BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig3047

Length=477
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP08772.1|  unnamed protein product                              70.9    3e-11   Coffea canephora [robusta coffee]
ref|XP_010669936.1|  PREDICTED: probable serine/threonine-protein...  70.5    4e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008438006.1|  PREDICTED: probable serine/threonine-protein...  70.1    6e-11   Cucumis melo [Oriental melon]
ref|XP_004133851.1|  PREDICTED: probable serine/threonine-protein...  70.1    6e-11   Cucumis sativus [cucumbers]
ref|XP_003633957.1|  PREDICTED: probable serine/threonine-protein...  69.7    7e-11   Vitis vinifera
ref|XP_010112963.1|  putative serine/threonine-protein kinase         68.6    2e-10   
ref|XP_006339616.1|  PREDICTED: probable serine/threonine-protein...  68.2    3e-10   Solanum tuberosum [potatoes]
ref|XP_004229894.1|  PREDICTED: probable serine/threonine-protein...  68.2    3e-10   Solanum lycopersicum
ref|XP_008232993.1|  PREDICTED: probable serine/threonine-protein...  67.8    4e-10   Prunus mume [ume]
ref|XP_007217938.1|  hypothetical protein PRUPE_ppa004985mg           67.8    4e-10   
ref|XP_004306745.1|  PREDICTED: probable serine/threonine-protein...  67.4    4e-10   Fragaria vesca subsp. vesca
gb|KJB09713.1|  hypothetical protein B456_001G158500                  66.2    1e-09   Gossypium raimondii
gb|KHG20856.1|  hypothetical protein F383_28408                       66.2    1e-09   Gossypium arboreum [tree cotton]
ref|XP_012083324.1|  PREDICTED: probable serine/threonine-protein...  66.2    1e-09   Jatropha curcas
ref|XP_007051724.1|  Kinase superfamily protein                       66.2    1e-09   
ref|XP_002511906.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  66.2    1e-09   Ricinus communis
ref|XP_008376015.1|  PREDICTED: probable serine/threonine-protein...  63.9    1e-09   
ref|XP_008361259.1|  PREDICTED: probable serine/threonine-protein...  63.5    1e-09   
ref|XP_009366550.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...  66.2    1e-09   
gb|KJB49438.1|  hypothetical protein B456_008G119900                  63.9    2e-09   Gossypium raimondii
gb|KJB49439.1|  hypothetical protein B456_008G119900                  63.9    2e-09   Gossypium raimondii
ref|XP_006418432.1|  hypothetical protein EUTSA_v10007528mg           65.1    2e-09   Eutrema salsugineum [saltwater cress]
gb|AAK56254.1|AF367265_1  At1g01540/F22L4_6                           65.1    2e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002320820.1|  hypothetical protein POPTR_0014s08480g           64.7    3e-09   Populus trichocarpa [western balsam poplar]
gb|KJB49437.1|  hypothetical protein B456_008G119900                  63.9    3e-09   Gossypium raimondii
gb|AAF81312.1|AC061957_8  Contains a strong similarity to an unkn...  64.7    3e-09   Arabidopsis thaliana [mouse-ear cress]
gb|KJB49436.1|  hypothetical protein B456_008G119900                  64.3    4e-09   Gossypium raimondii
ref|XP_010053752.1|  PREDICTED: probable serine/threonine-protein...  64.3    4e-09   Eucalyptus grandis [rose gum]
gb|KHG06929.1|  hypothetical protein F383_00687                       64.3    4e-09   Gossypium arboreum [tree cotton]
gb|KJB09717.1|  hypothetical protein B456_001G158500                  63.9    5e-09   Gossypium raimondii
gb|KJB09716.1|  hypothetical protein B456_001G158500                  63.9    5e-09   Gossypium raimondii
gb|KJB09714.1|  hypothetical protein B456_001G158500                  63.5    6e-09   Gossypium raimondii
ref|XP_010457114.1|  PREDICTED: probable serine/threonine-protein...  63.2    1e-08   Camelina sativa [gold-of-pleasure]
ref|XP_002892058.1|  kinase family protein                            63.2    1e-08   
ref|NP_171661.1|  putative serine/threonine-protein kinase            63.2    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010480177.1|  PREDICTED: probable serine/threonine-protein...  63.2    1e-08   Camelina sativa [gold-of-pleasure]
gb|KFK42539.1|  hypothetical protein AALP_AA1G007600                  63.2    1e-08   Arabis alpina [alpine rockcress]
ref|XP_010522963.1|  PREDICTED: probable serine/threonine-protein...  62.8    1e-08   Tarenaya hassleriana [spider flower]
ref|XP_010522961.1|  PREDICTED: probable serine/threonine-protein...  62.8    1e-08   Tarenaya hassleriana [spider flower]
ref|XP_011036971.1|  PREDICTED: probable serine/threonine-protein...  62.8    1e-08   Populus euphratica
ref|XP_008346227.1|  PREDICTED: LOW QUALITY PROTEIN: probable ser...  62.8    2e-08   
ref|NP_849573.1|  putative serine/threonine-protein kinase            62.4    2e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009349806.1|  PREDICTED: probable serine/threonine-protein...  62.8    2e-08   Pyrus x bretschneideri [bai li]
ref|XP_006303639.1|  hypothetical protein CARUB_v10011595mg           62.0    2e-08   Capsella rubella
ref|XP_009118815.1|  PREDICTED: probable serine/threonine-protein...  62.0    2e-08   Brassica rapa
ref|XP_010474755.1|  PREDICTED: probable serine/threonine-protein...  62.0    3e-08   Camelina sativa [gold-of-pleasure]
ref|XP_007135125.1|  hypothetical protein PHAVU_010G103100g           61.6    3e-08   Phaseolus vulgaris [French bean]
emb|CDY38011.1|  BnaCnng08720D                                        61.6    3e-08   Brassica napus [oilseed rape]
gb|KCW78102.1|  hypothetical protein EUGRSUZ_D02315                   61.2    4e-08   Eucalyptus grandis [rose gum]
ref|XP_006444971.1|  hypothetical protein CICLE_v10019913mg           61.2    5e-08   Citrus clementina [clementine]
gb|AFK38528.1|  unknown                                               60.5    9e-08   Medicago truncatula
ref|XP_003622458.1|  hypothetical protein MTR_7g037990                60.5    9e-08   
ref|XP_010276896.1|  PREDICTED: probable serine/threonine-protein...  60.1    1e-07   Nelumbo nucifera [Indian lotus]
ref|XP_010544401.1|  PREDICTED: probable serine/threonine-protein...  60.1    1e-07   Tarenaya hassleriana [spider flower]
ref|XP_009119704.1|  PREDICTED: probable serine/threonine-protein...  60.1    1e-07   Brassica rapa
emb|CDX90040.1|  BnaA10g00420D                                        59.7    1e-07   
