BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2998

Length=1186
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010651244.1|  PREDICTED: uncharacterized protein LOC100260...    275   2e-127   Vitis vinifera
ref|XP_002282837.2|  PREDICTED: uncharacterized protein LOC100260...    275   2e-127   
emb|CBI16384.3|  unnamed protein product                                275   3e-127   Vitis vinifera
emb|CAN73088.1|  hypothetical protein VITISV_030762                     275   6e-127   Vitis vinifera
ref|XP_011090367.1|  PREDICTED: uncharacterized protein LOC105171060    269   3e-126   Sesamum indicum [beniseed]
ref|XP_006361748.1|  PREDICTED: uncharacterized protein LOC102597805    267   2e-125   Solanum tuberosum [potatoes]
gb|KJB21894.1|  hypothetical protein B456_004G019700                    268   6e-124   Gossypium raimondii
gb|KJB21895.1|  hypothetical protein B456_004G019700                    268   6e-124   Gossypium raimondii
gb|KJB21893.1|  hypothetical protein B456_004G019700                    268   9e-124   Gossypium raimondii
ref|XP_003539473.1|  PREDICTED: uncharacterized protein LOC100777...    268   1e-123   Glycine max [soybeans]
ref|XP_002314070.2|  hypothetical protein POPTR_0009s05900g             266   4e-123   
ref|XP_011025525.1|  PREDICTED: uncharacterized protein LOC105126373    266   4e-123   Populus euphratica
gb|KEH30215.1|  GTPase Der protein                                      263   7e-123   Medicago truncatula
gb|KHG00071.1|  GTPase Der                                              268   7e-123   Gossypium arboreum [tree cotton]
gb|KHN25243.1|  GTPase Der                                              267   2e-122   Glycine soja [wild soybean]
ref|XP_010519745.1|  PREDICTED: uncharacterized protein LOC104799102    259   2e-122   Tarenaya hassleriana [spider flower]
emb|CDP04574.1|  unnamed protein product                                266   8e-122   Coffea canephora [robusta coffee]
ref|XP_007132015.1|  hypothetical protein PHAVU_011G059500g             259   1e-121   Phaseolus vulgaris [French bean]
ref|XP_006407372.1|  hypothetical protein EUTSA_v10020226mg             260   1e-121   Eutrema salsugineum [saltwater cress]
ref|XP_010031794.1|  PREDICTED: uncharacterized protein LOC104421519    261   2e-121   Eucalyptus grandis [rose gum]
gb|EYU26176.1|  hypothetical protein MIMGU_mgv1a002590mg                258   2e-121   Erythranthe guttata [common monkey flower]
gb|KFK38573.1|  hypothetical protein AALP_AA3G131000                    259   2e-121   Arabis alpina [alpine rockcress]
emb|CDY01098.1|  BnaC05g41020D                                          260   3e-121   
emb|CDY01099.1|  BnaC05g41010D                                          260   3e-121   
ref|XP_009146648.1|  PREDICTED: uncharacterized protein LOC103870279    260   4e-121   Brassica rapa
emb|CDY08458.1|  BnaA05g26940D                                          260   4e-121   Brassica napus [oilseed rape]
ref|XP_010257319.1|  PREDICTED: uncharacterized protein LOC104597...    260   6e-121   Nelumbo nucifera [Indian lotus]
ref|XP_004507094.1|  PREDICTED: GTPase Der-like                         260   7e-121   Cicer arietinum [garbanzo]
ref|XP_010102336.1|  GTPase Der                                         256   1e-120   Morus notabilis
ref|XP_010257317.1|  PREDICTED: uncharacterized protein LOC104597...    259   1e-120   Nelumbo nucifera [Indian lotus]
ref|XP_010257318.1|  PREDICTED: uncharacterized protein LOC104597...    259   1e-120   Nelumbo nucifera [Indian lotus]
gb|AAG51052.1|AC069473_14  GTPase, putative; 34281-30152                260   1e-120   Arabidopsis thaliana [mouse-ear cress]
ref|NP_187815.2|  putative double era-like GTPase                       259   2e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882766.1|  EMB2738                                            260   2e-120   Arabidopsis lyrata subsp. lyrata
ref|XP_010486897.1|  PREDICTED: uncharacterized protein LOC104764969    259   2e-120   Camelina sativa [gold-of-pleasure]
ref|XP_012089992.1|  PREDICTED: uncharacterized protein LOC105648271    256   3e-120   Jatropha curcas
ref|XP_010464959.1|  PREDICTED: uncharacterized protein LOC104745422    258   3e-120   Camelina sativa [gold-of-pleasure]
ref|XP_010498493.1|  PREDICTED: uncharacterized protein LOC104776175    258   3e-120   Camelina sativa [gold-of-pleasure]
dbj|BAB01956.1|  GTP-binding protein-like                               259   4e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006297160.1|  hypothetical protein CARUB_v10013165mg             258   6e-120   Capsella rubella
ref|XP_002513491.1|  GTP-binding protein enga, putative                 252   9e-120   
ref|XP_010673632.1|  PREDICTED: uncharacterized protein LOC104889980    256   2e-119   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006850201.1|  PREDICTED: uncharacterized protein LOC18439984     249   2e-117   Amborella trichopoda
gb|EPS73678.1|  hypothetical protein M569_01078                         238   7e-115   Genlisea aurea
ref|XP_007015041.1|  GTP-binding family protein                         236   1e-114   
ref|XP_009394388.1|  PREDICTED: uncharacterized protein LOC103979...    242   2e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009394391.1|  PREDICTED: uncharacterized protein LOC103979...    242   3e-113   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009394390.1|  PREDICTED: uncharacterized protein LOC103979...    242   3e-113   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC68516.1|  hypothetical protein OsI_36791                          241   4e-113   Oryza sativa Indica Group [Indian rice]
gb|EEE52426.1|  hypothetical protein OsJ_34551                          239   8e-113   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001068337.1|  Os11g0638000                                       239   1e-112   
gb|ABA94923.2|  small GTP-binding protein domain containing prote...    239   2e-112   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006663069.1|  PREDICTED: uncharacterized protein LOC102708...    234   2e-110   
ref|XP_002449905.1|  hypothetical protein SORBIDRAFT_05g025430          230   4e-109   
tpg|DAA42328.1|  TPA: hypothetical protein ZEAMMB73_012049              232   5e-109   
ref|NP_001146320.1|  uncharacterized protein LOC100279896               232   5e-109   
ref|XP_010237502.1|  PREDICTED: uncharacterized protein LOC100845...    230   1e-108   Brachypodium distachyon [annual false brome]
ref|XP_010237503.1|  PREDICTED: uncharacterized protein LOC100845...    230   1e-108   Brachypodium distachyon [annual false brome]
gb|EMS63685.1|  GTPase Der                                              231   1e-108   Triticum urartu
ref|XP_004979812.1|  PREDICTED: uncharacterized protein LOC101764561    229   8e-108   
ref|XP_006592177.1|  PREDICTED: uncharacterized protein LOC100777...    268   3e-107   
gb|EMT17683.1|  GTP-binding protein engA                                232   4e-106   
ref|XP_001770231.1|  predicted protein                                  197   2e-92    
ref|XP_002985833.1|  hypothetical protein SELMODRAFT_123195             193   9e-91    
ref|XP_002984773.1|  hypothetical protein SELMODRAFT_121150             193   3e-90    
ref|XP_006663070.1|  PREDICTED: uncharacterized protein LOC102708...    193   2e-89    
ref|NP_001078139.1|  putative double era-like GTPase                    202   3e-89    Arabidopsis thaliana [mouse-ear cress]
gb|KHN21905.1|  GTPase Der                                              240   1e-84    Glycine soja [wild soybean]
ref|XP_007214807.1|  hypothetical protein PRUPE_ppa023138m2g            267   3e-84    
ref|XP_008227136.1|  PREDICTED: uncharacterized protein LOC103326678    270   5e-80    Prunus mume [ume]
ref|XP_008449721.1|  PREDICTED: uncharacterized protein LOC103491517    270   7e-80    Cucumis melo [Oriental melon]
ref|XP_009768584.1|  PREDICTED: uncharacterized protein LOC104219584    267   7e-79    Nicotiana sylvestris
ref|XP_004142117.1|  PREDICTED: uncharacterized protein LOC101205027    267   1e-78    Cucumis sativus [cucumbers]
ref|XP_009347314.1|  PREDICTED: uncharacterized protein LOC103938985    266   1e-78    Pyrus x bretschneideri [bai li]
ref|XP_009376882.1|  PREDICTED: uncharacterized protein LOC103965542    266   2e-78    
ref|XP_004250946.1|  PREDICTED: uncharacterized protein LOC101251249    266   2e-78    Solanum lycopersicum
gb|AGL34232.1|  plastid GTPase Der                                      266   2e-78    Nicotiana benthamiana
gb|KGN54174.1|  hypothetical protein Csa_4G291380                       266   3e-78    Cucumis sativus [cucumbers]
ref|XP_009615948.1|  PREDICTED: uncharacterized protein LOC104108581    265   3e-78    Nicotiana tomentosiformis
ref|XP_009375054.1|  PREDICTED: uncharacterized protein LOC103963899    265   4e-78    Pyrus x bretschneideri [bai li]
ref|XP_008385564.1|  PREDICTED: uncharacterized protein LOC103448103    265   4e-78    
ref|XP_011469724.1|  PREDICTED: uncharacterized protein LOC101310...    258   2e-75    Fragaria vesca subsp. vesca
ref|XP_004289593.1|  PREDICTED: uncharacterized protein LOC101310...    257   2e-75    Fragaria vesca subsp. vesca
ref|XP_011469726.1|  PREDICTED: uncharacterized protein LOC101310...    256   8e-75    Fragaria vesca subsp. vesca
gb|ACJ85632.1|  unknown                                                 246   3e-74    Medicago truncatula
ref|XP_010907855.1|  PREDICTED: uncharacterized protein LOC105034...    245   3e-72    
ref|XP_010907854.1|  PREDICTED: uncharacterized protein LOC105034...    245   9e-72    
ref|XP_010907853.1|  PREDICTED: uncharacterized protein LOC105034...    245   2e-71    Elaeis guineensis
ref|XP_006470605.1|  PREDICTED: uncharacterized protein LOC102625...    246   5e-71    
ref|XP_006446112.1|  hypothetical protein CICLE_v10014514mg             246   6e-71    Citrus clementina [clementine]
ref|XP_010907852.1|  PREDICTED: uncharacterized protein LOC105034...    246   8e-71    Elaeis guineensis
ref|WP_011319645.1|  GTPase Der                                         147   1e-66    Trichormus variabilis
ref|WP_010994659.1|  GTPase Der                                         145   1e-66    Nostocaceae
ref|WP_015131793.1|  ribosome-associated GTPase EngA                    153   2e-66    Calothrix sp. PCC 7507
ref|WP_015112943.1|  ribosome-associated GTPase EngA                    142   6e-66    Nostoc sp. PCC 7107
ref|WP_045873105.1|  GTPase Der                                         142   2e-65    Nostocales
gb|KDO61267.1|  hypothetical protein CISIN_1g005504mg                   232   2e-65    Citrus sinensis [apfelsine]
ref|WP_015139682.1|  ribosome-associated GTPase EngA                    142   3e-65    Nostoc sp. PCC 7524
gb|KCW51184.1|  hypothetical protein EUGRSUZ_J00770                     204   5e-65    Eucalyptus grandis [rose gum]
ref|WP_039752516.1|  ribosome-associated GTPase EngA                    145   7e-65    
ref|WP_029633792.1|  ribosome-associated GTPase EngA [                  142   1e-64    [Scytonema hofmanni] UTEX B 1581
ref|WP_013192173.1|  ribosome-associated GTPase EngA                    145   2e-64    Trichormus azollae
ref|WP_015206775.1|  ribosome-associated GTPase EngA                    142   1e-63    Cylindrospermum stagnale
ref|WP_016876204.1|  ribosome-associated GTPase EngA                    140   1e-63    Chlorogloeopsis fritschii
ref|WP_017319096.1|  ribosome-associated GTPase EngA                    142   2e-63    Mastigocladopsis repens
ref|WP_011432890.1|  GTPase Der                                         141   3e-63    Synechococcus sp. JA-2-3B'a(2-13)
ref|WP_006277473.1|  ribosome-associated GTPase EngA                    142   3e-63    Cylindrospermopsis raciborskii
ref|WP_012408391.1|  GTPase Der                                         139   3e-63    Nostoc punctiforme
ref|WP_016953465.1|  ribosome-associated GTPase EngA                    145   4e-63    Anabaena sp. PCC 7108
ref|WP_009341396.1|  ribosome-associated GTPase EngA                    141   6e-63    Aphanizomenonaceae
ref|WP_006198540.1|  ribosome-associated GTPase EngA                    142   6e-63    Nodularia spumigena
ref|WP_019498611.1|  ribosome-associated GTPase EngA                    144   8e-63    Pseudanabaena sp. PCC 6802
gb|ERT04166.1|  ribosome-associated GTPase EngA                         144   8e-63    Lyngbya aestuarii BL J
ref|WP_009788122.1|  ribosome-associated GTPase EngA                    144   9e-63    Lyngbya sp. PCC 8106
ref|WP_040484699.1|  ribosome-associated GTPase EngA                    144   9e-63    Lyngbya aestuarii
gb|EDX86223.1|  GTPase, putative                                        138   9e-63    Synechococcus sp. PCC 7335
ref|WP_038015372.1|  ribosome-associated GTPase EngA                    138   9e-63    Synechococcus sp. PCC 7335
ref|WP_009454105.1|  MULTISPECIES: ribosome-associated GTPase EngA      136   1e-62    Fischerella thermalis
ref|WP_015166473.1|  ribosome-associated GTPase EngA                    144   1e-62    Pseudanabaena sp. PCC 7367
ref|WP_017653411.1|  ribosome-associated GTPase EngA                    143   1e-62    Fortiea contorta
ref|WP_016865529.1|  ribosome-associated GTPase EngA                    138   2e-62    Fischerella muscicola
ref|WP_011430082.1|  GTPase Der                                         138   3e-62    Synechococcus
ref|WP_015216887.1|  ribosome-associated GTPase EngA                    140   4e-62    Anabaena cylindrica
ref|WP_026731732.1|  ribosome-associated GTPase EngA                    139   4e-62    Fischerella sp. PCC 9605
ref|WP_011610203.1|  GTPase Der                                         144   4e-62    Trichodesmium erythraeum
ref|WP_006634202.1|  ribosome-associated GTPase EngA                    139   7e-62    Microcoleus vaginatus
ref|WP_019488832.1|  ribosome-associated GTPase EngA                    137   8e-62    Calothrix sp. PCC 7103
ref|WP_039715879.1|  ribosome-associated GTPase EngA                    139   9e-62    
ref|WP_041038340.1|  ribosome-associated GTPase EngA                    137   1e-61    Tolypothrix campylonemoides
ref|WP_024125807.1|  ribosome-associated GTPase EngA                    140   1e-61    Thermosynechococcus sp. NK55a
ref|WP_011244073.1|  MULTISPECIES: GTPase Der                           149   1e-61    Synechococcus
ref|WP_028082829.1|  ribosome-associated GTPase EngA                    137   2e-61    Dolichospermum circinale
ref|WP_015153762.1|  ribosome-associated GTPase EngA                    138   2e-61    Chroococcidiopsis
ref|WP_015178472.1|  ribosome-associated GTPase EngA                    139   3e-61    Oscillatoria nigro-viridis
ref|WP_028091329.1|  ribosome-associated GTPase EngA                    137   3e-61    Dolichospermum circinale
ref|WP_012593504.1|  MULTISPECIES: GTPase Der                           144   4e-61    Cyanothece
ref|WP_037221902.1|  ribosome-associated GTPase EngA                    137   9e-61    
ref|WP_044107095.1|  GTPase Der                                         136   1e-60    cyanobacterium endosymbiont of Epithemia turgida
ref|WP_009629189.1|  ribosome-associated GTPase EngA                    135   1e-60    Pseudanabaena biceps
ref|WP_017743501.1|  ribosome-associated GTPase EngA                    134   2e-60    Scytonema hofmannii
ref|WP_027249351.1|  ribosome-associated GTPase EngA                    138   2e-60    Planktothrix agardhii
ref|WP_026786940.1|  MULTISPECIES: ribosome-associated GTPase EngA      138   2e-60    Planktothrix
gb|KIE12801.1|  GTPase Der                                              133   2e-60    Tolypothrix bouteillei VB521301
ref|WP_015171009.1|  ribosome-associated GTPase EngA                    139   2e-60    Geitlerinema sp. PCC 7407
ref|WP_017718897.1|  ribosome-associated GTPase EngA                    132   2e-60    Oscillatoria sp. PCC 10802
ref|XP_011401550.1|  GTPase Der                                         134   3e-60    Auxenochlorella protothecoides
gb|KIJ80624.1|  GTPase Der                                              134   4e-60    Scytonema tolypothrichoides VB-61278
ref|XP_002509246.1|  predicted protein                                  154   4e-60    Micromonas commoda
ref|WP_011056722.1|  GTPase Der                                         140   4e-60    Thermosynechococcus elongatus
ref|WP_026721377.1|  ribosome-associated GTPase EngA                    136   4e-60    Fischerella sp. PCC 9431
ref|WP_016859054.1|  ribosome-associated GTPase EngA                    132   1e-59    Fischerella muscicola
ref|WP_042151580.1|  ribosome-associated GTPase EngA                    135   1e-59    Planktothrix agardhii
ref|WP_015150727.1|  ribosome-associated GTPase EngA                    130   1e-59    Oscillatoria acuminata
ref|WP_044451605.1|  GTPase Der                                         132   1e-59    Mastigocladus laminosus
ref|WP_039202145.1|  ribosome-associated GTPase EngA                    129   2e-59    Nostocales
ref|WP_027401964.1|  ribosome-associated GTPase EngA                    129   2e-59    Aphanizomenon flos-aquae
gb|KEI65594.1|  EngA                                                    135   2e-59    Planktothrix agardhii NIVA-CYA 126/8
ref|WP_009556849.1|  ribosome-associated GTPase EngA                    137   2e-59    Oscillatoriales cyanobacterium JSC-12
ref|WP_017309647.1|  ribosome-associated GTPase EngA                    132   2e-59    Fischerella sp. PCC 9339
ref|WP_015121858.1|  ribosome-associated GTPase EngA                    130   3e-59    Rivularia sp. PCC 7116
ref|WP_015197239.1|  ribosome-associated GTPase EngA                    129   5e-59    Calothrix parietina
ref|XP_003061511.1|  predicted protein                                  158   6e-59    Micromonas pusilla CCMP1545
ref|WP_017299024.1|  ribosome-associated GTPase EngA                    129   7e-59    Nodosilinea nodulosa
ref|WP_035154056.1|  ribosome-associated GTPase EngA                    129   7e-59    Calothrix sp. 336/3
ref|WP_040054265.1|  ribosome-associated GTPase EngA                    135   8e-59    
ref|XP_001697913.1|  hypothetical protein CHLREDRAFT_120661             141   1e-58    Chlamydomonas reinhardtii
ref|WP_009546754.1|  MULTISPECIES: GTPase Der                           136   1e-58    Cyanothece
ref|WP_017290366.1|  ribosome-associated GTPase EngA                    130   1e-58    Leptolyngbya boryana
ref|WP_007358531.1|  MULTISPECIES: ribosome-associated GTPase EngA      131   1e-58    Kamptonema
ref|WP_032524108.1|  ribosome-associated GTPase EngA                    149   1e-58    Prochlorococcus marinus
ref|WP_009631866.1|  ribosome-associated GTPase EngA                    129   2e-58    Synechocystis sp. PCC 7509
ref|WP_015078384.1|  ribosome-associated GTPase EngA                    129   2e-58    Anabaena sp. 90
ref|XP_008813437.1|  PREDICTED: uncharacterized protein LOC103724...    209   2e-58    
ref|WP_040929759.1|  ribosome-associated GTPase EngA                    136   2e-58    
ref|WP_040939429.1|  ribosome-associated GTPase EngA                    136   2e-58    
ref|WP_018396230.1|  ribosome-associated GTPase EngA                    138   3e-58    filamentous cyanobacterium ESFC-1
ref|WP_008234921.1|  ribosome-associated GTPase EngA                    135   3e-58    
ref|WP_012953913.1|  ribosome-associated GTPase EngA                    135   4e-58    Candidatus Atelocyanobacterium thalassa
ref|WP_025952411.1|  ribosome-associated GTPase EngA                    146   4e-58    
gb|ABE10748.1|  GTP-binding protein                                     147   4e-58    uncultured Prochlorococcus marinus clone ASNC1092
gb|KDO61269.1|  hypothetical protein CISIN_1g005504mg                   209   5e-58    Citrus sinensis [apfelsine]
ref|WP_035987429.1|  ribosome-associated GTPase EngA                    128   5e-58    Leptolyngbya sp. KIOST-1
ref|WP_025971786.1|  ribosome-associated GTPase EngA                    145   5e-58    
ref|WP_021829354.1|  ribosome-associated GTPase EngA                    132   5e-58    
ref|WP_019504656.1|  ribosome-associated GTPase EngA                    136   6e-58    Pleurocapsa sp. PCC 7319
ref|WP_025943936.1|  ribosome-associated GTPase EngA                    146   6e-58    
gb|ABE11270.1|  GTP-binding protein                                     147   6e-58    uncultured Prochlorococcus marinus clone HF10-88F10
ref|WP_025944471.1|  ribosome-associated GTPase EngA                    147   6e-58    
ref|WP_015142441.1|  ribosome-associated GTPase EngA                    137   7e-58    Pleurocapsa minor
ref|WP_025953462.1|  GTPase Der                                         146   7e-58    
ref|WP_025931428.1|  MULTISPECIES: GTPase Der                           146   7e-58    
ref|WP_032515588.1|  MULTISPECIES: ribosome-associated GTPase EngA      146   7e-58    Prochlorococcus
ref|WP_032517522.1|  ribosome-associated GTPase EngA                    147   8e-58    Prochlorococcus marinus
ref|WP_025964619.1|  GTPase Der                                         146   8e-58    
ref|WP_025929191.1|  MULTISPECIES: GTPase Der                           146   8e-58    
ref|WP_025945041.1|  MULTISPECIES: ribosome-associated GTPase EngA      146   8e-58    
ref|WP_011862416.1|  MULTISPECIES: GTPase Der                           146   8e-58    Prochlorococcus
ref|WP_025959358.1|  ribosome-associated GTPase EngA                    146   8e-58    
ref|WP_025962830.1|  ribosome-associated GTPase EngA                    146   8e-58    
ref|WP_011817902.1|  GTPase Der                                         146   9e-58    Prochlorococcus marinus
ref|WP_025906324.1|  MULTISPECIES: ribosome-associated GTPase EngA      146   9e-58    
ref|WP_025924200.1|  GTPase Der                                         146   9e-58    
ref|WP_015204682.1|  ribosome-associated GTPase EngA                    133   9e-58    Crinalium epipsammum
ref|WP_032519539.1|  ribosome-associated GTPase EngA                    146   1e-57    Prochlorococcus marinus
ref|WP_025942178.1|  MULTISPECIES: GTPase Der                           146   1e-57    
ref|WP_035826190.1|  ribosome-associated GTPase EngA                    133   1e-57    Crocosphaera watsonii
ref|XP_001420333.1|  predicted protein                                  157   1e-57    Ostreococcus lucimarinus CCE9901
gb|KGF97332.1|  GTP-binding protein EngA                                146   1e-57    Prochlorococcus marinus str. MIT 9302
ref|WP_007310476.1|  ribosome-associated GTPase EngA                    133   1e-57    
ref|WP_008190660.1|  ribosome-associated GTPase EngA                    130   1e-57    Moorea producens
ref|XP_008813436.1|  PREDICTED: uncharacterized protein LOC103724...    209   1e-57    
ref|WP_025880612.1|  GTPase Der                                         146   2e-57    
ref|WP_017302885.1|  ribosome-associated GTPase EngA                    132   2e-57    Spirulina subsalsa
ref|XP_005535285.1|  GTP-binding protein of engA family                 140   2e-57    Cyanidioschyzon merolae strain 10D
ref|WP_032526702.1|  ribosome-associated GTPase EngA                    145   2e-57    Prochlorococcus marinus
ref|WP_025960871.1|  ribosome-associated GTPase EngA                    145   2e-57    
ref|WP_017661046.1|  ribosome-associated GTPase EngA                    133   2e-57    Geitlerinema sp. PCC 7105
ref|WP_002807087.1|  GTPase Der                                         145   2e-57    Prochlorococcus marinus
ref|WP_025941350.1|  ribosome-associated GTPase EngA                    145   2e-57    
ref|WP_035996465.1|  ribosome-associated GTPase EngA                    134   2e-57    [Leptolyngbya] sp. JSC-1
ref|WP_025926052.1|  ribosome-associated GTPase EngA                    144   2e-57    
ref|WP_012007226.1|  GTPase Der                                         145   2e-57    Prochlorococcus marinus
ref|WP_025933176.1|  ribosome-associated GTPase EngA                    145   2e-57    
ref|WP_032513998.1|  ribosome-associated GTPase EngA                    143   2e-57    Prochlorococcus marinus
ref|WP_006529492.1|  ribosome-associated GTPase EngA                    129   2e-57    Gloeocapsa sp. PCC 73106
ref|WP_015185061.1|  ribosome-associated GTPase EngA                    134   3e-57    Microcoleus sp. PCC 7113
ref|WP_015124686.1|  ribosome-associated GTPase EngA                    135   3e-57    Synechococcus sp. PCC 6312
gb|ABE10882.1|  GTP-binding protein                                     146   3e-57    uncultured Prochlorococcus marinus clone ASNC2259
ref|WP_025929814.1|  ribosome-associated GTPase EngA                    143   3e-57    
