BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3118

Length=866
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002311552.2|  IAA-ALANINE RESISTANCE protein 1                 55.5    2e-05   
ref|XP_011028121.1|  PREDICTED: IAA-alanine resistance protein 1      53.5    1e-04   Populus euphratica
gb|KCW64452.1|  hypothetical protein EUGRSUZ_G02069                   52.4    2e-04   Eucalyptus grandis [rose gum]
ref|XP_010066542.1|  PREDICTED: IAA-alanine resistance protein 1      52.4    3e-04   Eucalyptus grandis [rose gum]
gb|ACU22819.1|  unknown                                               51.6    5e-04   Glycine max [soybeans]
ref|XP_009784524.1|  PREDICTED: IAA-alanine resistance protein 1      51.6    5e-04   Nicotiana sylvestris
ref|XP_003524844.1|  PREDICTED: IAA-alanine resistance protein 1-...  51.2    6e-04   Glycine max [soybeans]
gb|KHN28886.1|  IAA-alanine resistance protein 1                      51.2    7e-04   Glycine soja [wild soybean]
ref|XP_003531130.1|  PREDICTED: IAA-alanine resistance protein 1      51.2    7e-04   Glycine max [soybeans]
ref|XP_002285173.1|  PREDICTED: IAA-alanine resistance protein 1      50.8    7e-04   
ref|XP_006492293.1|  PREDICTED: IAA-alanine resistance protein 1-...  50.8    8e-04   
ref|XP_006580088.1|  PREDICTED: IAA-alanine resistance protein 1-...  50.8    8e-04   



>ref|XP_002311552.2| IAA-ALANINE RESISTANCE protein 1 [Populus trichocarpa]
 gb|EEE88919.2| IAA-ALANINE RESISTANCE protein 1 [Populus trichocarpa]
Length=398

 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 72/89 (81%), Gaps = 7/89 (8%)
 Frame = +2

Query  548  YGFGTRDEhhhhhhdhghVDSEFSGLGLWLHAMscsllvslaslvcliilPLIFLKGRPS  727
            YGFG  D  HH          E SGLGLW+HA+ CSLLVSLASL+CLI LP+IF+KG+PS
Sbjct  4    YGFGNHDHDHHRGL-------ELSGLGLWIHALGCSLLVSLASLICLIFLPVIFIKGKPS  56

Query  728  KAIVdalalfgagamlgdaflHQLPHAFG  814
            KAIVD+LALFGAGAMLGDAFLHQLPHAFG
Sbjct  57   KAIVDSLALFGAGAMLGDAFLHQLPHAFG  85



>ref|XP_011028121.1| PREDICTED: IAA-alanine resistance protein 1, partial [Populus 
euphratica]
Length=396

 Score = 53.5 bits (127),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +2

Query  611  EFSGLGLWLHAMscsllvslaslvcliilPLIFLKGRPSKAIVdalalfgagamlgdafl  790
            E SGLGLW+HA+ CSLLVSLASL+CLI LP+IF+KG+PSKAIVD+LALFGAGAMLGDAFL
Sbjct  14   ELSGLGLWIHALGCSLLVSLASLICLIFLPVIFIKGKPSKAIVDSLALFGAGAMLGDAFL  73

Query  791  HQLPHAFG  814
            HQLPHAFG
Sbjct  74   HQLPHAFG  81



>gb|KCW64452.1| hypothetical protein EUGRSUZ_G02069 [Eucalyptus grandis]
Length=389

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  605  DSEFSGLGLWLHAMscsllvslaslvcliilPLIFLKGRPSKAIVdalalfgagamlgda  784
            +S+ SGLGLW+HA+ CSLLVS+ASL+CLIILP++F++G+PSKAIVD+LALFGAGAMLGDA
Sbjct  113  ESDLSGLGLWVHALGCSLLVSMASLICLIILPVMFVQGKPSKAIVDSLALFGAGAMLGDA  172

Query  785  flHQLPHAFG  814
            FLHQLPHAFG
Sbjct  173  FLHQLPHAFG  182



>ref|XP_010066542.1| PREDICTED: IAA-alanine resistance protein 1 [Eucalyptus grandis]
 gb|KCW64451.1| hypothetical protein EUGRSUZ_G02069 [Eucalyptus grandis]
Length=492

 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 68/70 (97%), Gaps = 0/70 (0%)
 Frame = +2

Query  605  DSEFSGLGLWLHAMscsllvslaslvcliilPLIFLKGRPSKAIVdalalfgagamlgda  784
            +S+ SGLGLW+HA+ CSLLVS+ASL+CLIILP++F++G+PSKAIVD+LALFGAGAMLGDA
Sbjct  113  ESDLSGLGLWVHALGCSLLVSMASLICLIILPVMFVQGKPSKAIVDSLALFGAGAMLGDA  172

Query  785  flHQLPHAFG  814
            FLHQLPHAFG
Sbjct  173  FLHQLPHAFG  182



>gb|ACU22819.1| unknown [Glycine max]
Length=402

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  608  SEFSGLGLWLHAMscsllvslaslvcliilPLIFLKGRPSKAIVdalalfgagamlgdaf  787
            +E SGLGLWL+A+ CS LVS+ASLVCLIILP+IF++G+PSKA+VD+LALFGAGAMLGDAF
Sbjct  18   AELSGLGLWLNALGCSFLVSMASLVCLIILPVIFVQGKPSKAVVDSLALFGAGAMLGDAF  77

Query  788  lHQLPHAFG  814
            LHQLPHAFG
Sbjct  78   LHQLPHAFG  86



>ref|XP_009784524.1| PREDICTED: IAA-alanine resistance protein 1 [Nicotiana sylvestris]
Length=592