ref|XP_006444970.1|  hypothetical protein CICLE_v10019913mg           59.3    2e-07   
ref|XP_006829016.1|  PREDICTED: probable serine/threonine-protein...  59.7    2e-07   Amborella trichopoda
gb|KDO86284.1|  hypothetical protein CISIN_1g011498mg                 58.9    2e-07   Citrus sinensis [apfelsine]
ref|NP_001235315.1|  protein kinase family protein                    58.9    3e-07   Glycine max [soybeans]
ref|XP_003548643.1|  PREDICTED: probable serine/threonine-protein...  58.2    5e-07   Glycine max [soybeans]
ref|XP_004492785.1|  PREDICTED: probable serine/threonine-protein...  57.8    7e-07   Cicer arietinum [garbanzo]
ref|XP_010919126.1|  PREDICTED: probable serine/threonine-protein...  57.4    8e-07   Elaeis guineensis
gb|KFK30713.1|  hypothetical protein AALP_AA6G017900                  57.4    9e-07   Arabis alpina [alpine rockcress]
gb|KFK30714.1|  hypothetical protein AALP_AA6G017900                  57.4    9e-07   Arabis alpina [alpine rockcress]
ref|XP_003552413.1|  PREDICTED: probable serine/threonine-protein...  57.0    1e-06   Glycine max [soybeans]
ref|XP_007139796.1|  hypothetical protein PHAVU_008G059400g           57.0    1e-06   Phaseolus vulgaris [French bean]
ref|XP_008805559.1|  PREDICTED: probable serine/threonine-protein...  56.2    2e-06   
ref|XP_003534544.1|  PREDICTED: probable serine/threonine-protein...  56.2    2e-06   Glycine max [soybeans]
ref|XP_010556568.1|  PREDICTED: probable serine/threonine-protein...  55.8    3e-06   Tarenaya hassleriana [spider flower]
gb|EPS60979.1|  hypothetical protein M569_13821                       55.5    4e-06   Genlisea aurea
gb|KHN29322.1|  Putative serine/threonine-protein kinase              54.7    6e-06   Glycine soja [wild soybean]
ref|XP_008810112.1|  PREDICTED: probable serine/threonine-protein...  54.7    7e-06   Phoenix dactylifera
ref|NP_192042.5|  protein kinase family protein                       54.7    7e-06   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001190651.1|  protein kinase family protein                    54.7    7e-06   Arabidopsis thaliana [mouse-ear cress]
gb|KJB41391.1|  hypothetical protein B456_007G102400                  54.3    8e-06   Gossypium raimondii
ref|XP_003624053.1|  Protein kinase family protein                    53.9    1e-05   Medicago truncatula
ref|XP_010427508.1|  PREDICTED: probable serine/threonine-protein...  53.9    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010427500.1|  PREDICTED: probable serine/threonine-protein...  53.9    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010422805.1|  PREDICTED: probable serine/threonine-protein...  53.9    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010422804.1|  PREDICTED: probable serine/threonine-protein...  53.9    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_010261327.1|  PREDICTED: probable serine/threonine-protein...  53.9    1e-05   Nelumbo nucifera [Indian lotus]
ref|XP_010933965.1|  PREDICTED: probable serine/threonine-protein...  53.5    2e-05   Elaeis guineensis
ref|XP_010263506.1|  PREDICTED: probable serine/threonine-protein...  53.5    2e-05   Nelumbo nucifera [Indian lotus]
gb|ABL66736.1|  At4g01330                                             52.8    2e-05   Arabidopsis thaliana [mouse-ear cress]
gb|AAB61036.1|  Similar to protein kinase                             52.8    3e-05   Arabidopsis thaliana [mouse-ear cress]
gb|KHG15701.1|  hypothetical protein F383_10484                       52.4    4e-05   Gossypium arboreum [tree cotton]
gb|KJB41390.1|  hypothetical protein B456_007G102400                  52.4    4e-05   Gossypium raimondii
ref|XP_009111450.1|  PREDICTED: probable serine/threonine-protein...  52.4    4e-05   Brassica rapa
ref|XP_009111449.1|  PREDICTED: probable serine/threonine-protein...  52.4    4e-05   Brassica rapa
ref|XP_006396277.1|  hypothetical protein EUTSA_v10028635mg           52.4    4e-05   
ref|XP_009411430.1|  PREDICTED: probable serine/threonine-protein...  52.0    5e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009767889.1|  PREDICTED: probable serine/threonine-protein...  52.0    6e-05   Nicotiana sylvestris
ref|XP_009597783.1|  PREDICTED: probable serine/threonine-protein...  52.0    6e-05   Nicotiana tomentosiformis
ref|XP_009597781.1|  PREDICTED: probable serine/threonine-protein...  52.0    6e-05   
ref|XP_009382265.1|  PREDICTED: probable serine/threonine-protein...  52.0    6e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006287640.1|  hypothetical protein CARUB_v10000851mg           51.6    6e-05   Capsella rubella
emb|CBI29390.3|  unnamed protein product                              51.6    8e-05   Vitis vinifera
emb|CDY48518.1|  BnaA09g00050D                                        51.2    9e-05   Brassica napus [oilseed rape]
emb|CDY07192.1|  BnaCnng02070D                                        51.2    9e-05   
ref|XP_002874989.1|  predicted protein                                50.8    1e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_004510749.1|  PREDICTED: probable serine/threonine-protein...  50.8    1e-04   
ref|XP_004510748.1|  PREDICTED: probable serine/threonine-protein...  50.8    1e-04   Cicer arietinum [garbanzo]
ref|XP_010933966.1|  PREDICTED: probable serine/threonine-protein...  50.4    1e-04   Elaeis guineensis
ref|XP_010456238.1|  PREDICTED: probable serine/threonine-protein...  50.4    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010456237.1|  PREDICTED: probable serine/threonine-protein...  50.4    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_003621777.1|  Protein kinase family protein                    50.1    2e-04   
ref|XP_010664563.1|  PREDICTED: probable serine/threonine-protein...  48.1    9e-04   Vitis vinifera
ref|XP_002282863.1|  PREDICTED: probable serine/threonine-protein...  48.1    9e-04   Vitis vinifera
ref|XP_009792774.1|  PREDICTED: probable serine/threonine-protein...  48.1    9e-04   Nicotiana sylvestris
ref|XP_009604560.1|  PREDICTED: probable serine/threonine-protein...  48.1    9e-04   Nicotiana tomentosiformis
emb|CDP01314.1|  unnamed protein product                              48.1    0.001   Coffea canephora [robusta coffee]