ref|WP_036482751.1|  ribosome-associated GTPase EngA                    134   3e-57    Myxosarcina sp. GI1
ref|WP_042711456.1|  ribosome-associated GTPase EngA                    133   4e-57    Crocosphaera watsonii
ref|WP_025955243.1|  ribosome-associated GTPase EngA                    146   4e-57    
ref|WP_015187905.1|  ribosome-associated GTPase EngA                    130   4e-57    Gloeocapsa sp. PCC 7428
gb|EAM51161.1|  Small GTP-binding protein domain:GTP-binding            132   5e-57    Crocosphaera watsonii WH 8501
ref|WP_025914220.1|  ribosome-associated GTPase EngA                    146   5e-57    
ref|WP_011375948.1|  GTPase Der                                         144   5e-57    Prochlorococcus marinus
ref|WP_006105990.1|  ribosome-associated GTPase EngA                    139   7e-57    Coleofasciculus chthonoplastes
ref|WP_012627022.1|  GTPase Der                                         127   7e-57    Cyanothece sp. PCC 7425
ref|WP_008275747.1|  ribosome-associated GTPase EngA                    134   7e-57    Cyanothece sp. CCY0110
ref|WP_017327927.1|  ribosome-associated GTPase EngA                    129   9e-57    Synechococcus sp. PCC 7336
ref|WP_015162474.1|  ribosome-associated GTPase EngA                    127   3e-56    Chamaesiphon minutus
ref|XP_007213298.1|  hypothetical protein PRUPE_ppb024253mg             193   3e-56    
ref|WP_010872829.1|  GTPase Der                                         130   5e-56    Synechocystis
ref|WP_028949233.1|  ribosome-associated GTPase EngA                    129   9e-56    Synechocystis sp. PCC 6714
ref|XP_005713928.1|  unnamed protein product                            130   2e-55    Chondrus crispus [carageen]
ref|WP_022605295.1|  ribosome-associated GTPase EngA                    132   5e-55    Rubidibacter lacunae
ref|WP_019475241.1|  ribosome-associated GTPase EngA                    139   5e-55    
ref|WP_010476306.1|  GTPase Der                                         127   1e-54    Acaryochloris sp. CCMEE 5410
ref|WP_012166078.1|  GTPase Der                                         127   2e-54    Acaryochloris marina
ref|XP_007509383.1|  GTP-binding protein EngA                           162   3e-54    Bathycoccus prasinos
ref|WP_019480514.1|  ribosome-associated GTPase EngA                    137   5e-54    
ref|WP_036921523.1|  ribosome-associated GTPase EngA                    139   3e-53    
ref|WP_007894908.1|  ribosome-associated GTPase EngA                    120   2e-52    Streptococcus pseudoporcinus
ref|WP_019478654.1|  ribosome-associated GTPase EngA                    136   2e-52    
ref|WP_013781460.1|  ribosome-associated GTPase EngA                    132   3e-52    Mahella australiensis
ref|WP_003085171.1|  ribosome-associated GTPase EngA                    119   4e-52    Streptococcus porcinus
ref|WP_025927393.1|  hypothetical protein                               130   5e-52    
ref|WP_020917354.1|  ribosome-associated GTPase EngA                    117   9e-52    Streptococcus lutetiensis
ref|WP_003101663.1|  ribosome-associated GTPase EngA                    120   9e-52    Streptococcus iniae
ref|WP_021143005.1|  ribosome-associated GTPase EngA                    116   1e-51    Streptococcus equinus
ref|WP_025967862.1|  ribosome-associated GTPase EngA                    146   1e-51    
ref|WP_003049745.1|  ribosome-associated GTPase EngA                    119   1e-51    Streptococcus dysgalactiae
ref|WP_022237873.1|  ribosome-associated GTPase EngA                    123   1e-51    
ref|WP_027969842.1|  ribosome-associated GTPase EngA                    118   1e-51    Streptococcus castoreus
ref|WP_027973487.1|  ribosome-associated GTPase EngA                    119   1e-51    Streptococcus porci
ref|WP_023610030.1|  GTPase Der                                         119   2e-51    Streptococcus pyogenes
ref|WP_025956514.1|  GTPase Der                                         146   2e-51    
ref|WP_027972616.1|  ribosome-associated GTPase EngA                    116   2e-51    Streptococcus plurextorum
ref|WP_003059001.1|  ribosome-associated GTPase EngA                    119   2e-51    Streptococcus dysgalactiae
ref|WP_004233037.1|  ribosome-associated GTPase EngA                    115   2e-51    Streptococcus equinus
ref|WP_039696382.1|  ribosome-associated GTPase EngA                    115   2e-51    Streptococcus
ref|WP_003066176.1|  MULTISPECIES: ribosome-associated GTPase EngA      117   2e-51    Streptococcus
ref|WP_003092252.1|  ribosome-associated GTPase EngA                    117   3e-51    Streptococcus vestibularis
ref|WP_003046772.1|  ribosome-associated GTPase EngA                    119   3e-51    Streptococcus canis
gb|ETW91528.1|  GTP-binding protein Der                                 116   4e-51    Streptococcus thermophilus M17PTZA496
ref|WP_023054216.1|  ribosome-associated GTPase EngA                    120   5e-51    Megasphaera sp. BV3C16-1
ref|WP_035451697.1|  ribosome-associated GTPase EngA                    117   5e-51    Lactobacillus composti
ref|WP_022795581.1|  ribosome-associated GTPase EngA                    117   5e-51    Bavariicoccus seileri
ref|WP_013643363.1|  ribosome-associated GTPase EngA                    115   5e-51    Streptococcus gallolyticus
ref|WP_030127017.1|  ribosome-associated GTPase EngA                    119   6e-51    
ref|WP_002949644.1|  GTPase Der                                         116   6e-51    
ref|WP_019226346.1|  MULTISPECIES: ribosome-associated GTPase EngA      120   6e-51    
ref|WP_011680741.1|  GTPase Der                                         116   6e-51    
ref|WP_020490978.1|  ribosome-associated GTPase EngA                    120   7e-51    
ref|WP_002946789.1|  MULTISPECIES: ribosome-associated GTPase EngA      116   7e-51    
ref|WP_015043054.1|  MULTISPECIES: ribosome-associated GTPase EngA      120   7e-51    
ref|WP_030127141.1|  GTPase Der                                         119   7e-51    
ref|WP_037595740.1|  ribosome-associated GTPase EngA                    115   7e-51    
ref|WP_022495833.1|  ribosome-associated GTPase EngA                    116   7e-51    
ref|WP_015016700.1|  MULTISPECIES: ribosome-associated GTPase EngA      119   7e-51    
ref|WP_018165199.1|  ribosome-associated GTPase EngA                    116   8e-51    
ref|WP_014335207.1|  ribosome-associated GTPase EngA                    115   8e-51    
gb|EQC71281.1|  GTP-binding protein EngA                                116   8e-51    
gb|EJO16386.1|  GTP-binding protein                                     116   8e-51    
ref|WP_006702316.1|  ribosome-associated GTPase EngA                    115   8e-51    
ref|WP_010768714.1|  ribosome-associated GTPase EngA                    119   8e-51    
gb|EQG76389.1|  ribosome-associated GTPase EngA                         115   8e-51    
ref|WP_006532912.1|  ribosome-associated GTPase EngA                    115   8e-51    
gb|EEK10879.1|  ribosome biogenesis GTPase Der                          116   8e-51    
ref|WP_014607972.1|  GTPase Der                                         115   9e-51    
ref|WP_021145039.1|  ribosome-associated GTPase EngA                    115   9e-51    
ref|WP_021151440.1|  ribosome-associated GTPase EngA                    115   9e-51    
ref|WP_011225483.1|  GTPase Der                                         115   9e-51    
gb|EQI01849.1|  ribosome-associated GTPase EngA                         115   9e-51    
gb|EWM57762.1|  GTP-binding protein Der                                 115   9e-51    
ref|WP_011284518.1|  GTPase Der                                         119   9e-51    
ref|WP_032463632.1|  GTPase Der                                         119   9e-51    
ref|WP_002991013.1|  GTPase Der                                         119   1e-50    
ref|WP_003103613.1|  ribosome-associated GTPase EngA                    115   1e-50    
gb|KGE60889.1|  ribosome-associated GTPase EngA                         119   1e-50    
ref|WP_003416123.1|  ribosome-associated GTPase EngA                    115   1e-50    
ref|WP_020833267.1|  ribosome-associated GTPase EngA                    119   1e-50    
ref|WP_002985935.1|  ribosome-associated GTPase EngA                    119   1e-50    
ref|WP_038433693.1|  GTPase Der                                         119   1e-50    
ref|WP_017770841.1|  ribosome-associated GTPase EngA                    115   1e-50    
ref|WP_002889183.1|  ribosome-associated GTPase EngA                    115   1e-50    
ref|WP_002886596.1|  MULTISPECIES: ribosome-associated GTPase EngA      115   1e-50    
ref|WP_032464820.1|  ribosome-associated GTPase EngA                    119   1e-50    
ref|WP_004256153.1|  ribosome-associated GTPase EngA                    116   1e-50    
ref|WP_031488563.1|  ribosome-associated GTPase EngA                    119   1e-50    
ref|WP_037597430.1|  ribosome-associated GTPase EngA                    116   1e-50    
ref|WP_037600316.1|  ribosome-associated GTPase EngA                    116   1e-50    
ref|WP_003135558.1|  ribosome-associated GTPase EngA                    116   1e-50    
ref|WP_021385505.1|  ribosome-associated GTPase EngA                    115   1e-50    
ref|WP_021403870.1|  ribosome-associated GTPase EngA                    115   1e-50    
ref|WP_014024530.1|  ribosome-associated GTPase EngA                    116   1e-50    
ref|WP_009854815.1|  ribosome-associated GTPase EngA                    115   1e-50    
ref|WP_003426959.1|  ribosome-associated GTPase EngA                    115   1e-50    
ref|WP_021388143.1|  ribosome-associated GTPase EngA                    115   1e-50    
ref|WP_018375772.1|  ribosome-associated GTPase EngA                    114   1e-50    
ref|WP_021422536.1|  ribosome-associated GTPase EngA                    115   1e-50    
ref|WP_030126151.1|  ribosome-associated GTPase EngA                    117   1e-50    
ref|WP_012657919.1|  GTPase Der                                         117   1e-50    
gb|EFU73529.1|  ribosome biogenesis GTPase Der                          120   2e-50    
ref|WP_029691199.1|  ribosome-associated GTPase EngA                    115   2e-50    
ref|WP_018367542.1|  ribosome-associated GTPase EngA                    117   2e-50    
ref|WP_014295158.1|  ribosome-associated GTPase EngA                    115   2e-50    
ref|WP_037592454.1|  GTPase Der                                         117   2e-50    
ref|WP_008535902.1|  ribosome-associated GTPase EngA                    115   2e-50    
ref|WP_011528270.1|  GTPase Der                                         118   2e-50    
ref|WP_018381114.1|  ribosome-associated GTPase EngA                    115   2e-50    
ref|WP_012962413.1|  ribosome-associated GTPase EngA                    115   2e-50    
ref|WP_040366821.1|  ribosome-associated GTPase EngA                    120   2e-50    
ref|WP_008088296.1|  ribosome-associated GTPase EngA                    118   2e-50    
ref|WP_038811443.1|  ribosome-associated GTPase EngA                    115   2e-50    
ref|WP_018365508.1|  ribosome-associated GTPase EngA                    115   2e-50    
emb|CEW37949.1|  GTP-binding protein EngA                               119   2e-50    
ref|WP_021421692.1|  ribosome-associated GTPase EngA                    115   2e-50    
ref|WP_007391315.1|  MULTISPECIES: ribosome-associated GTPase EngA      122   2e-50    
ref|WP_032462298.1|  GTPase Der                                         117   2e-50    
ref|WP_039694023.1|  ribosome-associated GTPase EngA                    115   2e-50    
ref|WP_005237082.1|  MULTISPECIES: ribosome-associated GTPase EngA      119   2e-50    
ref|WP_005231911.1|  ribosome-associated GTPase EngA                    119   2e-50    
ref|WP_023612129.1|  ribosome-associated GTPase EngA                    117   3e-50    
ref|WP_023605005.1|  GTPase Der                                         117   3e-50    
ref|WP_014015903.1|  MULTISPECIES: ribosome-associated GTPase EngA      119   3e-50    
ref|WP_011054203.1|  GTPase Der                                         117   3e-50    
ref|WP_042756334.1|  GTPase Der                                         117   3e-50    
ref|WP_008381044.1|  ribosome-associated GTPase EngA                    119   3e-50    
ref|WP_032460969.1|  ribosome-associated GTPase EngA                    117   3e-50    
ref|WP_023611386.1|  ribosome-associated GTPase EngA                    117   3e-50    
ref|WP_018211304.1|  GTPase Der                                         122   4e-50    
ref|WP_021733991.1|  GTPase Der                                         117   4e-50    
ref|WP_015510071.1|  ribosome-associated GTPase EngA                    119   4e-50    
ref|WP_032460017.1|  ribosome-associated GTPase EngA                    117   4e-50    
ref|WP_031575509.1|  ribosome-associated GTPase EngA                    119   4e-50    
ref|WP_032461702.1|  ribosome-associated GTPase EngA                    119   4e-50    
ref|WP_003013034.1|  ribosome-associated GTPase EngA                    119   4e-50    
ref|WP_003005632.1|  MULTISPECIES: ribosome-associated GTPase EngA      119   4e-50    
ref|WP_014794611.1|  MULTISPECIES: ribosome-associated GTPase EngA      121   4e-50    
ref|WP_001207697.1|  GTPase Der                                         119   4e-50    
gb|EDK66803.1|  GTP-binding protein EngA                                119   4e-50    
ref|WP_025908375.1|  ribosome-associated GTPase EngA                    117   4e-50    
ref|WP_013852181.1|  ribosome-associated GTPase EngA                    115   5e-50    
ref|WP_001207708.1|  ribosome-associated GTPase EngA                    118   5e-50    
ref|WP_001207683.1|  ribosome-associated GTPase EngA                    118   5e-50    
ref|WP_001207687.1|  MULTISPECIES: ribosome-associated GTPase EngA      118   6e-50    
ref|WP_042900505.1|  GTPase Der                                         119   6e-50    
ref|WP_001207686.1|  ribosome-associated GTPase EngA                    118   7e-50    
ref|WP_004258542.1|  ribosome-associated GTPase EngA                    119   7e-50    
emb|CFG36080.1|  GTP-binding protein EngA                               119   7e-50    
ref|WP_001207691.1|  ribosome-associated GTPase EngA                    118   7e-50    
ref|WP_034550005.1|  ribosome-associated GTPase EngA                    115   7e-50    
ref|WP_044503244.1|  GTP-binding protein Der                            119   8e-50    
ref|WP_014572928.1|  GTPase Der                                         114   8e-50    
emb|CEX50507.1|  GTP-binding protein EngA                               119   8e-50    
ref|WP_024393868.1|  ribosome-associated GTPase EngA                    116   8e-50    
ref|WP_018369308.1|  ribosome-associated GTPase EngA                    116   8e-50    
ref|WP_011889131.1|  GTPase Der                                         116   9e-50    
ref|WP_017647675.1|  ribosome-associated GTPase EngA                    116   9e-50    
emb|CEZ83826.1|  GTP-binding protein EngA                               119   9e-50    
emb|CEY28235.1|  GTP-binding protein EngA                               119   9e-50    
ref|WP_011675724.1|  GTPase Der                                         113   9e-50    
emb|CEX90113.1|  GTP-binding protein EngA                               119   9e-50    
emb|CEW24317.1|  GTP-binding protein EngA                               119   9e-50    
ref|WP_018373281.1|  ribosome-associated GTPase EngA                    119   9e-50    
ref|WP_001207703.1|  MULTISPECIES: ribosome-associated GTPase EngA      119   9e-50    
emb|CFG11095.1|  GTP-binding protein EngA                               119   9e-50    
ref|WP_042748853.1|  ribosome-associated GTPase EngA                    113   9e-50    
ref|WP_033683214.1|  ribosome-associated GTPase EngA                    119   9e-50    
ref|WP_001207696.1|  MULTISPECIES: GTPase Der                           119   9e-50    
emb|CEQ01091.1|  GTP-binding protein Der [ [                            117   9e-50    
ref|WP_021129236.1|  ribosome-associated GTPase EngA [                  117   9e-50    
emb|CFC32161.1|  GTP-binding protein EngA                               119   9e-50    
emb|CFG09379.1|  GTP-binding protein EngA                               119   9e-50    
emb|CEZ43100.1|  GTP-binding protein EngA                               119   1e-49    
ref|WP_025016737.1|  GTPase Der                                         113   1e-49    
ref|WP_015605756.1|  ribosome-associated GTPase EngA                    117   1e-49    
ref|WP_014635290.1|  ribosome-associated GTPase EngA                    117   1e-49    
ref|WP_001207705.1|  MULTISPECIES: ribosome-associated GTPase EngA      118   1e-49    
ref|WP_001207701.1|  ribosome-associated GTPase EngA                    119   1e-49    
ref|WP_035028353.1|  ribosome-associated GTPase EngA                    114   1e-49    
ref|WP_009730455.1|  ribosome-associated GTPase EngA                    118   1e-49    
ref|WP_018370753.1|  ribosome-associated GTPase EngA                    114   1e-49    
ref|WP_004226789.1|  ribosome-associated GTPase EngA                    114   1e-49    
ref|WP_033584374.1|  ribosome-associated GTPase EngA                    118   1e-49    
ref|WP_016179949.1|  ribosome-associated GTPase EngA                    115   1e-49    
ref|WP_024057294.1|  ribosome-associated GTPase EngA                    119   1e-49    
ref|WP_024532836.1|  ribosome-associated GTPase EngA                    116   1e-49    
ref|WP_006739060.1|  ribosome-associated GTPase EngA                    116   1e-49    
ref|WP_001207711.1|  ribosome-associated GTPase EngA                    118   1e-49    
ref|WP_001207698.1|  GTPase Der                                         119   1e-49    
ref|WP_001207712.1|  ribosome-associated GTPase EngA                    118   1e-49    
ref|WP_011460200.1|  GTPase Der                                         122   1e-49    
ref|WP_015944579.1|  GTPase Der                                         122   1e-49    
ref|WP_012897443.1|  GTPase Der                                         113   1e-49    
ref|WP_001207699.1|  ribosome-associated GTPase EngA                    119   1e-49    
ref|WP_024396420.1|  ribosome-associated GTPase EngA                    115   1e-49    
ref|WP_001207692.1|  MULTISPECIES: ribosome-associated GTPase EngA      118   1e-49    
ref|WP_000244015.1|  ribosome-associated GTPase EngA                    116   1e-49    
ref|WP_018306797.1|  GTPase Der                                         122   1e-49    
ref|WP_045616786.1|  GTP-binding protein Der                            118   1e-49    
ref|WP_002418923.1|  ribosome-associated GTPase EngA                    118   1e-49    
ref|WP_020311473.1|  MULTISPECIES: ribosome-associated GTPase EngA      119   1e-49    
ref|WP_001207700.1|  ribosome-associated GTPase EngA                    119   1e-49    
ref|WP_001207690.1|  MULTISPECIES: ribosome-associated GTPase EngA      118   1e-49    
ref|WP_001207684.1|  ribosome-associated GTPase EngA                    118   1e-49    
gb|EPZ60252.1|  small GTP-binding domain protein [ [                    117   1e-49    
ref|WP_001207695.1|  GTPase Der                                         119   1e-49    
ref|WP_045592498.1|  GTP-binding protein Der                            118   1e-49    
ref|WP_023024130.1|  ribosome-associated GTPase EngA                    118   1e-49    
ref|WP_001207688.1|  ribosome-associated GTPase EngA                    118   1e-49    
ref|WP_003132476.1|  GTPase Der                                         113   1e-49    
ref|WP_002380289.1|  ribosome-associated GTPase EngA                    118   1e-49    
ref|WP_024391139.1|  ribosome-associated GTPase EngA                    115   1e-49    
ref|WP_001207704.1|  ribosome-associated GTPase EngA                    118   1e-49    
ref|WP_001207682.1|  ribosome-associated GTPase EngA                    118   1e-49    
ref|WP_001207710.1|  ribosome-associated GTPase EngA                    118   1e-49    
ref|WP_045762664.1|  GTP-binding protein Der                            118   1e-49    
ref|WP_001207693.1|  MULTISPECIES: ribosome-associated GTPase EngA      118   1e-49    
ref|WP_006149414.1|  ribosome-associated GTPase EngA                    118   1e-49    
ref|WP_045613478.1|  GTP-binding protein Der                            118   1e-49    
ref|WP_021036913.1|  GTPase Der                                         112   1e-49    
ref|WP_004250788.1|  MULTISPECIES: ribosome-associated GTPase EngA      118   1e-49    
ref|WP_001207709.1|  MULTISPECIES: ribosome-associated GTPase EngA      118   1e-49    
ref|WP_010753303.1|  ribosome-associated GTPase EngA                    116   1e-49    
ref|WP_021935017.1|  ribosome-associated GTPase EngA                    118   1e-49    
ref|WP_000244010.1|  ribosome-associated GTPase EngA                    118   1e-49    
gb|EHL07464.1|  ribosome biogenesis GTPase Der                          122   2e-49    
ref|WP_006595767.1|  ribosome-associated GTPase EngA                    118   2e-49    
ref|WP_044811555.1|  GTP-binding protein Der                            119   2e-49    
emb|CEX04711.1|  GTP-binding protein EngA                               119   2e-49    
ref|WP_027890617.1|  ribosome-associated GTPase EngA                    119   2e-49    
ref|WP_042768560.1|  ribosome-associated GTPase EngA                    118   2e-49    
ref|WP_001207702.1|  ribosome-associated GTPase EngA                    119   2e-49    
ref|WP_023027162.1|  ribosome-associated GTPase EngA                    118   2e-49    
ref|WP_010707592.1|  ribosome-associated GTPase EngA                    118   2e-49    
ref|WP_007517163.1|  ribosome-associated GTPase EngA                    118   2e-49    
ref|WP_001207694.1|  ribosome-associated GTPase EngA                    119   2e-49    
ref|WP_014636107.1|  GTPase Der                                         115   2e-49    
ref|WP_016625576.1|  ribosome-associated GTPase EngA                    114   2e-49    
ref|WP_044676061.1|  GTP-binding protein Der                            115   2e-49    
ref|WP_029185426.1|  ribosome-associated GTPase EngA                    115   2e-49    
gb|KHO11826.1|  ribosome-associated GTPase EngA                         112   2e-49    
ref|WP_016617310.1|  ribosome-associated GTPase EngA                    118   2e-49    
ref|WP_002357608.1|  MULTISPECIES: ribosome-associated GTPase EngA      118   2e-49    
ref|WP_038804973.1|  ribosome-associated GTPase EngA                    117   2e-49    
ref|WP_004270389.1|  ribosome-associated GTPase EngA                    112   2e-49    
ref|WP_036944327.1|  ribosome-associated GTPase EngA                    121   2e-49    
ref|WP_001207689.1|  ribosome-associated GTPase EngA                    118   2e-49    
ref|WP_044684118.1|  GTP-binding protein Der                            115   2e-49    
ref|WP_002942705.1|  ribosome-associated GTPase EngA                    115   2e-49    
gb|EGG53395.1|  ribosome biogenesis GTPase Der                          118   2e-49    
ref|WP_010710393.1|  ribosome-associated GTPase EngA                    118   2e-49    
ref|WP_006154629.1|  ribosome-associated GTPase EngA                    117   2e-49    
ref|WP_006150861.1|  ribosome-associated GTPase EngA                    117   2e-49    
emb|CFG23603.1|  GTP-binding protein EngA                               115   2e-49    
ref|WP_029171461.1|  GTPase Der                                         115   2e-49    
ref|WP_022476684.1|  ribosome-associated GTPase EngA                    129   2e-49    
ref|WP_024384558.1|  ribosome-associated GTPase EngA                    115   2e-49    
ref|WP_010784014.1|  ribosome-associated GTPase EngA                    118   2e-49    
ref|WP_044682066.1|  GTPase Der                                         115   2e-49    
ref|WP_024406639.1|  ribosome-associated GTPase EngA                    115   2e-49    
ref|WP_044775158.1|  GTP-binding protein Der                            115   2e-49    
ref|WP_018377046.1|  ribosome-associated GTPase EngA                    116   2e-49    
ref|WP_001932998.1|  ribosome-associated GTPase EngA                    116   2e-49    
ref|WP_024394984.1|  ribosome-associated GTPase EngA                    115   2e-49    
ref|WP_044758146.1|  GTP-binding protein Der                            115   2e-49    
ref|WP_006146311.1|  ribosome-associated GTPase EngA                    118   2e-49    
ref|WP_029172749.1|  GTPase Der                                         115   2e-49    



