVLSHQMKQFVIDGNKVVLSLSNPDTRVDEAEFEENEVYAIDIVTSTGD  120

Query  933   GKPKILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLV  1112
             GKPK+LDEKQTTIYKRAVDK+Y+LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLV
Sbjct  121   GKPKLLDEKQTTIYKRAVDKSYHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLV  180

Query  1113  ECVNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKA  1292
             ECVNH+LLQPYPVLHEKPGD VAHIKFTVLLMPNGSDRIT HPLQ+L  TK IDDP+IKA
Sbjct  181   ECVNHELLQPYPVLHEKPGDFVAHIKFTVLLMPNGSDRITTHPLQELQPTKTIDDPDIKA  240

Query  1293  WLAL  1304
             WLAL
Sbjct  241   WLAL  244



>gb|ACU22749.1| unknown [Glycine max]
Length=280

 Score =   422 bits (1085),  Expect = 5e-141, Method: Compositional matrix adjust.
 Identities = 215/244 (88%), Positives = 232/244 (95%), Gaps = 0/244 (0%)
 Frame = +3

Query  573   MGCHIDGFIAVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQK  752
             M CHIDGFIA VAHTH+L EGPVTGRAAD IAAANTAAEVA+RLVRPG+KN DVTEAIQK
Sbjct  1     MACHIDGFIAAVAHTHVLHEGPVTGRAADAIAAANTAAEVALRLVRPGRKNKDVTEAIQK  60

Query  753   VAAAYDCKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGE  932
             VAAAYDCKIVEGVLSHQMKQFVIDGNKVVLSVSNP+TRVD+AEFEENEVY+IDIV STG+
Sbjct  61    VAAAYDCKIVEGVLSHQMKQFVIDGNKVVLSVSNPDTRVDDAEFEENEVYAIDIVASTGD  120

Query  933   GKPKILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLV  1112
             GKPK+LDEKQTTIYKRAVDK+ +LKMKASRFI+SEISQKFP+MPF+AR LEEKRARLGLV
Sbjct  121   GKPKLLDEKQTTIYKRAVDKSSHLKMKASRFIFSEISQKFPIMPFSARALEEKRARLGLV  180

Query  1113  ECVNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKA  1292
             ECVNH+LLQPYPVLHEKPGD VAHIKFTVLLMPNGSDR+T+HPLQ+L  TK IDDPEIKA
Sbjct  181   ECVNHELLQPYPVLHEKPGDDVAHIKFTVLLMPNGSDRVTSHPLQELQPTKTIDDPEIKA  240

Query  1293  WLAL  1304
             WLAL
Sbjct  241   WLAL  244



>gb|KJB36949.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
Length=291

 Score =   418 bits (1075),  Expect = 3e-139, Method: Compositional matrix adjust.
 Identities = 214/245 (87%), Positives = 230/245 (94%), Gaps = 0/245 (0%)
 Frame = +3

Query  570   DMGCHIDGFIAVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQ  749
             DMGCHIDGFIAVVAHTH++QEG V  R ADVIAAANTAAEVA+RLVRPGKKN DVT+AIQ
Sbjct  9     DMGCHIDGFIAVVAHTHVVQEGLVNDRKADVIAAANTAAEVALRLVRPGKKNKDVTDAIQ  68

Query  750   KVAAAYDCKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTG  929
             KVAAAYDCKIVEGVLSHQ+KQFVIDGNKV+LSVSNP+TRVD+AEFEENEVY++DIV STG
Sbjct  69    KVAAAYDCKIVEGVLSHQLKQFVIDGNKVILSVSNPDTRVDDAEFEENEVYAVDIVASTG  128

Query  930   EGKPKILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGL  1109
             EGKPK+LDEKQTTIYKRAVDKNY+LKMK SRFI+SEI+QKFP++PFTAR LEEKRARLGL
Sbjct  129   EGKPKLLDEKQTTIYKRAVDKNYHLKMKTSRFIFSEINQKFPILPFTARALEEKRARLGL  188

Query  1110  VECVNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIK  1289
             VECVNHDLLQPYPVLHEKPGD VAHIKFTVLLMPNGSDRIT HPLQ L  TK IDDPEIK
Sbjct  189   VECVNHDLLQPYPVLHEKPGDYVAHIKFTVLLMPNGSDRITLHPLQKLQPTKTIDDPEIK  248

Query  1290  AWLAL  1304
              WLAL
Sbjct  249   GWLAL  253



>ref|XP_005650680.1| proliferation-associated protein 1 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26136.1| proliferation-associated protein 1 [Coccomyxa subellipsoidea 
C-169]
Length=402

 Score =   409 bits (1050),  Expect = 7e-134, Method: Compositional matrix adjust.
 Identities = 210/359 (58%), Positives = 275/359 (77%), Gaps = 8/359 (2%)
 Frame = +3

Query  243   MSDEE---REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
             MSD +    E +ELDLS+ +VVTKYK+AA+I N AL  V+   K  A++VD+C  GD  I
Sbjct  1     MSDYDSDVEEGQELDLSNSDVVTKYKAAADITNNALAAVIKAAKAGAKLVDLCSLGDKSI  60

Query  414   REQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDG  593
              + +  ++K   K IE+G+AFPTC SVNN + H SPL+ D   L+EGD+VKID+G HIDG
Sbjct  61    EDASAKVFKG--KTIEKGIAFPTCTSVNNVIGHVSPLAEDTVELKEGDVVKIDLGSHIDG  118

Query  594   FIAVVAHTHLLQ---EGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAA  764
             F+A  AHT ++Q   E PVTG+AADVI AANTA E A+RL+RPGK+ S+VT  + +VA A
Sbjct  119   FVATAAHTIVVQSDAEAPVTGKAADVIVAANTALEAAIRLIRPGKRISEVTGVLGQVAEA  178

Query  765   YDCKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPK  944
             Y   +VEGVLSHQ+KQFVIDGNK VL+ ++PE RV++ EFEENEVY IDIV S+GEGK +
Sbjct  179   YGVSLVEGVLSHQLKQFVIDGNKCVLNKASPEYRVEDGEFEENEVYGIDIVVSSGEGKGR  238

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVN  1124
             +LDE++TT+YKRA+D+ Y LK+KASR I+SEI++K P MPFT R L+ K++RLG++EC+N
Sbjct  239   VLDERETTVYKRALDQEYKLKLKASRSIFSEINKKHPTMPFTTRGLDSKQSRLGILECLN  298

Query  1125  HDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLA  1301
             H LL PYPVLHEK G++VA  K TVLLMPNGSDRITA PLQ ++  K +++ ++K  LA
Sbjct  299   HGLLHPYPVLHEKNGEVVAQFKATVLLMPNGSDRITAAPLQKVDSDKKVENEDLKKLLA  357



>ref|XP_002947167.1| hypothetical protein VOLCADRAFT_79596 [Volvox carteri f. nagariensis]
 gb|EFJ51757.1| hypothetical protein VOLCADRAFT_79596 [Volvox carteri f. nagariensis]
Length=382

 Score =   401 bits (1030),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 212/370 (57%), Positives = 276/370 (75%), Gaps = 17/370 (5%)
 Frame = +3

Query  243   MSDEE--REEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
             MSD+   + E+E +LS PEVVTKYK+AA+I N+AL+ V+  CK  +++VD+C  GD FI 
Sbjct  1     MSDDGSIQGEQEPNLSVPEVVTKYKAAADICNRALQAVIDGCKDGSKIVDLCRTGDNFIT  60

Query  417   EQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGF  596
             ++ GN+YK   K+IE+GVAFPTC+SVN+ V HFSP ++D + L+ GD+VK DMGCHIDGF
Sbjct  61    KECGNIYKG--KQIEKGVAFPTCVSVNSVVGHFSPNADDTSALKAGDVVKFDMGCHIDGF  118

Query  597   IAVVAHTHLLQEG--PVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             IA  A T ++Q G  P+TGRAADVIAAA TA + A+RL+RPGK  SDV   +QK+A AY 
Sbjct  119   IATQATTVVVQAGEVPITGRAADVIAAARTAFDAAVRLIRPGKHISDVAGPLQKIAEAYG  178

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKIL  950
             C +VEGV+SH+MKQFVIDG+K +L+   P+ +V++AEFEENEVY+IDIV STGEGKP++L
Sbjct  179   CNMVEGVMSHEMKQFVIDGSKCILNKPTPDQKVEDAEFEENEVYAIDIVVSTGEGKPRVL  238

Query  951   DEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRA-----------  1097
             DEK+TT+YKRA++  Y LKM+ASR ++S I+  F  MPFT R L ++ A           
Sbjct  239   DEKETTVYKRALEVAYQLKMQASRIVFSLINSSFATMPFTLRALLDEAANQKTELKVGQL  298

Query  1098  RLGLVECVNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDD  1277
             +LGLVEC+NH LL PYPVLHEK G+LVA IK TVLLMPNGS  +T+   Q +N  K ++D
Sbjct  299   KLGLVECLNHGLLHPYPVLHEKGGELVAQIKGTVLLMPNGSSIVTSASRQPVNSEKKVED  358

Query  1278  PEIKAWLALP  1307
              EI   LA P
Sbjct  359   KEILDLLATP  368



>ref|XP_001699126.1| hypothetical protein CHLREDRAFT_139416 [Chlamydomonas reinhardtii]
 gb|EDO98981.1| predicted protein [Chlamydomonas reinhardtii]
Length=387

 Score =   390 bits (1003),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 204/367 (56%), Positives = 270/367 (74%), Gaps = 14/367 (4%)
 Frame = +3

Query  243   MSDEER-EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
             MSD+   E +E +LS PEVVTKYK+AA+I N+AL  VV   K  A+VVD+C  GD FI +
Sbjct  1     MSDDGSIEHQEPNLSVPEVVTKYKAAADICNRALLAVVEAAKDGAKVVDLCRMGDQFINK  60

Query  420   QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFI  599
             +  N+YK   K+IE+GVAFPTC+S N+ V HFSP S D T L+ GD+VKIDMGCHIDGFI
Sbjct  61    ECANIYKG--KEIEKGVAFPTCVSANSIVGHFSPNSEDATALKNGDVVKIDMGCHIDGFI  118

Query  600   AVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKI  779
             A  A T ++ +  ++G+AADVIAAA TA + A+RL+RPGK  +DV+  +QKVA ++ C +
Sbjct  119   ATQATTIVVGDAAISGKAADVIAAARTAFDAAVRLIRPGKHIADVSAPLQKVAESFGCNL  178

Query  780   VEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEK  959
             VEGV+SH+MKQFVIDG+K +L+   P+ +V++ EFEENEVY++DIV S+GEGKP++LDEK
Sbjct  179   VEGVMSHEMKQFVIDGSKCILNKPTPDQKVEDGEFEENEVYAVDIVVSSGEGKPRVLDEK  238

Query  960   QTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTAR-----------DLEEKRARLG  1106
             +TT+YKRA++  Y LKM+ASR ++S ++  F  MPFT R           +L+  + +LG
Sbjct  239   ETTVYKRALEVTYQLKMQASRAVFSLVNSAFATMPFTLRALLDEAAAQKTELKASQLKLG  298

Query  1107  LVECVNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEI  1286
             LVEC+NH LL PYPVLHEKPG++VA IK TVLLMPNGS  IT+ P Q +   K ++D EI
Sbjct  299   LVECLNHGLLHPYPVLHEKPGEVVAQIKGTVLLMPNGSSIITSAPRQTVTTEKKVEDKEI  358

Query  1287  KAWLALP  1307
                LA P
Sbjct  359   LDLLATP  365



>gb|KIZ00762.1| hypothetical protein MNEG_7198 [Monoraphidium neglectum]
Length=383

 Score =   387 bits (995),  Expect = 7e-126, Method: Compositional matrix adjust.
 Identities = 205/360 (57%), Positives = 268/360 (74%), Gaps = 16/360 (4%)
 Frame = +3

Query  261   EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
             EE+ELDLS+ +VVTKYK+AAEI NKA+   V   K  A+VVD+C  GD  I ++  N++K
Sbjct  3     EEQELDLSNSDVVTKYKAAAEICNKAISAAVEASKDGAKVVDVCRIGDDVITKEVQNIFK  62

Query  441   NVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVVAHTH  620
                KK E+G+AFPTC+SVN+ V HFSP ++D T +++GD+VKID+GCHIDG+IA  A T 
Sbjct  63    G--KKFEKGIAFPTCVSVNSVVGHFSPATDDTTTIKDGDLVKIDLGCHIDGWIATQATTI  120

Query  621   LLQEG----PVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
              +  G    P+TGRAADV+AAA TA +VA+RL++PGKK S+V++ + K    + C++VEG
Sbjct  121   QVAAGGVATPITGRAADVVAAARTAFDVAIRLIKPGKKVSEVSDKLVKAVEPFGCQLVEG  180

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTT  968
             VL+H +KQ+VIDGNKVVL+  +P+ +V+EAEFE NEVY+IDIV STGEGKPK+LD+K+TT
Sbjct  181   VLTHDLKQYVIDGNKVVLNRPSPDQKVEEAEFEPNEVYAIDIVVSTGEGKPKVLDDKETT  240

Query  969   IYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEE----------KRARLGLVEC  1118
             +YKRA+D  Y LKMKASR +   IS+KFP++PFT R L E          K+ RLGLVEC
Sbjct  241   VYKRALDVEYKLKMKASRLVLGAISKKFPMLPFTLRALSEGEGEDVSELKKQLRLGLVEC  300

Query  1119  VNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWL  1298
             + H LL PYPVLHEK G+LVA IK TVLLMPNGSD+IT  P Q +   K ++D E+   L
Sbjct  301   LTHGLLHPYPVLHEKGGELVAQIKGTVLLMPNGSDKITVAPQQPVETEKKVEDAELLKLL  360



>gb|ABR26103.1| proliferation-associated protein 2g4 [Oryza sativa Indica Group]
Length=231

 Score =   370 bits (951),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 190/227 (84%), Positives = 214/227 (94%), Gaps = 0/227 (0%)
 Frame = +3

Query  249  DEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTG  428
            DE REEKELDLSS +VVTKYK AA+I+N AL+LVVS CKP A++VDICEKGD++IREQTG
Sbjct  5    DEVREEKELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICEKGDSYIREQTG  64

Query  429  NMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVV  608
            N+YKNVK+KIERGVAFPTC+SVNNTVCHFSPL+ D+ VLEE DMVKIDMGCHIDGFIAVV
Sbjct  65   NIYKNVKRKIERGVAFPTCVSVNNTVCHFSPLATDEAVLEENDMVKIDMGCHIDGFIAVV  124

Query  609  AHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
            AHTH++ +G VTG+AADV+AAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCKIVEG
Sbjct  125  AHTHVIHDGAVTGKAADVLAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCKIVEG  184

Query  789  VLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTG  929
            VLSHQ+KQFVIDGNKVVLSVSN +T+VD+AEFEENEVY+IDIVTSTG
Sbjct  185  VLSHQLKQFVIDGNKVVLSVSNADTKVDDAEFEENEVYAIDIVTSTG  231



>gb|ACU19222.1| unknown [Glycine max]
Length=219

 Score =   368 bits (944),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 188/219 (86%), Positives = 212/219 (97%), Gaps = 0/219 (0%)
 Frame = +3

Query  243  MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
            MSD+EREEKELDLSS EVVTKYK+AAEI+NKAL+LV+S+CKP A++VDICEKGD++IREQ
Sbjct  1    MSDDEREEKELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDICEKGDSYIREQ  60

Query  423  TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIA  602
            TGN+YKNVK+KIERGVAFPTC+SVNN VCHFSPL++D+ VLEEGD++KIDM CHIDGFIA
Sbjct  61   TGNVYKNVKRKIERGVAFPTCLSVNNVVCHFSPLASDEAVLEEGDILKIDMACHIDGFIA  120

Query  603  VVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             VAHTH+LQEGPVTGRAADVIAAANTAAEVA+RLVRPGKKN DV++AIQKVAAAYDCKIV
Sbjct  121  AVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVSDAIQKVAAAYDCKIV  180

Query  783  EGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEV  899
            EGVLSHQMKQFVIDGNKVVLS+SNP+TRVDEAEFEENEV
Sbjct  181  EGVLSHQMKQFVIDGNKVVLSLSNPDTRVDEAEFEENEV  219



>ref|XP_002508417.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69675.1| predicted protein [Micromonas sp. RCC299]
Length=376

 Score =   369 bits (948),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 195/365 (53%), Positives = 254/365 (70%), Gaps = 10/365 (3%)
 Frame = +3

Query  243   MSD---EEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFI  413
             MSD   +  +E E   ++P VV KYK AAEI NKAL + ++ CKP A++VDIC  GD  +
Sbjct  1     MSDYGSDAEDETETTCANPAVVDKYKVAAEIANKALAVALAACKPGAKIVDICNLGDKTV  60

Query  414   REQTGNMYKNVKK---KIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCH  584
              E+    Y    K   KIE+G+AFPTCISVN+ VCH SP S+D T LEEG  VKID+G H
Sbjct  61    EEEAAKFYNKKDKDGNKIEKGIAFPTCISVNHQVCHNSPPSDDATSLEEGQAVKIDLGAH  120

Query  585   IDGFIAVVAHTHLLQ---EGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKV  755
             +DG++A VAHT +L      PV G  ADV+ A  TA E A+R +RPG  NS+V +AI +V
Sbjct  121   VDGYVATVAHTVVLMGDMNAPVVGAQADVMKAVVTAGEAAIRKLRPGVNNSEVAKAIGRV  180

Query  756   AAAYDCKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEG  935
             A  +  ++VEGVLSH MK++VIDGNKV+L+  + E + DEAE + NEVY++DIV S+GEG
Sbjct  181   AEDFGVRVVEGVLSHNMKRYVIDGNKVILNKPSAELKADEAEIKLNEVYALDIVMSSGEG  240

Query  936   KPKILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEE-KRARLGLV  1112
              PK+LDEK+T +YKRAV+ NY LKM+ASR ++SEI ++FP MPF+ R +E  K A+LGLV
Sbjct  241   TPKMLDEKETAVYKRAVENNYKLKMQASRAVFSEIQKRFPTMPFSMRAMEGIKGAKLGLV  300

Query  1113  ECVNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKA  1292
             EC  H+LL  YPVL+EKPGD VAH K TVL+M NG+DRIT    Q +     + D E+K 
Sbjct  301   ECCTHELLHKYPVLYEKPGDAVAHFKATVLVMQNGNDRITTWTCQPVESALELTDEELKE  360

Query  1293  WLALP  1307
              +  P
Sbjct  361   LITQP  365



>ref|XP_010040429.1| PREDICTED: proliferation-associated protein 2G4-like, partial 
[Eucalyptus grandis]
Length=237

 Score =   358 bits (919),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 181/234 (77%), Positives = 204/234 (87%), Gaps = 3/234 (1%)
 Frame = +3

Query  720   KNSDVTEAIQKVAAAYDCKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEV  899
             +N DVTEAI KVAAAYDCKIVEGVLSHQ+KQFVIDGNKV++SVSNP+T+VDE EFEENEV
Sbjct  5     QNKDVTEAINKVAAAYDCKIVEGVLSHQLKQFVIDGNKVIISVSNPDTKVDEFEFEENEV  64

Query  900   YSIDIVTSTGEGKPKILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARD  1079
             Y+IDIVTSTGEGKPK+LDEKQTT+YKRAVDKNY+LKMKASRFI+SEI+QKFP++PF+AR 
Sbjct  65    YAIDIVTSTGEGKPKLLDEKQTTVYKRAVDKNYHLKMKASRFIFSEINQKFPILPFSARA  124

Query  1080  LEEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNV  1259
             LEEKRARLGLVECVNH+LLQPYPVLHEKPGD  AHIKFTVLLMPNGSDRIT+H LQ+L  
Sbjct  125   LEEKRARLGLVECVNHELLQPYPVLHEKPGDYAAHIKFTVLLMPNGSDRITSHSLQELQP  184

Query  1260  TKPIDDPEIKAWLALPtktkkkgggkkkkgkkgekteeAPQTEPTDEATNKSKS  1421
             TK IDDPEIKAWLAL     K       K KKG+K  E+ +TEP D  TN ++S
Sbjct  185   TKTIDDPEIKAWLAL---GTKTKKKGGGKKKKGKKGTESAETEPMDATTNGAES  235



>gb|KCW45226.1| hypothetical protein EUGRSUZ_L01140 [Eucalyptus grandis]
Length=325

 Score =   358 bits (918),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 181/233 (78%), Positives = 203/233 (87%), Gaps = 3/233 (1%)
 Frame = +3

Query  723   NSDVTEAIQKVAAAYDCKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVY  902
             N DVTEAI KVAAAYDCKIVEGVLSHQ+KQFVIDGNKV++SVSNP+T+VDE EFEENEVY
Sbjct  94    NKDVTEAINKVAAAYDCKIVEGVLSHQLKQFVIDGNKVIISVSNPDTKVDEFEFEENEVY  153

Query  903   SIDIVTSTGEGKPKILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDL  1082
             +IDIVTSTGEGKPK+LDEKQTT+YKRAVDKNY+LKMKASRFI+SEI+QKFP++PF+AR L
Sbjct  154   AIDIVTSTGEGKPKLLDEKQTTVYKRAVDKNYHLKMKASRFIFSEINQKFPILPFSARAL  213

Query  1083  EEKRARLGLVECVNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVT  1262
             EEKRARLGLVECVNH+LLQPYPVLHEKPGD  AHIKFTVLLMPNGSDRIT+H LQ+L  T
Sbjct  214   EEKRARLGLVECVNHELLQPYPVLHEKPGDYAAHIKFTVLLMPNGSDRITSHSLQELQPT  273

Query  1263  KPIDDPEIKAWLALPtktkkkgggkkkkgkkgekteeAPQTEPTDEATNKSKS  1421
             K IDDPEIKAWLAL     K       K KKG+K  E+ +TEP D  TN ++S
Sbjct  274   KTIDDPEIKAWLAL---GTKTKKKGGGKKKKGKKGTESAETEPMDATTNGAES  323



>ref|XP_003062941.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH52880.1| predicted protein [Micromonas pusilla CCMP1545]
Length=374

 Score =   355 bits (910),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 199/361 (55%), Positives = 257/361 (71%), Gaps = 7/361 (2%)
 Frame = +3

Query  246   SDEEREEKELD-LSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             SD +REE+E + L +P VV KYK AAEI NK+L  V++ C P A+VVD C  GD  I ++
Sbjct  4     SDSDREEREDETLGNPAVVDKYKVAAEIANKSLAAVIAACVPGAKVVDACALGDKSIEDE  63

Query  423   TGNMYKNVK---KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDG  593
                 Y       +KI++G+AFPTC+SVNN VCH SP  +DD V+EEG  VKID+G H+DG
Sbjct  64    AAKFYNKKGADGQKIDKGIAFPTCVSVNNQVCHNSPAPDDDAVIEEGQAVKIDLGAHVDG  123

Query  594   FIAVVAHTHL--LQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAY  767
             ++AVVAHTH+    +    G  ADV+ AA  A+E A+R +RPG   SDV +AI+ VA  Y
Sbjct  124   YVAVVAHTHVVGADDRVPAGAQADVMEAAVVASEAAIRKLRPGASTSDVAKAIETVANDY  183

Query  768   DCKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKI  947
               KIVEGVL+H MK+FVIDGNKVVL+   PE + DE   E NEVY++DIV STGEGKPK+
Sbjct  184   GVKIVEGVLTHSMKRFVIDGNKVVLNKPTPELKADETTIELNEVYALDIVLSTGEGKPKM  243

Query  948   LDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKR-ARLGLVECVN  1124
              DEK+T +YKRA++KNY LKM+ASR ++SEIS+KFP MPFT R + + R A+LGL EC+ 
Sbjct  244   QDEKETNVYKRAIEKNYKLKMQASRAVFSEISKKFPTMPFTMRAMGDVRGAKLGLSECMK  303

Query  1125  HDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLAL  1304
             H+LL  YPVL+EKPGD VAH+K TVL+M NG+DR+T    Q     K + D ++KA +A 
Sbjct  304   HELLHEYPVLYEKPGDAVAHVKCTVLVMQNGNDRVTTFAPQVTKSEKELMDEDLKALIAE  363

Query  1305  P  1307
             P
Sbjct  364   P  364



>ref|XP_011653701.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4 [Cucumis sativus]
Length=221

 Score =   348 bits (892),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 197/205 (96%), Gaps = 0/205 (0%)
 Frame = +3

Query  543   LEEGDMVKIDMGCHIDGFIAVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKK  722
             +EEGD++KIDMGCHIDGFIAVV HTH+LQEGPVTGRAADVIAAANTAAEV + LVRPGKK
Sbjct  1     MEEGDILKIDMGCHIDGFIAVVLHTHVLQEGPVTGRAADVIAAANTAAEVTLMLVRPGKK  60

Query  723   NSDVTEAIQKVAAAYDCKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVY  902
             N DVTEAIQKVAAAYDCK+VEGVLSHQ+KQFVIDGNKV+LSVSNPETRVD+AEFEENE+Y
Sbjct  61    NKDVTEAIQKVAAAYDCKVVEGVLSHQLKQFVIDGNKVILSVSNPETRVDDAEFEENEIY  120

Query  903   SIDIVTSTGEGKPKILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDL  1082
             +IDIVTSTGEGKPK+LDEKQTTIYKRA+DK+Y+LKMKA R I+SEIS+KFP++PFTAR L
Sbjct  121   AIDIVTSTGEGKPKLLDEKQTTIYKRAMDKSYHLKMKACRXIFSEISKKFPVLPFTARAL  180

Query  1083  EEKRARLGLVECVNHDLLQPYPVLH  1157
             EEKRARLGLVECVN DLLQPYP+LH
Sbjct  181   EEKRARLGLVECVNRDLLQPYPILH  205



>ref|XP_003084394.1| putative DNA-binding protein GBP16 (ISS) [Ostreococcus tauri]
Length=367

 Score =   347 bits (889),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/356 (49%), Positives = 240/356 (67%), Gaps = 5/356 (1%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MS   R  + +    P+VVTKYK AA+  N AL++    C   A++VD C+ GD  + ++
Sbjct  1     MSRSSRRARAM--KQPDVVTKYKIAADCANAALKVATDACVVGAKIVDCCQAGDDSLEKE  58

Query  423   TGNMYKNVKK---KIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDG  593
             T   Y    K   K+E+GVAFPTC+SVNN VCH SP ++ D VL+EGD VKID+G HIDG
Sbjct  59    TAKYYNKKDKDGNKVEKGVAFPTCVSVNNQVCHASPNADCDAVLKEGDCVKIDLGAHIDG  118

Query  594   FIAVVAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDC  773
             ++A  AHT ++ +  +TG+ ADV+ A   A+E+ +R +RPG   +D++E I+ VA  +  
Sbjct  119   YVATSAHTFVIGQDKITGQVADVMKACELASEIVIRKLRPGASTADISETIENVAKDFGV  178

Query  774   KIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILD  953
              +VEGV++H MK+F+IDGNKV+L+   PE + +  E E  E Y++DIV S+GEGKPK  D
Sbjct  179   NVVEGVMTHNMKRFIIDGNKVILNKQTPEMKAEPTEIEMYETYALDIVMSSGEGKPKQRD  238

Query  954   EKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDL  1133
             E++T +YKRA++KNY LKM  SR ++SEIS++FP MPFTAR L+EKR   GLVEC NH L
Sbjct  239   ERETRVYKRAIEKNYQLKMANSRAVFSEISKRFPTMPFTARALQEKRVNFGLVECCNHGL  298

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLA  1301
             L  YPVL+EK G  VAHIK T L++ NG+DRIT    Q +   K + D  +   +A
Sbjct  299   LHSYPVLYEKDGSAVAHIKSTFLVLKNGNDRITTFAPQAVESDKKLSDTALYDLIA  354



>emb|CEG00817.1| Peptidase M24, methionine aminopeptidase [Ostreococcus tauri]
Length=385

 Score =   347 bits (890),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 172/350 (49%), Positives = 238/350 (68%), Gaps = 3/350 (1%)
 Frame = +3

Query  261   EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
             E +   +  P+VVTKYK AA+  N AL++    C   A++VD C+ GD  + ++T   Y 
Sbjct  23    ENRARAMKQPDVVTKYKIAADCANAALKVATDACVVGAKIVDCCQAGDDSLEKETAKYYN  82

Query  441   NVKK---KIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVVA  611
                K   K+E+GVAFPTC+SVNN VCH SP ++ D VL+EGD VKID+G HIDG++A  A
Sbjct  83    KKDKDGNKVEKGVAFPTCVSVNNQVCHASPNADCDAVLKEGDCVKIDLGAHIDGYVATSA  142

Query  612   HTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEGV  791
             HT ++ +  +TG+ ADV+ A   A+E+ +R +RPG   +D++E I+ VA  +   +VEGV
Sbjct  143   HTFVIGQDKITGQVADVMKACELASEIVIRKLRPGASTADISETIENVAKDFGVNVVEGV  202

Query  792   LSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTI  971
             ++H MK+F+IDGNKV+L+   PE + +  E E  E Y++DIV S+GEGKPK  DE++T +
Sbjct  203   MTHNMKRFIIDGNKVILNKQTPEMKAEPTEIEMYETYALDIVMSSGEGKPKQRDERETRV  262

Query  972   YKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPV  1151
             YKRA++KNY LKM  SR ++SEIS++FP MPFTAR L+EKR   GLVEC NH LL  YPV
Sbjct  263   YKRAIEKNYQLKMANSRAVFSEISKRFPTMPFTARALQEKRVNFGLVECCNHGLLHSYPV  322

Query  1152  LHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLA  1301
             L+EK G  VAHIK T L++ NG+DRIT    Q +   K + D  +   +A
Sbjct  323   LYEKDGSAVAHIKSTFLVLKNGNDRITTFAPQAVESDKKLSDTALYDLIA  372



>ref|XP_011400941.1| Proliferation-associated protein A [Auxenochlorella protothecoides]
 gb|KFM27934.1| Proliferation-associated protein A [Auxenochlorella protothecoides]
Length=353

 Score =   342 bits (878),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 185/352 (53%), Positives = 243/352 (69%), Gaps = 25/352 (7%)
 Frame = +3

Query  246   SDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQT  425
             SD E  E E  +S+P+VVTKYK+AA+I+N  L  V+   KP A++VD+C  GD  I E  
Sbjct  6     SDSESRENE-SISNPDVVTKYKAAAKIVNDTLAAVIDAAKPGAKIVDLCTLGDKLITEAA  64

Query  426   GNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAV  605
                +K   K IE+G+A PTC+SVNN + HFSP +++   L+EGD+VKID+G HIDGFIA 
Sbjct  65    AKEFKG--KDIEKGIAVPTCVSVNNCIGHFSPPADNTATLKEGDVVKIDLGAHIDGFIAQ  122

Query  606   VAHTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVE  785
              AH+ +  +GP  GRAADV+AAA+ A E A RLVR G++  +V   + K+A AY C +VE
Sbjct  123   AAHSLVAVDGPAKGRAADVVAAAHAAYEAASRLVRAGRRAKEVGPVLSKIAEAYGCTLVE  182

Query  786   GVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQT  965
             GVLSH+MK+F+ID +K            D+ E EE EVY+IDIV STGEGK K++DEK+T
Sbjct  183   GVLSHEMKRFIIDASKAA----------DDFEIEEGEVYAIDIVMSTGEGKSKVVDEKET  232

Query  966   TIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPY  1145
             T++KRA+D  Y LK+KASR + SEI++KFP M +            GL+EC+NH+LLQP+
Sbjct  233   TVFKRALDVQYQLKIKASREVLSEINKKFPTMMY------------GLLECINHNLLQPF  280

Query  1146  PVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLA  1301
             PVL+EKP  LVAH K TVLL+P+G DRIT   LQ L   K I+D E+KA LA
Sbjct  281   PVLYEKPDALVAHFKGTVLLVPSGVDRITNSTLQALESDKSIEDAEVKALLA  332



>ref|XP_006629280.1| PREDICTED: proliferation-associated protein 2G4-like [Lepisosteus 
oculatus]
Length=394

 Score =   342 bits (876),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 187/355 (53%), Positives = 254/355 (72%), Gaps = 11/355 (3%)
 Frame = +3

Query  261   EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
             E++E  ++   VVTKYK   +I N+AL  VV   KP   V+ +CEKGDA I E+TG ++K
Sbjct  6     EQQEQTIAEDLVVTKYKMGGDIANQALRKVVEAAKPGVSVLALCEKGDALIMEETGKIFK  65

Query  441   NVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVAHT  617
               +K++++G+AFPT +SVNN VCHFSPL +D D  L+EGD+VKID+G H+DGFIA VAH+
Sbjct  66    K-EKEMKKGIAFPTSVSVNNCVCHFSPLKSDPDYTLKEGDLVKIDLGVHVDGFIANVAHS  124

Query  618   HLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
              ++   +E PVTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ C  +EG
Sbjct  125   FVVGATKEAPVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFKCTAIEG  184

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             +LSHQ+KQ VIDG K ++   + + R D  +AEFE +EVY++D++ STGEGK +   ++ 
Sbjct  185   MLSHQLKQHVIDGEKTIIQNPSDQQRKDHEKAEFEVHEVYAVDVLISTGEGKARDAGQR-  243

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQ  1139
             TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC  H+LLQ
Sbjct  244   TTIYKRDPTKQYGLKMKTSRVFFSEVERRFDGMPFTLRAFEDEGKARLGVVECAKHELLQ  303

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPL-QDLNVTK-PIDDPEIKAWL  1298
             P+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P  Q+L  ++  + DPE+KA L
Sbjct  304   PFNVLYEKEGENVAQFKFTVLLMPNGPMRITSGPFDQELYKSEHEVQDPELKALL  358



>ref|XP_009041985.1| hypothetical protein AURANDRAFT_55591 [Aureococcus anophagefferens]
 gb|EGB03305.1| hypothetical protein AURANDRAFT_55591 [Aureococcus anophagefferens]
Length=393

 Score =   341 bits (874),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 183/335 (55%), Positives = 249/335 (74%), Gaps = 11/335 (3%)
 Frame = +3

Query  261   EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMY-  437
             EE ELD+S+ +V TKY+ A +I N AL+ +V Q KP A+V+D+C+ GD  I ++ G +Y 
Sbjct  18    EEVELDISNSDVCTKYREAGKIANLALQGLVLQVKPGAKVLDLCKFGDMVITKKCGTIYQ  77

Query  438   KNVK-KKIERGVAFPTCISVNNTVCHFSPLSNDDT--VLEEGDMVKIDMGCHIDGFIAVV  608
             K VK K I++GVAFPTC+SVN  VCH SPL +D    VL++GDMVK+D+GC++DG+IAV 
Sbjct  78    KKVKGKAIDKGVAFPTCVSVNECVCHNSPLESDANIDVLKDGDMVKLDVGCYVDGYIAVA  137

Query  609   AHTHLLQE-----GPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDC  773
             AHT L  E      P+ G  ADV+ AA+ A EVA +L+RPG  NS VT+AI KVA  ++ 
Sbjct  138   AHTMLCGEQPSLDNPLLGSQADVLHAAHVACEVAQKLLRPGNTNSQVTKAIHKVAEDFNV  197

Query  774   KIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILD  953
             +   GVLSH+MK+FVIDGNKV+L     + +V++  FE NEVYSID+  STG+GKPK + 
Sbjct  198   RACSGVLSHRMKRFVIDGNKVILLREETDQKVEDFCFELNEVYSIDVAMSTGDGKPKEM-  256

Query  954   EKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHD  1130
             + +TTI+KR+VDKNY LKM++SR +++E++ KFP +PFT R LE E++AR+G+VEC+ H+
Sbjct  257   QSRTTIFKRSVDKNYMLKMRSSRTLFNEVNAKFPALPFTLRALEDERQARMGVVECLKHE  316

Query  1131  LLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITA  1235
             L+ PYPVL EK GD +AH KFTVLL+P+G  RIT 
Sbjct  317   LIHPYPVLFEKKGDHIAHFKFTVLLLPSGPTRITG  351



>ref|XP_004544946.1| PREDICTED: proliferation-associated protein 2G4-like [Maylandia 
zebra]
Length=424

 Score =   340 bits (872),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 189/363 (52%), Positives = 255/363 (70%), Gaps = 16/363 (4%)
 Frame = +3

Query  240   KMSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
             KMSD+E+E+    ++   VVTKYK   +I N+AL LV+   KP   V+ +CEKGDA+I  
Sbjct  33    KMSDDEQEQT---IAEDLVVTKYKMGGDIANQALRLVMEAAKPGVSVLSLCEKGDAYIMV  89

Query  420   QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGF  596
             +TG ++K  +K++++G+AFPT +SVNN VCHFSPL +D D  L++GD+VKID+G H+DGF
Sbjct  90    ETGKVFKK-EKEMKKGIAFPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGF  148

Query  597   IAVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAY  767
             IA VAH+ ++   +E PVTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++
Sbjct  149   IANVAHSFIVGASKENPVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSF  208

Query  768   DCKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKP  941
              C  +EG+LSHQ+KQ VIDG K ++     + R D  +AEFE +EVY++D++ STGEGK 
Sbjct  209   KCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLISTGEGKA  268

Query  942   KILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVEC  1118
             +     +TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC
Sbjct  269   RD-SGLRTTIYKRDPSKQYGLKMKTSRTFFSEVERRFDAMPFTLRAFEDEAKARLGVVEC  327

Query  1119  VNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIK  1289
               H+LLQP+ VLHEK G++VA  KFTVLLM NG  RIT  PL D  + K    + DPE+K
Sbjct  328   AKHELLQPFSVLHEKEGEVVAQFKFTVLLMANGPHRITNGPL-DPELYKSEHEVQDPELK  386

Query  1290  AWL  1298
               L
Sbjct  387   TLL  389



>ref|XP_005311138.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4 [Chrysemys picta bellii]
Length=394

 Score =   339 bits (870),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 187/361 (52%), Positives = 251/361 (70%), Gaps = 12/361 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MS EE E  EL ++   VVTKYK   +I N+ L  VV   K    V+ +CEKGDA I E+
Sbjct  1     MSGEE-EAAELTIAEDLVVTKYKMGGDIANRVLRAVVEAAKSGGSVLSLCEKGDAMIMEE  59

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFI
Sbjct  60    TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKDGDLVKIDLGVHVDGFI  118

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ L+   +E PVTGR ADV+ AA+  AE A+RLV+PG +N+ VT+A  K+A +++
Sbjct  119   ANVAHSFLVDAAKETPVTGRKADVVKAAHLCAEAALRLVKPGNQNTQVTDAWNKIAHSFN  178

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY+ID++ STGEGK K
Sbjct  179   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAIDVLVSTGEGKAK  238

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC 
Sbjct  239   DAGQR-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDTMPFTLRAFEDEKKARMGVVECA  297

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTK--PIDDPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLMPNG  RIT  P +         + D E+KA 
Sbjct  298   KHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITCGPFEPERYKSEFEVQDAELKAL  357

Query  1296  L  1298
             L
Sbjct  358   L  358



>ref|XP_007253393.1| PREDICTED: proliferation-associated protein 2G4-like [Astyanax 
mexicanus]
Length=392

 Score =   339 bits (869),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 182/361 (50%), Positives = 255/361 (71%), Gaps = 13/361 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+E++E+   ++   VVTKYK + +I N+AL+LV+   KP   V+ +CEKGDA+I  +
Sbjct  1     MSDDEQQEQ--TIAEDLVVTKYKMSGDIANQALKLVIEAAKPGVSVLSLCEKGDAYIMAE  58

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K +++G+AFPTC+SVNN VCHFSPL +D D  L++GD+VKID+G H+DGFI
Sbjct  59    TGKVFKR-EKDMKKGIAFPTCVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFI  117

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   +E PVTG+ ADV+ AA   AE A+RLV+PG +N+ +TEA  K+A ++ 
Sbjct  118   ANVAHSFVIGASKEAPVTGKKADVVKAAYLCAEAALRLVKPGNQNTQITEAWNKIAHSFK  177

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + R D  +AEFE +EVY++D++ STGEGK +
Sbjct  178   CNPIEGMLSHQLKQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLISTGEGKAR  237

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R LE E +ARLG+VEC 
Sbjct  238   DGGQR-TTIYKRDPSKQYGLKMKTSRIFFSEVERRFNAMPFTLRALEDEGKARLGVVECA  296

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPID--DPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLM NG  RIT+   +        D  DPE+K+ 
Sbjct  297   KHELLQPFSVLNEKEGEFVAQFKFTVLLMANGPLRITSGAFEPEFYKSEFDVQDPELKSL  356

Query  1296  L  1298
             +
Sbjct  357   I  357



>ref|XP_006807648.1| PREDICTED: proliferation-associated protein 2G4-like [Neolamprologus 
brichardi]
Length=391

 Score =   338 bits (867),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 187/362 (52%), Positives = 253/362 (70%), Gaps = 16/362 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+E+E+    ++   VVTKYK   +I N+AL LV+   KP   V+ +CEKGDA+I  +
Sbjct  1     MSDDEQEQT---IAEDLVVTKYKMGGDIANQALRLVMEAAKPGVSVLSLCEKGDAYIMAE  57

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT +SVNN VCHFSPL +D D  L++GD+VKID+G H+DGFI
Sbjct  58    TGKVFKK-EKEMKKGIAFPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFI  116

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   +E P+TGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ 
Sbjct  117   ANVAHSFIVGASKENPITGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFK  176

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + R D  +AEFE +EVY++D++ STGEGK +
Sbjct  177   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLISTGEGKAR  236

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                  +TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  237   D-SGLRTTIYKRDPSKQYGLKMKTSRTFFSEVERRFDAMPFTLRAFEDEAKARLGVVECA  295

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKA  1292
              H+LLQP+ VLHEK G+ VA  KFTVLLM NG  RIT  PL D  + K    + DPE+K 
Sbjct  296   KHELLQPFSVLHEKEGEFVAQFKFTVLLMANGPHRITNGPL-DPELYKSEHEVQDPELKT  354

Query  1293  WL  1298
              L
Sbjct  355   LL  356



>ref|XP_005741395.1| PREDICTED: proliferation-associated protein 2G4-like [Pundamilia 
nyererei]
 ref|XP_005944019.1| PREDICTED: proliferation-associated protein 2G4-like [Haplochromis 
burtoni]
Length=391

 Score =   338 bits (866),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 188/362 (52%), Positives = 254/362 (70%), Gaps = 16/362 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+E+E+    ++   VVTKYK   +I N+AL LV+   KP   V+ +CEKGDA+I  +
Sbjct  1     MSDDEQEQT---IAEDLVVTKYKMGGDIANQALRLVMEAAKPGVSVLSLCEKGDAYIMVE  57

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT +SVNN VCHFSPL +D D  L++GD+VKID+G H+DGFI
Sbjct  58    TGKVFKK-EKEMKKGIAFPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFI  116

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   +E PVTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ 
Sbjct  117   ANVAHSFIVGASKENPVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFK  176

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + R D  +AEFE +EVY++D++ STGEGK +
Sbjct  177   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLISTGEGKAR  236

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                  +TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  237   D-SGLRTTIYKRDPSKQYGLKMKTSRTFFSEVERRFDAMPFTLRAFEDEAKARLGVVECA  295

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKA  1292
              H+LLQP+ VLHEK G++VA  KFTVLLM NG  RIT  PL D  + K    + DPE+K 
Sbjct  296   KHELLQPFSVLHEKEGEVVAQFKFTVLLMANGPHRITNGPL-DPELYKSEHEVQDPELKT  354

Query  1293  WL  1298
              L
Sbjct  355   LL  356



>ref|NP_001002070.1| proliferation-associated 2G4, a [Danio rerio]
 emb|CAD58759.1| novel protein similar to human proliferation-associated 2G4 protein 
(PA2G4) [Danio rerio]
 gb|AAH71407.1| Proliferation-associated 2G4, a [Danio rerio]
Length=392

 Score =   338 bits (866),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 181/361 (50%), Positives = 255/361 (71%), Gaps = 13/361 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+E++E+   ++   VVTKYK   +I N+AL  V+   KP   V+ +C+KGDAFI  +
Sbjct  1     MSDDEQQEQ--TIAEDLVVTKYKMGGDIANQALRAVIEAAKPGVSVLSLCQKGDAFIMAE  58

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K +++G+AFPTC+SVNN VCHFSPL +D D +L++GD+VKID+G H+DGFI
Sbjct  59    TGKIFKR-EKDMKKGIAFPTCVSVNNCVCHFSPLKSDPDYMLKDGDLVKIDLGVHVDGFI  117

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             + VAH+ ++   +E PVTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ 
Sbjct  118   SNVAHSFVIGATKEAPVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAHSFK  177

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK +
Sbjct  178   CNPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISSGEGKAR  237

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  238   DGGQR-TTIYKRDPSKQYGLKMKTSRMFFSEVERRFDAMPFTLRAFEDEGKARLGVVECA  296

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQD--LNVTKPIDDPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLM NG  RIT+ PL+         + DPE+K+ 
Sbjct  297   KHELLQPFSVLNEKEGEFVAQFKFTVLLMANGPLRITSGPLEAELYKSEHDVQDPELKSL  356

Query  1296  L  1298
             +
Sbjct  357   I  357



>ref|XP_008294311.1| PREDICTED: proliferation-associated protein 2G4 [Stegastes partitus]
Length=391

 Score =   337 bits (865),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 185/362 (51%), Positives = 252/362 (70%), Gaps = 16/362 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+E+E+    ++   VVTKYK   +I N+AL LVV   KP   V+ +CEKGDA+I  +
Sbjct  1     MSDDEQEQT---IAEDLVVTKYKMGGDIANQALRLVVETAKPGVSVLSLCEKGDAYIMAE  57

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT +SVNN VCHFSPL +D D  L++GD+VKID+G H+DGFI
Sbjct  58    TGKVFKK-EKEMKKGIAFPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFI  116

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   +E P+TGR ADV+ AA+  AE A+RLV+PG +N+ VTEA  K+A ++ 
Sbjct  117   ANVAHSFVVGASKENPITGRKADVVKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFK  176

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + R D  +AEFE +EVY++D++ STGEGK +
Sbjct  177   CSPIEGMLSHQLKQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLISTGEGKAR  236

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                 + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  237   DAGLR-TTIYKRDPSKQYGLKMKTSRTFFSEVERRFDAMPFTLRAFEDEAKARLGVVECA  295

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKA  1292
              H+LLQP+ VLHEK G+ VA  KFTVLLM NG  RIT  P  D  + K    + DPE++ 
Sbjct  296   KHELLQPFSVLHEKEGEFVAQFKFTVLLMANGPHRITNGPF-DPELYKSEHEVQDPELRT  354

Query  1293  WL  1298
              L
Sbjct  355   LL  356



>ref|XP_010747198.1| PREDICTED: proliferation-associated protein 2G4 [Larimichthys 
crocea]
Length=391

 Score =   337 bits (863),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 188/362 (52%), Positives = 252/362 (70%), Gaps = 16/362 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+E+E+    ++   VVTKYK   +I N+AL LVV   KP   V+ +CEKGDA+I  +
Sbjct  1     MSDDEQEQT---IAEDLVVTKYKMGGDIANQALRLVVETAKPGVSVLSLCEKGDAYIMAE  57

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT +SVNN VCHFSPL +D D  L++GD+VKID+G H+DGFI
Sbjct  58    TGKVFKK-EKEMKKGIAFPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFI  116

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   +E P+TGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ 
Sbjct  117   ANVAHSFVVGASKENPITGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFK  176

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K V+     + R D  +AEFE +EVY++D++ STGEGK +
Sbjct  177   CTPIEGMLSHQLKQHVIDGEKTVIQNPTDQQRKDHEKAEFEVHEVYAVDVLISTGEGKAR  236

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                  +TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  237   D-GGLRTTIYKRDPSKQYGLKMKTSRTFFSEVERRFDAMPFTLRAFEDEAKARLGVVECA  295

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKA  1292
              H+LLQP+ VLHEK G+ VA  KFTVLLM NG  RIT  P  D  + K    + DPE+K 
Sbjct  296   KHELLQPFSVLHEKEGECVAQFKFTVLLMANGPHRITNGPF-DPELYKSEHEVQDPELKT  354

Query  1293  WL  1298
              L
Sbjct  355   LL  356



>ref|XP_004085494.1| PREDICTED: proliferation-associated protein 2G4-like [Oryzias 
latipes]
Length=391

 Score =   336 bits (862),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 184/361 (51%), Positives = 248/361 (69%), Gaps = 14/361 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+E+E+    ++   VVTKYK   +I N+ L LV+   KP   V+ +CEKGDA+I  +
Sbjct  1     MSDDEQEQT---IAEDLVVTKYKMGGDIANQTLRLVMEAAKPGVSVISLCEKGDAYIMAE  57

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D  L++GD+VKID+G H+DGFI
Sbjct  58    TGKVFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFI  116

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   +E P TGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ 
Sbjct  117   ANVAHSFVVGASKEQPATGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFK  176

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ +IDG K ++     + R D  +AEFE +EVY++D++ STGEGK +
Sbjct  177   CTPIEGMLSHQLKQHIIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLISTGEGKAR  236

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                 + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R LE E +ARLG+VEC 
Sbjct  237   DSGLR-TTIYKRDPSKQYGLKMKTSRTFFSEVERRFDAMPFTLRALEDEAKARLGVVECT  295

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQD--LNVTKPIDDPEIKAW  1295
              H+LLQP+ VLHEK G+ VA  KFTVLLM NG  RIT  P           + DPE+K  
Sbjct  296   KHELLQPFSVLHEKEGEFVAQFKFTVLLMANGPHRITNGPFDSEFYKSEHEVQDPELKTL  355

Query  1296  L  1298
             L
Sbjct  356   L  356



>ref|WP_028832180.1| hypothetical protein [Proteobacteria bacterium JGI 0000113-E04]
Length=392

 Score =   336 bits (862),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 174/327 (53%), Positives = 240/327 (73%), Gaps = 8/327 (2%)
 Frame = +3

Query  276   DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKK  455
             DLS+  V+TKYK +AEI+ K LE V+SQC  +  V +IC  G+  +  Q  N++K+  KK
Sbjct  17    DLSNDTVMTKYKMSAEIVQKTLEGVISQCVADKSVSEICAFGNLVVEAQCKNIFKS--KK  74

Query  456   IERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVVAHTHLL---  626
             +E+G+AFPTCISVNN VCH SPL  D T L++GD+VKID+G H+DGFIAVVAHTH++   
Sbjct  75    VEKGLAFPTCISVNNCVCHNSPLPADSTTLKDGDVVKIDIGAHVDGFIAVVAHTHVVGRT  134

Query  627   -QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEGVLSHQ  803
                 P+TG  ADV+ A N AA+VA+  ++ G  N+ VTEAI KVA  Y    ++GVL HQ
Sbjct  135   ENSEPITGPLADVLQAGNDAAKVALMTLKVGNTNAMVTEAIAKVAKTYGVNPIQGVLMHQ  194

Query  804   MKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRA  983
             +K+FVIDGNKVV+  +  +  VDE  FE NEVY++DI  STGEGKPK +D K TT++KRA
Sbjct  195   LKRFVIDGNKVVIQRNEVDQEVDEITFEANEVYAVDIALSTGEGKPKEMDTK-TTVFKRA  253

Query  984   VDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKR-ARLGLVECVNHDLLQPYPVLHE  1160
             V+ NY LKMKASR++++EI++K+P +PF+    ++ R +++G+VECV H++L  YPVL E
Sbjct  254   VETNYRLKMKASRYVFNEINKKYPSLPFSIAAFDDTRQSKMGVVECVKHNMLHTYPVLFE  313

Query  1161  KPGDLVAHIKFTVLLMPNGSDRITAHP  1241
             K GD + H+KFT L++PNG+ +IT+ P
Sbjct  314   KEGDHIVHVKFTALVLPNGTSKITSGP  340



>ref|XP_003441515.1| PREDICTED: proliferation-associated protein 2G4-like [Oreochromis 
niloticus]
Length=391

 Score =   336 bits (861),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 187/362 (52%), Positives = 252/362 (70%), Gaps = 16/362 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+E+E+    ++   VVTKYK   +I N+AL LV+   KP   V+ +CEKGDA+I  +
Sbjct  1     MSDDEQEQT---IAEDLVVTKYKMGGDIANQALRLVMEAAKPGVSVLSLCEKGDAYIMAE  57

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT +SVNN VCHFSPL +D D  L++GD+VKID+G H+DGFI
Sbjct  58    TGKVFKK-EKEMKKGIAFPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFI  116

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   +E PVTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ 
Sbjct  117   ANVAHSFIVGASKENPVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFK  176

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + R D  +AEFE +EVY++D++ STGEGK +
Sbjct  177   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLISTGEGKAR  236

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                 + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  237   DSGLR-TTIYKRDPSKQYGLKMKTSRTFFSEVERRFDAMPFTLRAFEDEAKARLGVVECA  295

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKA  1292
              H+LLQP+ VLHEK G+ VA  KFTVLLM NG  RIT  PL D  + K    + D E+K 
Sbjct  296   KHELLQPFSVLHEKEGEFVAQFKFTVLLMANGPHRITNGPL-DPELYKSEHEVQDAELKT  354

Query  1293  WL  1298
              L
Sbjct  355   LL  356



>ref|XP_008318205.1| PREDICTED: proliferation-associated protein 2G4-like [Cynoglossus 
semilaevis]
Length=391

 Score =   334 bits (857),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 186/362 (51%), Positives = 251/362 (69%), Gaps = 16/362 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+E+E+    ++   VVTKYK   +I N+AL LVV   KP   V+ +CE GDA+I  +
Sbjct  1     MSDDEQEQT---VAEDLVVTKYKMGGDIANQALRLVVGAAKPGLSVLSLCEMGDAYIMTE  57

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D  L++GD+VKID+G H+DGFI
Sbjct  58    TGKVFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDPDCTLKDGDLVKIDLGVHVDGFI  116

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   +E PVTGR ADVI AA+  AE A+RLV+PG +N  VTEA  K+A  + 
Sbjct  117   ANVAHSFVVGATKEAPVTGRKADVIKAAHLCAEAALRLVKPGNQNFQVTEAWNKIAKEFK  176

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ +IDG K ++     + R D  + +FE +EVY++D++ STGEGK +
Sbjct  177   CSPIEGMLSHQLKQHIIDGEKTIIQNPTDQQRKDHEKTDFEVHEVYAVDVLISTGEGKAR  236

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                  +TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  237   D-GGLRTTIYKRDPSKQYGLKMKTSRSFFSEVERRFSAMPFTLRAFEDEAKARLGVVECA  295

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKA  1292
              H+LLQP+ VL EK G+ VA  KFTVLLM NG  RIT+ PL DL + K    + DPE++A
Sbjct  296   KHELLQPFSVLQEKEGEFVAQFKFTVLLMANGPHRITSGPL-DLELYKSEHEVQDPELRA  354

Query  1293  WL  1298
              L
Sbjct  355   LL  356



>gb|AAH44287.1| Pa2g4 protein, partial [Xenopus laevis]
Length=395

 Score =   334 bits (857),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 185/363 (51%), Positives = 258/363 (71%), Gaps = 12/363 (3%)
 Frame = +3

Query  237   TKMSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIR  416
             TKMS +E E++E  ++   VVTKYK   +I N+ L  +V      A ++++CEKGDA I 
Sbjct  4     TKMSGDE-EQQEQTIAEDLVVTKYKMGGDIANRVLRALVDTATAGASLLNLCEKGDAMIM  62

Query  417   EQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDG  593
             E+TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DG
Sbjct  63    EETGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYLLKDGDLVKIDLGVHVDG  121

Query  594   FIAVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAA  764
             FIA VAH+ ++   +E PVTGR ADVI AA+   E A+RLV+PG +NS VTEA  K++ +
Sbjct  122   FIANVAHSFVVGASKECPVTGRKADVIKAAHLCVEAALRLVKPGNQNSQVTEAWNKISPS  181

Query  765   YDCKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGK  938
             + C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ STGEGK
Sbjct  182   FKCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISTGEGK  241

Query  939   PKILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVE  1115
              +   ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VE
Sbjct  242   ARDAGQR-TTIYKRDPTKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVE  300

Query  1116  CVNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIK  1289
             C  H+LLQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+K
Sbjct  301   CAKHELLQPFNVLYEKEGEYVAQYKFTVLLMPNGPMRITSGPFEPDLYKSELEVQDSELK  360

Query  1290  AWL  1298
             A L
Sbjct  361   ALL  363



>ref|XP_003223249.1| PREDICTED: proliferation-associated protein 2G4 [Anolis carolinensis]
Length=394

 Score =   334 bits (856),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 186/361 (52%), Positives = 252/361 (70%), Gaps = 12/361 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MS EE E  EL ++   VV KYK   EI N+ L  V    KP   V+ +CE+GD  I E+
Sbjct  1     MSGEE-ETSELTIAEDVVVNKYKMGGEIANRTLRTVTETAKPGVSVLSLCERGDEMIMEE  59

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K +++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFI
Sbjct  60    TGKIFKK-EKDMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFI  118

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             + VAH+ ++   +E  VTGR ADVI AA+  AE A+RLV+PG +NS VT+A  K+A +++
Sbjct  119   SNVAHSFVIGASKESLVTGRKADVIKAAHLCAEAALRLVKPGNQNSQVTDAWNKIAHSFN  178

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ V+DG K ++     + R D  +AEFE +EVY+ID++ STGEGK K
Sbjct  179   CTPIEGMLSHQLKQHVVDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAIDVLISTGEGKAK  238

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC 
Sbjct  239   DAGQR-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECA  297

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + +L  ++  + D E+KA 
Sbjct  298   KHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEFEVQDAELKAL  357

Query  1296  L  1298
             L
Sbjct  358   L  358



>emb|CAJ82581.1| proliferation-associated 2G4 [Xenopus (Silurana) tropicalis]
Length=367

 Score =   333 bits (854),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 183/361 (51%), Positives = 256/361 (71%), Gaps = 12/361 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MS +E E++E  ++   VVTKYK   +I N+ L  +V      A ++++CEKGDA I E+
Sbjct  1     MSGDE-EQQEQTIAEDLVVTKYKMGGDIANRVLRTLVDAATAGASLLNLCEKGDAMIMEE  59

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFI
Sbjct  60    TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYLLKDGDLVKIDLGVHVDGFI  118

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   +E PVTGR ADVI AA+   E A+RLV+PG +NS VTEA  K++ ++ 
Sbjct  119   ANVAHSFVVGASKECPVTGRKADVIKAAHLCGEAALRLVKPGNQNSQVTEAWNKISPSFK  178

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ STGEGK K
Sbjct  179   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISTGEGKAK  238

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC 
Sbjct  239   DAGQR-TTIYKRDPTKQYGLKMKTSRAFFSEVERRFAAMPFTLRAFEDEKKARMGVVECA  297

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + D+  ++  + D E+KA 
Sbjct  298   KHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDMYKSELEVQDSELKAL  357

Query  1296  L  1298
             L
Sbjct  358   L  358



>ref|XP_008877833.1| DNA-binding protein, 42 kDa [Aphanomyces invadans]
 gb|ETV93491.1| DNA-binding protein, 42 kDa [Aphanomyces invadans]
Length=407

 Score =   334 bits (857),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 182/368 (49%), Positives = 253/368 (69%), Gaps = 18/368 (5%)
 Frame = +3

Query  240   KMSDEEREEKELDL------SSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKG  401
             +MSD + +E + D+      S+ +VVTKY+ AAEI   ALE V++Q  P   VV++   G
Sbjct  19    RMSDVDPQETKADVPVVEDCSNTDVVTKYRLAAEIAQSALEGVIAQLLPGKSVVEVATFG  78

Query  402   DAFIREQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGC  581
             DA I  + G +YK+  KK+E+G+AFPTC+SVN  VCHFSPL ++   L+ GD VKID+GC
Sbjct  79    DALITARAGTVYKS--KKVEKGIAFPTCLSVNEVVCHFSPLPSESVTLKAGDWVKIDLGC  136

Query  582   HIDGFIAVVAHTHLL--QEGP---VTGRaadviaaantaaevaMRLVRPGKKNSDVTEAI  746
             HIDG+IAVVAHT ++   EG    V G  ADV+ AA+ A E+  RL++PG  N+ VTEA+
Sbjct  137   HIDGYIAVVAHTVIVPDAEGSDNIVLGTQADVLKAAHDAVELCARLIKPGNTNAQVTEAL  196

Query  747   QKVAAAYDCKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTST  926
             + +A AY  K + G L HQ+K+FVIDG+K +   ++PET+   A F+ NE Y+ID+  +T
Sbjct  197   EALAEAYGVKALSGTLMHQLKRFVIDGSKTIAVKNDPETKAARATFDVNEAYAIDVAFTT  256

Query  927   GEGKPKILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARL  1103
             G  KP +  E++TT++KR VDK+Y LKMKASR+++SEI+ KFP +PFT R  E E ++RL
Sbjct  257   GLEKP-VQSERRTTVFKRQVDKSYRLKMKASRYVFSEINSKFPTLPFTIRAFEDESQSRL  315

Query  1104  GLVECVNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRIT--AHPLQDLNVTKPIDD  1277
             G+ ECV HDLL P+PVL  + GD +AH K TVLL+PNG+ +IT  A P+  +N  K +  
Sbjct  316   GVSECVKHDLLTPFPVLEGRHGDHIAHFKATVLLLPNGTTKITGLALPVDRVNSDKVL-T  374

Query  1278  PEIKAWLA  1301
             PE+ A L 
Sbjct  375   PELAAVLG  382



>ref|XP_001363571.1| PREDICTED: proliferation-associated protein 2G4 [Monodelphis 
domestica]
Length=394

 Score =   333 bits (855),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 185/361 (51%), Positives = 256/361 (71%), Gaps = 12/361 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MS E+ E++E  ++   VVTKYK   +I N+ L +VV      A V+ +CEKGDA I E+
Sbjct  1     MSGED-EQQEQTIAEDLVVTKYKMGGDIANRVLRVVVEASTSGASVLGLCEKGDAMIMEE  59

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFI
Sbjct  60    TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFI  118

Query  600   AVVAHTHLLQEG---PVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++      PVTGR ADVI AA+  AE A+RLV+PG +N+ VT+A  KVA +++
Sbjct  119   ANVAHSFVVNASKGTPVTGRKADVIRAAHLCAEAALRLVKPGNQNTQVTDAWNKVAHSFN  178

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K
Sbjct  179   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAK  238

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC 
Sbjct  239   DAGQR-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECA  297

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + +L  ++  + D E+KA 
Sbjct  298   KHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSELEVQDAELKAL  357

Query  1296  L  1298
             L
Sbjct  358   L  358



>ref|NP_001008439.1| ErbB3-binding protein 1 [Xenopus (Silurana) tropicalis]
 gb|AAH80337.1| MGC79578 protein [Xenopus (Silurana) tropicalis]
Length=390

 Score =   333 bits (854),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 183/361 (51%), Positives = 256/361 (71%), Gaps = 12/361 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MS +E E++E  ++   VVTKYK   +I N+ L  +V      A ++++CEKGDA I E+
Sbjct  1     MSGDE-EQQEQTIAEDLVVTKYKMGGDIANRVLRTLVDAATAGASLLNLCEKGDAMIMEE  59

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFI
Sbjct  60    TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYLLKDGDLVKIDLGVHVDGFI  118

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   +E PVTGR ADVI AA+   E A+RLV+PG +NS VTEA  K++ ++ 
Sbjct  119   ANVAHSFVVGASKECPVTGRKADVIKAAHLCGEAALRLVKPGNQNSQVTEAWNKISPSFK  178

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ STGEGK K
Sbjct  179   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISTGEGKAK  238

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC 
Sbjct  239   DAGQR-TTIYKRDPTKQYGLKMKTSRAFFSEVERRFAAMPFTLRAFEDEKKARMGVVECA  297

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + D+  ++  + D E+KA 
Sbjct  298   KHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDMYKSELEVQDSELKAL  357

Query  1296  L  1298
             L
Sbjct  358   L  358



>gb|ELR50756.1| Proliferation-associated protein 2G4, partial [Bos mutus]
Length=395

 Score =   333 bits (854),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 187/362 (52%), Positives = 255/362 (70%), Gaps = 12/362 (3%)
 Frame = +3

Query  240   KMSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
             KMS E+ E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E
Sbjct  1     KMSGED-EQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASCSGVSVLSLCEKGDAMIME  59

Query  420   QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGF  596
             +TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGF
Sbjct  60    ETGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGF  118

Query  597   IAVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAY  767
             IA VAHT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA ++
Sbjct  119   IANVAHTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSF  178

Query  768   DCKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKP  941
             +C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK 
Sbjct  179   NCTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKA  238

Query  942   KILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVEC  1118
             K   ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC
Sbjct  239   KDAGQR-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVEC  297

Query  1119  VNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKA  1292
               H+LLQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA
Sbjct  298   AKHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKA  357

Query  1293  WL  1298
              L
Sbjct  358   LL  359



>ref|XP_009039553.1| hypothetical protein AURANDRAFT_54512 [Aureococcus anophagefferens]
 gb|EGB05714.1| hypothetical protein AURANDRAFT_54512 [Aureococcus anophagefferens]
Length=395

 Score =   333 bits (854),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 178/335 (53%), Positives = 249/335 (74%), Gaps = 11/335 (3%)
 Frame = +3

Query  261   EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMY-  437
             E+ ELD+S+ +V TKY+ A +I N AL+ +V Q KP A+V+++C+ GD  I ++ G++Y 
Sbjct  18    EDVELDISNSDVCTKYREAGKIANLALQGLVLQVKPGAKVLELCKFGDMVIIQKCGSIYQ  77

Query  438   KNVKKK-IERGVAFPTCISVNNTVCHFSPLSNDDT--VLEEGDMVKIDMGCHIDGFIAVV  608
             K +K K I++GVAFPTC+SVN  VCH SPL +D T  VL EGD+VK+D+GC++DG+IAV 
Sbjct  78    KKIKGKLIDKGVAFPTCVSVNECVCHNSPLESDTTSEVLSEGDLVKLDVGCYVDGYIAVA  137

Query  609   AHTHLLQ-----EGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDC  773
             AHT +       + P++G  ADV+ AA+ A EVA +L+RPG  NS VT+AI KVA  +  
Sbjct  138   AHTMMCGKQPSIDRPLSGPQADVLHAAHIACEVAQKLLRPGNTNSQVTKAIAKVAEDFSV  197

Query  774   KIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILD  953
                 GVLSH+MK+FVIDGNKV+L   + + +V++  FE NEVYSID+  STG+GKPK + 
Sbjct  198   SACAGVLSHRMKRFVIDGNKVILLREDTDQKVEDFSFELNEVYSIDVAMSTGDGKPKEMI  257

Query  954   EKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDL-EEKRARLGLVECVNHD  1130
              + TTI+KR+VDKNY LKM++SR +++EI+ KFP +PFT R L +E++AR+G+VEC+ H+
Sbjct  258   SR-TTIFKRSVDKNYMLKMRSSRTLFNEINSKFPALPFTLRALDDERQARMGVVECLKHE  316

Query  1131  LLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITA  1235
             L+ PYPVL EK GD V+H KFTVL++P+G  RIT 
Sbjct  317   LIHPYPVLFEKKGDYVSHFKFTVLILPSGPTRITG  351



>ref|XP_005876787.1| PREDICTED: proliferation-associated protein 2G4 [Myotis brandtii]
 ref|XP_006093721.1| PREDICTED: proliferation-associated protein 2G4 [Myotis lucifugus]
 ref|XP_006777912.1| PREDICTED: proliferation-associated protein 2G4 [Myotis davidii]
 ref|XP_008146840.1| PREDICTED: proliferation-associated protein 2G4 [Eptesicus fuscus]
 gb|EPQ14237.1| Proliferation-associated protein 2G4 [Myotis brandtii]
Length=394

 Score =   333 bits (854),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 185/357 (52%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASCSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVGVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVT-KPIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  + K + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSDKEVQDAELKALL  358



>ref|XP_008619458.1| hypothetical protein SDRG_15074 [Saprolegnia diclina VS20]
 gb|EQC27064.1| hypothetical protein SDRG_15074 [Saprolegnia diclina VS20]
Length=393

 Score =   333 bits (853),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 176/349 (50%), Positives = 241/349 (69%), Gaps = 12/349 (3%)
 Frame = +3

Query  276   DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKK  455
             D S+ +VVTKY+ AAEI   ALE V+ Q  P   VV++C  GDA I  +   +YK+  KK
Sbjct  21    DCSNTDVVTKYRLAAEIAQSALEGVIGQLAPGKSVVELCAFGDAIITARAATVYKS--KK  78

Query  456   IERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVVAHTHLL--Q  629
             +E+G+AFPTC+SVN  VCHFSPL N+ T ++ GD VKID+GCHIDG+IAVVAHT ++   
Sbjct  79    VEKGIAFPTCVSVNEVVCHFSPLPNETTTIKAGDWVKIDLGCHIDGYIAVVAHTVIVPAA  138

Query  630   EGP---VTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEGVLSH  800
             EG    V G  ADV+  A  A E+  RL++PG  N  VT+A++ +A +Y  K + G L H
Sbjct  139   EGDDLIVIGSQADVLKCAQDALELCARLIKPGNTNHQVTDALEALAESYGVKSLHGTLMH  198

Query  801   QMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  980
             QMK+FVIDG+K +    + E +  +  FE NEVY+ID+  +TG  K  +  E++TT++KR
Sbjct  199   QMKRFVIDGSKTIAQKHDHEAKTAKVTFEANEVYAIDVAFTTGLDKA-VASERRTTVFKR  257

Query  981   AVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLH  1157
              VDK+Y LKMKASR+++SEI+ KFP +PFT R  E E ++R+G+VECV HDLL P+P+L 
Sbjct  258   QVDKSYRLKMKASRYVFSEINSKFPTLPFTIRAFEDESQSRMGVVECVKHDLLTPFPILE  317

Query  1158  EKPGDLVAHIKFTVLLMPNGSDRIT--AHPLQDLNVTKPIDDPEIKAWL  1298
              + GD +AH+K TVLLMPNG+ +IT  + PL+ +N  K +  PEI A L
Sbjct  318   GREGDHIAHLKATVLLMPNGTTKITGLSLPLERINSDKTV-TPEIAAIL  365



>gb|KDO19442.1| DNA-binding protein [Saprolegnia parasitica CBS 223.65]
Length=393

 Score =   333 bits (853),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 176/349 (50%), Positives = 241/349 (69%), Gaps = 12/349 (3%)
 Frame = +3

Query  276   DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKK  455
             D S+ +VVTKY+ AAEI   ALE V+ Q  P   VV++C  GDA I  +   +YK+  KK
Sbjct  21    DCSNTDVVTKYRLAAEIAQSALEGVIGQLAPGKSVVELCAFGDAIITARAATVYKS--KK  78

Query  456   IERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVVAHTHLL--Q  629
             +E+G+AFPTC+SVN  VCHFSPL N+ T ++ GD VKID+GCHIDG+IAVVAHT ++   
Sbjct  79    VEKGIAFPTCVSVNEVVCHFSPLPNETTTIKAGDWVKIDLGCHIDGYIAVVAHTVIVPAT  138

Query  630   EGP---VTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEGVLSH  800
             EG    V G  ADV+  A  A E+  RL++PG  N  VT+A++ +A +Y  K + G L H
Sbjct  139   EGDDLIVIGSQADVLKCAQDALELCARLIKPGNTNHQVTDALEALAESYGVKSLHGTLMH  198

Query  801   QMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  980
             QMK+FVIDG+K +    + E +  +  FE NEVY+ID+  +TG  K  +  E++TT++KR
Sbjct  199   QMKRFVIDGSKTIAQKHDHEAKTAKVTFEANEVYAIDVAFTTGLDKA-VASERRTTVFKR  257

Query  981   AVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLH  1157
              VDK+Y LKMKASR+++SEI+ KFP +PFT R  E E ++R+G+VECV HDLL P+P+L 
Sbjct  258   QVDKSYRLKMKASRYVFSEINSKFPTLPFTIRAFEDESQSRMGVVECVKHDLLTPFPILE  317

Query  1158  EKPGDLVAHIKFTVLLMPNGSDRIT--AHPLQDLNVTKPIDDPEIKAWL  1298
              + GD +AH+K TVLLMPNG+ +IT  + PL+ +N  K +  PEI A L
Sbjct  318   GREGDHIAHLKATVLLMPNGTTKITGLSLPLERINSEKTV-TPEIAAIL  365



>ref|XP_005371237.1| PREDICTED: proliferation-associated protein 2G4 [Microtus ochrogaster]
Length=394

 Score =   333 bits (853),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVDAASSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVIGVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEYVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_005335677.1| PREDICTED: proliferation-associated protein 2G4 [Ictidomys tridecemlineatus]
Length=394

 Score =   332 bits (852),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 185/357 (52%), Positives = 252/357 (71%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V    P   V+ +CEKGD  I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSPGVSVLSLCEKGDNMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL--QEGP-VTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   EG  VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVGVAEGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_006908945.1| PREDICTED: proliferation-associated protein 2G4 [Pteropus alecto]
 ref|XP_011374000.1| PREDICTED: proliferation-associated protein 2G4 [Pteropus vampyrus]
Length=394

 Score =   332 bits (850),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 185/357 (52%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASCSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++DI+ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDILVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>gb|ADX97052.1| proliferation-associated protein 2g4, partial [Perca flavescens]
Length=391

 Score =   332 bits (850),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 179/341 (52%), Positives = 243/341 (71%), Gaps = 12/341 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSDEE+E+    ++   VVTKYK   +I N+AL LVV   KP   V+ +CEKGDA+I  +
Sbjct  1     MSDEEQEQT---IAEDLVVTKYKMGGDIANQALRLVVETAKPGVSVLSLCEKGDAYIMAE  57

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT +SVNN VCHFSPL +D D  L++GD+VKID+G H+DGFI
Sbjct  58    TGKVFKK-EKEMKKGIAFPTSVSVNNCVCHFSPLKSDPDYALKDGDLVKIDLGVHVDGFI  116

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   +E P+TGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ 
Sbjct  117   ANVAHSFVVGASKENPITGRKADVIKAAHLCAEAALRLVKPGNQNNQVTEAWNKIAQSFK  176

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++   + + R D  +AEFE +EVY++D++ S+GEGK +
Sbjct  177   CSPIEGMLSHQLKQHVIDGEKTIIQNPSDQQRKDHEKAEFEVHEVYAVDVLISSGEGKAR  236

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                  +TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  237   D-GGLRTTIYKRDPSKQYGLKMKTSRTFFSEVERRFDAMPFTLRAFEDEAKARLGVVECA  295

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPL  1244
              H+LLQP+ VL EK G+ VA  KFTVLLM NG  RIT+ P 
Sbjct  296   KHELLQPFSVLQEKEGECVAQFKFTVLLMANGPHRITSGPF  336



>ref|XP_005799891.1| PREDICTED: proliferation-associated protein 2G4-like [Xiphophorus 
maculatus]
Length=391

 Score =   331 bits (848),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 183/361 (51%), Positives = 249/361 (69%), Gaps = 14/361 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSDEE+E+    ++   VVTKYK   +I  +AL  VV   K    V+ +CE GDA+I  +
Sbjct  1     MSDEEQEQT---IAEDLVVTKYKMGGDIATQALRKVVEAAKAGISVLSLCEVGDAYIMTE  57

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT +SVNN VCHFSPL +D D  L++GD+VKID+G H+DGFI
Sbjct  58    TGKVFKK-EKEMKKGIAFPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFI  116

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   +E P+TGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ 
Sbjct  117   ANVAHSFVVGAKKENPITGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAHSFK  176

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++   + + R D  +AEFE +EVY++D++ STGEGK +
Sbjct  177   CSPIEGMLSHQLKQHVIDGEKTIIQNPSDQQRKDHEKAEFEVHEVYAVDVLVSTGEGKAR  236

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                 + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  237   DSGLR-TTIYKRDPSKQYGLKMKTSRTFFSEVERRFDAMPFTLRAFEDEAKARLGVVECA  295

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPL--QDLNVTKPIDDPEIKAW  1295
              H+LLQP+ VLHEK G+ VA  KFTVLLM NG+ RIT  P   +       + DPE+KA 
Sbjct  296   KHELLQPFSVLHEKEGEFVAQFKFTVLLMANGAHRITNGPFDPELYQSEHEVQDPELKAL  355