>emb|CDP08772.1| unnamed protein product [Coffea canephora]
Length=508

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVNSELSKPTSIFGL+LWVVIGIFVG
Sbjct  1    MSVYDAAFVNSELSKPTSIFGLRLWVVIGIFVG  33



>ref|XP_010669936.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Beta vulgaris subsp. vulgaris]
Length=533

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS+YDAAFVNSELSKPTSIFGL+LWVVIGIFVG
Sbjct  1    MSIYDAAFVNSELSKPTSIFGLRLWVVIGIFVG  33



>ref|XP_008438006.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Cucumis melo]
Length=492

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVN+ELSKPTSIFGL+LWVVIGIFVG
Sbjct  1    MSVYDAAFVNTELSKPTSIFGLRLWVVIGIFVG  33



>ref|XP_004133851.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Cucumis sativus]
 gb|KGN56493.1| hypothetical protein Csa_3G121690 [Cucumis sativus]
Length=492

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVN+ELSKPTSIFGL+LWVVIGIFVG
Sbjct  1    MSVYDAAFVNTELSKPTSIFGLRLWVVIGIFVG  33



>ref|XP_003633957.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Vitis vinifera]
 emb|CBI40423.3| unnamed protein product [Vitis vinifera]
Length=492

 Score = 69.7 bits (169),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAF+NSELSKPTSIFGL+LWVVIGIFVG
Sbjct  1    MSVYDAAFLNSELSKPTSIFGLRLWVVIGIFVG  33



>ref|XP_010112963.1| putative serine/threonine-protein kinase [Morus notabilis]
 gb|EXC35122.1| putative serine/threonine-protein kinase [Morus notabilis]
Length=519

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVNSELSKPTSIFGL+LWVVIGI VG
Sbjct  1    MSVYDAAFVNSELSKPTSIFGLRLWVVIGILVG  33



>ref|XP_006339616.1| PREDICTED: probable serine/threonine-protein kinase At1g01540-like 
[Solanum tuberosum]
Length=501

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVNSELSK TSIFGLKLWVVIGIFVG
Sbjct  1    MSVYDAAFVNSELSKNTSIFGLKLWVVIGIFVG  33



>ref|XP_004229894.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Solanum lycopersicum]
Length=501

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/33 (97%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVNSELSK TSIFGLKLWVVIGIFVG
Sbjct  1    MSVYDAAFVNSELSKNTSIFGLKLWVVIGIFVG  33



>ref|XP_008232993.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Prunus mume]
Length=482

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVN+ELSKPTSIFGL+LWVVIGI VG
Sbjct  1    MSVYDAAFVNTELSKPTSIFGLRLWVVIGILVG  33



>ref|XP_007217938.1| hypothetical protein PRUPE_ppa004985mg [Prunus persica]
 gb|EMJ19137.1| hypothetical protein PRUPE_ppa004985mg [Prunus persica]
Length=482

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 30/33 (91%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVN+ELSKPTSIFGL+LWVVIGI VG
Sbjct  1    MSVYDAAFVNTELSKPTSIFGLRLWVVIGILVG  33



>ref|XP_004306745.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Fragaria vesca subsp. vesca]
Length=487

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 31/33 (94%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVNSELSKPTSIFGL LWVVIGI VG
Sbjct  1    MSVYDAAFVNSELSKPTSIFGLHLWVVIGILVG  33



>gb|KJB09713.1| hypothetical protein B456_001G158500 [Gossypium raimondii]
 gb|KJB09715.1| hypothetical protein B456_001G158500 [Gossypium raimondii]
Length=489

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVN+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVYDAAFVNTELSKPTSIFGLRLWVVIGILLG  33



>gb|KHG20856.1| hypothetical protein F383_28408 [Gossypium arboreum]
Length=489

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVN+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVYDAAFVNTELSKPTSIFGLRLWVVIGILLG  33



>ref|XP_012083324.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Jatropha curcas]
 gb|KDP28584.1| hypothetical protein JCGZ_14355 [Jatropha curcas]
Length=489

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVN+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVYDAAFVNTELSKPTSIFGLRLWVVIGILLG  33



>ref|XP_007051724.1| Kinase superfamily protein [Theobroma cacao]
 gb|EOX95881.1| Kinase superfamily protein [Theobroma cacao]
Length=489

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVN+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVYDAAFVNTELSKPTSIFGLRLWVVIGILLG  33



>ref|XP_002511906.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
 gb|EEF50575.1| BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 precursor, 
putative [Ricinus communis]
Length=492

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVN+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVYDAAFVNTELSKPTSIFGLRLWVVIGILLG  33



>ref|XP_008376015.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Malus domestica]
Length=185

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS+YDAAFVNS+LSKPTSIFGL+LWVVIGI VG
Sbjct  1    MSLYDAAFVNSQLSKPTSIFGLRLWVVIGILVG  33



>ref|XP_008361259.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Malus domestica]
Length=185