>ref|XP_010651244.1| PREDICTED: uncharacterized protein LOC100260310 isoform X1 [Vitis 
vinifera]
Length=677

 Score =   275 bits (703),  Expect(2) = 2e-127, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TATYYEQDVR KLRVLGWAPIVYSTAIAGHSVDKIIV A+ VEKERSRRL+T+IL
Sbjct  511  NKNQQTATYYEQDVREKLRVLGWAPIVYSTAIAGHSVDKIIVAASTVEKERSRRLSTSIL  570

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVV+EA+AFKSPPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLF ETYRRYMEKQLR
Sbjct  571  NQVVQEALAFKSPPRNRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFPETYRRYMEKQLR  630

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGK-VSRETSTSLERR  386
            S AGFSGTPIRLLWRSRRK+EK+G +  S +T  +L  R
Sbjct  631  SDAGFSGTPIRLLWRSRRKIEKNGARAASAKTQANLAPR  669


 Score =   209 bits (533),  Expect(2) = 2e-127, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEFTG DGQKYRLIDTAGIR++A VASSGS TEALSVN+A
Sbjct  402   VGEDRTIVSPVSGTTRDAIDTEFTGPDGQKYRLIDTAGIRRRAAVASSGSTTEALSVNRA  461

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD +IAERIE+EGKGCL+VVNKWDTIP K  Q
Sbjct  462   FRAIRRSDVVALVIEAMACITEQDYRIAERIEREGKGCLIVVNKWDTIPNKNQQ  515



>ref|XP_002282837.2| PREDICTED: uncharacterized protein LOC100260310 isoform X2 [Vitis 
vinifera]
Length=676

 Score =   275 bits (703),  Expect(2) = 2e-127, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TATYYEQDVR KLRVLGWAPIVYSTAIAGHSVDKIIV A+ VEKERSRRL+T+IL
Sbjct  510  NKNQQTATYYEQDVREKLRVLGWAPIVYSTAIAGHSVDKIIVAASTVEKERSRRLSTSIL  569

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVV+EA+AFKSPPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLF ETYRRYMEKQLR
Sbjct  570  NQVVQEALAFKSPPRNRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFPETYRRYMEKQLR  629

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGK-VSRETSTSLERR  386
            S AGFSGTPIRLLWRSRRK+EK+G +  S +T  +L  R
Sbjct  630  SDAGFSGTPIRLLWRSRRKIEKNGARAASAKTQANLAPR  668


 Score =   209 bits (533),  Expect(2) = 2e-127, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEFTG DGQKYRLIDTAGIR++A VASSGS TEALSVN+A
Sbjct  401   VGEDRTIVSPVSGTTRDAIDTEFTGPDGQKYRLIDTAGIRRRAAVASSGSTTEALSVNRA  460

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD +IAERIE+EGKGCL+VVNKWDTIP K  Q
Sbjct  461   FRAIRRSDVVALVIEAMACITEQDYRIAERIEREGKGCLIVVNKWDTIPNKNQQ  514



>emb|CBI16384.3| unnamed protein product [Vitis vinifera]
Length=658

 Score =   275 bits (703),  Expect(2) = 3e-127, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TATYYEQDVR KLRVLGWAPIVYSTAIAGHSVDKIIV A+ VEKERSRRL+T+IL
Sbjct  492  NKNQQTATYYEQDVREKLRVLGWAPIVYSTAIAGHSVDKIIVAASTVEKERSRRLSTSIL  551

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVV+EA+AFKSPPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLF ETYRRYMEKQLR
Sbjct  552  NQVVQEALAFKSPPRNRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFPETYRRYMEKQLR  611

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGK-VSRETSTSLERR  386
            S AGFSGTPIRLLWRSRRK+EK+G +  S +T  +L  R
Sbjct  612  SDAGFSGTPIRLLWRSRRKIEKNGARAASAKTQANLAPR  650


 Score =   209 bits (532),  Expect(2) = 3e-127, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEFTG DGQKYRLIDTAGIR++A VASSGS TEALSVN+A
Sbjct  383   VGEDRTIVSPVSGTTRDAIDTEFTGPDGQKYRLIDTAGIRRRAAVASSGSTTEALSVNRA  442

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD +IAERIE+EGKGCL+VVNKWDTIP K  Q
Sbjct  443   FRAIRRSDVVALVIEAMACITEQDYRIAERIEREGKGCLIVVNKWDTIPNKNQQ  496



>emb|CAN73088.1| hypothetical protein VITISV_030762 [Vitis vinifera]
Length=344

 Score =   275 bits (703),  Expect(2) = 6e-127, Method: Compositional matrix adjust.
 Identities = 133/155 (86%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TATYYEQDVR KLRVLGWAPIVYSTAIAGHSVDKIIV A+ VEKERSRRL+T+IL
Sbjct  181  NKNQQTATYYEQDVREKLRVLGWAPIVYSTAIAGHSVDKIIVAASTVEKERSRRLSTSIL  240

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVV+EA+AFKSPPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLF ETYRRYMEKQLR
Sbjct  241  NQVVQEALAFKSPPRNRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFPETYRRYMEKQLR  300

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSL  395
            S AGFSGTPIRLLWRSRRK+EK+G   + + S SL
Sbjct  301  SDAGFSGTPIRLLWRSRRKIEKNGVGKANQGSCSL  335


 Score =   208 bits (529),  Expect(2) = 6e-127, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEFTG DGQKYRLIDTAGIR++A VASSGS TEALSVN+A
Sbjct  72    VGEDRTIVSPVSGTTRDAIDTEFTGPDGQKYRLIDTAGIRRRAAVASSGSTTEALSVNRA  131

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD +IAERIE+EGKGCL+VVNKWDTIP K  Q
Sbjct  132   FRAIRRSDVVALVIEAMACITEQDYRIAERIEREGKGCLIVVNKWDTIPNKNQQ  185



>ref|XP_011090367.1| PREDICTED: uncharacterized protein LOC105171060 [Sesamum indicum]
Length=657

 Score =   269 bits (687),  Expect(2) = 3e-126, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA +YE+DVRGKLR+L WAPIVYSTAI G SV+KIIV A+ VEKERSRRL+TAIL
Sbjct  491  NKNQQTAMHYEEDVRGKLRILNWAPIVYSTAIQGQSVEKIIVAASMVEKERSRRLSTAIL  550

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVVREAVAFK+PPR RGGKRGRVYYCTQAAIRPPTFVFFVND+KLF ETYRRYMEKQLR
Sbjct  551  NQVVREAVAFKAPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDSKLFPETYRRYMEKQLR  610

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGK  422
            SSAGF+GTPIRLLWRSRRK+EKD GK
Sbjct  611  SSAGFAGTPIRLLWRSRRKVEKDEGK  636


 Score =   212 bits (539),  Expect(2) = 3e-126, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEFTGSDGQK+RLIDTAGIRK+A VASSGS TEALSVN+A
Sbjct  382   VGEDRTIVSPISGTTRDAIDTEFTGSDGQKFRLIDTAGIRKRAAVASSGSTTEALSVNRA  441

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRA+RRSDVVALVIEAM+CITEQD KIAERIEKEGKGCL+VVNKWDTIP K  Q
Sbjct  442   FRAVRRSDVVALVIEAMACITEQDFKIAERIEKEGKGCLIVVNKWDTIPNKNQQ  495



>ref|XP_006361748.1| PREDICTED: uncharacterized protein LOC102597805 [Solanum tuberosum]
Length=646

 Score =   267 bits (682),  Expect(2) = 2e-125, Method: Compositional matrix adjust.
 Identities = 131/165 (79%), Positives = 143/165 (87%), Gaps = 4/165 (2%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ T  +YE+DVR K+R L WAPIVYSTAIAGHSV+KIIV+AAAVEKERSRRLTTAIL
Sbjct  480  NKNQETTVFYEEDVRRKVRSLSWAPIVYSTAIAGHSVEKIIVSAAAVEKERSRRLTTAIL  539

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVVREAVAFK+PPR RGGKRGRVYY TQAAIRPPTFVFFVNDAKLF ETYRRYMEKQLR
Sbjct  540  NQVVREAVAFKAPPRTRGGKRGRVYYSTQAAIRPPTFVFFVNDAKLFPETYRRYMEKQLR  599

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGK----VSRETSTSLERRLEV  377
            +SAGF+GTPIRLLWRSRRKMEK  GK      ++  T +E+ L V
Sbjct  600  TSAGFAGTPIRLLWRSRRKMEKSAGKGPSTTMQDNFTGIEKSLAV  644


 Score =   211 bits (538),  Expect(2) = 2e-125, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEFTG DGQK+RLIDTAGIRKK  VASSGSI EALSVNQA
Sbjct  371   VGEDRTIVSPVSGTTRDAIDTEFTGPDGQKFRLIDTAGIRKKTAVASSGSIPEALSVNQA  430

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQDCKIAERIE EGKGCL+VVNKWDTIP K  +
Sbjct  431   FRAIRRSDVVALVIEAMACITEQDCKIAERIEGEGKGCLIVVNKWDTIPNKNQE  484



>gb|KJB21894.1| hypothetical protein B456_004G019700 [Gossypium raimondii]
Length=656

 Score =   268 bits (684),  Expect(2) = 6e-124, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TATYYEQDVR K+R+L WAPIVYSTAI G SV+K+IV A+ VEKER+RRL+TAIL
Sbjct  491  NKNQQTATYYEQDVREKMRMLDWAPIVYSTAITGQSVEKVIVAASTVEKERARRLSTAIL  550

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REA+AFK PPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLF ETYRRYMEKQLR
Sbjct  551  NQVIREAIAFKPPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFPETYRRYMEKQLR  610

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSLERR  386
            S AGF+GTPIRLLWRSRRK+EKD GK +  T ++L  R
Sbjct  611  SDAGFAGTPIRLLWRSRRKVEKDEGKAATRTRSNLSPR  648


 Score =   205 bits (522),  Expect(2) = 6e-124, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GEDRTIVSP+SGTTRDAIDTEF G DGQK+RLIDTAGIR++A+VASSGS TEALSVN+A
Sbjct  382   LGEDRTIVSPISGTTRDAIDTEFVGPDGQKFRLIDTAGIRRRASVASSGSTTEALSVNRA  441

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD +IAERIEKEGKGCL+VVNKWDTIP K  Q
Sbjct  442   FRAIRRSDVVALVIEAMACITEQDTRIAERIEKEGKGCLIVVNKWDTIPNKNQQ  495



>gb|KJB21895.1| hypothetical protein B456_004G019700 [Gossypium raimondii]
Length=409

 Score =   268 bits (684),  Expect(2) = 6e-124, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TATYYEQDVR K+R+L WAPIVYSTAI G SV+K+IV A+ VEKER+RRL+TAIL
Sbjct  244  NKNQQTATYYEQDVREKMRMLDWAPIVYSTAITGQSVEKVIVAASTVEKERARRLSTAIL  303

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REA+AFK PPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLF ETYRRYMEKQLR
Sbjct  304  NQVIREAIAFKPPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFPETYRRYMEKQLR  363

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSLERR  386
            S AGF+GTPIRLLWRSRRK+EKD GK +  T ++L  R
Sbjct  364  SDAGFAGTPIRLLWRSRRKVEKDEGKAATRTRSNLSPR  401


 Score =   205 bits (522),  Expect(2) = 6e-124, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GEDRTIVSP+SGTTRDAIDTEF G DGQK+RLIDTAGIR++A+VASSGS TEALSVN+A
Sbjct  135   LGEDRTIVSPISGTTRDAIDTEFVGPDGQKFRLIDTAGIRRRASVASSGSTTEALSVNRA  194

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD +IAERIEKEGKGCL+VVNKWDTIP K  Q
Sbjct  195   FRAIRRSDVVALVIEAMACITEQDTRIAERIEKEGKGCLIVVNKWDTIPNKNQQ  248



>gb|KJB21893.1| hypothetical protein B456_004G019700 [Gossypium raimondii]
Length=491

 Score =   268 bits (684),  Expect(2) = 9e-124, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TATYYEQDVR K+R+L WAPIVYSTAI G SV+K+IV A+ VEKER+RRL+TAIL
Sbjct  326  NKNQQTATYYEQDVREKMRMLDWAPIVYSTAITGQSVEKVIVAASTVEKERARRLSTAIL  385

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REA+AFK PPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLF ETYRRYMEKQLR
Sbjct  386  NQVIREAIAFKPPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFPETYRRYMEKQLR  445

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSLERR  386
            S AGF+GTPIRLLWRSRRK+EKD GK +  T ++L  R
Sbjct  446  SDAGFAGTPIRLLWRSRRKVEKDEGKAATRTRSNLSPR  483


 Score =   205 bits (522),  Expect(2) = 9e-124, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GEDRTIVSP+SGTTRDAIDTEF G DGQK+RLIDTAGIR++A+VASSGS TEALSVN+A
Sbjct  217   LGEDRTIVSPISGTTRDAIDTEFVGPDGQKFRLIDTAGIRRRASVASSGSTTEALSVNRA  276

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD +IAERIEKEGKGCL+VVNKWDTIP K  Q
Sbjct  277   FRAIRRSDVVALVIEAMACITEQDTRIAERIEKEGKGCLIVVNKWDTIPNKNQQ  330



>ref|XP_003539473.1| PREDICTED: uncharacterized protein LOC100777588 isoform X1 [Glycine 
max]
Length=632

 Score =   268 bits (686),  Expect(2) = 1e-123, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 140/162 (86%), Gaps = 3/162 (2%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA+YYEQDVR KLR L WAPIVYSTA+AGHSVDKIIV A  VEKERSRRL T+IL
Sbjct  466  NKNQQTASYYEQDVREKLRSLVWAPIVYSTAVAGHSVDKIIVAAIEVEKERSRRLGTSIL  525

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVV+EAV FK PPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLF ETYRRYMEKQLR
Sbjct  526  NQVVQEAVGFKPPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFPETYRRYMEKQLR  585

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKV---SRETSTSLERRL  383
            + AGFSGTPIRLLWRSRRKM KD GK    +RE  TS +R+L
Sbjct  586  TDAGFSGTPIRLLWRSRRKMGKDEGKPVTKTRENLTSNDRKL  627


 Score =   203 bits (517),  Expect(2) = 1e-123, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEFTG DGQK++LIDTAGIRK+  +AS+GS TEALSVN+A
Sbjct  357   VGEDRTIVSPISGTTRDAIDTEFTGPDGQKFQLIDTAGIRKRTAIASAGSTTEALSVNRA  416

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD KIAERIEKEGKGC++VVNKWDTIP K  Q
Sbjct  417   FRAIRRSDVVALVIEAMACITEQDYKIAERIEKEGKGCVIVVNKWDTIPNKNQQ  470



>ref|XP_002314070.2| hypothetical protein POPTR_0009s05900g [Populus trichocarpa]
 gb|EEE88025.2| hypothetical protein POPTR_0009s05900g [Populus trichocarpa]
Length=651

 Score =   266 bits (681),  Expect(2) = 4e-123, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TATYYEQDVR KLR+L WAPIVYSTAIAGH+V+KIIV A+ VEKERSRRL T+IL
Sbjct  486  NKNQQTATYYEQDVREKLRLLHWAPIVYSTAIAGHNVEKIIVAASTVEKERSRRLGTSIL  545

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVVREA+AFK PPR RGGKRGRVYYCTQAAIRPPTFVFFVND+ LF ETYRRYMEKQLR
Sbjct  546  NQVVREALAFKPPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDSNLFPETYRRYMEKQLR  605

Query  499  SSAGFSGTPIRLLWRSRRKMEKD  431
            S AGFSGTPIRLLWRSRRKMEKD
Sbjct  606  SDAGFSGTPIRLLWRSRRKMEKD  628


 Score =   204 bits (518),  Expect(2) = 4e-123, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEF G DGQK+ LIDTAGIR++A VASSGS+TEALSVN+A
Sbjct  377   VGEDRTIVSPISGTTRDAIDTEFVGPDGQKFLLIDTAGIRRRAAVASSGSVTEALSVNRA  436

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FR IRRSDVVALVIEAM+CITEQD +IAERIEKEGKGCL+VVNKWDTIP K  Q
Sbjct  437   FRGIRRSDVVALVIEAMACITEQDYRIAERIEKEGKGCLIVVNKWDTIPNKNQQ  490



>ref|XP_011025525.1| PREDICTED: uncharacterized protein LOC105126373 [Populus euphratica]
Length=651

 Score =   266 bits (681),  Expect(2) = 4e-123, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TATYYEQDVR KLR+L WAPIVYSTAIAGH+V+KIIV A+ VEKERSRRL T+IL
Sbjct  486  NKNQQTATYYEQDVREKLRLLHWAPIVYSTAIAGHNVEKIIVAASTVEKERSRRLGTSIL  545

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVVREA+AFK PPR RGGKRGRVYYCTQAAIRPPTFVFFVND+ LF ETYRRYMEKQLR
Sbjct  546  NQVVREALAFKPPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDSNLFPETYRRYMEKQLR  605

Query  499  SSAGFSGTPIRLLWRSRRKMEKD  431
            S AGFSGTPIRLLWRSRRKMEKD
Sbjct  606  SDAGFSGTPIRLLWRSRRKMEKD  628


 Score =   204 bits (518),  Expect(2) = 4e-123, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEF G DGQK+ LIDTAGIR++A VASSGS+TEALSVN+A
Sbjct  377   VGEDRTIVSPISGTTRDAIDTEFVGPDGQKFLLIDTAGIRRRAAVASSGSVTEALSVNRA  436

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FR IRRSDVVALVIEAM+CITEQD +IAERIEKEGKGCL+VVNKWDTIP K  Q
Sbjct  437   FRGIRRSDVVALVIEAMACITEQDYRIAERIEKEGKGCLIVVNKWDTIPNKNQQ  490



>gb|KEH30215.1| GTPase Der protein [Medicago truncatula]
Length=646

 Score =   263 bits (671),  Expect(2) = 7e-123, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 131/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA YYEQDVR KLR+L WAP+VYSTA+AG +VDKIIV A  VEKERSRRL T+IL
Sbjct  476  NKNQQTALYYEQDVREKLRLLDWAPVVYSTALAGQNVDKIIVAAIEVEKERSRRLGTSIL  535

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVVREAV FK PPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLF ETYRR+MEKQLR
Sbjct  536  NQVVREAVTFKPPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFPETYRRFMEKQLR  595

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGK  422
            S+AGF GTPIRLLWRSRRKMEKD GK
Sbjct  596  SNAGFPGTPIRLLWRSRRKMEKDEGK  621


 Score =   207 bits (526),  Expect(2) = 7e-123, Method: Compositional matrix adjust.
 Identities = 99/117 (85%), Positives = 107/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEFTG DGQK+ LIDTAGIRK+ TVAS+GS TEALSVN+A
Sbjct  367   VGEDRTIVSPISGTTRDAIDTEFTGPDGQKFHLIDTAGIRKRTTVASAGSTTEALSVNRA  426

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQLQL  835
             FRAIRRSDVVALVIEAM+CITEQD KIAERIEKEGKGC++VVNKWDTIP K  Q  L
Sbjct  427   FRAIRRSDVVALVIEAMACITEQDYKIAERIEKEGKGCVIVVNKWDTIPNKNQQTAL  483



>gb|KHG00071.1| GTPase Der [Gossypium arboreum]
Length=657

 Score =   268 bits (684),  Expect(2) = 7e-123, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 140/158 (89%), Gaps = 0/158 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TATYYEQDVR K+R+L WAPIVYSTAI G SV+K+IV A+ VEKER+RRL+TAIL
Sbjct  492  NKNQQTATYYEQDVREKMRMLDWAPIVYSTAITGQSVEKVIVAASTVEKERARRLSTAIL  551

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REA+AFK PPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLF ETYRRYMEKQLR
Sbjct  552  NQVIREAIAFKPPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFPETYRRYMEKQLR  611

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSLERR  386
            S AGF+GTPIRLLWRSRRK+EKD GK +  T ++L  R
Sbjct  612  SDAGFAGTPIRLLWRSRRKVEKDEGKAATRTRSNLSPR  649


 Score =   202 bits (513),  Expect(2) = 7e-123, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GEDRTIVSP+SGTTRDAIDTEF G D QK+RLIDTAGIR++A+VASSGS TEALSVN+A
Sbjct  383   LGEDRTIVSPISGTTRDAIDTEFVGPDRQKFRLIDTAGIRRRASVASSGSTTEALSVNRA  442

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD +IAERIEKEGKGCL+VVNKWDTIP K  Q
Sbjct  443   FRAIRRSDVVALVIEAMACITEQDTRIAERIEKEGKGCLIVVNKWDTIPNKNQQ  496



>gb|KHN25243.1| GTPase Der [Glycine soja]
Length=957

 Score =   267 bits (683),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 140/162 (86%), Gaps = 3/162 (2%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA+YYEQDVR KLR L WAPIVYSTA+AGHSVDKIIV A  VEKERSRRL T+IL
Sbjct  791  NKNQQTASYYEQDVREKLRSLVWAPIVYSTAVAGHSVDKIIVAAIEVEKERSRRLGTSIL  850

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVV+EAV FK PPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLF ETYRRYMEKQLR
Sbjct  851  NQVVQEAVGFKPPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFPETYRRYMEKQLR  910

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKV---SRETSTSLERRL  383
            + AGFSGTPIRLLWRSRRKM KD GK    +RE  TS +R+L
Sbjct  911  TDAGFSGTPIRLLWRSRRKMGKDEGKPVTKTRENLTSNDRKL  952


 Score =   201 bits (512),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEFTG DGQK++LIDTAGIRK+  +AS+GS TEALSVN+A
Sbjct  682   VGEDRTIVSPISGTTRDAIDTEFTGPDGQKFQLIDTAGIRKRTAIASAGSTTEALSVNRA  741

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD KIAERIEKEGKGC++VVNKWDTIP K  Q
Sbjct  742   FRAIRRSDVVALVIEAMACITEQDYKIAERIEKEGKGCVIVVNKWDTIPNKNQQ  795



>ref|XP_010519745.1| PREDICTED: uncharacterized protein LOC104799102 [Tarenaya hassleriana]
 ref|XP_010519746.1| PREDICTED: uncharacterized protein LOC104799102 [Tarenaya hassleriana]
Length=655

 Score =   259 bits (662),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 124/160 (78%), Positives = 139/160 (87%), Gaps = 1/160 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA+ YE+DVR KLR+L WAP+VYSTAI G SV+ II+ A  VEKERSRRL+TAIL
Sbjct  491  NKNQQTASLYEEDVREKLRILNWAPVVYSTAITGQSVENIIMAAETVEKERSRRLSTAIL  550

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVVREAVAFK+PPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLF ETYRRYMEKQLR
Sbjct  551  NQVVREAVAFKAPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFPETYRRYMEKQLR  610

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGK-VSRETSTSLERRL  383
            + AGF+GTPIRLLWRSRRK EK+ G+  +R T+   ER+L
Sbjct  611  TDAGFAGTPIRLLWRSRRKSEKNAGRPATRMTTLGRERKL  650


 Score =   209 bits (531),  Expect(2) = 2e-122, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEFTG DGQK+RLIDTAGIRK+A VASSGS TEALSVN+A
Sbjct  382   VGEDRTIVSPVSGTTRDAIDTEFTGPDGQKFRLIDTAGIRKRAAVASSGSTTEALSVNRA  441

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRA+RRSDVVALVIEAM+CITEQD KIAERIEKEGK CLVVVNKWDTIP K  Q
Sbjct  442   FRAVRRSDVVALVIEAMACITEQDFKIAERIEKEGKACLVVVNKWDTIPNKNQQ  495



>emb|CDP04574.1| unnamed protein product [Coffea canephora]
Length=659

 Score =   266 bits (680),  Expect(2) = 8e-122, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 139/167 (83%), Gaps = 5/167 (3%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TATYYEQDVR KLR+L WAPIVY TAIAGHSVDKII  A  VEKER RRLTTA L
Sbjct  493  NKNQQTATYYEQDVRDKLRLLSWAPIVYCTAIAGHSVDKIIDAAGMVEKERKRRLTTATL  552

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQ+V+EAV FK PPR RGGKRGRVYYCTQAA+RPPTFVFFVNDAKLF ETYRRYMEKQLR
Sbjct  553  NQLVQEAVVFKPPPRTRGGKRGRVYYCTQAAVRPPTFVFFVNDAKLFLETYRRYMEKQLR  612

Query  499  SSAGFSGTPIRLLWRSRRKMEKD-----GGKVSRETSTSLERRLEVA  374
            SSAGFSGTP+RLLWRSRRKMEK          ++E   S++RRL VA
Sbjct  613  SSAGFSGTPVRLLWRSRRKMEKGDRRPAATNFAQENYISVDRRLAVA  659


 Score =   200 bits (508),  Expect(2) = 8e-122, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             V EDRTIVSPVSGTTRDAID EFTG DGQK+RLIDTAGIR++  VASSGS TEALSVN+A
Sbjct  384   VREDRTIVSPVSGTTRDAIDMEFTGPDGQKFRLIDTAGIRRRVAVASSGSTTEALSVNRA  443

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVA+VIEAM+CITEQD KIAERIE+EGKGCL+VVNKWDTIP K  Q
Sbjct  444   FRAIRRSDVVAIVIEAMACITEQDYKIAERIEREGKGCLIVVNKWDTIPNKNQQ  497



>ref|XP_007132015.1| hypothetical protein PHAVU_011G059500g [Phaseolus vulgaris]
 gb|ESW04009.1| hypothetical protein PHAVU_011G059500g [Phaseolus vulgaris]
Length=633

 Score =   259 bits (661),  Expect(2) = 1e-121, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 132/155 (85%), Gaps = 0/155 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NK Q TA +YE+DVR KLR L WAPIVYSTAIAGHSVDKIIV A+ VEKERSRRL T+IL
Sbjct  467  NKKQQTALHYEEDVREKLRSLDWAPIVYSTAIAGHSVDKIIVAASEVEKERSRRLGTSIL  526