Query  1296  L  1298
             L
Sbjct  356   L  356



>ref|NP_001029871.1| proliferation-associated protein 2G4 [Bos taurus]
 ref|NP_001277540.1| proliferation-associated 2G4, 38kDa [Panthera tigris altaica]
 ref|XP_531629.2| PREDICTED: proliferation-associated protein 2G4 [Canis lupus 
familiaris]
 ref|XP_003988925.1| PREDICTED: proliferation-associated protein 2G4 [Felis catus]
 ref|XP_004401711.1| PREDICTED: proliferation-associated protein 2G4 [Odobenus rosmarus 
divergens]
 ref|XP_004773144.1| PREDICTED: proliferation-associated protein 2G4 [Mustela putorius 
furo]
 ref|XP_004800650.1| PREDICTED: proliferation-associated protein 2G4 [Mustela putorius 
furo]
 ref|XP_005680428.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Capra 
hircus]
 ref|XP_005903484.1| PREDICTED: proliferation-associated protein 2G4 [Bos mutus]
 ref|XP_005975566.1| PREDICTED: proliferation-associated protein 2G4 [Pantholops hodgsonii]
 ref|XP_006728833.1| PREDICTED: proliferation-associated protein 2G4 [Leptonychotes 
weddellii]
 ref|XP_006075113.1| PREDICTED: proliferation-associated protein 2G4 [Bubalus bubalis]
 ref|XP_008710451.1| PREDICTED: proliferation-associated protein 2G4 [Ursus maritimus]
 ref|XP_010837513.1| PREDICTED: proliferation-associated protein 2G4 [Bison bison 
bison]
 ref|XP_011219007.1| PREDICTED: proliferation-associated protein 2G4 [Ailuropoda melanoleuca]
 ref|XP_012016095.1| PREDICTED: proliferation-associated protein 2G4 [Ovis aries musimon]
 gb|AAI03293.1| Proliferation-associated 2G4, 38kDa [Bos taurus]
 gb|EFB28840.1| hypothetical protein PANDA_004075, partial [Ailuropoda melanoleuca]
 tpg|DAA29554.1| TPA: ErbB3-binding protein 1 [Bos taurus]
 gb|AHJ25867.1| proliferation-associated 2G4 [Panthera tigris altaica]
Length=394

 Score =   331 bits (848),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASCSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_007533407.1| PREDICTED: proliferation-associated protein 2G4 [Erinaceus europaeus]
Length=394

 Score =   331 bits (848),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASNSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVNVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + +L  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSELEVQDAELKALL  358



>ref|NP_001083993.1| proliferation-associated 2G4, 38kD [Xenopus laevis]
 gb|AAH84760.1| Pa2g4 protein [Xenopus laevis]
Length=390

 Score =   331 bits (848),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 183/361 (51%), Positives = 256/361 (71%), Gaps = 12/361 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MS +E E++E  ++   VVTKYK   +I N+ L  +V      A ++++CEKGDA I E+
Sbjct  1     MSGDE-EQQEQTIAEDLVVTKYKMGGDIANRVLRALVDTATAGASLLNLCEKGDAMIMEE  59

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFI
Sbjct  60    TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYLLKDGDLVKIDLGVHVDGFI  118

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   +E PVTGR ADVI AA+   E A+RLV+PG +NS VTEA  K++ ++ 
Sbjct  119   ANVAHSFVVGASKECPVTGRKADVIKAAHLCVEAALRLVKPGNQNSQVTEAWNKISPSFK  178

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ STGEGK +
Sbjct  179   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISTGEGKAR  238

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC 
Sbjct  239   DAGQR-TTIYKRDPTKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECA  297

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA 
Sbjct  298   KHELLQPFNVLYEKEGEYVAQYKFTVLLMPNGPMRITSGPFEPDLYKSELEVQDSELKAL  357

Query  1296  L  1298
             L
Sbjct  358   L  358



>ref|XP_008279469.1| PREDICTED: proliferation-associated protein 2G4-like [Stegastes 
partitus]
Length=392

 Score =   331 bits (848),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 181/356 (51%), Positives = 252/356 (71%), Gaps = 13/356 (4%)
 Frame = +3

Query  261   EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
             E +E  ++   VVTKYK  AEI N+AL+ VV        V+ +CEKGDAFI  +TG ++K
Sbjct  6     ETQEQTIADDLVVTKYKMGAEIANQALKTVVGAATAGVSVLSLCEKGDAFIAAETGKIFK  65

Query  441   NVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVAHT  617
               +K +++G+AFPTC+SVNN VCH+SPL +D D +L++GD++KID+G H+DGFI+ VAH+
Sbjct  66    K-EKDMKKGIAFPTCVSVNNCVCHYSPLKSDPDVILKDGDLIKIDLGVHVDGFISNVAHS  124

Query  618   HLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
              ++   +E P+TGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ C  +EG
Sbjct  125   FVVGVTKENPLTGRKADVIKAAHLCAEAAIRLVKPGNQNTQVTEAWNKIAKSFKCSPIEG  184

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             +LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ STGEGK K   ++ 
Sbjct  185   MLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISTGEGKAKDGGQR-  243

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQ  1139
             TT+YKR  +K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC  H+LLQ
Sbjct  244   TTVYKRDPNKVYGLKMKTSRTFFSEMERRFDTMPFTLRAFEDEGKARLGVVECAKHELLQ  303

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKAWL  1298
             P+ VLHEK G+ VA  KFTVLLM NG  RIT + L +  + K    ++DPE+KA L
Sbjct  304   PFTVLHEKEGEFVAQFKFTVLLMANGPLRIT-NSLFEPELYKSEHEVEDPELKALL  358



>ref|XP_010764812.1| PREDICTED: proliferation-associated protein 2G4 [Notothenia coriiceps]
Length=391

 Score =   330 bits (847),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 177/337 (53%), Positives = 242/337 (72%), Gaps = 12/337 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+E+E+    ++   VVTKYK   +I N+AL LVV    P   V+ +CEKGDA+I  +
Sbjct  1     MSDDEKEQT---IAEDLVVTKYKMGGDIANQALRLVVETAMPGVSVLSLCEKGDAYIMAE  57

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT +SVNN VCHFSPL +D D  L++GD+VKID+G H+DGFI
Sbjct  58    TGKVFKK-EKEMKKGIAFPTSVSVNNCVCHFSPLKSDPDFTLKDGDLVKIDLGVHVDGFI  116

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   +E P+TG+ ADVI AA+  AE A+RLV+PG +NS VTEA  K+A ++ 
Sbjct  117   ANVAHSFVVGASKENPITGKKADVIKAAHLCAEAALRLVKPGSQNSKVTEAWNKIAKSFK  176

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ +IDG K ++   + + R D  +AEFE +EVY++D++ STGEGK +
Sbjct  177   CTPIEGMLSHQLKQHIIDGEKTIIQNPSDQQRKDHEKAEFEVHEVYAVDVLISTGEGKAR  236

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                 + TTIYKR   K Y LKMK SR ++SE+ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  237   DAGLR-TTIYKRDPSKQYGLKMKTSRMVFSEVERRFDAMPFTLRAFEDEAKARLGVVECA  295

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRIT  1232
              H+LLQP+ VLHEK G+ VA  KFTVLLM NG  RIT
Sbjct  296   KHELLQPFGVLHEKEGECVAQFKFTVLLMANGPHRIT  332



>ref|XP_004006644.1| PREDICTED: proliferation-associated protein 2G4 [Ovis aries]
Length=394

 Score =   330 bits (846),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASCSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDVELKALL  358



>ref|NP_001085830.1| ErbB3-binding protein 1 [Xenopus laevis]
 gb|AAH73401.1| MGC80858 protein [Xenopus laevis]
Length=390

 Score =   330 bits (845),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 182/361 (50%), Positives = 255/361 (71%), Gaps = 12/361 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MS +E E++E  ++   VVTKYK   +I N+ L  ++      A ++++CEKGDA I E+
Sbjct  1     MSGDE-EQQEQTIAEDLVVTKYKMGGDIANRVLRTLLDTATAGASLLNLCEKGDAMIMEE  59

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFI
Sbjct  60    TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYLLKDGDLVKIDLGVHVDGFI  118

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   +E PVTGR ADVI AA+   E A+RLV+PG +N+ VTEA  K++  + 
Sbjct  119   ANVAHSFVVGASKECPVTGRKADVIKAAHLCGEAALRLVKPGNQNTQVTEAWNKISPEFK  178

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ STGEGK K
Sbjct  179   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISTGEGKAK  238

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC 
Sbjct  239   DAGQR-TTIYKRDPTKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECA  297

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA 
Sbjct  298   KHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSELEVQDSELKAL  357

Query  1296  L  1298
             L
Sbjct  358   L  358



>ref|XP_003448224.1| PREDICTED: proliferation-associated protein 2G4-like [Oreochromis 
niloticus]
Length=392

 Score =   329 bits (844),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 180/356 (51%), Positives = 254/356 (71%), Gaps = 13/356 (4%)
 Frame = +3

Query  261   EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
             E +E  ++   VVTKYK  AEI N+AL+ VV   K    V+ +CEKGDAFI  +TG ++K
Sbjct  6     ETQEQTIADDLVVTKYKMGAEIANQALKAVVEAAKAGVSVLSLCEKGDAFIAAETGKIFK  65

Query  441   NVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVAHT  617
               +K++++G+AFPTC+SVNN VCHFSPL +D + +L++GD+VKID+G H+DGFI+ VAH+
Sbjct  66    R-EKEMKKGIAFPTCVSVNNCVCHFSPLKSDPEIILKDGDLVKIDLGVHVDGFISNVAHS  124

Query  618   HLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
              ++   ++ P+TGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ C  +EG
Sbjct  125   FVVGVTKDNPLTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAKSFKCSPIEG  184

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             +LSHQ+KQ VIDG K ++   + + + D  +AEFE +EVY++D++ STGEGK K   ++ 
Sbjct  185   MLSHQLKQHVIDGEKTIIQNPSDQQKKDHEKAEFEVHEVYAVDVLISTGEGKAKDGGQR-  243

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQ  1139
             TT+YKR  +K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC  H+L+Q
Sbjct  244   TTVYKRDANKVYGLKMKTSRTFFSEMERRFDTMPFTLRAFEDEAKARLGVVECAKHELVQ  303

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKAWL  1298
             P+ VL EK G+ VA  KFTVLLM NG  RIT + L +  + K    ++DPE+KA L
Sbjct  304   PFTVLQEKEGEFVAQFKFTVLLMANGPLRIT-NSLFEPELYKSEHEVEDPELKALL  358



>ref|XP_001504854.1| PREDICTED: proliferation-associated protein 2G4 isoform 1 [Equus 
caballus]
 ref|XP_004429287.1| PREDICTED: proliferation-associated protein 2G4 [Ceratotherium 
simum simum]
 ref|XP_008528370.1| PREDICTED: proliferation-associated protein 2G4 [Equus przewalskii]
Length=394

 Score =   329 bits (843),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASCSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LK+K SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKIKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_002163189.2| PREDICTED: proliferation-associated protein 2G4-like [Hydra vulgaris]
Length=400

 Score =   329 bits (843),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 191/364 (52%), Positives = 251/364 (69%), Gaps = 15/364 (4%)
 Frame = +3

Query  243   MSDEER-EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIRE  419
             M+D++  +E+EL ++   VVTKYK A +I N  L+ ++++CK  A    ICE GD  I E
Sbjct  1     MADKDSGDEEELTIADDVVVTKYKMAGDITNGVLKAIIAECKDGASARAICELGDKLILE  60

Query  420   QTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPL-SNDDTVLEEGDMVKIDMGCHIDGF  596
             +T  +YK  +K++++G+ FPTCI +NN VCHFSPL S  D +L+ GD+VKID+G H+DGF
Sbjct  61    ETNKIYKK-EKELKKGIGFPTCICINNVVCHFSPLQSETDMILKTGDLVKIDLGTHVDGF  119

Query  597   IAVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAY  767
             I  VAHT ++   +E  VTGR ADV+ AA  A EVA RLV+PG  N+ VTEAI KVA  +
Sbjct  120   IGGVAHTLVVGASKETKVTGRKADVLLAAYYAGEVAQRLVKPGNNNNQVTEAITKVAEEF  179

Query  768   DCKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKP  941
              CK VEG+LSHQ+KQ VIDG K ++   N   + D  + EFE +EVY+ID++ STG+GK 
Sbjct  180   KCKPVEGMLSHQLKQNVIDGEKTIIQNPNDAQKKDHKKCEFELHEVYAIDVLLSTGDGKA  239

Query  942   KILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVEC  1118
             K   E +TT+YKR  D NY+LKMKASR  YSE+  KF +MPFT R  E EK+ARLG+ EC
Sbjct  240   K-ERETRTTVYKR-TDMNYSLKMKASRNFYSEVCNKFTMMPFTLRAFEDEKKARLGVNEC  297

Query  1119  VNHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTK---PIDDPEIK  1289
              NH+L+ PYPVL+EK G+ VA  KFTVLLMPNG  RIT H   D  + +    I D E+K
Sbjct  298   TNHELITPYPVLYEKDGEYVAQFKFTVLLMPNGPLRIT-HGTWDPELVQSEYSIKDEELK  356

Query  1290  AWLA  1301
               L+
Sbjct  357   KILS  360



>ref|XP_006179892.1| PREDICTED: proliferation-associated protein 2G4 [Camelus ferus]
 ref|XP_006218628.1| PREDICTED: proliferation-associated protein 2G4 [Vicugna pacos]
 ref|XP_010962177.1| PREDICTED: proliferation-associated protein 2G4 [Camelus bactrianus]
 ref|XP_010975183.1| PREDICTED: proliferation-associated protein 2G4 [Camelus dromedarius]
Length=394

 Score =   329 bits (843),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 250/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASCSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLLQEG---PVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++       VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVDVALGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSELEVQDAELKALL  358



>ref|XP_003405168.1| PREDICTED: proliferation-associated protein 2G4 [Loxodonta africana]
Length=394

 Score =   328 bits (842),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 186/357 (52%), Positives = 253/357 (71%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLLQ--EG-PVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   EG PVTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVDVAEGTPVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>emb|CAG06775.1| unnamed protein product [Tetraodon nigroviridis]
Length=391

 Score =   328 bits (842),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 187/361 (52%), Positives = 248/361 (69%), Gaps = 14/361 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+E E+    ++   VVTKYK   +I N+AL LVV    P A V+ +CEKGDA+I  +
Sbjct  1     MSDDEHEQT---IAEDIVVTKYKMGGDIANQALRLVVESACPGASVLSLCEKGDAYIMAE  57

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D  L +GD+VKID+G HIDGFI
Sbjct  58    TGKVFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDPDYTLNDGDLVKIDLGVHIDGFI  116

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+  +   +E PVTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ 
Sbjct  117   ANVAHSFAVGASKEKPVTGRKADVIRAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFK  176

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + R D  +AEFE +EVY++D++ STGEGK +
Sbjct  177   CSPIEGMLSHQLKQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLISTGEGKAR  236

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                  +TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  237   D-GGLRTTIYKRDPSKQYGLKMKTSRMFFSEVERRFDAMPFTLRAFEDEAKARLGVVECA  295

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAW  1295
               +LLQP+ VL EK G+ VA  KFTVLLM NG  RIT      DL +++  + DPE+K  
Sbjct  296   KRELLQPFSVLQEKEGEFVAQFKFTVLLMANGPHRITNGLFDPDLYMSEYEVQDPELKTL  355

Query  1296  L  1298
             L
Sbjct  356   L  356



>ref|XP_005801435.1| PREDICTED: proliferation-associated protein 2G4-like [Xiphophorus 
maculatus]
Length=392

 Score =   328 bits (842),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 181/361 (50%), Positives = 250/361 (69%), Gaps = 12/361 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MS +E E  E  ++   VVTKYK  AEI N+AL+ V     P   V+ +C+KGD FI  +
Sbjct  1     MSGDE-ETPEQTIAEDLVVTKYKMGAEIANQALKKVAEAAAPGVSVLSLCQKGDEFIAAE  59

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K +++G+AFPTC+SVNN VCHFSPL +D D +L++GD+VKID+G H+DGFI
Sbjct  60    TGKIFKR-EKDMKKGIAFPTCVSVNNCVCHFSPLKSDPDVILKDGDLVKIDLGVHVDGFI  118

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             + VAH+ ++   ++ PVTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ 
Sbjct  119   SNVAHSFVVGATKDNPVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAKSFK  178

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  VEG+LSHQ+KQ +IDG K ++     + R D  +AEFE +EVY++D++ STGEGK K
Sbjct  179   CSAVEGMLSHQLKQHLIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLISTGEGKAK  238

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TT+YKR  +K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  239   DGGQR-TTVYKRDPNKVYGLKMKTSRTFFSEMERRFDTMPFTLRAFEDEAKARLGVVECA  297

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQD--LNVTKPIDDPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLM NG  RIT+   +         ++DPE+K  
Sbjct  298   KHELLQPFAVLYEKEGEFVAQFKFTVLLMANGPLRITSSLFEPELYQSEHDVEDPELKVL  357

Query  1296  L  1298
             L
Sbjct  358   L  358



>emb|CDQ74715.1| unnamed protein product [Oncorhynchus mykiss]
Length=393

 Score =   328 bits (842),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 176/342 (51%), Positives = 242/342 (71%), Gaps = 11/342 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD   EE+E  ++   VVTKYK   +I N+AL +V+   K    VV++CEKGDA I  +
Sbjct  1     MSD--NEEQEQTIAEDLVVTKYKMGGDIANQALRVVIEAAKSGVSVVNLCEKGDAHIMVE  58

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG +++  +K +++G+AFPT +SVNN VCHFSPL +D D  L++GD+VKID+G H+DGFI
Sbjct  59    TGKVFRK-EKDLKKGIAFPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFI  117

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             + VAH+ ++   +E PVTG+ ADVI AA+  AE A+RLV+PG +NS VTEA  K+A ++ 
Sbjct  118   SNVAHSFVVGATKEAPVTGKKADVINAAHMCAEAALRLVKPGNQNSKVTEAWNKIAQSFK  177

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ +IDG K ++     + R D  +AEFE +EVY++D++ STGEGK +
Sbjct  178   CTAIEGMLSHQLKQHIIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLISTGEGKAR  237

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  238   DGGQR-TTIYKRDPSKQYGLKMKTSRMFFSEVERRFDAMPFTLRAFEDEAKARLGVVECA  296

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ  1247
              H+LLQP+ VL+EK G+ VA  KFTVLLM NG  RIT+ P +
Sbjct  297   KHELLQPFSVLNEKEGEFVAQFKFTVLLMANGPHRITSGPFE  338



>gb|ACI33868.1| Proliferation-associated protein 2G4 [Salmo salar]
Length=393

 Score =   328 bits (841),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 176/342 (51%), Positives = 241/342 (70%), Gaps = 11/342 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD   EE+E  ++   VVTKYK   +I N+AL +V+   K    V+ +CEKGDA I  +
Sbjct  1     MSD--NEEQEQTIAEDLVVTKYKMGGDIANQALRVVIEASKSGVSVLSLCEKGDAHIMAE  58

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG +++  +K +++G+AFPT +SVNN VCHFSPL +D D  L++GD+VKID+G H+DGFI
Sbjct  59    TGKVFRK-EKDLKKGIAFPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFI  117

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   +E PVTG+ ADVI AA+  AE A+RLV+PG +NS VTEA  K+A ++ 
Sbjct  118   ANVAHSFVVGATKEAPVTGKKADVIKAAHLCAEAALRLVKPGNQNSKVTEAWNKIAQSFK  177