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS+YDAAFVNS+LSKPTSIFGL+LWVVIGI VG
Sbjct  1    MSLYDAAFVNSQLSKPTSIFGLRLWVVIGILVG  33



>ref|XP_009366550.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase At1g01540 [Pyrus x bretschneideri]
Length=484

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS+YDAAFVNS+LSKPTSIFGL+LWVVIGI VG
Sbjct  1    MSLYDAAFVNSQLSKPTSIFGLRLWVVIGILVG  33



>gb|KJB49438.1| hypothetical protein B456_008G119900 [Gossypium raimondii]
Length=270

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVNSELSKPTS+FGLKLWVVIGI  G
Sbjct  1    MSVYDAAFVNSELSKPTSVFGLKLWVVIGILFG  33



>gb|KJB49439.1| hypothetical protein B456_008G119900 [Gossypium raimondii]
Length=267

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVNSELSKPTS+FGLKLWVVIGI  G
Sbjct  1    MSVYDAAFVNSELSKPTSVFGLKLWVVIGILFG  33



>ref|XP_006418432.1| hypothetical protein EUTSA_v10007528mg [Eutrema salsugineum]
 gb|ESQ36785.1| hypothetical protein EUTSA_v10007528mg [Eutrema salsugineum]
Length=475

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAF+N+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVYDAAFLNTELSKPTSIFGLRLWVVIGILLG  33



>gb|AAK56254.1|AF367265_1 At1g01540/F22L4_6 [Arabidopsis thaliana]
 gb|AAM16225.1| At1g01540/F22L4_6 [Arabidopsis thaliana]
Length=479

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAF+N+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVYDAAFLNTELSKPTSIFGLRLWVVIGILLG  33



>ref|XP_002320820.1| hypothetical protein POPTR_0014s08480g [Populus trichocarpa]
 gb|EEE99135.1| hypothetical protein POPTR_0014s08480g [Populus trichocarpa]
Length=485

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYD AFVN+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVYDGAFVNTELSKPTSIFGLRLWVVIGILLG  33



>gb|KJB49437.1| hypothetical protein B456_008G119900 [Gossypium raimondii]
Length=326

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVNSELSKPTS+FGLKLWVVIGI  G
Sbjct  1    MSVYDAAFVNSELSKPTSVFGLKLWVVIGILFG  33



>gb|AAF81312.1|AC061957_8 Contains a strong similarity to an unknown protein from Arabidopsis 
thaliana gi|2505874 and contains an eukaryotic protein 
kinase PF|00069 domain. ESTs gb|Z26473, gb|AI996016, gb|Z17558, 
gb|N97089, gb|BE039500, gb|AA712856, gb|Z26772 come from 
this gene [Arabidopsis thaliana]
Length=497

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAF+N+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVYDAAFLNTELSKPTSIFGLRLWVVIGILLG  33



>gb|KJB49436.1| hypothetical protein B456_008G119900 [Gossypium raimondii]
Length=463

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVNSELSKPTS+FGLKLWVVIGI  G
Sbjct  1    MSVYDAAFVNSELSKPTSVFGLKLWVVIGILFG  33



>ref|XP_010053752.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Eucalyptus grandis]
 gb|KCW78101.1| hypothetical protein EUGRSUZ_D02315 [Eucalyptus grandis]
Length=503

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVY+++FVN+ELSKPTSIFGL+LWVVIGIF+G
Sbjct  1    MSVYNSSFVNTELSKPTSIFGLRLWVVIGIFLG  33



>gb|KHG06929.1| hypothetical protein F383_00687 [Gossypium arboreum]
Length=463

 Score = 64.3 bits (155),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 30/33 (91%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVNSELSKPTS+FGLKLWVVIGI  G
Sbjct  1    MSVYDAAFVNSELSKPTSVFGLKLWVVIGILFG  33



>gb|KJB09717.1| hypothetical protein B456_001G158500 [Gossypium raimondii]
Length=356

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVN+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVYDAAFVNTELSKPTSIFGLRLWVVIGILLG  33



>gb|KJB09716.1| hypothetical protein B456_001G158500 [Gossypium raimondii]
Length=469

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVN+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVYDAAFVNTELSKPTSIFGLRLWVVIGILLG  33



>gb|KJB09714.1| hypothetical protein B456_001G158500 [Gossypium raimondii]
Length=379

 Score = 63.5 bits (153),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 29/33 (88%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVN+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVYDAAFVNTELSKPTSIFGLRLWVVIGILLG  33



>ref|XP_010457114.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Camelina sativa]
Length=473

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAF+N+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVYDAAFLNTELSKPTSIFGLRLWVVIGILLG  33



>ref|XP_002892058.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68317.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAF+N+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVYDAAFLNTELSKPTSIFGLRLWVVIGILLG  33



>ref|NP_171661.1| putative serine/threonine-protein kinase [Arabidopsis thaliana]
 sp|Q3EDL4.2|Y1154_ARATH RecName: Full=Probable serine/threonine-protein kinase At1g01540 
[Arabidopsis thaliana]
 gb|AAG48792.1|AF332429_1 putative protein serine/threonine kinase [Arabidopsis thaliana]
 emb|CAA73303.1| putative kinase [Arabidopsis thaliana]
 gb|AEE27302.1| putative serine/threonine-protein kinase [Arabidopsis thaliana]
Length=472

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAF+N+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVYDAAFLNTELSKPTSIFGLRLWVVIGILLG  33



>ref|XP_010480177.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Camelina sativa]
Length=465

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAF+N+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVYDAAFLNTELSKPTSIFGLRLWVVIGILLG  33



>gb|KFK42539.1| hypothetical protein AALP_AA1G007600 [Arabis alpina]
Length=474

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAF+N+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVYDAAFLNTELSKPTSIFGLRLWVVIGILLG  33



>ref|XP_010522963.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X2 [Tarenaya hassleriana]
Length=482

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS+YDA F+N+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSLYDATFINTELSKPTSIFGLRLWVVIGILLG  33



>ref|XP_010522961.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010522962.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X1 [Tarenaya hassleriana]
Length=483