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVV EAVAFK PPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLF ETYRRYME+QLR
Sbjct  527  NQVVLEAVAFKPPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFPETYRRYMERQLR  586

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSL  395
            + AGFSGTPIRLLWRSRRKM KD  K    T  +L
Sbjct  587  TDAGFSGTPIRLLWRSRRKMGKDESKAVTRTQENL  621


 Score =   206 bits (525),  Expect(2) = 1e-121, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 108/117 (92%), Gaps = 0/117 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEFTG DGQK++LIDTAGIRK+A +AS+GS TEALSVN+A
Sbjct  358   VGEDRTIVSPISGTTRDAIDTEFTGPDGQKFQLIDTAGIRKRAAIASAGSTTEALSVNRA  417

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQLQL  835
             FRAIRRSDVVALVIEAM+CITEQD KIAERIEKEGKGC++VVNKWDTIP K  Q  L
Sbjct  418   FRAIRRSDVVALVIEAMACITEQDYKIAERIEKEGKGCVIVVNKWDTIPNKKQQTAL  474



>ref|XP_006407372.1| hypothetical protein EUTSA_v10020226mg [Eutrema salsugineum]
 gb|ESQ48825.1| hypothetical protein EUTSA_v10020226mg [Eutrema salsugineum]
Length=664

 Score =   260 bits (665),  Expect(2) = 1e-121, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA +YE DVR KLR L WAPIVYSTAI GHSVD I+V AA V+KERSRRL+TAIL
Sbjct  499  NKNQQTAAHYEDDVREKLRSLKWAPIVYSTAITGHSVDNIVVAAATVQKERSRRLSTAIL  558

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REAVAFKSPPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFS+TYRRYMEKQLR
Sbjct  559  NQVIREAVAFKSPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSDTYRRYMEKQLR  618

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGG  425
            + AGF+GTPIRLLWRSR++ +K+GG
Sbjct  619  TDAGFAGTPIRLLWRSRKRSDKNGG  643


 Score =   205 bits (521),  Expect(2) = 1e-121, Method: Compositional matrix adjust.
 Identities = 100/114 (88%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             V EDRTIVSPVSGTTRDAID EFTG DG+K+RLIDTAGIRKKA VASSGS TEALSVN+A
Sbjct  390   VREDRTIVSPVSGTTRDAIDAEFTGPDGEKFRLIDTAGIRKKAAVASSGSTTEALSVNRA  449

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD KIAERIE+EGKGCLVVVNKWDTIP K  Q
Sbjct  450   FRAIRRSDVVALVIEAMACITEQDMKIAERIEREGKGCLVVVNKWDTIPNKNQQ  503



>ref|XP_010031794.1| PREDICTED: uncharacterized protein LOC104421519 [Eucalyptus grandis]
Length=650

 Score =   261 bits (666),  Expect(2) = 2e-121, Method: Compositional matrix adjust.
 Identities = 127/163 (78%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ +ATYYEQDVR KLR L WAPIVYSTAIAGHSV+KIIV A  VEKERSRRL+TAIL
Sbjct  487  NKNQQSATYYEQDVREKLRSLDWAPIVYSTAIAGHSVEKIIVAAGTVEKERSRRLSTAIL  546

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVV EA AFK+PPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLF ETYRRYMEKQLR
Sbjct  547  NQVVHEAAAFKAPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFPETYRRYMEKQLR  606

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRE-TSTSLERRLEVA  374
            S AGF+GTPIRLLWRSR+K EK     + +  S + +R+L +A
Sbjct  607  SDAGFAGTPIRLLWRSRKKTEKGRASTNAQGASIAPDRKLVIA  649


 Score =   204 bits (519),  Expect(2) = 2e-121, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEF G+DGQK+RLIDTAGIR++A VASSGS TEALSVN+A
Sbjct  378   VGEDRTIVSPISGTTRDAIDTEFVGADGQKFRLIDTAGIRRRAAVASSGSTTEALSVNRA  437

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
              RAIRRSDVVALVIEAM+CITEQD +IAERIEKEGKGCL+VVNKWDTIP K  Q
Sbjct  438   IRAIRRSDVVALVIEAMACITEQDYRIAERIEKEGKGCLIVVNKWDTIPNKNQQ  491



>gb|EYU26176.1| hypothetical protein MIMGU_mgv1a002590mg [Erythranthe guttata]
Length=656

 Score =   258 bits (659),  Expect(2) = 2e-121, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 147/166 (89%), Gaps = 4/166 (2%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TAT+YE+DVR KLR+L WAPIVYSTAI G+SV++I V A  VEKERS+RL+TA L
Sbjct  490  NKNQQTATHYEEDVRAKLRILSWAPIVYSTAIEGNSVERITVAATLVEKERSKRLSTATL  549

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REAVAFKSP + RGGKRGR+YYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR
Sbjct  550  NQVIREAVAFKSPAKTRGGKRGRLYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  609

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGK---VSRETSTS-LERRLEVA  374
            +S G++GTPIRLLWRSRRK +KD GK   ++++TS+S ++++L VA
Sbjct  610  TSVGYTGTPIRLLWRSRRKSDKDDGKDAFLAKQTSSSQVDKKLAVA  655


 Score =   207 bits (526),  Expect(2) = 2e-121, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEFTG DGQK+RLIDTAGIRK+A VASSG+ TE LSVN+A
Sbjct  381   VGEDRTIVSPVSGTTRDAIDTEFTGPDGQKFRLIDTAGIRKRAAVASSGNTTEGLSVNRA  440

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD KIAERIE+EGKGCL+VVNKWDTIP K  Q
Sbjct  441   FRAIRRSDVVALVIEAMACITEQDFKIAERIEEEGKGCLIVVNKWDTIPNKNQQ  494



>gb|KFK38573.1| hypothetical protein AALP_AA3G131000 [Arabis alpina]
Length=658

 Score =   259 bits (663),  Expect(2) = 2e-121, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 133/145 (92%), Gaps = 0/145 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA +YE+DVR KLR L WAPIVYSTAI GHSVD I+V AA V+KERSRRL+TAIL
Sbjct  493  NKNQQTALHYEEDVREKLRSLKWAPIVYSTAITGHSVDNIVVAAATVQKERSRRLSTAIL  552

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REAVAFKSPPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFS+TYRRYMEKQLR
Sbjct  553  NQVIREAVAFKSPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSDTYRRYMEKQLR  612

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGG  425
            + AGF+GTPIRLLWRSR++ +K+GG
Sbjct  613  TDAGFAGTPIRLLWRSRKRSDKNGG  637


 Score =   205 bits (521),  Expect(2) = 2e-121, Method: Compositional matrix adjust.
 Identities = 100/117 (85%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             V EDRTIVSPVSGTTRDAID EFTG DG+K+RLIDTAGIRKKA VASSGS TEA+SVN+A
Sbjct  384   VREDRTIVSPVSGTTRDAIDAEFTGPDGEKFRLIDTAGIRKKAAVASSGSTTEAMSVNRA  443

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQLQL  835
             FRAIRRSDVVALVIEAM+CITEQD KIAERIE+EGKGCLVVVNKWDTIP K  Q  L
Sbjct  444   FRAIRRSDVVALVIEAMACITEQDMKIAERIEREGKGCLVVVNKWDTIPNKNQQTAL  500



>emb|CDY01098.1| BnaC05g41020D [Brassica napus]
Length=656

 Score =   260 bits (664),  Expect(2) = 3e-121, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA +YE DVR KLR L WAPIVYSTAI GHSVD I+V AA V+KERSRRL+TA L
Sbjct  491  NKNQQTAAHYEDDVREKLRSLKWAPIVYSTAITGHSVDNIVVAAATVQKERSRRLSTATL  550

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REAVAFKSPPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFS+TYRRYMEKQLR
Sbjct  551  NQVIREAVAFKSPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSDTYRRYMEKQLR  610

Query  499  SSAGFSGTPIRLLWRSRRKMEKD--GGKVSRETSTSLERRL  383
            + AGF+GTPIRLLWRSR++ +K+  GG   R +S S ER L
Sbjct  611  TDAGFAGTPIRLLWRSRKRSDKNGGGGGTMRMSSLSRERNL  651


 Score =   204 bits (519),  Expect(2) = 3e-121, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             V EDRTIVSPVSGTTRDAID EFTG DG+K+RLIDTAGIRKKA VASSGS TEA+SVN+A
Sbjct  382   VREDRTIVSPVSGTTRDAIDAEFTGPDGEKFRLIDTAGIRKKAAVASSGSTTEAMSVNRA  441

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD KIAERIE+EGKGCLVVVNKWDTIP K  Q
Sbjct  442   FRAIRRSDVVALVIEAMACITEQDMKIAERIEREGKGCLVVVNKWDTIPNKNQQ  495



>emb|CDY01099.1| BnaC05g41010D [Brassica napus]
Length=348

 Score =   260 bits (665),  Expect(2) = 3e-121, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 139/161 (86%), Gaps = 2/161 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA +YE DVR KLR L WAPIVYSTAI GHSVD I+V AA V+KERSRRL+TA L
Sbjct  183  NKNQQTAAHYEDDVREKLRSLKWAPIVYSTAITGHSVDNIVVAAATVQKERSRRLSTATL  242

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REAVAFKSPPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFS+TYRRYMEKQLR
Sbjct  243  NQVIREAVAFKSPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSDTYRRYMEKQLR  302

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGG--KVSRETSTSLERRL  383
            + AGF+GTPIRLLWRSR++ +K+GG  +  R +S S ER L
Sbjct  303  TDAGFAGTPIRLLWRSRKRSDKNGGGTRTMRMSSLSRERNL  343


 Score =   203 bits (517),  Expect(2) = 3e-121, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             V EDRTIVSPVSGTTRDAID EFTG DG+K+RLIDTAGIRKKA VASSGS TEA+SVN+A
Sbjct  74    VREDRTIVSPVSGTTRDAIDAEFTGPDGEKFRLIDTAGIRKKAAVASSGSTTEAMSVNRA  133

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD KIAERIE+EGKGCLVVVNKWDTIP K  Q
Sbjct  134   FRAIRRSDVVALVIEAMACITEQDMKIAERIEREGKGCLVVVNKWDTIPNKNQQ  187



>ref|XP_009146648.1| PREDICTED: uncharacterized protein LOC103870279 [Brassica rapa]
Length=657

 Score =   260 bits (664),  Expect(2) = 4e-121, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA +YE DVR KLR L WAPIVYSTAI GHSVD I+V AA V+KERSRRL+TA L
Sbjct  492  NKNQQTAAHYEDDVREKLRSLKWAPIVYSTAITGHSVDNIVVAAATVQKERSRRLSTATL  551

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REAVAFKSPPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFS+TYRRYMEKQLR
Sbjct  552  NQVIREAVAFKSPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSDTYRRYMEKQLR  611

Query  499  SSAGFSGTPIRLLWRSRRKMEKD--GGKVSRETSTSLERRL  383
            + AGF+GTPIRLLWRSR++ +K+  GG   R +S S ER L
Sbjct  612  TDAGFAGTPIRLLWRSRKRSDKNGGGGGTMRMSSLSRERNL  652


 Score =   204 bits (519),  Expect(2) = 4e-121, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             V EDRTIVSPVSGTTRDAID EFTG DG+K+RLIDTAGIRKKA VASSGS TEA+SVN+A
Sbjct  383   VREDRTIVSPVSGTTRDAIDAEFTGPDGEKFRLIDTAGIRKKAAVASSGSTTEAMSVNRA  442

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD KIAERIE+EGKGCLVVVNKWDTIP K  Q
Sbjct  443   FRAIRRSDVVALVIEAMACITEQDMKIAERIEREGKGCLVVVNKWDTIPNKNQQ  496



>emb|CDY08458.1| BnaA05g26940D [Brassica napus]
Length=659

 Score =   260 bits (664),  Expect(2) = 4e-121, Method: Compositional matrix adjust.
 Identities = 125/161 (78%), Positives = 138/161 (86%), Gaps = 2/161 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA +YE DVR KLR L WAPIVYSTAI GHSVD I+V AA V+KERSRRL+TA L
Sbjct  494  NKNQQTAAHYEDDVREKLRSLKWAPIVYSTAITGHSVDNIVVAAATVQKERSRRLSTATL  553

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REAVAFKSPPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFS+TYRRYMEKQLR
Sbjct  554  NQVIREAVAFKSPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSDTYRRYMEKQLR  613

Query  499  SSAGFSGTPIRLLWRSRRKMEKD--GGKVSRETSTSLERRL  383
            + AGF+GTPIRLLWRSR++ +K+  GG   R +S S ER L
Sbjct  614  TDAGFAGTPIRLLWRSRKRSDKNGGGGGTMRMSSLSRERNL  654


 Score =   204 bits (518),  Expect(2) = 4e-121, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             V EDRTIVSPVSGTTRDAID EFTG DG+K+RLIDTAGIRKKA VASSGS TEA+SVN+A
Sbjct  385   VREDRTIVSPVSGTTRDAIDAEFTGPDGEKFRLIDTAGIRKKAAVASSGSTTEAMSVNRA  444

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD KIAERIE+EGKGCLVVVNKWDTIP K  Q
Sbjct  445   FRAIRRSDVVALVIEAMACITEQDMKIAERIEREGKGCLVVVNKWDTIPNKNQQ  498



>ref|XP_010257319.1| PREDICTED: uncharacterized protein LOC104597468 isoform X3 [Nelumbo 
nucifera]
Length=673

 Score =   260 bits (665),  Expect(2) = 6e-121, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NK+Q TATYYEQDVR KLR+L WAPIVYSTA  G+SV+KII  A+ VEKERSRRL T+IL
Sbjct  507  NKDQKTATYYEQDVREKLRILDWAPIVYSTATTGNSVEKIIAAASMVEKERSRRLGTSIL  566

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+ EA+AFKSPPR RGGKRGRVYY TQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR
Sbjct  567  NQVIHEALAFKSPPRTRGGKRGRVYYSTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  626

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVS  416
            S AGFSGTPIRLLWRSRRK EKDGG+ +
Sbjct  627  SDAGFSGTPIRLLWRSRRKTEKDGGRTA  654


 Score =   203 bits (516),  Expect(2) = 6e-121, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GEDRTIVSP+SGTTRDAIDTEFT  DGQK+RLIDTAGIR++A VASSGS TEALSVN+A
Sbjct  398   LGEDRTIVSPISGTTRDAIDTEFTAPDGQKFRLIDTAGIRRRAAVASSGSTTEALSVNRA  457

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTK  853
             FRAIRRSDVVALVIEA++CITEQDC+IAERIEKEGKGC++VVNKWDTIP K
Sbjct  458   FRAIRRSDVVALVIEAIACITEQDCRIAERIEKEGKGCVIVVNKWDTIPNK  508



>ref|XP_004507094.1| PREDICTED: GTPase Der-like [Cicer arietinum]
Length=653

 Score =   260 bits (665),  Expect(2) = 7e-121, Method: Compositional matrix adjust.
 Identities = 124/162 (77%), Positives = 141/162 (87%), Gaps = 3/162 (2%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA +YEQD+R KLR+L WAP+VYSTA+AG SV+KIIV A+ VEKERSRRL T+IL
Sbjct  487  NKNQQTAFHYEQDIREKLRLLDWAPVVYSTALAGQSVEKIIVAASEVEKERSRRLGTSIL  546

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVVRE+V FK PPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLF ETYRR+MEKQLR
Sbjct  547  NQVVRESVTFKPPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFPETYRRFMEKQLR  606

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKV---SRETSTSLERRL  383
            ++AGF GTPIRLLWRSRRKMEKD GK+   ++E + S  R+L
Sbjct  607  TNAGFPGTPIRLLWRSRRKMEKDEGKMVTRTKENNASRRRKL  648


 Score =   202 bits (515),  Expect(2) = 7e-121, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEF G+DGQK+ LIDTAGIRK+  VAS+GS TEALSVN+A
Sbjct  378   VGEDRTIVSPISGTTRDAIDTEFIGADGQKFHLIDTAGIRKRTAVASAGSTTEALSVNRA  437

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD KIAERIEKEGKGC++VVNKWDTIP K  Q
Sbjct  438   FRAIRRSDVVALVIEAMACITEQDYKIAERIEKEGKGCVIVVNKWDTIPNKNQQ  491



>ref|XP_010102336.1| GTPase Der [Morus notabilis]
 gb|EXB93297.1| GTPase Der [Morus notabilis]
Length=661

 Score =   256 bits (654),  Expect(2) = 1e-120, Method: Compositional matrix adjust.
 Identities = 121/146 (83%), Positives = 132/146 (90%), Gaps = 0/146 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA YYEQDVR KLR+L WAPIVYSTAIAG SV+KII  A+ VEKERSRRL T+IL
Sbjct  487  NKNQQTAMYYEQDVREKLRILDWAPIVYSTAIAGQSVEKIIGAASMVEKERSRRLGTSIL  546

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV++EA+AFK+PPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLF ETYRR+MEKQLR
Sbjct  547  NQVLQEALAFKAPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFPETYRRFMEKQLR  606

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGK  422
            + AGFSGTPIRLLWRSRRK+EK  GK
Sbjct  607  TDAGFSGTPIRLLWRSRRKLEKSDGK  632


 Score =   206 bits (525),  Expect(2) = 1e-120, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDR IVSPVSGTTRDAIDTE+TG DG+K+RLIDTAGIR++A VASSGS+TEALSVN+A
Sbjct  378   VGEDRAIVSPVSGTTRDAIDTEYTGPDGEKFRLIDTAGIRRRAVVASSGSVTEALSVNRA  437

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD KIAERIEKEGKGCL+VVNKWDTIP K  Q
Sbjct  438   FRAIRRSDVVALVIEAMACITEQDFKIAERIEKEGKGCLIVVNKWDTIPNKNQQ  491



>ref|XP_010257317.1| PREDICTED: uncharacterized protein LOC104597468 isoform X1 [Nelumbo 
nucifera]
Length=677

 Score =   259 bits (662),  Expect(2) = 1e-120, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 138/157 (88%), Gaps = 1/157 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NK+Q TATYYEQDVR KLR+L WAPIVYSTA  G+SV+KII  A+ VEKERSRRL T+IL
Sbjct  507  NKDQKTATYYEQDVREKLRILDWAPIVYSTATTGNSVEKIIAAASMVEKERSRRLGTSIL  566

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+ EA+AFKSPPR RGGKRGRVYY TQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR
Sbjct  567  NQVIHEALAFKSPPRTRGGKRGRVYYSTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  626

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVS-RETSTSLE  392
            S AGFSGTPIRLLWRSRRK EKDG  ++ R  +TS++
Sbjct  627  SDAGFSGTPIRLLWRSRRKTEKDGDLIAGRTANTSIQ  663


 Score =   203 bits (516),  Expect(2) = 1e-120, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GEDRTIVSP+SGTTRDAIDTEFT  DGQK+RLIDTAGIR++A VASSGS TEALSVN+A
Sbjct  398   LGEDRTIVSPISGTTRDAIDTEFTAPDGQKFRLIDTAGIRRRAAVASSGSTTEALSVNRA  457

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTK  853
             FRAIRRSDVVALVIEA++CITEQDC+IAERIEKEGKGC++VVNKWDTIP K
Sbjct  458   FRAIRRSDVVALVIEAIACITEQDCRIAERIEKEGKGCVIVVNKWDTIPNK  508



>ref|XP_010257318.1| PREDICTED: uncharacterized protein LOC104597468 isoform X2 [Nelumbo 
nucifera]
Length=676

 Score =   259 bits (662),  Expect(2) = 1e-120, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 138/157 (88%), Gaps = 1/157 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NK+Q TATYYEQDVR KLR+L WAPIVYSTA  G+SV+KII  A+ VEKERSRRL T+IL
Sbjct  506  NKDQKTATYYEQDVREKLRILDWAPIVYSTATTGNSVEKIIAAASMVEKERSRRLGTSIL  565

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+ EA+AFKSPPR RGGKRGRVYY TQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR
Sbjct  566  NQVIHEALAFKSPPRTRGGKRGRVYYSTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  625

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVS-RETSTSLE  392
            S AGFSGTPIRLLWRSRRK EKDG  ++ R  +TS++
Sbjct  626  SDAGFSGTPIRLLWRSRRKTEKDGDLIAGRTANTSIQ  662


 Score =   203 bits (516),  Expect(2) = 1e-120, Method: Compositional matrix adjust.
 Identities = 95/111 (86%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GEDRTIVSP+SGTTRDAIDTEFT  DGQK+RLIDTAGIR++A VASSGS TEALSVN+A
Sbjct  397   LGEDRTIVSPISGTTRDAIDTEFTAPDGQKFRLIDTAGIRRRAAVASSGSTTEALSVNRA  456

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTK  853
             FRAIRRSDVVALVIEA++CITEQDC+IAERIEKEGKGC++VVNKWDTIP K
Sbjct  457   FRAIRRSDVVALVIEAIACITEQDCRIAERIEKEGKGCVIVVNKWDTIPNK  507



>gb|AAG51052.1|AC069473_14 GTPase, putative; 34281-30152 [Arabidopsis thaliana]
Length=659

 Score =   260 bits (664),  Expect(2) = 1e-120, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA +YE DVR KLR L WAPIVYSTAI GHSVD I+V AA V+KERSRRL+TAIL
Sbjct  494  NKNQETAAHYEDDVREKLRSLKWAPIVYSTAITGHSVDNIVVAAATVQKERSRRLSTAIL  553

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REAVAFKSPPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFS+TYRRYMEKQLR
Sbjct  554  NQVIREAVAFKSPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSDTYRRYMEKQLR  613

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGG  425
            + AGF+GTPIRLLWRSR++ +K+GG
Sbjct  614  TDAGFAGTPIRLLWRSRKRSDKNGG  638


 Score =   202 bits (513),  Expect(2) = 1e-120, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             V EDRTIVSPVSGTTRDAID EFTG DG+K+RLIDTAGIRKK++VASSGS TEA+SVN+A
Sbjct  385   VREDRTIVSPVSGTTRDAIDAEFTGPDGEKFRLIDTAGIRKKSSVASSGSTTEAMSVNRA  444

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD KIAERIE+EGKGCLVVVNKWDTIP K  +
Sbjct  445   FRAIRRSDVVALVIEAMACITEQDLKIAERIEREGKGCLVVVNKWDTIPNKNQE  498



>ref|NP_187815.2| putative double era-like GTPase [Arabidopsis thaliana]
 gb|ACI49783.1| At3g12080 [Arabidopsis thaliana]
 gb|AEE75146.1| GTP-binding protein [Arabidopsis thaliana]
Length=663

 Score =   259 bits (663),  Expect(2) = 2e-120, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA +YE DVR KLR L WAPIVYSTAI GHSVD I+V AA V+KERSRRL+TAIL
Sbjct  498  NKNQETAAHYEDDVREKLRSLKWAPIVYSTAITGHSVDNIVVAAATVQKERSRRLSTAIL  557

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REAVAFKSPPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFS+TYRRYMEKQLR
Sbjct  558  NQVIREAVAFKSPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSDTYRRYMEKQLR  617

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGG  425
            + AGF+GTPIRLLWRSR++ +K+GG
Sbjct  618  TDAGFAGTPIRLLWRSRKRSDKNGG  642


 Score =   202 bits (514),  Expect(2) = 2e-120, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             V EDRTIVSPVSGTTRDAID EFTG DG+K+RLIDTAGIRKK++VASSGS TEA+SVN+A
Sbjct  389   VREDRTIVSPVSGTTRDAIDAEFTGPDGEKFRLIDTAGIRKKSSVASSGSTTEAMSVNRA  448

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD KIAERIE+EGKGCLVVVNKWDTIP K  +
Sbjct  449   FRAIRRSDVVALVIEAMACITEQDLKIAERIEREGKGCLVVVNKWDTIPNKNQE  502



>ref|XP_002882766.1| EMB2738 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59025.1| EMB2738 [Arabidopsis lyrata subsp. lyrata]
Length=661

 Score =   260 bits (664),  Expect(2) = 2e-120, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA +YE DVR KLR L WAPIVYSTAI GHSVD I+V AA V+KERSRRL+TAIL
Sbjct  496  NKNQETAAHYEDDVREKLRSLKWAPIVYSTAITGHSVDNIVVAAATVQKERSRRLSTAIL  555

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REAVAFKSPPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFS+TYRRYMEKQLR
Sbjct  556  NQVIREAVAFKSPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSDTYRRYMEKQLR  615

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGG  425
            + AGF+GTPIRLLWRSR++ +K+GG
Sbjct  616  TDAGFAGTPIRLLWRSRKRSDKNGG  640


 Score =   201 bits (512),  Expect(2) = 2e-120, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             V EDRTIVSPVSGTTRDAID EFTG DG+K+RLIDTAGIRKK++VASSGS TEA+SVN+A
Sbjct  387   VREDRTIVSPVSGTTRDAIDAEFTGPDGEKFRLIDTAGIRKKSSVASSGSTTEAMSVNRA  446

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD KIAERIE+EGKGCLVVVNKWDTIP K  +
Sbjct  447   FRAIRRSDVVALVIEAMACITEQDLKIAERIEREGKGCLVVVNKWDTIPNKNQE  500



>ref|XP_010486897.1| PREDICTED: uncharacterized protein LOC104764969 [Camelina sativa]
Length=663