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + R D  +AEFE +EVY++D++ STGEGK +
Sbjct  178   CTAIEGMLSHQLKQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLISTGEGKAR  237

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  238   DGGQR-TTIYKRDPSKQYGLKMKTSRMFFSEVERRFDAMPFTLRAFEDEAKARLGVVECA  296

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ  1247
              H+LLQP+ VL+EK G+ VA  KFTVLLM NG  +IT+ P +
Sbjct  297   KHELLQPFSVLNEKDGEFVAQFKFTVLLMANGPHKITSGPFE  338



>ref|XP_004558839.1| PREDICTED: proliferation-associated protein 2G4-like [Maylandia 
zebra]
 ref|XP_005732632.1| PREDICTED: proliferation-associated protein 2G4-like [Pundamilia 
nyererei]
 ref|XP_005914803.1| PREDICTED: proliferation-associated protein 2G4-like [Haplochromis 
burtoni]
 ref|XP_006785707.1| PREDICTED: proliferation-associated protein 2G4-like [Neolamprologus 
brichardi]
Length=392

 Score =   328 bits (841),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 180/356 (51%), Positives = 254/356 (71%), Gaps = 13/356 (4%)
 Frame = +3

Query  261   EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
             E +E  ++   VVTKYK  AEI N+AL+ VV   K    V+ +CEKGDAFI  +TG ++K
Sbjct  6     ETQEQTIADDLVVTKYKMGAEIANQALKAVVEAAKTGVSVLSLCEKGDAFIVAETGKIFK  65

Query  441   NVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVAHT  617
               +K++++G+AFPTC+SVNN VCHFSPL +D + +L++GD+VKID+G H+DGFI+ VAH+
Sbjct  66    R-EKEMKKGIAFPTCVSVNNCVCHFSPLKSDPEVILKDGDLVKIDLGVHVDGFISNVAHS  124

Query  618   HLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
              ++   ++ P+TGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ C  +EG
Sbjct  125   FIVGVTKDNPLTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAKSFKCSPIEG  184

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             +LSHQ+KQ VIDG K ++   + + + D  +AEFE +EVY++D++ STGEGK K   ++ 
Sbjct  185   MLSHQLKQHVIDGEKTIIQNPSDQQKKDHEKAEFEVHEVYAVDVLVSTGEGKAKDGGQR-  243

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQ  1139
             TT+YKR  +K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC  H+L+Q
Sbjct  244   TTVYKRDPNKVYGLKMKTSRTFFSEMERRFDTMPFTLRAFEDEAKARLGVVECAKHELVQ  303

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKAWL  1298
             P+ VL EK G+ VA  KFTVLLM NG  RIT + L +  + K    ++DPE+KA L
Sbjct  304   PFTVLQEKEGEFVAQFKFTVLLMANGPLRIT-NSLFEPELYKSEHEVEDPELKALL  358



>ref|NP_001004206.1| proliferation-associated protein 2G4 [Rattus norvegicus]
 sp|Q6AYD3.1|PA2G4_RAT RecName: Full=Proliferation-associated protein 2G4 [Rattus norvegicus]
 gb|AAH79095.1| Proliferation-associated 2G4 [Rattus norvegicus]
 gb|EDL84836.1| proliferation-associated 2G4, isoform CRA_a [Rattus norvegicus]
Length=394

 Score =   328 bits (840),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVIGVAQGSQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>gb|AAH03777.1| Pa2g4 protein, partial [Mus musculus]
 gb|AAH05593.1| Pa2g4 protein, partial [Mus musculus]
 gb|AAH28926.1| Pa2g4 protein, partial [Mus musculus]
 gb|AAH37623.1| Pa2g4 protein, partial [Mus musculus]
Length=372

 Score =   327 bits (838),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 186/361 (52%), Positives = 254/361 (70%), Gaps = 12/361 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MS E+ E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+
Sbjct  1     MSGED-EQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEE  59

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFI
Sbjct  60    TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFI  118

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAHT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++
Sbjct  119   ANVAHTFVIGVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN  178

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K
Sbjct  179   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAK  238

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC 
Sbjct  239   DAGQR-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECA  297

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA 
Sbjct  298   KHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKAL  357

Query  1296  L  1298
             L
Sbjct  358   L  358



>ref|XP_007559711.1| PREDICTED: proliferation-associated protein 2G4 [Poecilia formosa]
Length=391

 Score =   328 bits (840),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 184/361 (51%), Positives = 251/361 (70%), Gaps = 14/361 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSDEE+E+    ++   VVTKYK   +I  +AL  VV   K    V+ +CE GDA+I  +
Sbjct  1     MSDEEQEQT---IAEDLVVTKYKMGGDIATQALRKVVEAAKAGISVLSLCEVGDAYIMTE  57

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT +SVNN VCHFSPL +D D  L++GD+VKID+G H+DGFI
Sbjct  58    TGKVFKK-EKEMKKGIAFPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFI  116

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   +E P+TGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ 
Sbjct  117   ANVAHSFIVGASKENPITGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAHSFK  176

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + R D  +AEFE +EVY++D++ STGEGK +
Sbjct  177   CSPIEGMLSHQLKQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLVSTGEGKAR  236

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                  +TTIYKR  +K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  237   D-SGLRTTIYKRDPNKQYGLKMKTSRTFFSEVERRFDAMPFTLRAFEDEAKARLGVVECA  295

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRIT-AHPLQDLNVTK-PIDDPEIKAW  1295
              H+LLQP+ VLHEK G+ VA  KFTVLLM NG  RIT  H   +L  ++  + DPE+KA 
Sbjct  296   KHELLQPFSVLHEKEGEFVAQFKFTVLLMANGPHRITNGHFDPELYKSEHEVQDPELKAL  355

Query  1296  L  1298
             L
Sbjct  356   L  356



>ref|XP_007953297.1| PREDICTED: proliferation-associated protein 2G4 [Orycteropus 
afer afer]
Length=394

 Score =   327 bits (839),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 186/357 (52%), Positives = 253/357 (71%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLLQ--EG-PVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   EG PVTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVDVAEGIPVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDVELKALL  358



>ref|XP_008846918.1| PREDICTED: proliferation-associated protein 2G4 [Nannospalax 
galili]
Length=394

 Score =   327 bits (839),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVIGVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSELEVQDAELKALL  358



>ref|NP_035249.1| proliferation-associated protein 2G4 [Mus musculus]
 sp|P50580.3|PA2G4_MOUSE RecName: Full=Proliferation-associated protein 2G4; AltName: 
Full=IRES-specific cellular trans-acting factor 45 kDa; Short=ITAF45; 
AltName: Full=Mpp1; AltName: Full=Proliferation-associated 
protein 1; AltName: Full=Protein p38-2G4 [Mus musculus]
 gb|AAB60513.1| proliferation-associated protein 1 [Mus musculus]
 gb|AAH46532.1| Proliferation-associated 2G4 [Mus musculus]
 dbj|BAE39129.1| unnamed protein product [Mus musculus]
 dbj|BAE40451.1| unnamed protein product [Mus musculus]
 gb|EDL24585.1| proliferation-associated 2G4 [Mus musculus]
Length=394

 Score =   327 bits (839),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 186/361 (52%), Positives = 254/361 (70%), Gaps = 12/361 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MS E+ E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+
Sbjct  1     MSGED-EQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEE  59

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFI
Sbjct  60    TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFI  118

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAHT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++
Sbjct  119   ANVAHTFVIGVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN  178

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K
Sbjct  179   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAK  238

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC 
Sbjct  239   DAGQR-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECA  297

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA 
Sbjct  298   KHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKAL  357

Query  1296  L  1298
             L
Sbjct  358   L  358



>dbj|BAF84485.1| unnamed protein product [Homo sapiens]
Length=367

 Score =   327 bits (837),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_004379999.1| PREDICTED: proliferation-associated protein 2G4 [Trichechus manatus 
latirostris]
Length=394

 Score =   327 bits (839),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 185/357 (52%), Positives = 253/357 (71%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKQGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLLQ--EG-PVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   EG PVTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVDVAEGTPVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_002752647.1| PREDICTED: proliferation-associated protein 2G4 [Callithrix jacchus]
Length=390

 Score =   327 bits (839),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_006859475.1| PREDICTED: proliferation-associated protein 2G4 [Chrysochloris 
asiatica]
Length=394

 Score =   327 bits (839),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 185/357 (52%), Positives = 253/357 (71%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLLQ--EG-PVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   EG PVTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVIDVAEGTPVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDL-EEKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R   +EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFKDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFKPDLYKSEMEVQDAELKALL  358



>dbj|BAE25986.1| unnamed protein product [Mus musculus]
Length=394

 Score =   327 bits (839),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 186/361 (52%), Positives = 254/361 (70%), Gaps = 12/361 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MS E+ E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+
Sbjct  1     MSGED-EQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEE  59

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFI
Sbjct  60    TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFI  118

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAHT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++
Sbjct  119   ANVAHTFVIGVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN  178

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K
Sbjct  179   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAK  238

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC 
Sbjct  239   DAGQR-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECA  297

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA 
Sbjct  298   KHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKAL  357

Query  1296  L  1298
             L
Sbjct  358   L  358



>ref|XP_002711114.1| PREDICTED: proliferation-associated protein 2G4 [Oryctolagus 
cuniculus]
Length=394

 Score =   327 bits (839),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVGVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSELEVQDAELKALL  358



>gb|AAH32111.1| PA2G4 protein, partial [Homo sapiens]
 gb|AAH72007.1| PA2G4 protein, partial [Homo sapiens]
Length=373

 Score =   327 bits (837),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_008408124.1| PREDICTED: proliferation-associated protein 2G4 [Poecilia reticulata]
Length=391

 Score =   327 bits (838),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 185/361 (51%), Positives = 251/361 (70%), Gaps = 14/361 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSDEE+E+    ++   VVTKYK   +I ++AL  VV   K    V+ +CE GDA+I  +
Sbjct  1     MSDEEQEQT---IAEDLVVTKYKMGGDIASQALRKVVEAAKVGISVLSLCEVGDAYIMTE  57

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D  L++GD+VKID+G H+DGFI
Sbjct  58    TGKVFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFI  116

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   +E P+TGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ 
Sbjct  117   ANVAHSFVVGASKENPITGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAHSFK  176

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + R D  +AEFE +EVY++D++ STGEGK +
Sbjct  177   CSPIEGMLSHQLKQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLVSTGEGKAR  236

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                 + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  237   DSGLR-TTIYKRDPSKQYGLKMKTSRTFFSEVERRFDAMPFTLRAFEDEAKARLGVVECA  295

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRIT-AHPLQDLNVTK-PIDDPEIKAW  1295
              H+LLQP+ VLHEK G+ VA  KFTVLLM NG  RIT  H   +L  ++  + DPE+KA 
Sbjct  296   KHELLQPFSVLHEKEGEFVAQFKFTVLLMANGPHRITNGHFDPELYKSEHEVQDPELKAL  355

Query  1296  L  1298
             L
Sbjct  356   L  356



>ref|XP_003506238.1| PREDICTED: proliferation-associated protein 2G4 [Cricetulus griseus]
 ref|XP_007633754.1| PREDICTED: proliferation-associated protein 2G4 [Cricetulus griseus]
 gb|EGW12518.1| Proliferation-associated protein 2G4 [Cricetulus griseus]
 gb|ERE91717.1| proliferation-associated protein 2G4-like protein [Cricetulus 
griseus]
Length=394

 Score =   327 bits (838),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 185/357 (52%), Positives = 250/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++GVAFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGVAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVIGVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  +   + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSDMEVQDAELKALL  358



>ref|NP_001271715.1| uncharacterized protein LOC101867185 [Macaca fascicularis]
 ref|XP_004650027.1| PREDICTED: proliferation-associated protein 2G4 [Jaculus jaculus]
 ref|XP_010376117.1| PREDICTED: proliferation-associated protein 2G4 [Rhinopithecus 
roxellana]
 ref|XP_011918884.1| PREDICTED: proliferation-associated protein 2G4 [Cercocebus atys]
 ref|XP_011825402.1| PREDICTED: proliferation-associated protein 2G4 [Mandrillus leucophaeus]
 ref|XP_011781528.1| PREDICTED: proliferation-associated protein 2G4 [Colobus angolensis 
palliatus]
 ref|XP_011726929.1| PREDICTED: proliferation-associated protein 2G4 [Macaca nemestrina]
 dbj|BAE91123.1| unnamed protein product [Macaca fascicularis]
Length=394

 Score =   327 bits (838),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVGVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_008411912.1| PREDICTED: proliferation-associated protein 2G4-like [Poecilia 
reticulata]
Length=392

 Score =   327 bits (838),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 180/361 (50%), Positives = 248/361 (69%), Gaps = 12/361 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MS +E E  E  ++   VVTKYK  AEI N+AL+ +     P   V+ +C+KGD FI  +
Sbjct  1     MSGDE-ETPEQTIAEDLVVTKYKMGAEIANQALKTLAEAAAPGVSVLSLCQKGDEFIAAE  59

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K +++G+AFPTC+SVNN VCHFSPL +D D  L++GD+VKID+G H+DGFI
Sbjct  60    TGKIFKR-EKDMKKGIAFPTCVSVNNCVCHFSPLKSDPDVTLKDGDLVKIDLGVHVDGFI  118

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             + VAH+ ++   +E PVTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ 
Sbjct  119   SNVAHSFVVGATKENPVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAKSFK  178

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  VEG+LSHQ+KQ +IDG K ++     + + D  +AEFE +EVY++D++ STGEGK K
Sbjct  179   CSAVEGMLSHQLKQHLIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISTGEGKAK  238

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TT+YKR  +K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  239   DGGQR-TTVYKRDPNKVYGLKMKTSRTFFSEMERRFDTMPFTLRAFEDEAKARLGVVECA  297

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQD--LNVTKPIDDPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLM NG  RIT+   +         + DPE+K  
Sbjct  298   KHELLQPFAVLYEKEGECVAQFKFTVLLMANGPLRITSSLFESELYQSEHDVQDPELKVL  357

Query  1296  L  1298
             L
Sbjct  358   L  358



>ref|XP_005397344.1| PREDICTED: proliferation-associated protein 2G4 [Chinchilla lanigera]
Length=394

 Score =   327 bits (838),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 186/361 (52%), Positives = 254/361 (70%), Gaps = 12/361 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MS E+ E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+
Sbjct  1     MSGED-EQQEQTIAEDLVVTKYKMGGDIANRVLRALVEASSSGVSVLSLCEKGDAMIMEE  59

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFI
Sbjct  60    TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFI  118

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAHT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++
Sbjct  119   ANVAHTFVIGVPQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN  178

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K
Sbjct  179   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAK  238

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC 
Sbjct  239   DAGQR-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECA  297

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA 
Sbjct  298   KHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFKPDLYKSEMEVQDAELKAL  357

Query  1296  L  1298
             L
Sbjct  358   L  358



>ref|XP_007556640.1| PREDICTED: proliferation-associated protein 2G4-like [Poecilia 
formosa]
Length=392

 Score =   327 bits (837),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 180/361 (50%), Positives = 249/361 (69%), Gaps = 12/361 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MS +E E  E  ++   VVTKYK  AEI N+AL+ V     P   V+ +C+KGD FI  +
Sbjct  1     MSGDE-ETPEQTIAEDLVVTKYKMGAEIANQALKTVAEAAAPGVSVLSLCQKGDEFIAAE  59

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K +++G+AFPTC+SVNN VCHFSPL +D D  L++GD+VKID+G H+DGFI
Sbjct  60    TGKIFKR-EKDMKKGIAFPTCVSVNNCVCHFSPLKSDPDVTLKDGDLVKIDLGVHVDGFI  118

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             + VAH+ ++   ++ PVTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ 
Sbjct  119   SNVAHSFVVGATKDKPVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAKSFK  178

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  VEG+LSHQ+KQ +IDG K ++     + + D  +AEFE +EVY++D++ STGEGK K
Sbjct  179   CSAVEGMLSHQLKQHLIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISTGEGKAK  238

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TT+YKR  +K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  239   DGGQR-TTVYKRDPNKVYGLKMKTSRTFFSEMERRFDTMPFTLRAFEDEAKARLGVVECA  297

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQD--LNVTKPIDDPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLM NG  RIT+   +         ++DPE+K  
Sbjct  298   KHELLQPFAVLYEKEGEFVAQFKFTVLLMANGPLRITSSLFEPELYQSEHDVEDPELKVL  357

Query  1296  L  1298
             L
Sbjct  358   L  358



>ref|XP_004274221.1| PREDICTED: proliferation-associated protein 2G4 [Orcinus orca]
 ref|XP_004312046.1| PREDICTED: proliferation-associated protein 2G4 [Tursiops truncatus]
 ref|XP_007129410.1| PREDICTED: proliferation-associated protein 2G4 [Physeter catodon]
 ref|XP_007179621.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007179622.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007467801.1| PREDICTED: proliferation-associated protein 2G4 [Lipotes vexillifer]
Length=394

 Score =   327 bits (838),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 182/357 (51%), Positives = 249/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASCSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLLQEG---PVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++       VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVDVALGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  + EFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKVEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_010348255.1| PREDICTED: proliferation-associated protein 2G4 [Saimiri boliviensis 
boliviensis]
Length=394

 Score =   327 bits (838),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSELEVQDAELKALL  358



>ref|XP_003476243.1| PREDICTED: proliferation-associated protein 2G4 [Cavia porcellus]
Length=394

 Score =   327 bits (837),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 186/361 (52%), Positives = 254/361 (70%), Gaps = 12/361 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MS E+ E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+
Sbjct  1     MSGED-EQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEE  59

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFI
Sbjct  60    TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFI  118

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAHT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++
Sbjct  119   ANVAHTFIIGVPQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN  178

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K
Sbjct  179   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAK  238

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC 
Sbjct  239   DAGQR-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECA  297

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA 
Sbjct  298   KHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKAL  357

Query  1296  L  1298
             L
Sbjct  358   L  358



>ref|NP_006182.2| proliferation-associated protein 2G4 [Homo sapiens]
 ref|NP_001233412.1| proliferation-associated protein 2G4 [Pan troglodytes]
 ref|XP_008575383.1| PREDICTED: proliferation-associated protein 2G4 [Galeopterus 
variegatus]
 ref|XP_008976873.1| PREDICTED: proliferation-associated protein 2G4 [Pan paniscus]
 ref|XP_009246137.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Pongo 
abelii]
 sp|Q9UQ80.3|PA2G4_HUMAN RecName: Full=Proliferation-associated protein 2G4; AltName: 
Full=Cell cycle protein p38-2G4 homolog; Short=hG4-1; AltName: 
Full=ErbB3-binding protein 1 [Homo sapiens]
 pdb|3J2I|A Chain A, Structure Of Late Pre-60s Ribosomal Subunits With Nuclear 
Export Factor Arx1 Bound At The Peptide Exit Tunnel
 gb|AAD05561.1| cell cycle protein [Homo sapiens]
 gb|AAH01951.1| Proliferation-associated 2G4, 38kDa [Homo sapiens]
 gb|AAH07561.1| Proliferation-associated 2G4, 38kDa [Homo sapiens]
 gb|AAH69786.1| Proliferation-associated 2G4, 38kDa [Homo sapiens]
 gb|EAW96884.1| proliferation-associated 2G4, 38kDa, isoform CRA_a [Homo sapiens]
 gb|EAW96885.1| proliferation-associated 2G4, 38kDa, isoform CRA_a [Homo sapiens]
 gb|ABM84372.1| proliferation-associated 2G4, 38kDa [synthetic construct]
 gb|ABM87750.1| proliferation-associated 2G4, 38kDa [synthetic construct]
 dbj|BAG73585.1| proliferation-associated 2G4, 38kDa [synthetic construct]
 dbj|BAK63634.1| proliferation-associated protein 2G4 [Pan troglodytes]
 gb|AIC49332.1| PA2G4, partial [synthetic construct]
Length=394