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS+YDA F+N+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSLYDATFINTELSKPTSIFGLRLWVVIGILLG  33



>ref|XP_011036971.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Populus euphratica]
Length=485

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            M VYD AFVN+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MPVYDGAFVNTELSKPTSIFGLRLWVVIGILLG  33



>ref|XP_008346227.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase At1g01540 [Malus domestica]
 ref|XP_008362635.1| PREDICTED: LOW QUALITY PROTEIN: probable serine/threonine-protein 
kinase At1g01540 [Malus domestica]
Length=487

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVNS+L+K TSIFGL+LWVVIGI VG
Sbjct  1    MSVYDAAFVNSQLAKKTSIFGLRLWVVIGILVG  33



>ref|NP_849573.1| putative serine/threonine-protein kinase [Arabidopsis thaliana]
 gb|AEE27301.1| putative serine/threonine-protein kinase [Arabidopsis thaliana]
Length=386

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/33 (85%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAF+N+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVYDAAFLNTELSKPTSIFGLRLWVVIGILLG  33



>ref|XP_009349806.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Pyrus x bretschneideri]
Length=487

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFVNS+L+K TSIFGL+LWVVIGI VG
Sbjct  1    MSVYDAAFVNSQLAKTTSIFGLRLWVVIGILVG  33



>ref|XP_006303639.1| hypothetical protein CARUB_v10011595mg [Capsella rubella]
 gb|EOA36537.1| hypothetical protein CARUB_v10011595mg [Capsella rubella]
Length=469

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS+YDAAF+N+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSMYDAAFLNTELSKPTSIFGLRLWVVIGILLG  33



>ref|XP_009118815.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Brassica rapa]
Length=466

 Score = 62.0 bits (149),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS+YDAAF+N+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSMYDAAFLNTELSKPTSIFGLRLWVVIGILLG  33



>ref|XP_010474755.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Camelina sativa]
Length=473

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS+YDAAF+N+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSMYDAAFLNTELSKPTSIFGLRLWVVIGILLG  33



>ref|XP_007135125.1| hypothetical protein PHAVU_010G103100g [Phaseolus vulgaris]
 gb|ESW07119.1| hypothetical protein PHAVU_010G103100g [Phaseolus vulgaris]
Length=490

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Composition-based stats.
 Identities = 28/33 (85%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAFV++ELSK TSIFGL+LWVVIGI VG
Sbjct  1    MSVYDAAFVDTELSKRTSIFGLRLWVVIGILVG  33



>emb|CDY38011.1| BnaCnng08720D [Brassica napus]
Length=452

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 32/33 (97%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS+YDAAF+N+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSMYDAAFLNTELSKPTSIFGLRLWVVIGILLG  33



>gb|KCW78102.1| hypothetical protein EUGRSUZ_D02315 [Eucalyptus grandis]
Length=387

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 33/33 (100%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVY+++FVN+ELSKPTSIFGL+LWVVIGIF+G
Sbjct  1    MSVYNSSFVNTELSKPTSIFGLRLWVVIGIFLG  33



>ref|XP_006444971.1| hypothetical protein CICLE_v10019913mg [Citrus clementina]
 ref|XP_006491171.1| PREDICTED: probable serine/threonine-protein kinase At1g01540-like 
isoform X1 [Citrus sinensis]
 ref|XP_006491172.1| PREDICTED: probable serine/threonine-protein kinase At1g01540-like 
isoform X2 [Citrus sinensis]
 ref|XP_006491173.1| PREDICTED: probable serine/threonine-protein kinase At1g01540-like 
isoform X3 [Citrus sinensis]
 gb|ESR58211.1| hypothetical protein CICLE_v10019913mg [Citrus clementina]
 gb|KDO86279.1| hypothetical protein CISIN_1g011498mg [Citrus sinensis]
 gb|KDO86280.1| hypothetical protein CISIN_1g011498mg [Citrus sinensis]
 gb|KDO86281.1| hypothetical protein CISIN_1g011498mg [Citrus sinensis]
 gb|KDO86282.1| hypothetical protein CISIN_1g011498mg [Citrus sinensis]
 gb|KDO86283.1| hypothetical protein CISIN_1g011498mg [Citrus sinensis]
Length=484

 Score = 61.2 bits (147),  Expect = 5e-08, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS+YDAAFVN+ELSK TSIFGL+LWVVIGI +G
Sbjct  1    MSMYDAAFVNTELSKRTSIFGLRLWVVIGILLG  33



>gb|AFK38528.1| unknown [Medicago truncatula]
Length=477

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAF++++LSK TSIFGL+LWVVIGI VG
Sbjct  1    MSVYDAAFIDTQLSKKTSIFGLRLWVVIGILVG  33



>ref|XP_003622458.1| hypothetical protein MTR_7g037990 [Medicago truncatula]
 gb|KEH18811.1| Serine/Threonine-kinase plant-like protein, putative [Medicago 
truncatula]
Length=477

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVYDAAF++++LSK TSIFGL+LWVVIGI VG
Sbjct  1    MSVYDAAFIDTQLSKKTSIFGLRLWVVIGILVG  33



>ref|XP_010276896.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Nelumbo nucifera]
Length=495

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 27/33 (82%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS YD A +NSELSKPTSIFGL+LWVVIGI VG
Sbjct  1    MSFYDTALLNSELSKPTSIFGLRLWVVIGICVG  33



>ref|XP_010544401.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Tarenaya hassleriana]
Length=474

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 26/33 (79%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSV+DA F+N+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVFDATFINTELSKPTSIFGLRLWVVIGILLG  33



>ref|XP_009119704.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Brassica rapa]
Length=463

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSV+DAA VN+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVFDAAIVNTELSKPTSIFGLRLWVVIGILLG  33



>emb|CDX90040.1| BnaA10g00420D [Brassica napus]
Length=444

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSV+DAA VN+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSVFDAAIVNTELSKPTSIFGLRLWVVIGILLG  33



>ref|XP_006444970.1| hypothetical protein CICLE_v10019913mg [Citrus clementina]
 gb|ESR58210.1| hypothetical protein CICLE_v10019913mg [Citrus clementina]
 gb|KDO86278.1| hypothetical protein CISIN_1g011498mg [Citrus sinensis]
Length=408