 Score =   259 bits (661),  Expect(2) = 2e-120, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA +YE DVR KLR L WAPIVYSTAI GHSVD I+V AA V+KERSRRL+TAIL
Sbjct  498  NKNQETAAHYEDDVREKLRSLKWAPIVYSTAITGHSVDNIVVAAATVQKERSRRLSTAIL  557

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REAVAFKSPPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFS+TYRRYMEKQLR
Sbjct  558  NQVIREAVAFKSPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSDTYRRYMEKQLR  617

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGG  425
            + AGF+GTPIRLLWRSR++ +K+GG
Sbjct  618  TDAGFAGTPIRLLWRSRKRSDKNGG  642


 Score =   202 bits (514),  Expect(2) = 2e-120, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             V EDRTIVSPVSGTTRDAID EFTG DG+K+RLIDTAGIRKK++VASSGS TEA+SVN+A
Sbjct  389   VREDRTIVSPVSGTTRDAIDAEFTGPDGEKFRLIDTAGIRKKSSVASSGSTTEAMSVNRA  448

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD KIAERIE+EGKGCLVVVNKWDTIP K  +
Sbjct  449   FRAIRRSDVVALVIEAMACITEQDLKIAERIEREGKGCLVVVNKWDTIPNKNQE  502



>ref|XP_012089992.1| PREDICTED: uncharacterized protein LOC105648271 [Jatropha curcas]
 gb|KDP22086.1| hypothetical protein JCGZ_25917 [Jatropha curcas]
Length=642

 Score =   256 bits (653),  Expect(2) = 3e-120, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA YYEQDVR KLR L WAP+VYSTAIAG SV+KII  A+AVEKERSRRL+TAIL
Sbjct  484  NKNQQTAMYYEQDVREKLRTLHWAPVVYSTAIAGRSVEKIIDAASAVEKERSRRLSTAIL  543

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVV EA+AFKSPPR RGGKRGR+YYCTQAAIRPPTFVFFVNDA LF ETYRRYMEKQLR
Sbjct  544  NQVVGEALAFKSPPRTRGGKRGRIYYCTQAAIRPPTFVFFVNDASLFPETYRRYMEKQLR  603

Query  499  SSAGFSGTPIRLLWRSRRKMEK  434
            S  GFSGTPIRLLWRSRRKMEK
Sbjct  604  SDIGFSGTPIRLLWRSRRKMEK  625


 Score =   205 bits (522),  Expect(2) = 3e-120, Method: Compositional matrix adjust.
 Identities = 96/112 (86%), Positives = 106/112 (95%), Gaps = 0/112 (0%)
 Frame = -2

Query  1179  EDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAFR  1000
             EDRTIVSP+SGTTRDAIDTEF+G DGQK+RLIDTAGIR++A VASSGS+TEALSVN+AFR
Sbjct  377   EDRTIVSPISGTTRDAIDTEFSGPDGQKFRLIDTAGIRRRAAVASSGSVTEALSVNRAFR  436

Query  999   AIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             AIRRSDVVALVIEAM+CITEQD +IAERIEKEGKGCL+VVNKWDTIP K  Q
Sbjct  437   AIRRSDVVALVIEAMACITEQDYRIAERIEKEGKGCLIVVNKWDTIPNKNQQ  488



>ref|XP_010464959.1| PREDICTED: uncharacterized protein LOC104745422 [Camelina sativa]
Length=656

 Score =   258 bits (660),  Expect(2) = 3e-120, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA +YE DVR KLR L WAPIVYSTAI GHSVD I+V AA V+KERSRRL+TAIL
Sbjct  492  NKNQETAAHYEDDVREKLRSLKWAPIVYSTAITGHSVDNIVVAAATVQKERSRRLSTAIL  551

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REAVAFKSPPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFS+TYRRYMEKQLR
Sbjct  552  NQVIREAVAFKSPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSDTYRRYMEKQLR  611

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGG  425
            + AGF+GTPIRLLWRSR++ +K+GG
Sbjct  612  TDAGFAGTPIRLLWRSRKRSDKNGG  636


 Score =   202 bits (514),  Expect(2) = 3e-120, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             V EDRTIVSPVSGTTRDAID EFTG DG+K+RLIDTAGIRKK++VASSGS TEA+SVN+A
Sbjct  383   VREDRTIVSPVSGTTRDAIDAEFTGPDGEKFRLIDTAGIRKKSSVASSGSTTEAMSVNRA  442

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD KIAERIE+EGKGCLVVVNKWDTIP K  +
Sbjct  443   FRAIRRSDVVALVIEAMACITEQDLKIAERIEREGKGCLVVVNKWDTIPNKNQE  496



>ref|XP_010498493.1| PREDICTED: uncharacterized protein LOC104776175 [Camelina sativa]
Length=656

 Score =   258 bits (660),  Expect(2) = 3e-120, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA +YE DVR KLR L WAPIVYSTAI GHSVD I+V AA V+KERSRRL+TAIL
Sbjct  491  NKNQETAAHYEDDVREKLRSLKWAPIVYSTAITGHSVDNIVVAAATVQKERSRRLSTAIL  550

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REAVAFKSPPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFS+TYRRYMEKQLR
Sbjct  551  NQVIREAVAFKSPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSDTYRRYMEKQLR  610

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGG  425
            + AGF+GTPIRLLWRSR++ +K+GG
Sbjct  611  TDAGFAGTPIRLLWRSRKRSDKNGG  635


 Score =   202 bits (514),  Expect(2) = 3e-120, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             V EDRTIVSPVSGTTRDAID EFTG DG+K+RLIDTAGIRKK++VASSGS TEA+SVN+A
Sbjct  382   VREDRTIVSPVSGTTRDAIDAEFTGPDGEKFRLIDTAGIRKKSSVASSGSTTEAMSVNRA  441

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD KIAERIE+EGKGCLVVVNKWDTIP K  +
Sbjct  442   FRAIRRSDVVALVIEAMACITEQDLKIAERIEREGKGCLVVVNKWDTIPNKNQE  495



>dbj|BAB01956.1| GTP-binding protein-like [Arabidopsis thaliana]
Length=537

 Score =   259 bits (662),  Expect(2) = 4e-120, Method: Compositional matrix adjust.
 Identities = 120/145 (83%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA +YE DVR KLR L WAPIVYSTAI GHSVD I+V AA V+KERSRRL+TAIL
Sbjct  372  NKNQETAAHYEDDVREKLRSLKWAPIVYSTAITGHSVDNIVVAAATVQKERSRRLSTAIL  431

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REAVAFKSPPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFS+TYRRYMEKQLR
Sbjct  432  NQVIREAVAFKSPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSDTYRRYMEKQLR  491

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGG  425
            + AGF+GTPIRLLWRSR++ +K+GG
Sbjct  492  TDAGFAGTPIRLLWRSRKRSDKNGG  516


 Score =   201 bits (511),  Expect(2) = 4e-120, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             V EDRTIVSPVSGTTRDAID EFTG DG+K+RLIDTAGIRKK++VASSGS TEA+SVN+A
Sbjct  263   VREDRTIVSPVSGTTRDAIDAEFTGPDGEKFRLIDTAGIRKKSSVASSGSTTEAMSVNRA  322

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD KIAERIE+EGKGCLVVVNKWDTIP K  +
Sbjct  323   FRAIRRSDVVALVIEAMACITEQDLKIAERIEREGKGCLVVVNKWDTIPNKNQE  376



>ref|XP_006297160.1| hypothetical protein CARUB_v10013165mg [Capsella rubella]
 gb|EOA30058.1| hypothetical protein CARUB_v10013165mg [Capsella rubella]
Length=655

 Score =   258 bits (658),  Expect(2) = 6e-120, Method: Compositional matrix adjust.
 Identities = 119/145 (82%), Positives = 132/145 (91%), Gaps = 0/145 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA +YE+DVR KLR L WAPIVYSTAI GHSVD I+V AA V+KERSRRL+TA L
Sbjct  491  NKNQETAAHYEEDVRQKLRSLKWAPIVYSTAITGHSVDNIVVAAATVQKERSRRLSTATL  550

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REAVAFKSPPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFS+TYRRYMEKQLR
Sbjct  551  NQVIREAVAFKSPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSDTYRRYMEKQLR  610

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGG  425
            + AGF+GTPIRLLWRSR++ +K+GG
Sbjct  611  TDAGFAGTPIRLLWRSRKRSDKNGG  635


 Score =   202 bits (514),  Expect(2) = 6e-120, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             V EDRTIVSPVSGTTRDAID EFTG DG+K+RLIDTAGIRKK++VASSGS TEA+SVN+A
Sbjct  382   VREDRTIVSPVSGTTRDAIDAEFTGPDGEKFRLIDTAGIRKKSSVASSGSTTEAMSVNRA  441

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD KIAERIE+EGKGCLVVVNKWDTIP K  +
Sbjct  442   FRAIRRSDVVALVIEAMACITEQDLKIAERIEREGKGCLVVVNKWDTIPNKNQE  495



>ref|XP_002513491.1| GTP-binding protein enga, putative [Ricinus communis]
 gb|EEF48894.1| GTP-binding protein enga, putative [Ricinus communis]
Length=624

 Score =   252 bits (643),  Expect(2) = 9e-120, Method: Compositional matrix adjust.
 Identities = 127/146 (87%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TATYYEQDVR KLR+L WAPIVYSTAIA HSV+KII+ A+AVEKERSRRL+TAIL
Sbjct  479  NKNQQTATYYEQDVREKLRILQWAPIVYSTAIADHSVEKIIIAASAVEKERSRRLSTAIL  538

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVVREA+AFKSPPR RGG+RGRVYYCTQAAIRPPTFVFFVNDA LF ETYRR+MEKQLR
Sbjct  539  NQVVREALAFKSPPRTRGGRRGRVYYCTQAAIRPPTFVFFVNDASLFPETYRRFMEKQLR  598

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGK  422
            S AGFSGTPIRLLWRSRRKMEK GG+
Sbjct  599  SDAGFSGTPIRLLWRSRRKMEKGGGQ  624


 Score =   207 bits (527),  Expect(2) = 9e-120, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEF+G DGQK+RLIDTAGIR++A VASSGS+TEALSVN+A
Sbjct  370   VGEDRTIVSPISGTTRDAIDTEFSGPDGQKFRLIDTAGIRRRAAVASSGSLTEALSVNRA  429

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD +IA+RIEKEGKGCL+VVNKWDTIP K  Q
Sbjct  430   FRAIRRSDVVALVIEAMACITEQDFRIADRIEKEGKGCLIVVNKWDTIPNKNQQ  483



>ref|XP_010673632.1| PREDICTED: uncharacterized protein LOC104889980 [Beta vulgaris 
subsp. vulgaris]
Length=670

 Score =   256 bits (655),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 121/149 (81%), Positives = 131/149 (88%), Gaps = 0/149 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA  YEQDVR KLR L WAPIVY+ AI+G S+DKIIV A+ VEKERSRRL+TA L
Sbjct  506  NKNQETAMVYEQDVRQKLRSLHWAPIVYAAAISGQSIDKIIVAASIVEKERSRRLSTATL  565

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVVREAVAFK+PPR R GKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR
Sbjct  566  NQVVREAVAFKAPPRTRAGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  625

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSR  413
            + AGF+GTPIRLLWRSRRK EKD G  ++
Sbjct  626  TDAGFAGTPIRLLWRSRRKSEKDAGNTTK  654


 Score =   201 bits (512),  Expect(2) = 2e-119, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRT+VSP+SGTTRDAIDTEFT  DGQK+RLIDTAGIR+KA VASSGS TEALSVN+A
Sbjct  397   VGEDRTVVSPISGTTRDAIDTEFTAPDGQKFRLIDTAGIRRKAAVASSGSTTEALSVNRA  456

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD KIAE+IE EGKGCL+VVNKWDTIP K  +
Sbjct  457   FRAIRRSDVVALVIEAMACITEQDYKIAEQIEVEGKGCLIVVNKWDTIPNKNQE  510



>ref|XP_006850201.1| PREDICTED: uncharacterized protein LOC18439984 [Amborella trichopoda]
 gb|ERN11782.1| hypothetical protein AMTR_s00022p00249930 [Amborella trichopoda]
Length=651

 Score =   249 bits (637),  Expect(2) = 2e-117, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 130/147 (88%), Gaps = 0/147 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN  TATYYEQDVR KLR+L WAPIVYSTA +G SVDKII  A+ VE+ERSRRL T+ILN
Sbjct  485  KNNQTATYYEQDVREKLRILDWAPIVYSTATSGQSVDKIIDAASMVERERSRRLGTSILN  544

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            QVV+EA+AFK+PPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLF ETYRRYMEKQLR+
Sbjct  545  QVVQEALAFKAPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFPETYRRYMEKQLRA  604

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVS  416
            +AGF GTPIRLLWRSRRK EK  G+ +
Sbjct  605  NAGFPGTPIRLLWRSRRKTEKTEGRTT  631


 Score =   202 bits (513),  Expect(2) = 2e-117, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEF GSDGQKYRLIDTAGIR++A VAS+G++TE+LSVN+A
Sbjct  375   VGEDRTIVSPISGTTRDAIDTEFMGSDGQKYRLIDTAGIRRRAAVASAGNLTESLSVNRA  434

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAI RSD+VALVIEAM+CITEQD +IAERIEKEGKGC++VVNKWDTIP K NQ
Sbjct  435   FRAICRSDLVALVIEAMACITEQDYRIAERIEKEGKGCVIVVNKWDTIPKKNNQ  488



>gb|EPS73678.1| hypothetical protein M569_01078, partial [Genlisea aurea]
Length=544

 Score =   238 bits (608),  Expect(2) = 7e-115, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 123/141 (87%), Gaps = 1/141 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKN  TA +YE DVR KLR+L WAPIVYSTA+ GH VDKI   A+ VE+ERSRRL TA+L
Sbjct  395  NKNHETALHYEDDVRDKLRILNWAPIVYSTAVRGHKVDKIAAAASTVERERSRRLPTALL  454

Query  679  NQVVREAVAFKSPPRIRG-GKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQL  503
            NQVVRE+VAFK PPR RG  KRGRVYYCTQAA+RPPTFVFFVN++KLF ETYRRYMEKQL
Sbjct  455  NQVVRESVAFKPPPRTRGSNKRGRVYYCTQAAVRPPTFVFFVNESKLFPETYRRYMEKQL  514

Query  502  RSSAGFSGTPIRLLWRSRRKM  440
            RSSAGFSGTPIRLLWRSRRKM
Sbjct  515  RSSAGFSGTPIRLLWRSRRKM  535


 Score =   204 bits (520),  Expect(2) = 7e-115, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 109/117 (93%), Gaps = 0/117 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEF+G DGQK+R+IDTAGIRKK+ VASSGS TEALSVN+A
Sbjct  286   VGEDRTIVSPISGTTRDAIDTEFSGPDGQKFRIIDTAGIRKKSAVASSGSTTEALSVNRA  345

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQLQL  835
             FRAIRRSDVVAL+IEAM+CITEQD KIAERIE+EGKGC++VVNKWDTIP K ++  L
Sbjct  346   FRAIRRSDVVALIIEAMACITEQDFKIAERIEREGKGCVIVVNKWDTIPNKNHETAL  402



>ref|XP_007015041.1| GTP-binding family protein [Theobroma cacao]
 gb|EOY32660.1| GTP-binding family protein [Theobroma cacao]
Length=648

 Score =   236 bits (603),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TATYYEQDVR K+R+L WAPIVYSTAIAG SV+KIIV A  VEKERSRRL+TAIL
Sbjct  483  NKNQQTATYYEQDVREKMRILDWAPIVYSTAIAGQSVEKIIVAAITVEKERSRRLSTAIL  542

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV++EA+AFK PPR RGG+RGRVYYCTQAAIRPPTFVFFVNDAKLF ETYRRYMEKQLR
Sbjct  543  NQVIQEAIAFKPPPRTRGGRRGRVYYCTQAAIRPPTFVFFVNDAKLFPETYRRYMEKQLR  602

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSL  395
            + AGF+GTPIRLLWRSRRK+EK  G+ +  T ++L
Sbjct  603  TDAGFAGTPIRLLWRSRRKVEKGKGRAATRTRSNL  637


 Score =   206 bits (524),  Expect(2) = 1e-114, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEF G DGQK+RLIDTAGIR++A++ASSGS TEALSVN+A
Sbjct  374   VGEDRTIVSPISGTTRDAIDTEFIGPDGQKFRLIDTAGIRRRASIASSGSATEALSVNRA  433

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSD+VALVIEAM+CITEQD +IAERIEKEGKGCL+VVNKWDTIP K  Q
Sbjct  434   FRAIRRSDIVALVIEAMACITEQDTRIAERIEKEGKGCLIVVNKWDTIPNKNQQ  487



>ref|XP_009394388.1| PREDICTED: uncharacterized protein LOC103979879 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=634

 Score =   242 bits (618),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ T TYY+QDVR K+R L WAPIVYSTAI+GHSVDKII     VEKERSRRL T+IL
Sbjct  488  NKNQQTTTYYDQDVREKVRFLDWAPIVYSTAISGHSVDKIIADVGMVEKERSRRLGTSIL  547

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVV+EA+AFK PPR RGGKRGRVYY TQAAIRPPTFVFFVNDAKLF ETYRRYMEKQLR
Sbjct  548  NQVVQEALAFKPPPRTRGGKRGRVYYSTQAAIRPPTFVFFVNDAKLFPETYRRYMEKQLR  607

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGG  425
              AGF GTPIRLLWRSRR+  K  G
Sbjct  608  KDAGFPGTPIRLLWRSRRRGNKGNG  632


 Score =   196 bits (497),  Expect(2) = 2e-113, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTE TG DGQKYRLIDTAGIRK+A VAS+GS TE LSVN+A
Sbjct  379   VGEDRTIVSPISGTTRDAIDTEITGPDGQKYRLIDTAGIRKRAAVASAGSTTEVLSVNRA  438

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
              RAI RSDVVALVIEAM+CITEQD +IAERIEKEGKGC++VVNKWDTIP K  Q
Sbjct  439   LRAICRSDVVALVIEAMACITEQDVRIAERIEKEGKGCVIVVNKWDTIPNKNQQ  492



>ref|XP_009394391.1| PREDICTED: uncharacterized protein LOC103979879 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=492

 Score =   242 bits (617),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ T TYY+QDVR K+R L WAPIVYSTAI+GHSVDKII     VEKERSRRL T+IL
Sbjct  346  NKNQQTTTYYDQDVREKVRFLDWAPIVYSTAISGHSVDKIIADVGMVEKERSRRLGTSIL  405

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVV+EA+AFK PPR RGGKRGRVYY TQAAIRPPTFVFFVNDAKLF ETYRRYMEKQLR
Sbjct  406  NQVVQEALAFKPPPRTRGGKRGRVYYSTQAAIRPPTFVFFVNDAKLFPETYRRYMEKQLR  465

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGG  425
              AGF GTPIRLLWRSRR+  K  G
Sbjct  466  KDAGFPGTPIRLLWRSRRRGNKGNG  490


 Score =   196 bits (497),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTE TG DGQKYRLIDTAGIRK+A VAS+GS TE LSVN+A
Sbjct  237   VGEDRTIVSPISGTTRDAIDTEITGPDGQKYRLIDTAGIRKRAAVASAGSTTEVLSVNRA  296

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
              RAI RSDVVALVIEAM+CITEQD +IAERIEKEGKGC++VVNKWDTIP K  Q
Sbjct  297   LRAICRSDVVALVIEAMACITEQDVRIAERIEKEGKGCVIVVNKWDTIPNKNQQ  350



>ref|XP_009394390.1| PREDICTED: uncharacterized protein LOC103979879 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=506

 Score =   242 bits (617),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ T TYY+QDVR K+R L WAPIVYSTAI+GHSVDKII     VEKERSRRL T+IL
Sbjct  360  NKNQQTTTYYDQDVREKVRFLDWAPIVYSTAISGHSVDKIIADVGMVEKERSRRLGTSIL  419

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVV+EA+AFK PPR RGGKRGRVYY TQAAIRPPTFVFFVNDAKLF ETYRRYMEKQLR
Sbjct  420  NQVVQEALAFKPPPRTRGGKRGRVYYSTQAAIRPPTFVFFVNDAKLFPETYRRYMEKQLR  479

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGG  425
              AGF GTPIRLLWRSRR+  K  G
Sbjct  480  KDAGFPGTPIRLLWRSRRRGNKGNG  504


 Score =   196 bits (497),  Expect(2) = 3e-113, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTE TG DGQKYRLIDTAGIRK+A VAS+GS TE LSVN+A
Sbjct  251   VGEDRTIVSPISGTTRDAIDTEITGPDGQKYRLIDTAGIRKRAAVASAGSTTEVLSVNRA  310

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
              RAI RSDVVALVIEAM+CITEQD +IAERIEKEGKGC++VVNKWDTIP K  Q
Sbjct  311   LRAICRSDVVALVIEAMACITEQDVRIAERIEKEGKGCVIVVNKWDTIPNKNQQ  364



>gb|EEC68516.1| hypothetical protein OsI_36791 [Oryza sativa Indica Group]
Length=676

 Score =   241 bits (614),  Expect(2) = 4e-113, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKN  + TYYEQDVR KLR+L WAPIVY +A  G SVDKII  AA VEKERSRRL T+IL
Sbjct  513  NKNHQSTTYYEQDVREKLRILDWAPIVYCSATHGSSVDKIISAAALVEKERSRRLGTSIL  572

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVVREA+AFK PPR RGGKRGRVYY TQAAIRPPTFVFFVNDAKLF ETYRRYMEK+LR
Sbjct  573  NQVVREAIAFKPPPRTRGGKRGRVYYTTQAAIRPPTFVFFVNDAKLFPETYRRYMEKKLR  632

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSL  395
            S AGF GTPIRLLWRSR++ +K G        +S+
Sbjct  633  SDAGFPGTPIRLLWRSRKRPDKKGKSADNSLQSSV  667


 Score =   197 bits (500),  Expect(2) = 4e-113, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEFT  DGQKY+LIDTAGIR++A VAS+GS TE LSV +A
Sbjct  404   VGEDRTIVSPVSGTTRDAIDTEFTTEDGQKYKLIDTAGIRRRAAVASAGSTTETLSVKRA  463

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALV+EAM+CITEQD KIAERIEKEGK C++VVNKWDTIP K +Q
Sbjct  464   FRAIRRSDVVALVVEAMACITEQDYKIAERIEKEGKACVIVVNKWDTIPNKNHQ  517



>gb|EEE52426.1| hypothetical protein OsJ_34551 [Oryza sativa Japonica Group]
Length=563

 Score =   239 bits (610),  Expect(2) = 8e-113, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKN  + TYYEQDVR KLR+L WAPIVY +A  G SVDKII  AA VEKERSRRL T+IL
Sbjct  400  NKNHQSTTYYEQDVREKLRILDWAPIVYCSATHGSSVDKIISAAALVEKERSRRLGTSIL  459

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVVREA+AFK PPR RGGKRGRVYY TQAAIRPPTFVFFVNDAKLF ET+RRYMEK+LR
Sbjct  460  NQVVREAIAFKPPPRTRGGKRGRVYYTTQAAIRPPTFVFFVNDAKLFPETFRRYMEKKLR  519

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSL  395
            S AGF GTPIRLLWRSR++ +K G        +S+
Sbjct  520  SDAGFPGTPIRLLWRSRKRPDKKGKSADNSLQSSV  554


 Score =   197 bits (500),  Expect(2) = 8e-113, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEFT  DGQKY+LIDTAGIR++A VAS+GS TE LSV +A
Sbjct  291   VGEDRTIVSPVSGTTRDAIDTEFTTEDGQKYKLIDTAGIRRRAAVASAGSTTETLSVKRA  350

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALV+EAM+CITEQD KIAERIEKEGK C++VVNKWDTIP K +Q
Sbjct  351   FRAIRRSDVVALVVEAMACITEQDYKIAERIEKEGKACVIVVNKWDTIPNKNHQ  404



>ref|NP_001068337.1| Os11g0638000 [Oryza sativa Japonica Group]
 dbj|BAF28700.1| Os11g0638000 [Oryza sativa Japonica Group]
Length=315

 Score =   239 bits (609),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKN  + TYYEQDVR KLR+L WAPIVY +A  G SVDKII  AA VEKERSRRL T+IL
Sbjct  152  NKNHQSTTYYEQDVREKLRILDWAPIVYCSATHGSSVDKIISAAALVEKERSRRLGTSIL  211

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVVREA+AFK PPR RGGKRGRVYY TQAAIRPPTFVFFVNDAKLF ET+RRYMEK+LR
Sbjct  212  NQVVREAIAFKPPPRTRGGKRGRVYYTTQAAIRPPTFVFFVNDAKLFPETFRRYMEKKLR  271

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSL  395
            S AGF GTPIRLLWRSR++ +K G        +S+
Sbjct  272  SDAGFPGTPIRLLWRSRKRPDKKGKSADNSLQSSV  306


 Score =   196 bits (499),  Expect(2) = 1e-112, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEFT  DGQKY+LIDTAGIR++A VAS+GS TE LSV +A
Sbjct  43    VGEDRTIVSPVSGTTRDAIDTEFTTEDGQKYKLIDTAGIRRRAAVASAGSTTETLSVKRA  102

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALV+EAM+CITEQD KIAERIEKEGK C++VVNKWDTIP K +Q
Sbjct  103   FRAIRRSDVVALVVEAMACITEQDYKIAERIEKEGKACVIVVNKWDTIPNKNHQ  156



>gb|ABA94923.2| small GTP-binding protein domain containing protein, expressed 
[Oryza sativa Japonica Group]
Length=344