 Score =   327 bits (837),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>pdb|2Q8K|A Chain A, The Crystal Structure Of Ebp1
Length=401

 Score =   327 bits (838),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  11    EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  70

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  71    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  129

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  130   HTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  189

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  190   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  249

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  250   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  308

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  309   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  365



>ref|XP_004589712.1| PREDICTED: proliferation-associated protein 2G4 [Ochotona princeps]
Length=394

 Score =   327 bits (837),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 185/357 (52%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D VL+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYVLKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVDVAQGTHVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSELEVQDAELKALL  358



>ref|XP_003973252.1| PREDICTED: proliferation-associated protein 2G4 [Takifugu rubripes]
Length=391

 Score =   326 bits (836),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 184/362 (51%), Positives = 249/362 (69%), Gaps = 16/362 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+E E+    ++   VVTKYK   +I N+AL LVV      A V+ +CEKGDA+I  +
Sbjct  1     MSDDEHEQT---IAEDIVVTKYKMGGDIANQALRLVVESASSGASVLGLCEKGDAYIMAE  57

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT +SVNN VCHFSPL +D D  L++GD+VKID+G HIDGFI
Sbjct  58    TGKVFKK-EKEMKKGIAFPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHIDGFI  116

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   +E  +TGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ 
Sbjct  117   ANVAHSFVVGASKENLITGRKADVIKAAHLCAEAALRLVKPGNQNAQVTEAWNKIAQSFK  176

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + R D  +AEFE +EVY++D++ STGEGK +
Sbjct  177   CSAIEGMLSHQLKQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLISTGEGKAR  236

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                  +TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  237   D-GGLRTTIYKRDPSKQYGLKMKTSRMFFSEVERRFDAMPFTLRAFEDESKARLGVVECA  295

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKA  1292
               +LLQP+ VL EK G+ VA  KFTVLLM NG  RIT + L D ++ K    + DPE+K 
Sbjct  296   KRELLQPFSVLQEKEGEFVAQFKFTVLLMANGPHRIT-NGLFDPDLYKSTYEVQDPELKT  354

Query  1293  WL  1298
              L
Sbjct  355   LL  356



>emb|CDQ89185.1| unnamed protein product [Oncorhynchus mykiss]
Length=393

 Score =   327 bits (837),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 174/342 (51%), Positives = 242/342 (71%), Gaps = 11/342 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD   EE+E  ++   VVTKYK   +I N+AL +V+ + K    V+ +CEKGDA I  +
Sbjct  1     MSD--NEEQEQTIAEDLVVTKYKMGGDIANQALRMVIEEAKSGVSVLSLCEKGDAHIMAE  58

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG +++  +K +++G+AFPT +SVNN VCHFSPL +D D  L++GD+VKID+G H+DGFI
Sbjct  59    TGKVFRK-EKDLKKGIAFPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFI  117

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             + VAH+ ++   +E PVTG+ ADVI AA+  AE A+RLV+PG +NS VTEA  K+A ++ 
Sbjct  118   SNVAHSFVVGATKEAPVTGKKADVIKAAHLCAEAALRLVKPGNQNSKVTEAWNKIAQSFK  177

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + R D  +AEFE +EVY++D++ STGEGK +
Sbjct  178   CTAIEGMLSHQLKQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLISTGEGKAR  237

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +S++ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  238   DGGQR-TTIYKRDPSKQYGLKMKTSRMFFSDVERRFDTMPFTLRAFEDEAKARLGVVECA  296

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ  1247
              H+LLQP+ VL+EK G+ VA  KFTVLLM NG  +IT+ P +
Sbjct  297   KHELLQPFSVLNEKEGEFVAQFKFTVLLMANGPHKITSGPFE  338



>ref|XP_004700624.1| PREDICTED: proliferation-associated protein 2G4 [Echinops telfairi]
Length=394

 Score =   327 bits (837),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTMAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLLQEG---PVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++      PVTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVDIAGGTPVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + D+  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDIYKSEMEVQDAELKALL  358



>ref|XP_010643016.1| PREDICTED: proliferation-associated protein 2G4 [Fukomys damarensis]
Length=394

 Score =   327 bits (837),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 186/361 (52%), Positives = 254/361 (70%), Gaps = 12/361 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MS E+ E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+
Sbjct  1     MSGED-EQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEE  59

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFI
Sbjct  60    TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFI  118

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAHT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++
Sbjct  119   ANVAHTFVIGVPQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN  178

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K
Sbjct  179   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAK  238

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC 
Sbjct  239   DAGQR-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECA  297

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA 
Sbjct  298   KHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKAL  357

Query  1296  L  1298
             L
Sbjct  358   L  358



>ref|XP_009179195.1| PREDICTED: proliferation-associated protein 2G4 [Papio anubis]
Length=384

 Score =   326 bits (836),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 186/361 (52%), Positives = 254/361 (70%), Gaps = 12/361 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MS E+ E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+
Sbjct  1     MSGED-EQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEE  59

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFI
Sbjct  60    TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFI  118

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAHT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++
Sbjct  119   ANVAHTFVVGVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN  178

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K
Sbjct  179   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAK  238

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC 
Sbjct  239   DAGQR-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECA  297

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA 
Sbjct  298   KHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKAL  357

Query  1296  L  1298
             L
Sbjct  358   L  358



>ref|XP_010879916.1| PREDICTED: proliferation-associated protein 2G4-like [Esox lucius]
Length=393

 Score =   326 bits (836),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 174/342 (51%), Positives = 241/342 (70%), Gaps = 11/342 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD   EE+E  ++   VVTKYK   +I N+AL +V+   K    V+ +CEKGDA+I  +
Sbjct  1     MSD--NEEQEQTIAEDLVVTKYKMGGDIANQALCVVIEAAKSGMSVLSLCEKGDAYIMAE  58

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG +++  +K++++G+AFPT +SVNN VCHFSPL +D D +L++GD+VKID+G H+DGFI
Sbjct  59    TGKVFRK-EKELKKGIAFPTSVSVNNCVCHFSPLKSDPDYILKDGDLVKIDLGVHVDGFI  117

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             + VAH+ ++   +E PVTGR ADVI AA+  AE A+RLV+PG +NS VTEA   +A ++ 
Sbjct  118   SNVAHSFIVGATKEAPVTGRKADVIMAAHLCAEAALRLVKPGNQNSQVTEAWNNIAKSFK  177

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ +IDG K ++     + R D  +AEFE +EVY++D++ STGEGK +
Sbjct  178   CTAIEGMLSHQLKQHIIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLISTGEGKAR  237

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPF  R  E E +ARLG+VEC 
Sbjct  238   DGGQR-TTIYKRDPSKQYGLKMKTSRMFFSEVERRFDAMPFNLRAFEDEAKARLGVVECA  296

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ  1247
              H+LLQP+ VL+EK G+ VA  KFTVLLM NG  RIT  P +
Sbjct  297   KHELLQPFSVLNEKEGEFVAQFKFTVLLMANGPHRITCGPFE  338



>gb|ADT71645.1| proliferation associated 2G4 [Mesocricetus auratus]
Length=388

 Score =   326 bits (835),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 183/355 (52%), Positives = 250/355 (70%), Gaps = 11/355 (3%)
 Frame = +3

Query  261   EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
             E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG ++K
Sbjct  1     EQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFK  60

Query  441   NVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVAHT  617
               +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VAHT
Sbjct  61    K-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHT  119

Query  618   HLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
              ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +EG
Sbjct  120   FVIGVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPIEG  179

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             +LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   ++ 
Sbjct  180   MLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQR-  238

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQ  1139
             TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+LLQ
Sbjct  239   TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHELLQ  298

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             P+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  299   PFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  353



>gb|EHH20847.1| Cell cycle protein p38-2G4-like protein [Macaca mulatta]
Length=394

 Score =   326 bits (836),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 186/361 (52%), Positives = 254/361 (70%), Gaps = 12/361 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             M DE+ E++EL  +   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+
Sbjct  1     MQDED-EQQELTNAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEE  59

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFI
Sbjct  60    TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFI  118

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAHT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++
Sbjct  119   ANVAHTFVVGVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN  178

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K
Sbjct  179   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFELHEVYAVDVLVSSGEGKAK  238

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC 
Sbjct  239   DAGQR-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECA  297

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLMP+G  RIT+ P + DL  ++  + D E+KA 
Sbjct  298   KHELLQPFNVLYEKEGEFVAQFKFTVLLMPSGPMRITSGPFEPDLYKSEMEVQDAELKAL  357

Query  1296  L  1298
             L
Sbjct  358   L  358



>ref|XP_008317097.1| PREDICTED: proliferation-associated protein 2G4-like [Cynoglossus 
semilaevis]
Length=392

 Score =   326 bits (835),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 178/356 (50%), Positives = 253/356 (71%), Gaps = 13/356 (4%)
 Frame = +3

Query  261   EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
             + +E  ++   VVTKYK  AEI N+AL++VV   K    V+ +CEKGD+FI  +TG ++K
Sbjct  6     DSQEQTIADDLVVTKYKMGAEIANQALKVVVEAAKSGVSVLSLCEKGDSFIMTETGKIFK  65

Query  441   NVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVAHT  617
               +K++++G+AFPTC+SVNN VCHFSPL +D D +L++GD+VKID+G H+DGFI+ VAH+
Sbjct  66    K-EKEMKKGIAFPTCVSVNNCVCHFSPLKSDADIILKDGDLVKIDLGVHVDGFISNVAHS  124

Query  618   HLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
              ++   +E P+TGR ADVI AA+  AE A+RLV+PG +N+ VT+   K+A ++ C  +EG
Sbjct  125   FVVGVTKENPLTGRKADVIKAAHLCAEAAIRLVKPGNQNTQVTDVWNKIAKSFKCSPIEG  184

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             +LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK +   ++ 
Sbjct  185   MLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISSGEGKARDGGQR-  243

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQ  1139
             TT+YKR  +K Y LKMK SR   SE+ ++F  MPFT R  E E +ARLGLVEC  H+LLQ
Sbjct  244   TTVYKRDPNKVYGLKMKTSRTFLSEVDRRFNTMPFTLRAFEDEGKARLGLVECAKHELLQ  303

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKAWL  1298
             P+ VLHEK G+ VA  KFTV+LM NG  RIT + L +  + K    ++DPE+KA L
Sbjct  304   PFNVLHEKEGEFVAQFKFTVMLMANGPLRIT-NSLFEPELYKSELEVEDPELKALL  358



>gb|AAB91536.1| cell cycle protein p38-2G4 homolog [Homo sapiens]
Length=394

 Score =   326 bits (835),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>gb|AFM86347.1| proliferation-associated 2G4, partial [Callorhinchus milii]
Length=365

 Score =   325 bits (832),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 181/361 (50%), Positives = 252/361 (70%), Gaps = 13/361 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSDEE +E+   ++   VVTKYK   +I N+ L  VV   K    V  +CEKGDA I E+
Sbjct  1     MSDEESQEQ--TIAEDLVVTKYKMGGDIANRVLRTVVEAAKEGESVFSLCEKGDAMIMEE  58

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPTC+SVNN VCH+SPL +D D +L++ D+VK+D+G H+DGFI
Sbjct  59    TGKIFKK-EKEMKKGIAFPTCVSVNNCVCHYSPLKSDPDYILKDEDLVKVDLGVHVDGFI  117

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   ++ P+TGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ 
Sbjct  118   ANVAHSFIVGIKKDKPLTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFK  177

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY+ID++ STGEGK K
Sbjct  178   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAIDVLISTGEGKAK  237

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TT+YKR     Y LKMK SR  +SE+ ++F  MP+T R  E EK+AR+G+VEC 
Sbjct  238   DAGQR-TTVYKRDPTIQYGLKMKTSRAFFSEVERRFDAMPYTLRAFEDEKKARMGVVECA  296

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAW  1295
              H LLQP+ VL+EK G+ VA  KFTVLLMPNG  RIT  P + +L  T+  + D E+KA 
Sbjct  297   KHKLLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITNGPFEPELYKTECVVQDVELKAL  356

Query  1296  L  1298
             L
Sbjct  357   L  357



>gb|ACI33074.1| Proliferation-associated protein 2G4 [Salmo salar]
Length=398

 Score =   326 bits (835),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 180/355 (51%), Positives = 248/355 (70%), Gaps = 11/355 (3%)
 Frame = +3

Query  261   EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
             E +E  ++   VVTKYK  AEI N+AL+ VV   K    VV +CE GDAFI  +TG +++
Sbjct  6     EPQEQTIADDLVVTKYKMGAEIANQALKAVVESAKAGVTVVSLCETGDAFIMAETGKVFR  65

Query  441   NVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVAHT  617
               +K +++G+AFPT +SVNN VCHFSPL +D +  L++GD++KID+G H+DGFI+ +AH+
Sbjct  66    K-EKDLKKGIAFPTSVSVNNCVCHFSPLKSDPEITLKDGDLIKIDLGVHVDGFISNLAHS  124

Query  618   HLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
              ++   ++ P+TGR ADVI AA+  AE A+RLV+PG +NS VTEA  K+A ++ C  +EG
Sbjct  125   FVVGVTKDAPLTGRKADVIKAAHLCAEAALRLVKPGNQNSQVTEAWNKIAKSFKCSAIEG  184

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             +LSHQ+KQ VIDG K ++       R D  +AEFE +EVY++D++ STGEGK K   ++ 
Sbjct  185   MLSHQLKQHVIDGEKTIIQNPTDLQRKDHEKAEFEVHEVYAVDVLISTGEGKAKDAGQR-  243

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQ  1139
             TTIYKR  DK Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC  H+LLQ
Sbjct  244   TTIYKRDPDKQYGLKMKTSRSFFSEVERRFDAMPFTLRAFEDEGKARLGVVECAKHELLQ  303

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPL-QDLNVTK-PIDDPEIKAWL  1298
             P+ VLHEK G+ VA  KFTVLLM NG  RIT     Q+L  ++  ++D ++KA L
Sbjct  304   PFNVLHEKEGEFVAQFKFTVLLMANGPLRITTGLYEQELYQSEHQVEDADLKALL  358



>ref|XP_001422365.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00682.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=379

 Score =   325 bits (833),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 170/350 (49%), Positives = 236/350 (67%), Gaps = 3/350 (1%)
 Frame = +3

Query  261   EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
             +E E    +P+VVTKYK AA+  N A++ V +     A+VVD+C  GDA I  +T   Y 
Sbjct  17    DESEFTCENPDVVTKYKIAADCANAAMKEVRAAIAVGAKVVDLCALGDAAIERETAKYYN  76

Query  441   NVKK---KIERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVVA  611
                K   K+E+G+AFPTC+S++N VCH SP ++D   +E+G  VKID+G H+DG++A  A
Sbjct  77    KKDKDGNKVEKGIAFPTCVSIDNCVCHNSPDASDAKTIEDGASVKIDLGAHVDGYVATTA  136

Query  612   HTHLLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEGV  791
              T ++   PVTG  ADV+ AA  A+E+ +R +RPG    ++   I+ VA  +   +VEGV
Sbjct  137   TTVVVGGKPVTGAQADVMKAAELASEIVIRKLRPGASTGEIGGVIEGVAKDFGVNVVEGV  196

Query  792   LSHQMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTI  971
             ++H MK+F+IDGNKV+L+ S PE + D  E E  EVY++DIV S+GEGKPK  DE++T +
Sbjct  197   MTHNMKRFIIDGNKVILNKSTPEMKADPEEIELYEVYALDIVMSSGEGKPKQRDERETKV  256

Query  972   YKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEKRARLGLVECVNHDLLQPYPV  1151
             YKRA++KNY LKM+ SR ++SEIS++FP MPFTAR LEEKR   GLVEC NH LL  YPV
Sbjct  257   YKRAIEKNYQLKMQGSRAVFSEISKRFPTMPFTARALEEKRVNFGLVECCNHGLLHAYPV  316

Query  1152  LHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKPIDDPEIKAWLA  1301
             L+EK G  VAH+K T L++  G+DRIT    Q++   K + D  +   +A
Sbjct  317   LYEKDGAAVAHVKSTFLVLKKGNDRITTFEPQEVQSDKSLSDNALVELIA  366



>ref|XP_004093117.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4 [Nomascus leucogenys]
Length=394

 Score =   325 bits (834),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  +VA +++C  +
Sbjct  123   HTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWXQVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_004601656.1| PREDICTED: proliferation-associated protein 2G4 [Sorex araneus]
Length=394

 Score =   325 bits (834),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 184/357 (52%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTH---LLQEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT    ++Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVGIVQGTHVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDVELKALL  358



>ref|XP_006165654.1| PREDICTED: proliferation-associated protein 2G4 [Tupaia chinensis]
 gb|ELV12037.1| Proliferation-associated protein 2G4 [Tupaia chinensis]
Length=394

 Score =   325 bits (834),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VT+A  KVA +++C  +
Sbjct  123   HTFVVDVAQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTDAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|XP_004692692.1| PREDICTED: proliferation-associated protein 2G4 [Condylura cristata]
Length=394

 Score =   325 bits (833),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 183/357 (51%), Positives = 251/357 (70%), Gaps = 11/357 (3%)
 Frame = +3

Query  255   EREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNM  434
             E E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGD+ I E+TG +
Sbjct  4     EDEQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDSMIMEETGKI  63

Query  435   YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVA  611
             +K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFIA VA
Sbjct  64    FKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVA  122

Query  612   HTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIV  782
             HT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++C  +
Sbjct  123   HTFVVDVVQGTQVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNCTPI  182

Query  783   EGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDE  956
             EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K   +
Sbjct  183   EGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAKDAGQ  242

Query  957   KQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDL  1133
             + TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E EK+AR+G+VEC  H+L
Sbjct  243   R-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFEDEKKARMGVVECAKHEL  301

Query  1134  LQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAWL  1298
             LQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + DL  ++  + D E+KA L
Sbjct  302   LQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPDLYKSEMEVQDAELKALL  358



>ref|NP_001279838.1| proliferation-associated 2G4, 38kDa [Callorhinchus milii]
 gb|AFK10918.1| proliferation-associated protein 2G4 [Callorhinchus milii]
Length=393

 Score =   325 bits (833),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 181/361 (50%), Positives = 252/361 (70%), Gaps = 13/361 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSDEE +E+   ++   VVTKYK   +I N+ L  VV   K    V  +CEKGDA I E+
Sbjct  1     MSDEESQEQ--TIAEDLVVTKYKMGGDIANRVLRTVVEAAKEGESVFSLCEKGDAMIMEE  58

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPTC+SVNN VCH+SPL +D D +L++ D+VK+D+G H+DGFI
Sbjct  59    TGKIFKK-EKEMKKGIAFPTCVSVNNCVCHYSPLKSDPDYILKDEDLVKVDLGVHVDGFI  117

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   ++ P+TGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ 
Sbjct  118   ANVAHSFIVGIKKDKPLTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFK  177