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS+YDAAFVN+ELSK TSIFGL+LWVVIGI +G
Sbjct  1    MSMYDAAFVNTELSKRTSIFGLRLWVVIGILLG  33



>ref|XP_006829016.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Amborella trichopoda]
 gb|ERM96432.1| hypothetical protein AMTR_s00001p00248610 [Amborella trichopoda]
Length=498

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS YDA F+N++LSKPTSIFGL+LWVVIGI VG
Sbjct  1    MSFYDAPFLNNQLSKPTSIFGLRLWVVIGISVG  33



>gb|KDO86284.1| hypothetical protein CISIN_1g011498mg [Citrus sinensis]
Length=348

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS+YDAAFVN+ELSK TSIFGL+LWVVIGI +G
Sbjct  1    MSMYDAAFVNTELSKRTSIFGLRLWVVIGILLG  33



>ref|NP_001235315.1| protein kinase family protein [Glycine max]
 gb|ACM89559.1| protein kinase family protein [Glycine max]
Length=454

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 27/33 (82%), Positives = 31/33 (94%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS+YDAAFV++ELSK TSIFGL+LWVVIGI VG
Sbjct  1    MSLYDAAFVDTELSKRTSIFGLRLWVVIGILVG  33



>ref|XP_003548643.1| PREDICTED: probable serine/threonine-protein kinase At1g01540-like 
[Glycine max]
Length=497

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Composition-based stats.
 Identities = 26/32 (81%), Positives = 30/32 (94%), Gaps = 0/32 (0%)
 Frame = +2

Query  380  SVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            SVYDAAFV++ELSK TSIFGL+LWV+IGI VG
Sbjct  3    SVYDAAFVDTELSKRTSIFGLRLWVLIGILVG  34



>ref|XP_004492785.1| PREDICTED: probable serine/threonine-protein kinase At1g01540-like 
[Cicer arietinum]
Length=495

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS++D AF+N++LSK TSIFGL+LWVVIGI +G
Sbjct  1    MSIFDGAFINTQLSKHTSIFGLRLWVVIGILIG  33



>ref|XP_010919126.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Elaeis guineensis]
Length=495

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS ++  F+NSELSKPTSIFGLKLWVVIGI VG
Sbjct  1    MSFWNGDFLNSELSKPTSIFGLKLWVVIGICVG  33



>gb|KFK30713.1| hypothetical protein AALP_AA6G017900 [Arabis alpina]
Length=479

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS ++  F+N+ELSKPTSIFGLKLWVVIGI +G
Sbjct  1    MSFFNTDFINTELSKPTSIFGLKLWVVIGILLG  33



>gb|KFK30714.1| hypothetical protein AALP_AA6G017900 [Arabis alpina]
Length=480

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS ++  F+N+ELSKPTSIFGLKLWVVIGI +G
Sbjct  1    MSFFNTDFINTELSKPTSIFGLKLWVVIGILLG  33



>ref|XP_003552413.1| PREDICTED: probable serine/threonine-protein kinase At1g01540-like 
[Glycine max]
Length=489

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS++D AF+N++LSK TSIFGL+LWVVIGI +G
Sbjct  1    MSIFDGAFMNTQLSKHTSIFGLRLWVVIGILIG  33



>ref|XP_007139796.1| hypothetical protein PHAVU_008G059400g [Phaseolus vulgaris]
 gb|ESW11790.1| hypothetical protein PHAVU_008G059400g [Phaseolus vulgaris]
Length=493

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS++D AF+N++LSK TSIFGL+LWVVIGI +G
Sbjct  1    MSIFDGAFMNTQLSKHTSIFGLRLWVVIGILIG  33



>ref|XP_008805559.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Phoenix dactylifera]
Length=491

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS ++  F+NSEL+KPTSIFGLKLWVVIGI VG
Sbjct  1    MSFWNGDFLNSELAKPTSIFGLKLWVVIGICVG  33



>ref|XP_003534544.1| PREDICTED: probable serine/threonine-protein kinase At1g01540-like 
[Glycine max]
Length=493

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 23/33 (70%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS++D AF+N++LSK TSIFGL+LWVVIGI +G
Sbjct  1    MSIFDGAFMNTQLSKHTSIFGLRLWVVIGILIG  33



>ref|XP_010556568.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Tarenaya hassleriana]
Length=452

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/33 (73%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS+Y+A  +N+ELSKPTSIFGL+LWVVIGI +G
Sbjct  1    MSLYNATSINTELSKPTSIFGLRLWVVIGILLG  33



>gb|EPS60979.1| hypothetical protein M569_13821 [Genlisea aurea]
Length=512

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Composition-based stats.
 Identities = 26/51 (51%), Positives = 35/51 (69%), Gaps = 1/51 (2%)
 Frame = +2

Query  326  HAFAEREWGVGCV-F*VKMSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            H     +W   C  F ++MS++DA F ++ELSK T IFGL+LW+VIGI VG
Sbjct  396  HQPDREDWCAKCACFRIEMSIFDAIFADTELSKRTPIFGLRLWMVIGIAVG  446



>gb|KHN29322.1| Putative serine/threonine-protein kinase [Glycine soja]
Length=418

 Score = 54.7 bits (130),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 30/33 (91%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS++D AF+N++LSK TSIFGL+LWVVIGI +G
Sbjct  1    MSIFDGAFMNTQLSKHTSIFGLRLWVVIGILIG  33



>ref|XP_008810112.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Phoenix dactylifera]
Length=487

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS +D  F+N  LSKPTSIFGLKLWVVIGI VG
Sbjct  1    MSFWDGNFLNGVLSKPTSIFGLKLWVVIGICVG  33



>ref|NP_192042.5| protein kinase family protein [Arabidopsis thaliana]
 gb|AEE82010.1| protein kinase family protein [Arabidopsis thaliana]
Length=479

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  371  VKMSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            + MS+++   +N+ELSKPTSIFGLKLWVVIGI +G
Sbjct  1    MTMSIFNPDSINNELSKPTSIFGLKLWVVIGILLG  35