 Score =   239 bits (609),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 114/155 (74%), Positives = 126/155 (81%), Gaps = 0/155 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKN  + TYYEQDVR KLR+L WAPIVY +A  G SVDKII  AA VEKERSRRL T+IL
Sbjct  181  NKNHQSTTYYEQDVREKLRILDWAPIVYCSATHGSSVDKIISAAALVEKERSRRLGTSIL  240

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVVREA+AFK PPR RGGKRGRVYY TQAAIRPPTFVFFVNDAKLF ET+RRYMEK+LR
Sbjct  241  NQVVREAIAFKPPPRTRGGKRGRVYYTTQAAIRPPTFVFFVNDAKLFPETFRRYMEKKLR  300

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSL  395
            S AGF GTPIRLLWRSR++ +K G        +S+
Sbjct  301  SDAGFPGTPIRLLWRSRKRPDKKGKSADNSLQSSV  335


 Score =   196 bits (499),  Expect(2) = 2e-112, Method: Compositional matrix adjust.
 Identities = 94/114 (82%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEFT  DGQKY+LIDTAGIR++A VAS+GS TE LSV +A
Sbjct  72    VGEDRTIVSPVSGTTRDAIDTEFTTEDGQKYKLIDTAGIRRRAAVASAGSTTETLSVKRA  131

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALV+EAM+CITEQD KIAERIEKEGK C++VVNKWDTIP K +Q
Sbjct  132   FRAIRRSDVVALVVEAMACITEQDYKIAERIEKEGKACVIVVNKWDTIPNKNHQ  185



>ref|XP_006663069.1| PREDICTED: uncharacterized protein LOC102708102 isoform X1 [Oryza 
brachyantha]
Length=385

 Score =   234 bits (598),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 122/144 (85%), Gaps = 0/144 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKN  + TYYEQDVR KLR+L WAPIVY +A  G SVDKII  AA VEKERSRRL T+IL
Sbjct  222  NKNHQSTTYYEQDVREKLRILDWAPIVYCSATHGSSVDKIISAAALVEKERSRRLGTSIL  281

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REA+AFK PPR RGGKRGRVYY TQAAIRPPTFVFFVNDAKLF  TYRRYMEK+LR
Sbjct  282  NQVIREAIAFKPPPRTRGGKRGRVYYTTQAAIRPPTFVFFVNDAKLFPVTYRRYMEKKLR  341

Query  499  SSAGFSGTPIRLLWRSRRKMEKDG  428
            S AGF GTPIRLLWRSR++ +K G
Sbjct  342  SDAGFPGTPIRLLWRSRKRPDKKG  365


 Score =   193 bits (491),  Expect(2) = 2e-110, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEF   DGQKY+LIDTAGIR++A VAS+GS TE LSV +A
Sbjct  113   VGEDRTIVSPVSGTTRDAIDTEFITEDGQKYKLIDTAGIRRRAAVASAGSTTETLSVKRA  172

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALV+EAM+CITEQD KIAERIEKEGK C++VVNKWDTIP K +Q
Sbjct  173   FRAIRRSDVVALVVEAMACITEQDYKIAERIEKEGKACVIVVNKWDTIPNKNHQ  226



>ref|XP_002449905.1| hypothetical protein SORBIDRAFT_05g025430 [Sorghum bicolor]
 gb|EES08893.1| hypothetical protein SORBIDRAFT_05g025430 [Sorghum bicolor]
Length=684

 Score =   230 bits (587),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKN  + T+YEQDVR KLR+L WAPIVY +A  G SV+KII  AA VEKERSRRL T+IL
Sbjct  521  NKNHESTTHYEQDVREKLRILDWAPIVYCSATNGTSVEKIISAAALVEKERSRRLGTSIL  580

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REA+AFK PPR RGGKRGRVYY TQAAI PPTFV FVNDAKLF +TYRRYMEK+LR
Sbjct  581  NQVIREAIAFKPPPRTRGGKRGRVYYTTQAAIGPPTFVLFVNDAKLFPDTYRRYMEKKLR  640

Query  499  SSAGFSGTPIRLLWRSRRKMEKDG  428
            S AGF GTPIRLLWRSRR+ +K G
Sbjct  641  SDAGFPGTPIRLLWRSRRRPDKRG  664


 Score =   194 bits (492),  Expect(2) = 4e-109, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEFT +DG+KY+LIDTAGIR++A V S+GS TE+LSV +A
Sbjct  412   VGEDRTIVSPVSGTTRDAIDTEFTTADGEKYKLIDTAGIRRRAAVISAGSTTESLSVKRA  471

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+C+TEQD KIAERIEKEGK C++VVNKWDTIP K ++
Sbjct  472   FRAIRRSDVVALVIEAMACVTEQDYKIAERIEKEGKACVIVVNKWDTIPNKNHE  525



>tpg|DAA42328.1| TPA: hypothetical protein ZEAMMB73_012049 [Zea mays]
Length=653

 Score =   232 bits (592),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKN  + T+YEQDVR KLR+L WAPIVY +A  G SV+KII  AA VEKERSRRL+T+IL
Sbjct  490  NKNHESTTHYEQDVREKLRILDWAPIVYCSATNGTSVEKIISAAALVEKERSRRLSTSIL  549

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REA+AFKSPPR RGGKRGRVYY TQAA+ PPTFV FVNDAKLF +TYRRYMEK+LR
Sbjct  550  NQVIREAIAFKSPPRTRGGKRGRVYYTTQAAVGPPTFVLFVNDAKLFPDTYRRYMEKKLR  609

Query  499  SSAGFSGTPIRLLWRSRRKMEKDG  428
            S AGF GTPIRLLWRSRR+ +K G
Sbjct  610  SDAGFPGTPIRLLWRSRRRPDKRG  633


 Score =   191 bits (486),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEFT +DG+KY+LIDTAGIR++  V S+GS TE+LSV +A
Sbjct  381   VGEDRTIVSPVSGTTRDAIDTEFTTADGEKYKLIDTAGIRRRTAVISAGSTTESLSVKRA  440

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+C+TEQD KIAERIEKEGK C++VVNKWDTIP K ++
Sbjct  441   FRAIRRSDVVALVIEAMACVTEQDYKIAERIEKEGKACVIVVNKWDTIPNKNHE  494



>ref|NP_001146320.1| uncharacterized protein LOC100279896 [Zea mays]
 gb|ACL53683.1| unknown [Zea mays]
Length=653

 Score =   232 bits (592),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKN  + T+YEQDVR KLR+L WAPIVY +A  G SV+KII  AA VEKERSRRL+T+IL
Sbjct  490  NKNHESTTHYEQDVREKLRILDWAPIVYCSATNGTSVEKIISAAALVEKERSRRLSTSIL  549

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REA+AFKSPPR RGGKRGRVYY TQAA+ PPTFV FVNDAKLF +TYRRYMEK+LR
Sbjct  550  NQVIREAIAFKSPPRTRGGKRGRVYYTTQAAVGPPTFVLFVNDAKLFPDTYRRYMEKKLR  609

Query  499  SSAGFSGTPIRLLWRSRRKMEKDG  428
            S AGF GTPIRLLWRSRR+ +K G
Sbjct  610  SDAGFPGTPIRLLWRSRRRPDKRG  633


 Score =   191 bits (486),  Expect(2) = 5e-109, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 104/114 (91%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEFT +DG+KY+LIDTAGIR++  V S+GS TE+LSV +A
Sbjct  381   VGEDRTIVSPVSGTTRDAIDTEFTTADGEKYKLIDTAGIRRRTAVISAGSTTESLSVKRA  440

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+C+TEQD KIAERIEKEGK C++VVNKWDTIP K ++
Sbjct  441   FRAIRRSDVVALVIEAMACVTEQDYKIAERIEKEGKACVIVVNKWDTIPNKNHE  494



>ref|XP_010237502.1| PREDICTED: uncharacterized protein LOC100845933 isoform X1 [Brachypodium 
distachyon]
Length=648

 Score =   230 bits (586),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKN  + T+YE DVR KLRVL WAPIVY +AI G+SV+KII  A+ VEKERSRRL T+IL
Sbjct  488  NKNNESTTHYELDVREKLRVLDWAPIVYCSAINGNSVEKIISAASLVEKERSRRLGTSIL  547

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVVREAVAFK+PPR RGGKRGRVYY TQAA+RPPTFV FVNDAKLF E YRRYM KQLR
Sbjct  548  NQVVREAVAFKAPPRTRGGKRGRVYYTTQAAVRPPTFVLFVNDAKLFPEPYRRYMHKQLR  607

Query  499  SSAGFSGTPIRLLWRSRRKMEK  434
            S AGF GTPIRLLWRSR++ +K
Sbjct  608  SDAGFPGTPIRLLWRSRKRADK  629


 Score =   192 bits (488),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEFT  DGQK++LIDTAGIR++A VAS+GS TE LSV +A
Sbjct  379   VGEDRTIVSPVSGTTRDAIDTEFTTEDGQKFKLIDTAGIRRRAAVASAGSTTETLSVKRA  438

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             F AIRRSDVVALV+EAM+C+TEQD KIAERIEKEGK C++VVNKWDTIP K N+
Sbjct  439   FSAIRRSDVVALVVEAMACVTEQDYKIAERIEKEGKACVIVVNKWDTIPNKNNE  492



>ref|XP_010237503.1| PREDICTED: uncharacterized protein LOC100845933 isoform X2 [Brachypodium 
distachyon]
Length=645

 Score =   230 bits (586),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKN  + T+YE DVR KLRVL WAPIVY +AI G+SV+KII  A+ VEKERSRRL T+IL
Sbjct  485  NKNNESTTHYELDVREKLRVLDWAPIVYCSAINGNSVEKIISAASLVEKERSRRLGTSIL  544

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVVREAVAFK+PPR RGGKRGRVYY TQAA+RPPTFV FVNDAKLF E YRRYM KQLR
Sbjct  545  NQVVREAVAFKAPPRTRGGKRGRVYYTTQAAVRPPTFVLFVNDAKLFPEPYRRYMHKQLR  604

Query  499  SSAGFSGTPIRLLWRSRRKMEK  434
            S AGF GTPIRLLWRSR++ +K
Sbjct  605  SDAGFPGTPIRLLWRSRKRADK  626


 Score =   192 bits (488),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEFT  DGQK++LIDTAGIR++A VAS+GS TE LSV +A
Sbjct  376   VGEDRTIVSPVSGTTRDAIDTEFTTEDGQKFKLIDTAGIRRRAAVASAGSTTETLSVKRA  435

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             F AIRRSDVVALV+EAM+C+TEQD KIAERIEKEGK C++VVNKWDTIP K N+
Sbjct  436   FSAIRRSDVVALVVEAMACVTEQDYKIAERIEKEGKACVIVVNKWDTIPNKNNE  489



>gb|EMS63685.1| GTPase Der [Triticum urartu]
Length=640

 Score =   231 bits (590),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 128/155 (83%), Gaps = 0/155 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKN  + T+YEQDVR KLRVL WAPIVY +AI G+SV+KII  A+ VE+ERSRRL T+IL
Sbjct  482  NKNNESTTHYEQDVREKLRVLDWAPIVYCSAINGNSVEKIISAASLVEEERSRRLGTSIL  541

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVVREAVAFK+PPR RGGKRGRVYY TQAA+RPPTFV FVNDAKLF E YRRYM KQLR
Sbjct  542  NQVVREAVAFKAPPRTRGGKRGRVYYTTQAAVRPPTFVLFVNDAKLFPEPYRRYMHKQLR  601

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSL  395
            S AGF GTPIRLLWRSR++ ++   + + E  ++L
Sbjct  602  SDAGFPGTPIRLLWRSRKRTDRQQRRSNTEARSAL  636


 Score =   191 bits (484),  Expect(2) = 1e-108, Method: Compositional matrix adjust.
 Identities = 91/114 (80%), Positives = 102/114 (89%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTE T  DGQKY+LIDTAGIR++A VAS+GS TE LSV +A
Sbjct  373   VGEDRTIVSPVSGTTRDAIDTELTIKDGQKYKLIDTAGIRRRAAVASAGSTTETLSVKRA  432

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             F AIRRSDVVALVIEAM+C++EQD KIAERIEKEGK C++VVNKWDTIP K N+
Sbjct  433   FSAIRRSDVVALVIEAMACVSEQDYKIAERIEKEGKACVIVVNKWDTIPNKNNE  486



>ref|XP_004979812.1| PREDICTED: uncharacterized protein LOC101764561 [Setaria italica]
Length=661

 Score =   229 bits (583),  Expect(2) = 8e-108, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 121/144 (84%), Gaps = 0/144 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKN  + T+YEQDVR KLR+L WAPIVY +A  G SV+KII  AA VEKERSRRL T+IL
Sbjct  498  NKNHESTTHYEQDVREKLRILDWAPIVYCSATNGTSVEKIISAAALVEKERSRRLGTSIL  557

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVVREA+AFK PPR RGGKRGRVYY TQAA+ PPTFV FVNDAKLFS+ YRRYMEK+LR
Sbjct  558  NQVVREAIAFKPPPRTRGGKRGRVYYTTQAAVGPPTFVLFVNDAKLFSDMYRRYMEKKLR  617

Query  499  SSAGFSGTPIRLLWRSRRKMEKDG  428
            S AGF GTPIRLLWRSRR+ +K G
Sbjct  618  SDAGFPGTPIRLLWRSRRRPDKRG  641


 Score =   191 bits (484),  Expect(2) = 8e-108, Method: Compositional matrix adjust.
 Identities = 90/114 (79%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEFT +DG+KY+LIDTAGIR++A V S+GS TE+LSV +A
Sbjct  389   VGEDRTIVSPVSGTTRDAIDTEFTTADGEKYKLIDTAGIRRRAAVISAGSTTESLSVKRA  448

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             F+AIRRSDVVALVIEAM+C+TEQD KIAERIEKEGK C++VVNKWDTIP K ++
Sbjct  449   FQAIRRSDVVALVIEAMACVTEQDYKIAERIEKEGKACVIVVNKWDTIPNKNHE  502



>ref|XP_006592177.1| PREDICTED: uncharacterized protein LOC100777588 isoform X2 [Glycine 
max]
Length=572

 Score =   268 bits (685),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 140/162 (86%), Gaps = 3/162 (2%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA+YYEQDVR KLR L WAPIVYSTA+AGHSVDKIIV A  VEKERSRRL T+IL
Sbjct  406  NKNQQTASYYEQDVREKLRSLVWAPIVYSTAVAGHSVDKIIVAAIEVEKERSRRLGTSIL  465

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVV+EAV FK PPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLF ETYRRYMEKQLR
Sbjct  466  NQVVQEAVGFKPPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFPETYRRYMEKQLR  525

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKV---SRETSTSLERRL  383
            + AGFSGTPIRLLWRSRRKM KD GK    +RE  TS +R+L
Sbjct  526  TDAGFSGTPIRLLWRSRRKMGKDEGKPVTKTRENLTSNDRKL  567


 Score =   149 bits (376),  Expect(2) = 3e-107, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 94/116 (81%), Gaps = 2/116 (2%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGT-TRDAIDTEFTGSDG-QKYRLIDTAGIRKKATVASSGSITEALSVN  1012
             +G +   +S +SGT T + +D   +G    +K++LIDTAGIRK+  +AS+GS TEALSVN
Sbjct  295   LGFEPLPISAISGTGTGELLDLVCSGLQKIEKFQLIDTAGIRKRTAIASAGSTTEALSVN  354

Query  1011  QAFRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             +AFRAIRRSDVVALVIEAM+CITEQD KIAERIEKEGKGC++VVNKWDTIP K  Q
Sbjct  355   RAFRAIRRSDVVALVIEAMACITEQDYKIAERIEKEGKGCVIVVNKWDTIPNKNQQ  410



>gb|EMT17683.1| GTP-binding protein engA [Aegilops tauschii]
Length=639

 Score =   232 bits (592),  Expect(2) = 4e-106, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKN  + T+YEQDVR KLRVL WAPIVY +AI G+SV+KII  A+ VEKERSRRL T+IL
Sbjct  481  NKNNESTTHYEQDVREKLRVLDWAPIVYCSAINGNSVEKIISAASLVEKERSRRLGTSIL  540

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVVREAVAFK+PPR RGGKRGRVYY TQAA+RPPTFV FVNDAKLF E YRRYM KQLR
Sbjct  541  NQVVREAVAFKAPPRTRGGKRGRVYYTTQAAVRPPTFVLFVNDAKLFPEPYRRYMHKQLR  600

Query  499  SSAGFSGTPIRLLWRSRRKMEK  434
            S AGF GTPIRLLWRSR++ ++
Sbjct  601  SDAGFPGTPIRLLWRSRKRTDR  622


 Score =   181 bits (460),  Expect(2) = 4e-106, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 102/128 (80%), Gaps = 14/128 (11%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQ--------------KYRLIDTAGIRKKATVA  1048
             VGEDRTIVSPVSGTTRDAIDTE T  DGQ              KY+LIDTAGIR++A VA
Sbjct  358   VGEDRTIVSPVSGTTRDAIDTELTTVDGQYTANTGMLISQMPQKYKLIDTAGIRRRAAVA  417

Query  1047  SSGSITEALSVNQAFRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWD  868
             S+GS TE LSV +AF AIRRSDVVALVIEAM+C++EQD KIAERIEKEGK C++VVNKWD
Sbjct  418   SAGSTTETLSVKRAFSAIRRSDVVALVIEAMACVSEQDYKIAERIEKEGKACVIVVNKWD  477

Query  867   TIPTKTNQ  844
             TIP K N+
Sbjct  478   TIPNKNNE  485



>ref|XP_001770231.1| predicted protein [Physcomitrella patens]
 gb|EDQ64906.1| predicted protein [Physcomitrella patens]
Length=542

 Score =   197 bits (502),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NK+  +  +Y++DVR +LR L WAP VY +A +G  + KI+  A A  +ER RRLTTA L
Sbjct  368  NKDAMSTVWYDKDVRERLRCLDWAPTVYCSASSGQRIKKILEMAVAAGEERQRRLTTATL  427

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+R+AVA K PP  RGGK+GR+YYCTQA ++PPTFVFFVNDA LF E YRRYMEKQLR
Sbjct  428  NQVIRDAVALKQPPTGRGGKKGRIYYCTQAGVKPPTFVFFVNDANLFPEIYRRYMEKQLR  487

Query  499  SSAGFSGTPIRLLWRSRRKMEK  434
             + GF GTP+RLLWRS++K ++
Sbjct  488  LNVGFPGTPVRLLWRSKQKTDR  509


 Score =   171 bits (432),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 96/111 (86%), Gaps = 0/111 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+RTIVSPVSGTTRDAIDTEF   +GQ  +LIDTAGIR++  VAS+GS  E+LSVN+A
Sbjct  259   VGEERTIVSPVSGTTRDAIDTEFADDNGQTLKLIDTAGIRRRGAVASAGSRAESLSVNRA  318

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTK  853
             FRAIRRSDVVALVI+A+ C+TEQD ++ ERI +EGK C++VVNKWDTIP K
Sbjct  319   FRAIRRSDVVALVIDALDCVTEQDFRLGERIAREGKACIIVVNKWDTIPNK  369



>ref|XP_002985833.1| hypothetical protein SELMODRAFT_123195, partial [Selaginella 
moellendorffii]
 gb|EFJ13010.1| hypothetical protein SELMODRAFT_123195, partial [Selaginella 
moellendorffii]
Length=492

 Score =   193 bits (491),  Expect(2) = 9e-91, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 116/155 (75%), Gaps = 1/155 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +KN  +  +Y+ DVR KLRVL WAPIVY++A +G  V KI+ TA +  +ER RR++TAIL
Sbjct  339  DKNAESTYWYDMDVREKLRVLKWAPIVYTSATSGQRVQKILATALSAGQERERRISTAIL  398

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVV++A+  K PP  RGG++GR+Y+CTQA  RPPTFVFFVND KLF + Y+RYMEKQLR
Sbjct  399  NQVVQDAINMKQPPTTRGGRKGRLYFCTQATTRPPTFVFFVNDEKLFPDDYKRYMEKQLR  458

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSL  395
             + GF GTPIRL WRS+R + + G K S +   S+
Sbjct  459  QNIGFPGTPIRLFWRSKR-LARPGSKQSTQELASV  492


 Score =   169 bits (428),  Expect(2) = 9e-91, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VG++RTIVSPVSGTTRDAIDTE TG +G+ +RLIDTAGIRK+A +AS GS TE+L V  A
Sbjct  230   VGKERTIVSPVSGTTRDAIDTEVTGPEGKVFRLIDTAGIRKRAAIASGGSKTESLCVQSA  289

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
              RAIRR+DVVALVIEAM+C TEQD ++ ERIEK+GK C++VVNKWDT+P K  +
Sbjct  290   LRAIRRADVVALVIEAMTCATEQDYRLGERIEKDGKACIIVVNKWDTVPDKNAE  343



>ref|XP_002984773.1| hypothetical protein SELMODRAFT_121150, partial [Selaginella 
moellendorffii]
 gb|EFJ14023.1| hypothetical protein SELMODRAFT_121150, partial [Selaginella 
moellendorffii]
Length=490

 Score =   193 bits (491),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 116/155 (75%), Gaps = 1/155 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +KN  +  +Y+ DVR KLRVL WAPIVY++A +G  V KI+ TA +  +ER RR++TAIL
Sbjct  337  DKNAESTYWYDMDVREKLRVLKWAPIVYTSATSGQRVQKILATALSAGQERERRISTAIL  396

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVV++A+  K PP  RGG++GR+Y+CTQA  RPPTFVFFVND KLF + Y+RYMEKQLR
Sbjct  397  NQVVQDAINMKQPPTTRGGRKGRLYFCTQATTRPPTFVFFVNDEKLFPDDYKRYMEKQLR  456

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSL  395
             + GF GTPIRL WRS+R + + G K S +   S+
Sbjct  457  QNIGFPGTPIRLFWRSKR-LARPGSKQSTQELASV  490


 Score =   167 bits (424),  Expect(2) = 3e-90, Method: Compositional matrix adjust.
 Identities = 79/114 (69%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VG++RTIVSPVSGTTRDAIDTE  G +G+ +RLIDTAGIRK+A +AS GS TE+L V  A
Sbjct  228   VGKERTIVSPVSGTTRDAIDTEVAGPEGKVFRLIDTAGIRKRAAIASGGSKTESLCVQSA  287

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
              RAIRR+DVVALVIEAM+C TEQD ++ ERIEK+GK C++VVNKWDT+P K  +
Sbjct  288   LRAIRRADVVALVIEAMTCATEQDYRLGERIEKDGKACIIVVNKWDTVPDKNAE  341



>ref|XP_006663070.1| PREDICTED: uncharacterized protein LOC102708102 isoform X2 [Oryza 
brachyantha]
Length=357

 Score =   193 bits (490),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 103/114 (90%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEF   DGQKY+LIDTAGIR++A VAS+GS TE LSV +A
Sbjct  113   VGEDRTIVSPVSGTTRDAIDTEFITEDGQKYKLIDTAGIRRRAAVASAGSTTETLSVKRA  172

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALV+EAM+CITEQD KIAERIEKEGK C++VVNKWDTIP K +Q
Sbjct  173   FRAIRRSDVVALVVEAMACITEQDYKIAERIEKEGKACVIVVNKWDTIPNKNHQ  226


 Score =   165 bits (418),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 86/144 (60%), Positives = 96/144 (67%), Gaps = 28/144 (19%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKN  + TYYEQDVR KLR+L WAPIVY +A  G SVDKII  AA VEKERSRRL T+IL
Sbjct  222  NKNHQSTTYYEQDVREKLRILDWAPIVYCSATHGSSVDKIISAAALVEKERSRRLGTSIL  281

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQV+REA+AFK PPR RGGKRGRVYY TQ                            +LR
Sbjct  282  NQVIREAIAFKPPPRTRGGKRGRVYYTTQ----------------------------KLR  313

Query  499  SSAGFSGTPIRLLWRSRRKMEKDG  428
            S AGF GTPIRLLWRSR++ +K G
Sbjct  314  SDAGFPGTPIRLLWRSRKRPDKKG  337



>ref|NP_001078139.1| putative double era-like GTPase [Arabidopsis thaliana]
 gb|AEE75147.1| GTP-binding protein [Arabidopsis thaliana]
Length=587

 Score =   202 bits (514),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             V EDRTIVSPVSGTTRDAID EFTG DG+K+RLIDTAGIRKK++VASSGS TEA+SVN+A
Sbjct  389   VREDRTIVSPVSGTTRDAIDAEFTGPDGEKFRLIDTAGIRKKSSVASSGSTTEAMSVNRA  448

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQD KIAERIE+EGKGCLVVVNKWDTIP K  +
Sbjct  449   FRAIRRSDVVALVIEAMACITEQDLKIAERIEREGKGCLVVVNKWDTIPNKNQE  502


 Score =   155 bits (392),  Expect(2) = 3e-89, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 78/89 (88%), Gaps = 0/89 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA +YE DVR KLR L WAPIVYSTAI GHSVD I+V AA V+KERSRRL+TAIL
Sbjct  498  NKNQETAAHYEDDVREKLRSLKWAPIVYSTAITGHSVDNIVVAAATVQKERSRRLSTAIL  557

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQ  593
            NQV+REAVAFKSPPR RGGKRGRVYYCTQ
Sbjct  558  NQVIREAVAFKSPPRTRGGKRGRVYYCTQ  586