 Score = 51.6 bits (122),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 66/68 (97%), Gaps = 0/68 (0%)
 Frame = +2

Query  611  EFSGLGLWLHAMscsllvslaslvcliilPLIFLKGRPSKAIVdalalfgagamlgdafl  790
            + +GLGLW++AM CSLLVSLASL+CLIILP+IFLKG+PSKA+VD+LALFGAGAMLGDAFL
Sbjct  208  DITGLGLWVNAMGCSLLVSLASLICLIILPVIFLKGKPSKAVVDSLALFGAGAMLGDAFL  267

Query  791  HQLPHAFG  814
            HQLPHAFG
Sbjct  268  HQLPHAFG  275



>ref|XP_003524844.1| PREDICTED: IAA-alanine resistance protein 1-like isoform X1 [Glycine 
max]
 gb|KHN25970.1| IAA-alanine resistance protein 1 [Glycine soja]
Length=485

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  608  SEFSGLGLWLHAMscsllvslaslvcliilPLIFLKGRPSKAIVdalalfgagamlgdaf  787
            +E SGLGLWL+A+ CS LVS+ASLVCLIILP+IF++G+PSKA+VD+LALFGAGAMLGDAF
Sbjct  102  AELSGLGLWLNALGCSFLVSMASLVCLIILPVIFVQGKPSKAVVDSLALFGAGAMLGDAF  161

Query  788  lHQLPHAFG  814
            LHQLPHAFG
Sbjct  162  LHQLPHAFG  170



>gb|KHN28886.1| IAA-alanine resistance protein 1 [Glycine soja]
Length=485

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  608  SEFSGLGLWLHAMscsllvslaslvcliilPLIFLKGRPSKAIVdalalfgagamlgdaf  787
            +E SGLGLWL+A+ CS LVS+ASLVCLIILP+IF++G+PSKA+VD+LALFGAGAMLGDAF
Sbjct  101  AELSGLGLWLNALGCSFLVSMASLVCLIILPVIFVQGKPSKAVVDSLALFGAGAMLGDAF  160

Query  788  lHQLPHAFG  814
            LHQLPHAFG
Sbjct  161  LHQLPHAFG  169



>ref|XP_003531130.1| PREDICTED: IAA-alanine resistance protein 1 [Glycine max]
Length=485

 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  608  SEFSGLGLWLHAMscsllvslaslvcliilPLIFLKGRPSKAIVdalalfgagamlgdaf  787
            +E SGLGLWL+A+ CS LVS+ASLVCLIILP+IF++G+PSKA+VD+LALFGAGAMLGDAF
Sbjct  101  AELSGLGLWLNALGCSFLVSMASLVCLIILPVIFVQGKPSKAVVDSLALFGAGAMLGDAF  160

Query  788  lHQLPHAFG  814
            LHQLPHAFG
Sbjct  161  LHQLPHAFG  169



>ref|XP_002285173.1| PREDICTED: IAA-alanine resistance protein 1 [Vitis vinifera]
 ref|XP_010647762.1| PREDICTED: IAA-alanine resistance protein 1 [Vitis vinifera]
 emb|CBI26777.3| unnamed protein product [Vitis vinifera]
Length=483

 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 65/67 (97%), Gaps = 0/67 (0%)
 Frame = +2

Query  614  FSGLGLWLHAMscsllvslaslvcliilPLIFLKGRPSKAIVdalalfgagamlgdaflH  793
             SG+GLW+HAM CSLLVS+ASL+CLIILP+IF++G+PSKA+VD+LA+FGAGAMLGDAFLH
Sbjct  110  LSGVGLWVHAMGCSLLVSMASLICLIILPVIFIQGKPSKAVVDSLAVFGAGAMLGDAFLH  169

Query  794  QLPHAFG  814
            QLPHAFG
Sbjct  170  QLPHAFG  176



>ref|XP_006492293.1| PREDICTED: IAA-alanine resistance protein 1-like isoform X1 [Citrus 
sinensis]
 ref|XP_006492294.1| PREDICTED: IAA-alanine resistance protein 1-like isoform X2 [Citrus 
sinensis]
Length=485

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 53/70 (76%), Positives = 67/70 (96%), Gaps = 0/70 (0%)
 Frame = +2

Query  605  DSEFSGLGLWLHAMscsllvslaslvcliilPLIFLKGRPSKAIVdalalfgagamlgda  784
            DS+ SGL LW++A+ CSLLVSLASL+CL++LP+IF++G+PSKA+VD+LA+FGAGAMLGDA
Sbjct  102  DSQLSGLALWVNALGCSLLVSLASLICLVLLPVIFIQGKPSKAVVDSLAVFGAGAMLGDA  161

Query  785  flHQLPHAFG  814
            FLHQLPHAFG
Sbjct  162  FLHQLPHAFG  171



>ref|XP_006580088.1| PREDICTED: IAA-alanine resistance protein 1-like isoform X2 [Glycine 
max]
Length=409

 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 66/69 (96%), Gaps = 0/69 (0%)
 Frame = +2

Query  608  SEFSGLGLWLHAMscsllvslaslvcliilPLIFLKGRPSKAIVdalalfgagamlgdaf  787
            +E SGLGLWL+A+ CS LVS+ASLVCLIILP+IF++G+PSKA+VD+LALFGAGAMLGDAF
Sbjct  102  AELSGLGLWLNALGCSFLVSMASLVCLIILPVIFVQGKPSKAVVDSLALFGAGAMLGDAF  161

Query  788  lHQLPHAFG  814
            LHQLPHAFG
Sbjct  162  LHQLPHAFG  170



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1922415464620