>ref|NP_001190651.1| protein kinase family protein [Arabidopsis thaliana]
 gb|AEE82011.1| protein kinase family protein [Arabidopsis thaliana]
Length=480

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  371  VKMSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            + MS+++   +N+ELSKPTSIFGLKLWVVIGI +G
Sbjct  1    MTMSIFNPDSINNELSKPTSIFGLKLWVVIGILLG  35



>gb|KJB41391.1| hypothetical protein B456_007G102400 [Gossypium raimondii]
Length=478

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Composition-based stats.
 Identities = 21/31 (68%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIF  469
            MSVYD AF+N+ELSKPT IFG++LWV++G+ 
Sbjct  1    MSVYDVAFLNAELSKPTPIFGVRLWVLVGLL  31



>ref|XP_003624053.1| Protein kinase family protein [Medicago truncatula]
 gb|AES80271.1| brassinosteroid insensitive 1-associated receptor kinase [Medicago 
truncatula]
Length=491

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 21/33 (64%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS++D  F+N++LSK TSIFGL++WVVIGI +G
Sbjct  1    MSIFDGTFLNTQLSKHTSIFGLRVWVVIGILIG  33



>ref|XP_010427508.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X2 [Camelina sativa]
Length=476

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  371  VKMSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            + MS+++   +N+ELSKPTSIFGLKLWVVIGI +G
Sbjct  1    MTMSLFNPDSINNELSKPTSIFGLKLWVVIGILLG  35



>ref|XP_010427500.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X1 [Camelina sativa]
Length=477

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  371  VKMSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            + MS+++   +N+ELSKPTSIFGLKLWVVIGI +G
Sbjct  1    MTMSLFNPDSINNELSKPTSIFGLKLWVVIGILLG  35



>ref|XP_010422805.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X2 [Camelina sativa]
Length=482

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  371  VKMSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            + MS+++   +N+ELSKPTSIFGLKLWVVIGI +G
Sbjct  4    MTMSLFNPDSINNELSKPTSIFGLKLWVVIGILLG  38



>ref|XP_010422804.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X1 [Camelina sativa]
Length=483

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 0/35 (0%)
 Frame = +2

Query  371  VKMSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            + MS+++   +N+ELSKPTSIFGLKLWVVIGI +G
Sbjct  4    MTMSLFNPDSINNELSKPTSIFGLKLWVVIGILLG  38



>ref|XP_010261327.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Nelumbo nucifera]
Length=491

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Composition-based stats.
 Identities = 26/33 (79%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MSVY+ AF+N ELSKPTSIFGL L VVIGI VG
Sbjct  1    MSVYNTAFLNRELSKPTSIFGLHLSVVIGICVG  33



>ref|XP_010933965.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X1 [Elaeis guineensis]
Length=491

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS +D  F+ SELSKPTSIFGLKLWVVI I VG
Sbjct  1    MSFWDGNFLTSELSKPTSIFGLKLWVVIVICVG  33



>ref|XP_010263506.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Nelumbo nucifera]
Length=524

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 25/33 (76%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS Y AAF+N ELSK TSIFGL+LWVV+GI VG
Sbjct  1    MSDYRAAFLNDELSKRTSIFGLRLWVVLGICVG  33



>gb|ABL66736.1| At4g01330 [Arabidopsis thaliana]
Length=329

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS+++   +N+ELSKPTSIFGLKLWVVIGI +G
Sbjct  3    MSIFNPDSINNELSKPTSIFGLKLWVVIGILLG  35



>gb|AAB61036.1| Similar to protein kinase [Arabidopsis thaliana]
 emb|CAB80942.1| putative protein kinase [Arabidopsis thaliana]
Length=450

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS+++   +N+ELSKPTSIFGLKLWVVIGI +G
Sbjct  1    MSIFNPDSINNELSKPTSIFGLKLWVVIGILLG  33



>gb|KHG15701.1| hypothetical protein F383_10484 [Gossypium arboreum]
Length=478

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 20/31 (65%), Positives = 27/31 (87%), Gaps = 0/31 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIF  469
            M VYD AF+N+ELSKPT IFG++LWV++G+ 
Sbjct  1    MPVYDVAFLNAELSKPTPIFGVRLWVLVGLL  31



>gb|KJB41390.1| hypothetical protein B456_007G102400 [Gossypium raimondii]
Length=369

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 21/31 (68%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIF  469
            MSVYD AF+N+ELSKPT IFG++LWV++G+ 
Sbjct  1    MSVYDVAFLNAELSKPTPIFGVRLWVLVGLL  31



>ref|XP_009111450.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X2 [Brassica rapa]
Length=476

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  371  VKMSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            + +SV +   +N+ELSKPTSIFGLKLWVVIGI +G
Sbjct  11   MTISVLNPDHINAELSKPTSIFGLKLWVVIGILLG  45



>ref|XP_009111449.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X1 [Brassica rapa]
Length=477

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  371  VKMSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            + +SV +   +N+ELSKPTSIFGLKLWVVIGI +G
Sbjct  11   MTISVLNPDHINAELSKPTSIFGLKLWVVIGILLG  45



>ref|XP_006396277.1| hypothetical protein EUTSA_v10028635mg [Eutrema salsugineum]
 gb|ESQ37730.1| hypothetical protein EUTSA_v10028635mg [Eutrema salsugineum]
Length=470

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            +S+++   +NSELSKPTSIFGLKLWVVIGI +G
Sbjct  3    ISIFNPDSINSELSKPTSIFGLKLWVVIGILLG  35



>ref|XP_009411430.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Musa acuminata subsp. malaccensis]
Length=485

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 24/33 (73%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS +   F NSELSK TSIFGL+LWVVIGI VG
Sbjct  1    MSFWRGGFFNSELSKKTSIFGLRLWVVIGICVG  33



>ref|XP_009767889.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Nicotiana sylvestris]
Length=501

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLW  451
            MS+YDAAFVNSELSK TSIFGLKLW
Sbjct  1    MSLYDAAFVNSELSKTTSIFGLKLW  25



>ref|XP_009597783.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X2 [Nicotiana tomentosiformis]
Length=501