>gb|KHN21905.1| GTPase Der [Glycine soja]
Length=518

 Score =   240 bits (613),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TA+YYEQDVR KLR L WAPIVYST +AGHSV KIIV A+ VEKERSRRL T+ L
Sbjct  371  NKNQQTASYYEQDVREKLRSLDWAPIVYSTVVAGHSVGKIIVAASEVEKERSRRLGTSTL  430

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVV+EAV FK PPR RGGK GRVYYCTQAAI+PPTFVFFVND KLF ETYRRYMEKQ R
Sbjct  431  NQVVQEAVGFKPPPRTRGGKGGRVYYCTQAAIKPPTFVFFVNDGKLFPETYRRYMEKQHR  490

Query  499  SSAGFSGTPIRLLWRSRRKMEKD  431
            S AGF GTPIRLLWRSRRK+  D
Sbjct  491  SDAGFFGTPIRLLWRSRRKVGND  513


 Score =   102 bits (254),  Expect(2) = 1e-84, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 61/114 (54%), Gaps = 46/114 (40%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+S TTRDAIDTEFTG DGQ                               
Sbjct  308   VGEDRTIVSPISCTTRDAIDTEFTGPDGQ-------------------------------  336

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
                            AM+CITEQ+  IAERIEKEGKGC++VVNKWDTIP K  Q
Sbjct  337   ---------------AMACITEQEYNIAERIEKEGKGCVIVVNKWDTIPNKNQQ  375



>ref|XP_007214807.1| hypothetical protein PRUPE_ppa023138m2g, partial [Prunus persica]
 gb|EMJ16006.1| hypothetical protein PRUPE_ppa023138m2g, partial [Prunus persica]
Length=192

 Score =   267 bits (682),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 145/165 (88%), Gaps = 3/165 (2%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ TATYYEQDVR KLRVLGWAPIVYSTAIAG SVDKII+ A+ VEKERSRRL+T+++
Sbjct  27   NKNQQTATYYEQDVREKLRVLGWAPIVYSTAIAGQSVDKIIIAASTVEKERSRRLSTSVV  86

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVV+EA+AFKSPPR RGGKRGR+YYCTQAAIRPPTFVFFVNDAKLF ETYRRYMEKQLR
Sbjct  87   NQVVQEALAFKSPPRTRGGKRGRIYYCTQAAIRPPTFVFFVNDAKLFPETYRRYMEKQLR  146

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSL---ERRLEVA  374
            S AGF GTPIRLLW +RRK EK+ G+ +  T  +L   +R+LE+A
Sbjct  147  SDAGFLGTPIRLLWSNRRKTEKEEGRAATRTQANLVPRDRKLELA  191


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 26/31 (84%), Positives = 28/31 (90%), Gaps = 0/31 (0%)
 Frame = -2

Query  936  DCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
            DCKIAERIE+EGKGCL+VVNKWDTIP K  Q
Sbjct  1    DCKIAERIEREGKGCLIVVNKWDTIPNKNQQ  31



>ref|XP_008227136.1| PREDICTED: uncharacterized protein LOC103326678 [Prunus mume]
Length=662

 Score =   270 bits (691),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 156/193 (81%), Gaps = 8/193 (4%)
 Frame = -1

Query  931  QDC----RKDREGRQRLPRCCK*VGHNSNKNQSTATYYEQDVRGKLRVLGWAPIVYSTAI  764
            QDC    R +REG+  L    K      NKNQ TATYYEQDVR KLRVLGWAPIVYSTAI
Sbjct  470  QDCKIAERIEREGKGCLIVVNK-WDTIPNKNQQTATYYEQDVREKLRVLGWAPIVYSTAI  528

Query  763  AGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCTQAAI  584
            AG SVDKII+ A+ VEKERSRRL+T+++NQVV+EA+AFKSPPR RGGKRGR+YYCTQAAI
Sbjct  529  AGQSVDKIIIAASTVEKERSRRLSTSVVNQVVQEALAFKSPPRTRGGKRGRIYYCTQAAI  588

Query  583  RPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDGGKVSRETS  404
            RPPTFVFFVNDAKLF ETYRRYMEKQLRS AGF GTPIRLLW +RRK EK+ G+ +  T 
Sbjct  589  RPPTFVFFVNDAKLFPETYRRYMEKQLRSDAGFLGTPIRLLWSNRRKTEKEEGRAATRTQ  648

Query  403  TSL---ERRLEVA  374
             +L   +R+LE+A
Sbjct  649  ANLVPRDRKLELA  661


 Score =   207 bits (528),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAID EF G DGQK+RLIDTAGIR++A VASSGS+TEALSVN+A
Sbjct  388   VGEDRTIVSPVSGTTRDAIDIEFIGPDGQKFRLIDTAGIRRRAVVASSGSMTEALSVNRA  447

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEA++CITEQDCKIAERIE+EGKGCL+VVNKWDTIP K  Q
Sbjct  448   FRAIRRSDVVALVIEALACITEQDCKIAERIEREGKGCLIVVNKWDTIPNKNQQ  501



>ref|XP_008449721.1| PREDICTED: uncharacterized protein LOC103491517 [Cucumis melo]
Length=660

 Score =   270 bits (690),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 138/186 (74%), Positives = 151/186 (81%), Gaps = 5/186 (3%)
 Frame = -1

Query  931  QDC----RKDREGRQRLPRCCK*VGHNSNKNQSTATYYEQDVRGKLRVLGWAPIVYSTAI  764
            QDC    R ++EG+  L    K      NKNQ TA YYEQDVR KLR L WAPIVYSTAI
Sbjct  468  QDCKIAERIEKEGKGCLIVVNK-WDTIPNKNQQTAMYYEQDVREKLRCLDWAPIVYSTAI  526

Query  763  AGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCTQAAI  584
            AGHSVDKII  A+AVEKERSRRLTT+ILNQVV+EA+AFK+PPR RGGKRGRVYYCTQAAI
Sbjct  527  AGHSVDKIITAASAVEKERSRRLTTSILNQVVQEALAFKAPPRTRGGKRGRVYYCTQAAI  586

Query  583  RPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDGGKVSRETS  404
            RPPTFVFFVNDAKLF ETYRRYMEKQLR++AGF GTPIRLLWRSRRKMEK   K + +T 
Sbjct  587  RPPTFVFFVNDAKLFPETYRRYMEKQLRANAGFPGTPIRLLWRSRRKMEKGEVKGTTKTQ  646

Query  403  TSLERR  386
             SL +R
Sbjct  647  VSLTQR  652


 Score =   211 bits (536),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEFTG DGQK+RLIDTAGIR++A VASSGS+TE+LSVN+A
Sbjct  386   VGEDRTIVSPISGTTRDAIDTEFTGQDGQKFRLIDTAGIRRRAAVASSGSMTESLSVNRA  445

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEA++CITEQDCKIAERIEKEGKGCL+VVNKWDTIP K  Q
Sbjct  446   FRAIRRSDVVALVIEALACITEQDCKIAERIEKEGKGCLIVVNKWDTIPNKNQQ  499



>ref|XP_009768584.1| PREDICTED: uncharacterized protein LOC104219584 [Nicotiana sylvestris]
Length=652

 Score =   267 bits (683),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 146/174 (84%), Gaps = 5/174 (3%)
 Frame = -1

Query  931  QDC----RKDREGRQRLPRCCK*VGHNSNKNQSTATYYEQDVRGKLRVLGWAPIVYSTAI  764
            QDC    R ++EG+  L    K      NKNQ T  +YE+DVR K+R L WAPIVYSTAI
Sbjct  459  QDCKIAERIEKEGKGCLIVVNK-WDTIPNKNQETTVFYEEDVRRKVRSLSWAPIVYSTAI  517

Query  763  AGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCTQAAI  584
            AGHSV+KIIV AAAVEKERSRRLTTAILNQVVREAVAFK+PPR RGGKRGRVYY TQAAI
Sbjct  518  AGHSVEKIIVAAAAVEKERSRRLTTAILNQVVREAVAFKAPPRTRGGKRGRVYYSTQAAI  577

Query  583  RPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDGGK  422
            RPPTFVFFVNDAKLFSETYRRYMEKQLR+SAGF+GTPIRLLWRSRRKMEK  GK
Sbjct  578  RPPTFVFFVNDAKLFSETYRRYMEKQLRTSAGFAGTPIRLLWRSRRKMEKSDGK  631


 Score =   215 bits (547),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEFTGSDGQK+RLIDTAGIR+KA VASSGSI EALSVNQA
Sbjct  377   VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKFRLIDTAGIRRKAAVASSGSIPEALSVNQA  436

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
              RAIRRSDVVALVIEAM+CITEQDCKIAERIEKEGKGCL+VVNKWDTIP K  +
Sbjct  437   LRAIRRSDVVALVIEAMACITEQDCKIAERIEKEGKGCLIVVNKWDTIPNKNQE  490



>ref|XP_004142117.1| PREDICTED: uncharacterized protein LOC101205027 [Cucumis sativus]
Length=660

 Score =   267 bits (682),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 149/186 (80%), Gaps = 5/186 (3%)
 Frame = -1

Query  931  QDC----RKDREGRQRLPRCCK*VGHNSNKNQSTATYYEQDVRGKLRVLGWAPIVYSTAI  764
            QDC    R ++EG+  L    K      NKNQ TA YYEQDVR KLR L WAPIVYSTAI
Sbjct  468  QDCKIAERIEKEGKGCLIVVNK-WDTIPNKNQQTAMYYEQDVREKLRCLDWAPIVYSTAI  526

Query  763  AGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCTQAAI  584
            AGHSVDKII  A+AVEKERSRRLTT+ILNQVV+EA+AFK+PPR RGGKRGRVYYCTQAAI
Sbjct  527  AGHSVDKIITAASAVEKERSRRLTTSILNQVVQEALAFKAPPRTRGGKRGRVYYCTQAAI  586

Query  583  RPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDGGKVSRETS  404
            RPPTF+FFVNDAKLF ETYRRYMEKQLR++AGF GTPIRLLWRSRRKMEK   K   +T 
Sbjct  587  RPPTFIFFVNDAKLFPETYRRYMEKQLRANAGFPGTPIRLLWRSRRKMEKGEAKGPTKTQ  646

Query  403  TSLERR  386
              L ++
Sbjct  647  VKLTQQ  652


 Score =   211 bits (537),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEFTG DGQK+RLIDTAGIR++A VASSGS+TE+LSVN+A
Sbjct  386   VGEDRTIVSPISGTTRDAIDTEFTGQDGQKFRLIDTAGIRRRAAVASSGSMTESLSVNRA  445

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEA++CITEQDCKIAERIEKEGKGCL+VVNKWDTIP K  Q
Sbjct  446   FRAIRRSDVVALVIEALACITEQDCKIAERIEKEGKGCLIVVNKWDTIPNKNQQ  499



>ref|XP_009347314.1| PREDICTED: uncharacterized protein LOC103938985 [Pyrus x bretschneideri]
 ref|XP_009347317.1| PREDICTED: uncharacterized protein LOC103938988 [Pyrus x bretschneideri]
Length=659

 Score =   266 bits (681),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 154/193 (80%), Gaps = 8/193 (4%)
 Frame = -1

Query  931  QDC----RKDREGRQRLPRCCK*VGHNSNKNQSTATYYEQDVRGKLRVLGWAPIVYSTAI  764
            QDC    R +REG+  L    K      NKNQ TATYYE+DVR KLR+LGWAPIVYSTAI
Sbjct  467  QDCKIAERIEREGKGCLIVVNK-WDTIPNKNQQTATYYEEDVREKLRILGWAPIVYSTAI  525

Query  763  AGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCTQAAI  584
            AG SVDKII  A+ VEKERSRRL+T+++NQVV+EA+AFKSPPR RGGKRGR+YYCTQAAI
Sbjct  526  AGQSVDKIIDAASTVEKERSRRLSTSVVNQVVQEALAFKSPPRTRGGKRGRIYYCTQAAI  585

Query  583  RPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDGGKVSRETS  404
            RPPTFVFFVNDAKLF ETYRRYMEKQLRS AGF GTPIRLLW +RRK EK+ G+ +    
Sbjct  586  RPPTFVFFVNDAKLFPETYRRYMEKQLRSDAGFLGTPIRLLWSNRRKTEKEEGRAATRAQ  645

Query  403  TSL---ERRLEVA  374
             +L   ER+LE+A
Sbjct  646  ANLVPRERKLELA  658


 Score =   211 bits (536),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAID EFTG DGQK+RLIDTAGIR++A VASSGS+TEALSVN+A
Sbjct  385   VGEDRTIVSPVSGTTRDAIDMEFTGPDGQKFRLIDTAGIRRRAVVASSGSMTEALSVNRA  444

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEA++CITEQDCKIAERIE+EGKGCL+VVNKWDTIP K  Q
Sbjct  445   FRAIRRSDVVALVIEALACITEQDCKIAERIEREGKGCLIVVNKWDTIPNKNQQ  498



>ref|XP_009376882.1| PREDICTED: uncharacterized protein LOC103965542 [Pyrus x bretschneideri]
Length=659

 Score =   266 bits (681),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 154/193 (80%), Gaps = 8/193 (4%)
 Frame = -1

Query  931  QDC----RKDREGRQRLPRCCK*VGHNSNKNQSTATYYEQDVRGKLRVLGWAPIVYSTAI  764
            QDC    R +REG+  L    K      NKNQ TATYYE+DVR KLR+LGWAPIVYSTAI
Sbjct  467  QDCKIAERIEREGKGCLIVVNK-WDTIPNKNQQTATYYEEDVREKLRILGWAPIVYSTAI  525

Query  763  AGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCTQAAI  584
            AG SVDKII  A+ VEKERSRRL+T+++NQVV+EA+AFKSPPR RGGKRGR+YYCTQAAI
Sbjct  526  AGQSVDKIIDAASTVEKERSRRLSTSVVNQVVQEALAFKSPPRTRGGKRGRIYYCTQAAI  585

Query  583  RPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDGGKVSRETS  404
            RPPTFVFFVNDAKLF ETYRRYMEKQLRS AGF GTPIRLLW +RRK EK+ G+ +    
Sbjct  586  RPPTFVFFVNDAKLFPETYRRYMEKQLRSDAGFLGTPIRLLWSNRRKTEKEEGRAATRAQ  645

Query  403  TSL---ERRLEVA  374
             +L   ER+LE+A
Sbjct  646  ANLVPRERKLELA  658


 Score =   211 bits (536),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAID EFTG DGQK+RLIDTAGIR++A VASSGS+TEALSVN+A
Sbjct  385   VGEDRTIVSPVSGTTRDAIDMEFTGPDGQKFRLIDTAGIRRRAVVASSGSMTEALSVNRA  444

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEA++CITEQDCKIAERIE+EGKGCL+VVNKWDTIP K  Q
Sbjct  445   FRAIRRSDVVALVIEALACITEQDCKIAERIEREGKGCLIVVNKWDTIPNKNQQ  498



>ref|XP_004250946.1| PREDICTED: uncharacterized protein LOC101251249 [Solanum lycopersicum]
Length=645

 Score =   266 bits (679),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 154/193 (80%), Gaps = 9/193 (5%)
 Frame = -1

Query  931  QDC----RKDREGRQRLPRCCK*VGHNSNKNQSTATYYEQDVRGKLRVLGWAPIVYSTAI  764
            QDC    R +REG+  L    K      NKNQ T  +YE+DVR K+R L WAPIVYSTAI
Sbjct  452  QDCKIAERIEREGKGCLIVVNK-WDTIPNKNQETTIFYEEDVRRKVRSLSWAPIVYSTAI  510

Query  763  AGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCTQAAI  584
            AGHSV+KIIV+AAAVEKERSRRLTTAILNQVVREAVAFK+PPR RGGKRGRVYY TQAAI
Sbjct  511  AGHSVEKIIVSAAAVEKERSRRLTTAILNQVVREAVAFKAPPRTRGGKRGRVYYSTQAAI  570

Query  583  RPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDGGK----VS  416
            RPPTFVFFVNDAKLF ETYRRYMEKQLR+SAGF+GTPIRLLWRSRRK+EK  GK      
Sbjct  571  RPPTFVFFVNDAKLFPETYRRYMEKQLRTSAGFAGTPIRLLWRSRRKIEKSAGKGPSTTM  630

Query  415  RETSTSLERRLEV  377
            ++  T +E+ L V
Sbjct  631  QDGFTGIEKSLAV  643


 Score =   213 bits (542),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEFTG DGQK+RLIDTAGIRKK  VASSGSI EALSVNQA
Sbjct  370   VGEDRTIVSPVSGTTRDAIDTEFTGPDGQKFRLIDTAGIRKKTAVASSGSIPEALSVNQA  429

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQDCKIAERIE+EGKGCL+VVNKWDTIP K  +
Sbjct  430   FRAIRRSDVVALVIEAMACITEQDCKIAERIEREGKGCLIVVNKWDTIPNKNQE  483



>gb|AGL34232.1| plastid GTPase Der [Nicotiana benthamiana]
Length=651

 Score =   266 bits (679),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 145/174 (83%), Gaps = 5/174 (3%)
 Frame = -1

Query  931  QDC----RKDREGRQRLPRCCK*VGHNSNKNQSTATYYEQDVRGKLRVLGWAPIVYSTAI  764
            QDC    R ++EG+  L    K      NKNQ T  +YE+DVR K+R L WAPIVYSTAI
Sbjct  458  QDCKIAERIEKEGKGCLIVVNK-WDTIPNKNQETTVFYEEDVRRKVRSLSWAPIVYSTAI  516

Query  763  AGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCTQAAI  584
            AGHSV+KIIV AAAVEKERSRRLTTAILNQVVREAVAFK+PPR RGGKRGRVYY TQAAI
Sbjct  517  AGHSVEKIIVAAAAVEKERSRRLTTAILNQVVREAVAFKAPPRTRGGKRGRVYYSTQAAI  576

Query  583  RPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDGGK  422
            RPPTFVFFVNDAKLFSETYRRYMEKQLR SAGF+GTPIRLLWRSRRKMEK  GK
Sbjct  577  RPPTFVFFVNDAKLFSETYRRYMEKQLRMSAGFAGTPIRLLWRSRRKMEKSDGK  630


 Score =   216 bits (549),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+RTIVSPVSGTTRDAIDTEFTGSDGQK+RLIDTAGIR+KA VASSGSI EALSVNQA
Sbjct  376   VGENRTIVSPVSGTTRDAIDTEFTGSDGQKFRLIDTAGIRRKAAVASSGSIPEALSVNQA  435

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQDCKIAERIEKEGKGCL+VVNKWDTIP K  +
Sbjct  436   FRAIRRSDVVALVIEAMACITEQDCKIAERIEKEGKGCLIVVNKWDTIPNKNQE  489



>gb|KGN54174.1| hypothetical protein Csa_4G291380 [Cucumis sativus]
Length=697

 Score =   266 bits (681),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 149/186 (80%), Gaps = 5/186 (3%)
 Frame = -1

Query  931  QDC----RKDREGRQRLPRCCK*VGHNSNKNQSTATYYEQDVRGKLRVLGWAPIVYSTAI  764
            QDC    R ++EG+  L    K      NKNQ TA YYEQDVR KLR L WAPIVYSTAI
Sbjct  505  QDCKIAERIEKEGKGCLIVVNK-WDTIPNKNQQTAMYYEQDVREKLRCLDWAPIVYSTAI  563

Query  763  AGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCTQAAI  584
            AGHSVDKII  A+AVEKERSRRLTT+ILNQVV+EA+AFK+PPR RGGKRGRVYYCTQAAI
Sbjct  564  AGHSVDKIITAASAVEKERSRRLTTSILNQVVQEALAFKAPPRTRGGKRGRVYYCTQAAI  623

Query  583  RPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDGGKVSRETS  404
            RPPTF+FFVNDAKLF ETYRRYMEKQLR++AGF GTPIRLLWRSRRKMEK   K   +T 
Sbjct  624  RPPTFIFFVNDAKLFPETYRRYMEKQLRANAGFPGTPIRLLWRSRRKMEKGEAKGPTKTQ  683

Query  403  TSLERR  386
              L ++
Sbjct  684  VKLTQQ  689


 Score =   211 bits (537),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 99/114 (87%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEFTG DGQK+RLIDTAGIR++A VASSGS+TE+LSVN+A
Sbjct  423   VGEDRTIVSPISGTTRDAIDTEFTGQDGQKFRLIDTAGIRRRAAVASSGSMTESLSVNRA  482

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEA++CITEQDCKIAERIEKEGKGCL+VVNKWDTIP K  Q
Sbjct  483   FRAIRRSDVVALVIEALACITEQDCKIAERIEKEGKGCLIVVNKWDTIPNKNQQ  536



>ref|XP_009615948.1| PREDICTED: uncharacterized protein LOC104108581 [Nicotiana tomentosiformis]
Length=654

 Score =   265 bits (678),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 135/174 (78%), Positives = 146/174 (84%), Gaps = 5/174 (3%)
 Frame = -1

Query  931  QDC----RKDREGRQRLPRCCK*VGHNSNKNQSTATYYEQDVRGKLRVLGWAPIVYSTAI  764
            QDC    R ++EG+  L    K      NKNQ T  +YE+DVR K+R L WAPIVYSTAI
Sbjct  461  QDCKIAERIEKEGKGCLIVVNK-WDTIPNKNQETTVFYEEDVRRKVRSLSWAPIVYSTAI  519

Query  763  AGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCTQAAI  584
            AGHSV+KIIV AAAVEKERSRRLTTAILNQVVREAVAFK+PPR RGGKRGRVYY TQAAI
Sbjct  520  AGHSVEKIIVAAAAVEKERSRRLTTAILNQVVREAVAFKAPPRTRGGKRGRVYYSTQAAI  579

Query  583  RPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDGGK  422
            RPPTFVFFVNDAKLF ETYRRYMEKQLR+SAGF+GTPIRLLWRSRRKMEK+ GK
Sbjct  580  RPPTFVFFVNDAKLFPETYRRYMEKQLRTSAGFAGTPIRLLWRSRRKMEKNDGK  633


 Score =   217 bits (553),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/114 (91%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAIDTEFTGSDGQK+RLIDTAGIR+KA VASSGSI EALSVNQA
Sbjct  379   VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKFRLIDTAGIRRKAAVASSGSIPEALSVNQA  438

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQDCKIAERIEKEGKGCL+VVNKWDTIP K  +
Sbjct  439   FRAIRRSDVVALVIEAMACITEQDCKIAERIEKEGKGCLIVVNKWDTIPNKNQE  492



>ref|XP_009375054.1| PREDICTED: uncharacterized protein LOC103963899 [Pyrus x bretschneideri]
Length=660

 Score =   265 bits (678),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 154/193 (80%), Gaps = 8/193 (4%)
 Frame = -1

Query  931  QDC----RKDREGRQRLPRCCK*VGHNSNKNQSTATYYEQDVRGKLRVLGWAPIVYSTAI  764
            QDC    R +REG+  L    K      NKNQ TATYYEQDVR KLR+LGWAPIVYSTAI
Sbjct  468  QDCKIAERIEREGKGCLIVVNK-WDTVPNKNQQTATYYEQDVREKLRILGWAPIVYSTAI  526

Query  763  AGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCTQAAI  584
            AG SVDKII  A+ VEKERSRRL+T+++NQVV+EA+AFKSPPR RGGKRGR+YYCTQAAI
Sbjct  527  AGQSVDKIIDAASTVEKERSRRLSTSVVNQVVQEALAFKSPPRTRGGKRGRIYYCTQAAI  586

Query  583  RPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDGGKVSRETS  404
            RPPTFVFFVND+KLF ETYRRYMEKQLRS AGF GTPIRLLW +RRK EK+ G+ +    
Sbjct  587  RPPTFVFFVNDSKLFPETYRRYMEKQLRSDAGFLGTPIRLLWSNRRKTEKEEGRAAMRAQ  646

Query  403  TSL---ERRLEVA  374
             +L   +R+LE+A
Sbjct  647  ANLVPSDRKLELA  659


 Score =   205 bits (521),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             V EDRTIVSPVSGTTRDAID EFTG DGQK++LIDTAGIR++A VASSGS+TEALSVN+A
Sbjct  386   VREDRTIVSPVSGTTRDAIDMEFTGPDGQKFKLIDTAGIRRRAVVASSGSMTEALSVNRA  445

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEA++CITEQDCKIAERIE+EGKGCL+VVNKWDT+P K  Q
Sbjct  446   FRAIRRSDVVALVIEALACITEQDCKIAERIEREGKGCLIVVNKWDTVPNKNQQ  499



>ref|XP_008385564.1| PREDICTED: uncharacterized protein LOC103448103 [Malus domestica]
Length=660

 Score =   265 bits (678),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 134/193 (69%), Positives = 154/193 (80%), Gaps = 8/193 (4%)
 Frame = -1

Query  931  QDC----RKDREGRQRLPRCCK*VGHNSNKNQSTATYYEQDVRGKLRVLGWAPIVYSTAI  764
            QDC    R +REG+  L    K      NKNQ TATYYEQDVR KLR+LGWAPIVYSTAI
Sbjct  468  QDCKIAXRIEREGKGCLIVVNK-WDTIPNKNQQTATYYEQDVREKLRILGWAPIVYSTAI  526

Query  763  AGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCTQAAI  584
            AG SVDKII  A+ VEKERSRRL+T+++NQVV+EA+AFKSPPR RGGKRGR+YYCTQAAI
Sbjct  527  AGQSVDKIIDAASTVEKERSRRLSTSVVNQVVQEALAFKSPPRTRGGKRGRIYYCTQAAI  586