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY+ID++ STGEGK K
Sbjct  178   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAIDVLISTGEGKAK  237

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TT+YKR     Y LKMK SR  +SE+ ++F  MP+T R  E EK+AR+G+VEC 
Sbjct  238   DAGQR-TTVYKRDPTIQYGLKMKTSRAFFSEVERRFDAMPYTLRAFEDEKKARMGVVECA  296

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTKP-IDDPEIKAW  1295
              H LLQP+ VL+EK G+ VA  KFTVLLMPNG  RIT  P + +L  T+  + D E+KA 
Sbjct  297   KHKLLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITNGPFEPELYKTEYVVQDVELKAL  356

Query  1296  L  1298
             L
Sbjct  357   L  357



>ref|XP_002423336.1| Proliferation-associated protein 2G4, putative [Pediculus humanus 
corporis]
 gb|EEB10598.1| Proliferation-associated protein 2G4, putative [Pediculus humanus 
corporis]
Length=389

 Score =   324 bits (831),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 177/359 (49%), Positives = 259/359 (72%), Gaps = 16/359 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             M+D++ EEK   ++   VVTKYK A EI+N+ L+ V+ +C+PNA V  ICE GD+ I E+
Sbjct  1     MADKDVEEK--TIAEDLVVTKYKLAGEIVNRVLKQVIDKCQPNASVRQICESGDSLILEE  58

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             T  ++K  +K++++G+AFPTCISVNN +CHFSP+ ND D +L++GD+VKID+G HIDGFI
Sbjct  59    TNKVFKK-EKELKKGIAFPTCISVNNCICHFSPIPNDPDVILQDGDLVKIDLGAHIDGFI  117

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             AVVAH+ +L    E  V G+ ADVI AA+ A++VA+RL++PG +   +T+A+QKV  ++ 
Sbjct  118   AVVAHSLILGASAENKVEGKKADVIVAAHYASQVALRLLKPGNETYMITDAVQKVCESFK  177

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             CK +EG+LSHQ+KQF IDG K ++   N   + +  + EF+ +EVY++D++ STGEG  +
Sbjct  178   CKPIEGMLSHQLKQFTIDGEKTIIQNPNEAQKKEHEKYEFQTHEVYAMDVLVSTGEGISR  237

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
              ++ + T+IYK+  D+ Y LK+KASR  +SE   K+  MPF  R  E E +AR+G+VEC+
Sbjct  238   EMNSR-TSIYKKT-DEVYQLKLKASRMFFSEAVNKYGTMPFNIRGFEDENKARMGVVECL  295

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIK  1289
             NH L++P+ VL+EK G+ VAH KFTVLLMPNG+  IT  P+ DL+  K    I DP+++
Sbjct  296   NHKLVEPFQVLYEKSGEYVAHFKFTVLLMPNGTHVITGLPI-DLSFYKTEYQITDPDLQ  353



>ref|XP_009839077.1| DNA-binding protein, 42 kDa [Aphanomyces astaci]
 gb|ETV71412.1| DNA-binding protein, 42 kDa [Aphanomyces astaci]
Length=391

 Score =   324 bits (831),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 171/329 (52%), Positives = 235/329 (71%), Gaps = 9/329 (3%)
 Frame = +3

Query  276   DLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKK  455
             D S+ +VVTKY+ AAEI   ALE V++Q  P   VV++   GDA I  + G +YK+  KK
Sbjct  19    DCSNTDVVTKYRLAAEIAQSALEGVIAQLLPGKTVVEVATFGDALIAARAGTVYKS--KK  76

Query  456   IERGVAFPTCISVNNTVCHFSPLSNDDTVLEEGDMVKIDMGCHIDGFIAVVAHTHLLQEG  635
             +E+G+AFPTC+SVN  VCHFSPL ++   L+ GD VKID+GCHIDG+IAVVAHT ++ + 
Sbjct  77    VEKGIAFPTCLSVNEVVCHFSPLPSESVTLKAGDWVKIDLGCHIDGYIAVVAHTVIVPDA  136

Query  636   P-----VTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEGVLSH  800
                   V G  ADV+ A + A E+  RL++PG  N+ VTEA++ +AAAY  K V G L H
Sbjct  137   EASDNIVLGAQADVLKAGHDAVELCARLIKPGNTNAQVTEALEALAAAYGVKAVSGTLMH  196

Query  801   QMKQFVIDGNKVVLSVSNPETRVDEAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKR  980
             Q+K+FVIDG+K + + ++PET+   A F+ NEVY+ID+  +TG  KP +  E++TT++KR
Sbjct  197   QLKRFVIDGSKTIAAKNDPETKAARATFDVNEVYAIDVAFTTGLEKP-VQSERRTTVFKR  255

Query  981   AVDKNYNLKMKASRFIYSEISQKFPLMPFTARDL-EEKRARLGLVECVNHDLLQPYPVLH  1157
              VDK+Y LKMKASR+++SEI+ KFP +PFT R   +E ++RLG+ ECV HDLL P+PVL 
Sbjct  256   QVDKSYRLKMKASRYVFSEINSKFPTLPFTIRAFDDESQSRLGVSECVKHDLLTPFPVLE  315

Query  1158  EKPGDLVAHIKFTVLLMPNGSDRITAHPL  1244
              + GD +AH K TVLL+PNG+ +IT  PL
Sbjct  316   GRSGDHIAHFKATVLLLPNGTTKITGLPL  344



>ref|XP_008066667.1| PREDICTED: proliferation-associated protein 2G4, partial [Tarsius 
syrichta]
Length=373

 Score =   323 bits (829),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 184/361 (51%), Positives = 254/361 (70%), Gaps = 12/361 (3%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MS E+ E++E  ++   VVTKYK   +I N+ L  +V        V+ +CEKGDA I E+
Sbjct  1     MSGED-EQQEQTIAEDLVVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEE  59

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPT ISVNN VCHFSPL +D D +L+EGD+VKID+G H+DGFI
Sbjct  60    TGKIFKK-EKEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFI  118

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAHT ++   Q   VTGR ADVI AA+  AE A+RLV+PG +N+ VTEA  KVA +++
Sbjct  119   ANVAHTFVVGVAQGTQVTGRRADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFN  178

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ S+GEGK K
Sbjct  179   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLVSSGEGKAK  238

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  + EK+AR+G+VEC 
Sbjct  239   DAGQR-TTIYKRDPSKQYGLKMKTSRAFFSEVERRFDAMPFTLRAFDDEKKARMGVVECA  297

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAW  1295
              H+LLQP+ VL+EK G+ VA  KFTVLLMPNG  RIT+ P + +L  ++  + D E+KA 
Sbjct  298   KHELLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITSGPFEPELYKSEMEVQDAELKAL  357

Query  1296  L  1298
             L
Sbjct  358   L  358



>emb|CDQ85755.1| unnamed protein product [Oncorhynchus mykiss]
Length=398

 Score =   324 bits (831),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 179/355 (50%), Positives = 248/355 (70%), Gaps = 11/355 (3%)
 Frame = +3

Query  261   EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
             E +E  ++   VVTKYK  AEI N+AL+ VV   +    VV +CE GDAFI  +TG +++
Sbjct  6     EPQEQTIADDLVVTKYKMGAEIANQALKAVVEAARAGVTVVSLCETGDAFIMAETGKVFR  65

Query  441   NVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVAHT  617
               +K +++G+AFPT +SVNN VCHFSPL +D +  L++GD++KID+G H+DGFI+ +AH+
Sbjct  66    K-EKDLKKGIAFPTSVSVNNCVCHFSPLKSDPEITLKDGDLIKIDLGVHVDGFISNLAHS  124

Query  618   HLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
              ++   ++ P+TGR ADVI AA+  AE A+RLV+PG +NS VTEA  K+A ++ C  +EG
Sbjct  125   FVVGVTKDAPLTGRKADVIKAAHLCAEAALRLVKPGNQNSQVTEAWNKIAKSFKCSAIEG  184

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             +LSHQ+KQ VIDG K ++       R D  +AEFE +EVY++D++ STGEGK K   ++ 
Sbjct  185   MLSHQLKQHVIDGEKTIIQNPTDLQRKDHEKAEFEVHEVYAVDVLISTGEGKAKDAGQR-  243

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQ  1139
             TTIYKR  DK Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC  H+LLQ
Sbjct  244   TTIYKRDPDKQYGLKMKTSRSFFSEVERRFDAMPFTLRAFEDEGKARLGVVECAKHELLQ  303

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPL-QDLNVTK-PIDDPEIKAWL  1298
             P+ VLHEK G+ VA  KFTVLLM NG  RIT     Q+L  ++  ++D ++KA L
Sbjct  304   PFNVLHEKEGEFVAQFKFTVLLMANGPLRITTGLYEQELYKSEHEVEDADLKALL  358



>gb|ACO10060.1| Proliferation-associated protein 2G4 [Osmerus mordax]
Length=391

 Score =   323 bits (828),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 177/342 (52%), Positives = 239/342 (70%), Gaps = 12/342 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSD+E+E+    ++   VVTKYK   +I N+AL +V+        V+ +C KGDA I  +
Sbjct  1     MSDDEQEQT---IAEDLVVTKYKMGGDIANQALRMVMEAATAGVSVLSLCVKGDAHIMAE  57

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K I++G+AFPT +SVNN VCHFSPL +D D  L++GD+VKID+G HIDGFI
Sbjct  58    TGKVFKK-EKDIKKGIAFPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHIDGFI  116

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   +E PVTGR ADVI AA+  AE A+RLV+PG +NS VTEA  K+A ++ 
Sbjct  117   ANVAHSFVIGATKETPVTGRKADVIKAAHLCAEAALRLVKPGNQNSQVTEAWNKIAQSFK  176

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + R D  +AEFE +EVY++D++ STGEGK +
Sbjct  177   CSPIEGMLSHQLKQHVIDGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLISTGEGKAR  236

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TTIYKR   K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC 
Sbjct  237   DGGQR-TTIYKRDPSKQYGLKMKTSRMFFSEVERRFDTMPFTLRAFEDEAKARLGVVECA  295

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ  1247
              H+LLQP+ VL++K G+ VA  KFTVLLM NG  RIT  P +
Sbjct  296   KHELLQPFSVLNDKEGECVAQFKFTVLLMANGPHRITNGPFE  337



>ref|XP_010865536.1| PREDICTED: proliferation-associated protein 2G4-like [Esox lucius]
Length=396

 Score =   323 bits (828),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 177/345 (51%), Positives = 242/345 (70%), Gaps = 13/345 (4%)
 Frame = +3

Query  294   VVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYKNVKKKIERGVA  473
             VVTKYK  A+I N+A++ VV   +    VV +CE GDAFI  +TG +++  K + ++G+A
Sbjct  17    VVTKYKMGADIANQAMKTVVEAARAGVTVVSLCEMGDAFITAETGKVFRKEKDQ-KKGIA  75

Query  474   FPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVAHTHLL---QEGPV  641
             FPT +SVNN VCHFSPL +D + +L++GD+VKID+G H+DGFI+ +AH+ ++   +  P+
Sbjct  76    FPTSVSVNNCVCHFSPLKSDPEVILKDGDLVKIDLGVHVDGFISNLAHSFVVGVTKHTPL  135

Query  642   TGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEGVLSHQMKQFVI  821
             TGR ADVI AA+  AE A+RLV+PG +NS VTEA  K+A ++ C  +EG+LSHQ+KQ VI
Sbjct  136   TGRKADVIKAAHLCAEAALRLVKPGNQNSQVTEAWNKIAKSFKCTAIEGMLSHQLKQHVI  195

Query  822   DGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQTTIYKRAVDKN  995
             DG K ++     + R D  +AEFE +EVY++D++ STGEGK K   ++ TTIYKR  DK 
Sbjct  196   DGEKTIIQNPTDQQRKDHEKAEFEVHEVYAVDVLISTGEGKAKDAGQR-TTIYKRDPDKQ  254

Query  996   YNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQPYPVLHEKPGD  1172
             Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC  H+LLQP+ VLHEK G+
Sbjct  255   YGLKMKTSRIFFSEVERRFDAMPFTLRAFEDEAKARLGVVECAKHELLQPFNVLHEKEGE  314

Query  1173  LVAHIKFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKAWL  1298
              VA  KFTVLLM NG  RIT   L D  + K    ++D ++KA L
Sbjct  315   FVAQFKFTVLLMANGPLRITT-GLYDPELYKSEHEVEDADLKALL  358



>gb|AFM85909.1| proliferation-associated 2G4, partial [Callorhinchus milii]
Length=365

 Score =   322 bits (825),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 180/361 (50%), Positives = 251/361 (70%), Gaps = 13/361 (4%)
 Frame = +3

Query  243   MSDEEREEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQ  422
             MSDEE +E+   ++   VVTKYK   +I N+ L  VV   K    V  +CEKGDA I E+
Sbjct  1     MSDEESQEQ--TIAEDLVVTKYKMGGDIANRVLRTVVEAAKEGESVFSLCEKGDAMIMEE  58

Query  423   TGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFI  599
             TG ++K  +K++++G+AFPTC+SVNN VCH+SPL +D D +L++ D+VK+D+G H+DGFI
Sbjct  59    TGKIFKK-EKEMKKGIAFPTCVSVNNCVCHYSPLKSDPDYILKDEDLVKVDLGVHVDGFI  117

Query  600   AVVAHTHLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYD  770
             A VAH+ ++   ++ P+TGR ADVI AA+  AE A+RLV+ G +N+ VTEA  K+A ++ 
Sbjct  118   ANVAHSFIVGIKKDKPLTGRKADVIKAAHLCAEAALRLVKSGNQNTQVTEAWNKIAQSFK  177

Query  771   CKIVEGVLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPK  944
             C  +EG+LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY+ID++ STGEGK K
Sbjct  178   CTPIEGMLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAIDVLISTGEGKAK  237

Query  945   ILDEKQTTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECV  1121
                ++ TT+YKR     Y LKMK SR  +SE+ ++F  MP+T R  E EK+AR+G+VEC 
Sbjct  238   DAGQR-TTVYKRDPTIQYGLKMKTSRAFFSEVERRFDAMPYTLRAFEDEKKARMGVVECA  296

Query  1122  NHDLLQPYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQ-DLNVTK-PIDDPEIKAW  1295
              H LLQP+ VL+EK G+ VA  KFTVLLMPNG  RIT  P + +L  T+  + D E+KA 
Sbjct  297   KHKLLQPFNVLYEKEGEFVAQFKFTVLLMPNGPMRITNGPFEPELYKTEYVVQDVELKAL  356

Query  1296  L  1298
             L
Sbjct  357   L  357



>ref|XP_010782747.1| PREDICTED: proliferation-associated protein 2G4-like [Notothenia 
coriiceps]
Length=392

 Score =   323 bits (828),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 179/356 (50%), Positives = 250/356 (70%), Gaps = 13/356 (4%)
 Frame = +3

Query  261   EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
             + +E  ++   VVTKYK  AEI N+AL+ VV    P   V+ +C+KGDAF+  +TG ++K
Sbjct  6     DSQEQTIADDLVVTKYKMGAEIANQALKTVVEAALPGVSVLSLCQKGDAFVMAETGKIFK  65

Query  441   NVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVAHT  617
               +K +++G AFPTC+SVNNTVCH SPL +D D +L++GD+VKID+G H+DGFI+ VAH+
Sbjct  66    K-EKDMKKGSAFPTCVSVNNTVCHHSPLKSDPDVILKDGDVVKIDLGVHVDGFISNVAHS  124

Query  618   HLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
              ++   +E P+TGR ADV+ AA+  AE A+RLV+PG KNS VT+A  K+A ++ C  +EG
Sbjct  125   FVVGVTKETPLTGRKADVLIAAHLCAEAAIRLVKPGNKNSQVTDAWNKIAKSFKCSPIEG  184

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             +LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ STGEGK +   ++ 
Sbjct  185   MLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISTGEGKARDGGQR-  243

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLE-EKRARLGLVECVNHDLLQ  1139
             TT+YKR  +K Y LKMK SR  +SE+ ++F  MPFT R  E E +ARLG+VEC  H+LLQ
Sbjct  244   TTVYKRDPNKVYGLKMKTSRTFFSEMERRFDTMPFTLRAFEDEGKARLGVVECAKHELLQ  303

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKAWL  1298
             P+ VLHEK G+ VA  KFTVLLM NG  RIT + L D ++ K    + D E+K  L
Sbjct  304   PFNVLHEKEGECVAQFKFTVLLMANGPLRIT-NSLFDPDLYKSEHEVQDEELKTLL  358



>ref|XP_003963121.1| PREDICTED: proliferation-associated protein 2G4-like [Takifugu 
rubripes]
Length=392

 Score =   323 bits (827),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 174/356 (49%), Positives = 255/356 (72%), Gaps = 13/356 (4%)
 Frame = +3

Query  261   EEKELDLSSPEVVTKYKSAAEILNKALELVVSQCKPNARVVDICEKGDAFIREQTGNMYK  440
             E +E  ++   VVTK+K  A+I N+AL++VV        V+ +CEKGD +I E+ G ++K
Sbjct  6     ETQEQTIADDLVVTKFKMGADIANRALKMVVEAAVAGTSVLSLCEKGDTYIMEEIGKIFK  65

Query  441   NVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEEGDMVKIDMGCHIDGFIAVVAHT  617
               +K++++G+AFPTC+SVNN VCHFSP+ +D + +L++GD+VKID+G H+DGFI+ VAH+
Sbjct  66    K-EKEMKKGIAFPTCVSVNNCVCHFSPVKSDPNVILKDGDLVKIDLGVHVDGFISNVAHS  124

Query  618   HLL---QEGPVTGRaadviaaantaaevaMRLVRPGKKNSDVTEAIQKVAAAYDCKIVEG  788
              ++   ++ P TGR AD++ AA+  AE A+RLV+PG +N+ VTEA  K+A ++ C  +EG
Sbjct  125   LIVGVTKDNPQTGRKADLMMAAHLCAEAALRLVKPGNQNTQVTEAWNKIAKSFKCAPIEG  184

Query  789   VLSHQMKQFVIDGNKVVLSVSNPETRVD--EAEFEENEVYSIDIVTSTGEGKPKILDEKQ  962
             +LSHQ+KQ VIDG K ++     + + D  +AEFE +EVY++D++ STGEGK K   ++ 
Sbjct  185   MLSHQLKQHVIDGEKTIIQNPTDQQKKDHEKAEFEVHEVYAVDVLISTGEGKAKDGGQR-  243

Query  963   TTIYKRAVDKNYNLKMKASRFIYSEISQKFPLMPFTARDLEEK-RARLGLVECVNHDLLQ  1139
             TT+YKR  +K Y LKMK+SR ++S+I ++F  MPFT R  EE+ +ARLGLVEC  H+LLQ
Sbjct  244   TTVYKRDPNKVYGLKMKSSRMLFSDIERRFDTMPFTLRAFEEESKARLGLVECAKHELLQ  303

Query  1140  PYPVLHEKPGDLVAHIKFTVLLMPNGSDRITAHPLQDLNVTKP---IDDPEIKAWL  1298
             P+ VL+EK G+ VA  KFTVLLM NG  RIT + L D ++ K    ++DPE+K  L
Sbjct  304   PFTVLYEKEGEFVAQFKFTVLLMANGPLRIT-NSLFDPDLYKSEYKVEDPELKNLL  358



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 5627091282090