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLW  451
            MS+YDAAFVNSELSK TSIFGLKLW
Sbjct  1    MSLYDAAFVNSELSKTTSIFGLKLW  25



>ref|XP_009597781.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009597782.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X1 [Nicotiana tomentosiformis]
Length=504

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 23/25 (92%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLW  451
            MS+YDAAFVNSELSK TSIFGLKLW
Sbjct  1    MSLYDAAFVNSELSKTTSIFGLKLW  25



>ref|XP_009382265.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Musa acuminata subsp. malaccensis]
Length=499

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/33 (67%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS ++  F+N+ELSK TS+FGL+LWVVIGI VG
Sbjct  1    MSFWNGGFLNNELSKKTSVFGLRLWVVIGICVG  33



>ref|XP_006287640.1| hypothetical protein CARUB_v10000851mg [Capsella rubella]
 gb|EOA20538.1| hypothetical protein CARUB_v10000851mg [Capsella rubella]
Length=480

 Score = 51.6 bits (122),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  371  VKMSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            + +S+++   +N ELSKPTSIFGLKLWVVIGI +G
Sbjct  1    MTISLFNPDSINDELSKPTSIFGLKLWVVIGILLG  35



>emb|CBI29390.3| unnamed protein product [Vitis vinifera]
Length=597

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Composition-based stats.
 Identities = 24/30 (80%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = -1

Query  477  APTKIPITTHSFSPKIEVGFESSLFTNAAS  388
            APTK+PITTHS SPKI+VGF+SSLF NA S
Sbjct  556  APTKVPITTHSRSPKIKVGFKSSLFENATS  585



>emb|CDY48518.1| BnaA09g00050D [Brassica napus]
Length=466

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            +SV +   +N+ELSKPTSIFGLKLWVVIGI +G
Sbjct  3    ISVLNPDHINAELSKPTSIFGLKLWVVIGILLG  35



>emb|CDY07192.1| BnaCnng02070D [Brassica napus]
Length=466

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 23/33 (70%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            +SV +   +N+ELSKPTSIFGLKLWVVIGI +G
Sbjct  3    ISVLNPDHINAELSKPTSIFGLKLWVVIGILLG  35



>ref|XP_002874989.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51248.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=481

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  371  VKMSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            + MS+++   +N+ELSK TSIFGLKLWVVIGI +G
Sbjct  1    MTMSIFNPDSINNELSKQTSIFGLKLWVVIGILLG  35



>ref|XP_004510749.1| PREDICTED: probable serine/threonine-protein kinase At1g01540-like 
isoform X2 [Cicer arietinum]
Length=482

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS+YDA F++ +LS+ T+IFGL+LWV+IGI V 
Sbjct  1    MSLYDATFIDKQLSRRTTIFGLRLWVLIGILVA  33



>ref|XP_004510748.1| PREDICTED: probable serine/threonine-protein kinase At1g01540-like 
isoform X1 [Cicer arietinum]
Length=507

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Composition-based stats.
 Identities = 20/33 (61%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS+YDA F++ +LS+ T+IFGL+LWV+IGI V 
Sbjct  1    MSLYDATFIDKQLSRRTTIFGLRLWVLIGILVA  33



>ref|XP_010933966.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X2 [Elaeis guineensis]
Length=434

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS +D  F+ SELSKPTSIFGLKLWVVI I VG
Sbjct  1    MSFWDGNFLTSELSKPTSIFGLKLWVVIVICVG  33



>ref|XP_010456238.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X2 [Camelina sativa]
Length=473

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            +S+++   +N+ELSKPTSIFGLKLWVVIGI +G
Sbjct  3    ISLFNPDSINNELSKPTSIFGLKLWVVIGILLG  35



>ref|XP_010456237.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X1 [Camelina sativa]
Length=474

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 29/33 (88%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            +S+++   +N+ELSKPTSIFGLKLWVVIGI +G
Sbjct  3    ISLFNPDSINNELSKPTSIFGLKLWVVIGILLG  35



>ref|XP_003621777.1| Protein kinase family protein [Medicago truncatula]
 gb|AES77995.1| kinase superfamily protein, putative [Medicago truncatula]
Length=347

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 28/33 (85%), Gaps = 0/33 (0%)
 Frame = +2

Query  377  MSVYDAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            MS++D  F+N++LSK TSIF L+LWVVIGI +G
Sbjct  1    MSIFDGTFLNTQLSKHTSIFFLRLWVVIGILIG  33



>ref|XP_010664563.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X2 [Vitis vinifera]
Length=517

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  389  DAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            + AF+N ELSK TSIFGL+LWVV+GI VG
Sbjct  3    EGAFLNDELSKHTSIFGLRLWVVVGICVG  31



>ref|XP_002282863.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
isoform X1 [Vitis vinifera]
Length=519

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +2

Query  389  DAAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            + AF+N ELSK TSIFGL+LWVV+GI VG
Sbjct  3    EGAFLNDELSKHTSIFGLRLWVVVGICVG  31



>ref|XP_009792774.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Nicotiana sylvestris]
Length=501

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +2

Query  392  AAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            +AF+N ELSK TSIFGL LWVV+GI VG
Sbjct  2    SAFLNDELSKKTSIFGLHLWVVVGIIVG  29



>ref|XP_009604560.1| PREDICTED: probable serine/threonine-protein kinase At1g01540 
[Nicotiana tomentosiformis]
Length=502

 Score = 48.1 bits (113),  Expect = 9e-04, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +2

Query  392  AAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            +AF+N ELSK TSIFGL LWVV+GI VG
Sbjct  2    SAFLNDELSKKTSIFGLHLWVVVGIIVG  29



>emb|CDP01314.1| unnamed protein product [Coffea canephora]
Length=525

 Score = 48.1 bits (113),  Expect = 0.001, Method: Composition-based stats.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +2

Query  392  AAFVNSELSKPTSIFGLKLWVVIGIFVG  475
            AAF+N ELSK TSIFGL+LWVV+G+ VG
Sbjct  12   AAFLNDELSKRTSIFGLRLWVVLGVCVG  39



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 570886093523