Query  583  RPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDGGKVSRETS  404
            RPPTFVFFV+D+KLF ETYRRYMEKQLRS AGF GTPIRLLW +RRK EK+ GK +    
Sbjct  587  RPPTFVFFVBDSKLFPETYRRYMEKQLRSDAGFLGTPIRLLWSNRRKTEKEEGKAATRAQ  646

Query  403  TSL---ERRLEVA  374
             +L   +R+LE+A
Sbjct  647  ANLVPRDRKLELA  659


 Score =   206 bits (525),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAID EFTG DGQK++LIDTAGIR++A VASSGS+TEALSVN+A
Sbjct  386   VGEDRTIVSPVSGTTRDAIDMEFTGPDGQKFKLIDTAGIRRRAVVASSGSMTEALSVNRA  445

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEA++CITEQDCKIA RIE+EGKGCL+VVNKWDTIP K  Q
Sbjct  446   FRAIRRSDVVALVIEALACITEQDCKIAXRIEREGKGCLIVVNKWDTIPNKNQQ  499



>ref|XP_011469724.1| PREDICTED: uncharacterized protein LOC101310757 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=628

 Score =   258 bits (658),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 154/193 (80%), Gaps = 8/193 (4%)
 Frame = -1

Query  931  QDC----RKDREGRQRLPRCCK*VGHNSNKNQSTATYYEQDVRGKLRVLGWAPIVYSTAI  764
            QDC    R ++EG+  L    K      NKNQ TATYYEQD+R KLR+L WAP+VYSTA+
Sbjct  436  QDCKIAERIEKEGKGCLIVVNK-WDTIPNKNQQTATYYEQDIREKLRILDWAPVVYSTAL  494

Query  763  AGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCTQAAI  584
            AG SVDKII+ A+ VE+ERSRRLTTA++NQVV+EA+AFKSPPR RGGKRGR+YY TQAAI
Sbjct  495  AGRSVDKIIMAASTVERERSRRLTTAVVNQVVQEALAFKSPPRTRGGKRGRIYYSTQAAI  554

Query  583  RPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDGGKVSRETS  404
            RPPTFVFFVNDAKLF ETYRRYMEKQLRS AGF+GTP+RLLW +RRK E+D G+ +    
Sbjct  555  RPPTFVFFVNDAKLFPETYRRYMEKQLRSDAGFAGTPLRLLWSNRRKTERDEGRATTRPK  614

Query  403  TSL---ERRLEVA  374
             +L   +++LE+A
Sbjct  615  GNLVPRDKKLELA  627


 Score =   214 bits (545),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAID EFTG DGQK+RLIDTAGIR+KA VASSGS+TEALSVN+A
Sbjct  354   VGEDRTIVSPVSGTTRDAIDIEFTGPDGQKFRLIDTAGIRRKAVVASSGSVTEALSVNRA  413

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQDCKIAERIEKEGKGCL+VVNKWDTIP K  Q
Sbjct  414   FRAIRRSDVVALVIEAMACITEQDCKIAERIEKEGKGCLIVVNKWDTIPNKNQQ  467



>ref|XP_004289593.1| PREDICTED: uncharacterized protein LOC101310757 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011469717.1| PREDICTED: uncharacterized protein LOC101310757 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=629

 Score =   257 bits (657),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 154/193 (80%), Gaps = 8/193 (4%)
 Frame = -1

Query  931  QDC----RKDREGRQRLPRCCK*VGHNSNKNQSTATYYEQDVRGKLRVLGWAPIVYSTAI  764
            QDC    R ++EG+  L    K      NKNQ TATYYEQD+R KLR+L WAP+VYSTA+
Sbjct  437  QDCKIAERIEKEGKGCLIVVNK-WDTIPNKNQQTATYYEQDIREKLRILDWAPVVYSTAL  495

Query  763  AGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCTQAAI  584
            AG SVDKII+ A+ VE+ERSRRLTTA++NQVV+EA+AFKSPPR RGGKRGR+YY TQAAI
Sbjct  496  AGRSVDKIIMAASTVERERSRRLTTAVVNQVVQEALAFKSPPRTRGGKRGRIYYSTQAAI  555

Query  583  RPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDGGKVSRETS  404
            RPPTFVFFVNDAKLF ETYRRYMEKQLRS AGF+GTP+RLLW +RRK E+D G+ +    
Sbjct  556  RPPTFVFFVNDAKLFPETYRRYMEKQLRSDAGFAGTPLRLLWSNRRKTERDEGRATTRPK  615

Query  403  TSL---ERRLEVA  374
             +L   +++LE+A
Sbjct  616  GNLVPRDKKLELA  628


 Score =   214 bits (545),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAID EFTG DGQK+RLIDTAGIR+KA VASSGS+TEALSVN+A
Sbjct  355   VGEDRTIVSPVSGTTRDAIDIEFTGPDGQKFRLIDTAGIRRKAVVASSGSVTEALSVNRA  414

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQDCKIAERIEKEGKGCL+VVNKWDTIP K  Q
Sbjct  415   FRAIRRSDVVALVIEAMACITEQDCKIAERIEKEGKGCLIVVNKWDTIPNKNQQ  468



>ref|XP_011469726.1| PREDICTED: uncharacterized protein LOC101310757 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=617

 Score =   256 bits (653),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 145/176 (82%), Gaps = 5/176 (3%)
 Frame = -1

Query  931  QDC----RKDREGRQRLPRCCK*VGHNSNKNQSTATYYEQDVRGKLRVLGWAPIVYSTAI  764
            QDC    R ++EG+  L    K      NKNQ TATYYEQD+R KLR+L WAP+VYSTA+
Sbjct  437  QDCKIAERIEKEGKGCLIVVNK-WDTIPNKNQQTATYYEQDIREKLRILDWAPVVYSTAL  495

Query  763  AGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCTQAAI  584
            AG SVDKII+ A+ VE+ERSRRLTTA++NQVV+EA+AFKSPPR RGGKRGR+YY TQAAI
Sbjct  496  AGRSVDKIIMAASTVERERSRRLTTAVVNQVVQEALAFKSPPRTRGGKRGRIYYSTQAAI  555

Query  583  RPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDGGKVS  416
            RPPTFVFFVNDAKLF ETYRRYMEKQLRS AGF+GTP+RLLW +RRK E+D G+ S
Sbjct  556  RPPTFVFFVNDAKLFPETYRRYMEKQLRSDAGFAGTPLRLLWSNRRKTERDEGQFS  611


 Score =   214 bits (545),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSPVSGTTRDAID EFTG DGQK+RLIDTAGIR+KA VASSGS+TEALSVN+A
Sbjct  355   VGEDRTIVSPVSGTTRDAIDIEFTGPDGQKFRLIDTAGIRRKAVVASSGSVTEALSVNRA  414

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQDCKIAERIEKEGKGCL+VVNKWDTIP K  Q
Sbjct  415   FRAIRRSDVVALVIEAMACITEQDCKIAERIEKEGKGCLIVVNKWDTIPNKNQQ  468



>gb|ACJ85632.1| unknown [Medicago truncatula]
Length=319

 Score =   246 bits (627),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NKNQ  A YYEQDVR KLR+L WAP+VYSTA+AG +VDKIIV A  VEKERSRRL T+IL
Sbjct  181  NKNQQAALYYEQDVREKLRLLDWAPVVYSTALAGQNVDKIIVAAIEVEKERSRRLGTSIL  240

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            NQVVREAV FK PPR RGGKRGRVYYCTQAAIRPPTFVFFVNDAKLF ETYRR+MEKQLR
Sbjct  241  NQVVREAVTFKPPPRTRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFPETYRRFMEKQLR  300

Query  499  SSAGFSGTPIRLLWRSRRK  443
            S+AGF GTPIRLLWRSRRK
Sbjct  301  SNAGFPGTPIRLLWRSRRK  319


 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 107/121 (88%), Gaps = 0/121 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEFTG DGQK+ LIDTAGIRK+ TVAS+GS TEALSVN+A
Sbjct  72    VGEDRTIVSPISGTTRDAIDTEFTGPDGQKFHLIDTAGIRKRTTVASAGSTTEALSVNRA  131

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQLQLTMS  826
             FRAIRRSDV ALVIEAM+CITEQD KIAERIEKEGKGC++VVNKWDTIP K  Q  L   
Sbjct  132   FRAIRRSDVGALVIEAMACITEQDYKIAERIEKEGKGCVIVVNKWDTIPNKNQQAALYYE  191

Query  825   K  823
             +
Sbjct  192   Q  192



>ref|XP_010907855.1| PREDICTED: uncharacterized protein LOC105034405 isoform X4 [Elaeis 
guineensis]
Length=481

 Score =   245 bits (626),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 138/176 (78%), Gaps = 13/176 (7%)
 Frame = -1

Query  931  QDCRK----DREGRQRLPRCCK*VGHN----SNKNQSTATYYEQDVRGKLRVLGWAPIVY  776
            QDCR     +REG+      C  V +      NKNQ T TYYEQDVR KLRVL WAPIVY
Sbjct  291  QDCRIAERIEREGKG-----CIIVVNKWDTIPNKNQQTTTYYEQDVREKLRVLDWAPIVY  345

Query  775  STAIAGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCT  596
            ST   GHSV++II  A+ VEKERSRRL T+ILNQVV+EA+AFK PPR RGGKRGRVYY T
Sbjct  346  STTTNGHSVERIITAASMVEKERSRRLGTSILNQVVQEALAFKPPPRTRGGKRGRVYYST  405

Query  595  QAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDG  428
            QAAIRPPTFVFFVNDAKLF ETYRRYMEKQLRS+AGF GTPIRLLWRSRR+ + +G
Sbjct  406  QAAIRPPTFVFFVNDAKLFPETYRRYMEKQLRSNAGFPGTPIRLLWRSRRRADNEG  461


 Score =   208 bits (529),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEFTG DGQKY LIDTAGIR++A VASSGS TEALSVN+A
Sbjct  209   VGEDRTIVSPISGTTRDAIDTEFTGPDGQKYMLIDTAGIRRRAAVASSGSTTEALSVNRA  268

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQDC+IAERIE+EGKGC++VVNKWDTIP K  Q
Sbjct  269   FRAIRRSDVVALVIEAMACITEQDCRIAERIEREGKGCIIVVNKWDTIPNKNQQ  322



>ref|XP_010907854.1| PREDICTED: uncharacterized protein LOC105034405 isoform X3 [Elaeis 
guineensis]
Length=525

 Score =   245 bits (626),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 138/176 (78%), Gaps = 13/176 (7%)
 Frame = -1

Query  931  QDCRK----DREGRQRLPRCCK*VGHN----SNKNQSTATYYEQDVRGKLRVLGWAPIVY  776
            QDCR     +REG+      C  V +      NKNQ T TYYEQDVR KLRVL WAPIVY
Sbjct  335  QDCRIAERIEREGKG-----CIIVVNKWDTIPNKNQQTTTYYEQDVREKLRVLDWAPIVY  389

Query  775  STAIAGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCT  596
            ST   GHSV++II  A+ VEKERSRRL T+ILNQVV+EA+AFK PPR RGGKRGRVYY T
Sbjct  390  STTTNGHSVERIITAASMVEKERSRRLGTSILNQVVQEALAFKPPPRTRGGKRGRVYYST  449

Query  595  QAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDG  428
            QAAIRPPTFVFFVNDAKLF ETYRRYMEKQLRS+AGF GTPIRLLWRSRR+ + +G
Sbjct  450  QAAIRPPTFVFFVNDAKLFPETYRRYMEKQLRSNAGFPGTPIRLLWRSRRRADNEG  505


 Score =   208 bits (530),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEFTG DGQKY LIDTAGIR++A VASSGS TEALSVN+A
Sbjct  253   VGEDRTIVSPISGTTRDAIDTEFTGPDGQKYMLIDTAGIRRRAAVASSGSTTEALSVNRA  312

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQDC+IAERIE+EGKGC++VVNKWDTIP K  Q
Sbjct  313   FRAIRRSDVVALVIEAMACITEQDCRIAERIEREGKGCIIVVNKWDTIPNKNQQ  366



>ref|XP_010907853.1| PREDICTED: uncharacterized protein LOC105034405 isoform X2 [Elaeis 
guineensis]
Length=549

 Score =   245 bits (626),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 138/176 (78%), Gaps = 13/176 (7%)
 Frame = -1

Query  931  QDCRK----DREGRQRLPRCCK*VGHN----SNKNQSTATYYEQDVRGKLRVLGWAPIVY  776
            QDCR     +REG+      C  V +      NKNQ T TYYEQDVR KLRVL WAPIVY
Sbjct  359  QDCRIAERIEREGKG-----CIIVVNKWDTIPNKNQQTTTYYEQDVREKLRVLDWAPIVY  413

Query  775  STAIAGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCT  596
            ST   GHSV++II  A+ VEKERSRRL T+ILNQVV+EA+AFK PPR RGGKRGRVYY T
Sbjct  414  STTTNGHSVERIITAASMVEKERSRRLGTSILNQVVQEALAFKPPPRTRGGKRGRVYYST  473

Query  595  QAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDG  428
            QAAIRPPTFVFFVNDAKLF ETYRRYMEKQLRS+AGF GTPIRLLWRSRR+ + +G
Sbjct  474  QAAIRPPTFVFFVNDAKLFPETYRRYMEKQLRSNAGFPGTPIRLLWRSRRRADNEG  529


 Score =   209 bits (531),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEFTG DGQKY LIDTAGIR++A VASSGS TEALSVN+A
Sbjct  277   VGEDRTIVSPISGTTRDAIDTEFTGPDGQKYMLIDTAGIRRRAAVASSGSTTEALSVNRA  336

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQDC+IAERIE+EGKGC++VVNKWDTIP K  Q
Sbjct  337   FRAIRRSDVVALVIEAMACITEQDCRIAERIEREGKGCIIVVNKWDTIPNKNQQ  390



>ref|XP_006470605.1| PREDICTED: uncharacterized protein LOC102625125 isoform X2 [Citrus 
sinensis]
Length=665

 Score =   246 bits (629),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 142/182 (78%), Gaps = 3/182 (2%)
 Frame = -1

Query  931  QDCRKDREGRQRLPRCCK*VGH---NSNKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIA  761
            QDCR      Q    C   V       NKNQ TATYYEQDVR KLR L WAPIVYSTAIA
Sbjct  473  QDCRIAERIEQEGKGCLIVVNKWDTIPNKNQQTATYYEQDVREKLRALDWAPIVYSTAIA  532

Query  760  GHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIR  581
            G SVDKIIV A  V+KERSRRL+TA +NQVV+EAVAFKSPPR RGG+RGRVYYCTQAA+R
Sbjct  533  GQSVDKIIVAAEMVDKERSRRLSTATINQVVQEAVAFKSPPRTRGGRRGRVYYCTQAAVR  592

Query  580  PPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDGGKVSRETST  401
            PPTFVFFVNDAKLF ETYRRYMEKQLR+ AGFSGTPIRLLWRSRRKME   GK +  T  
Sbjct  593  PPTFVFFVNDAKLFPETYRRYMEKQLRADAGFSGTPIRLLWRSRRKMEMKEGKSASRTQA  652

Query  400  SL  395
            +L
Sbjct  653  NL  654


 Score =   203 bits (517),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 107/114 (94%), Gaps = 1/114 (1%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEFTG +GQ +RLIDTAGIRK+A +ASSGS TEALSVN+A
Sbjct  392   VGEDRTIVSPISGTTRDAIDTEFTGPEGQ-FRLIDTAGIRKRAAIASSGSTTEALSVNRA  450

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQDC+IAERIE+EGKGCL+VVNKWDTIP K  Q
Sbjct  451   FRAIRRSDVVALVIEAMACITEQDCRIAERIEQEGKGCLIVVNKWDTIPNKNQQ  504



>ref|XP_006446112.1| hypothetical protein CICLE_v10014514mg [Citrus clementina]
 ref|XP_006470604.1| PREDICTED: uncharacterized protein LOC102625125 isoform X1 [Citrus 
sinensis]
 gb|ESR59352.1| hypothetical protein CICLE_v10014514mg [Citrus clementina]
 gb|KDO61268.1| hypothetical protein CISIN_1g005504mg [Citrus sinensis]
Length=666

 Score =   246 bits (629),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 142/182 (78%), Gaps = 3/182 (2%)
 Frame = -1

Query  931  QDCRKDREGRQRLPRCCK*VGH---NSNKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIA  761
            QDCR      Q    C   V       NKNQ TATYYEQDVR KLR L WAPIVYSTAIA
Sbjct  474  QDCRIAERIEQEGKGCLIVVNKWDTIPNKNQQTATYYEQDVREKLRALDWAPIVYSTAIA  533

Query  760  GHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIR  581
            G SVDKIIV A  V+KERSRRL+TA +NQVV+EAVAFKSPPR RGG+RGRVYYCTQAA+R
Sbjct  534  GQSVDKIIVAAEMVDKERSRRLSTATINQVVQEAVAFKSPPRTRGGRRGRVYYCTQAAVR  593

Query  580  PPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDGGKVSRETST  401
            PPTFVFFVNDAKLF ETYRRYMEKQLR+ AGFSGTPIRLLWRSRRKME   GK +  T  
Sbjct  594  PPTFVFFVNDAKLFPETYRRYMEKQLRADAGFSGTPIRLLWRSRRKMEMKEGKSASRTQA  653

Query  400  SL  395
            +L
Sbjct  654  NL  655


 Score =   210 bits (534),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEFTG +GQK+RLIDTAGIRK+A +ASSGS TEALSVN+A
Sbjct  392   VGEDRTIVSPISGTTRDAIDTEFTGPEGQKFRLIDTAGIRKRAAIASSGSTTEALSVNRA  451

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQDC+IAERIE+EGKGCL+VVNKWDTIP K  Q
Sbjct  452   FRAIRRSDVVALVIEAMACITEQDCRIAERIEQEGKGCLIVVNKWDTIPNKNQQ  505



>ref|XP_010907852.1| PREDICTED: uncharacterized protein LOC105034405 isoform X1 [Elaeis 
guineensis]
Length=657

 Score =   246 bits (628),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 125/176 (71%), Positives = 138/176 (78%), Gaps = 13/176 (7%)
 Frame = -1

Query  931  QDCRK----DREGRQRLPRCCK*VGHN----SNKNQSTATYYEQDVRGKLRVLGWAPIVY  776
            QDCR     +REG+      C  V +      NKNQ T TYYEQDVR KLRVL WAPIVY
Sbjct  467  QDCRIAERIEREGKG-----CIIVVNKWDTIPNKNQQTTTYYEQDVREKLRVLDWAPIVY  521

Query  775  STAIAGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCT  596
            ST   GHSV++II  A+ VEKERSRRL T+ILNQVV+EA+AFK PPR RGGKRGRVYY T
Sbjct  522  STTTNGHSVERIITAASMVEKERSRRLGTSILNQVVQEALAFKPPPRTRGGKRGRVYYST  581

Query  595  QAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDG  428
            QAAIRPPTFVFFVNDAKLF ETYRRYMEKQLRS+AGF GTPIRLLWRSRR+ + +G
Sbjct  582  QAAIRPPTFVFFVNDAKLFPETYRRYMEKQLRSNAGFPGTPIRLLWRSRRRADNEG  637


 Score =   209 bits (533),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEFTG DGQKY LIDTAGIR++A VASSGS TEALSVN+A
Sbjct  385   VGEDRTIVSPISGTTRDAIDTEFTGPDGQKYMLIDTAGIRRRAAVASSGSTTEALSVNRA  444

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQDC+IAERIE+EGKGC++VVNKWDTIP K  Q
Sbjct  445   FRAIRRSDVVALVIEAMACITEQDCRIAERIEREGKGCIIVVNKWDTIPNKNQQ  498



>ref|WP_011319645.1| GTPase Der [Anabaena variabilis]
 sp|Q3M929.1|DER_ANAVT RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Anabaena variabilis ATCC 29413]
 gb|ABA22507.1| Small GTP-binding protein domain protein [Anabaena variabilis 
ATCC 29413]
Length=453

 Score =   147 bits (371),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 100/150 (67%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+++  +L    WA  +Y +A+ G  V+KI+       +E  RR++T+++N
Sbjct  302  KDSYTIYDYEKNLEARLHFTEWADTIYVSAVTGQRVEKILELVTKANEEHKRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +AV++ SPP  RGG++GR+YY TQ + +PPT   FVN+AK F++ YRRY+E+Q R 
Sbjct  362  EVLEDAVSWHSPPTSRGGRQGRIYYGTQVSTQPPTIALFVNEAKRFNDNYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRLLWRS++  + + G  +R T
Sbjct  422  QLGFKGTPIRLLWRSKKVRDVESGSANRAT  451


 Score =   135 bits (340),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 83/107 (78%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE+R IVSP+SGTTRDAIDT F   +GQ YRLIDTAGIRKK ++      TE  S+N+AF
Sbjct  198   GEERVIVSPISGTTRDAIDT-FIERNGQNYRLIDTAGIRKKKSIDYG---TEFFSINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             +AIRR+DVV LVI+A+  +TEQD K+A RI  EGK C+VVVNKWD +
Sbjct  254   KAIRRADVVLLVIDALDGVTEQDQKLAGRILDEGKACVVVVNKWDAV  300



>ref|WP_010994659.1| GTPase Der [Nostoc sp. PCC 7120]
 sp|Q8YZH7.1|DER_NOSS1 RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Nostoc sp. PCC 7120]
 dbj|BAB72441.1| GTP binding protein [Nostoc sp. PCC 7120]
Length=453

 Score =   145 bits (367),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 99/150 (66%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+++  +L    WA  +Y +A+ G  V+KI+       +E  RR++T+++N
Sbjct  302  KDSYTIYDYEKNLEARLHFTEWADTIYVSAVTGQRVEKILELVTKANEEHKRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +AV + SPP  RGG++GR+YY TQ + +PPT   FVN+AK F++ YRRY+E+Q R 
Sbjct  362  EVLEDAVRWHSPPTSRGGRQGRIYYGTQVSTQPPTIALFVNEAKRFNDNYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRLLWRS++  + + G  +R T
Sbjct  422  QLGFKGTPIRLLWRSKKVRDVESGSANRAT  451


 Score =   137 bits (344),  Expect(2) = 1e-66, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 83/107 (78%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE+R IVSP+SGTTRDAIDT F   DGQ YRLIDTAGIRKK ++      TE  S+N+AF
Sbjct  198   GEERVIVSPISGTTRDAIDT-FIERDGQNYRLIDTAGIRKKKSIDYG---TEFFSINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             +AIRR+DVV LVI+A+  +TEQD K+A RI  EGK C+VVVNKWD +
Sbjct  254   KAIRRADVVLLVIDALDGVTEQDQKLAGRILDEGKACVVVVNKWDAV  300



>ref|WP_015131793.1| ribosome-associated GTPase EngA [Calothrix sp. PCC 7507]
 gb|AFY36003.1| GTP-binding protein engA [Calothrix sp. PCC 7507]
Length=454

 Score =   153 bits (386),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 102/150 (68%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+D+ G+L    WA  +Y +A+ G  V+KI+       +   RR+TT+++N
Sbjct  302  KDSYTIYDYEKDLEGRLHFTEWADTIYVSAVTGQRVEKILELVNTAAESHKRRVTTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +AV++ SPP  RGG++G++YY TQ +I+PPT   FVN+AK F+E YRRY+E+Q R 
Sbjct  362  EVLTDAVSWHSPPASRGGRQGKIYYGTQVSIQPPTIALFVNEAKRFNENYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRLLWRS++  + + G ++R T
Sbjct  422  HLGFKGTPIRLLWRSKKVRDMESGNLNRAT  451


 Score =   129 bits (323),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRDAIDT     + Q YRLIDTAGIRKK ++      TE  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDAIDT-VVERNEQTYRLIDTAGIRKKKSIEYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LV++A+  +TEQD K+A RI +EG+ C++VVNKWD +
Sbjct  253   FKAIRRADVVLLVLDALDGVTEQDQKLAGRILEEGRACIIVVNKWDAV  300



>ref|WP_015112943.1| ribosome-associated GTPase EngA [Nostoc sp. PCC 7107]
 gb|AFY42727.1| GTP-binding protein engA [Nostoc sp. PCC 7107]
Length=453

 Score =   142 bits (357),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 97/150 (65%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+ ++ +L    WA  ++ +A+ G  V+KI+        E  RR++T+++N
Sbjct  302  KDSHTIYDYEKSMQERLHFTDWASTIFVSALTGQRVEKILELVKQAAVEHKRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
             V+ EA+ + SPP  RGG++G++YY TQ   +PPT   FVN+AK F++ YRRY+E+Q R 
Sbjct  362  DVLEEAIRWHSPPTSRGGRQGKIYYGTQVTSQPPTIALFVNEAKRFNDNYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRLLWRS++  + + G V+R T
Sbjct  422  QLGFKGTPIRLLWRSKKVRDMESGNVNRAT  451


 Score =   138 bits (347),  Expect(2) = 6e-66, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 86/108 (80%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRDAIDT F   DGQ+YRLIDTAGIRKK ++      TE  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDAIDT-FIERDGQQYRLIDTAGIRKKKSIDYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LV++A+  +TEQD K+A RI +EG+ C+VVVNKWD I
Sbjct  253   FKAIRRADVVLLVLDALDGVTEQDQKLAGRIIEEGRACIVVVNKWDAI  300



>ref|WP_045873105.1| GTPase Der [Tolypothrix sp. PCC 7601]
 gb|EKE98712.1| ribosome-associated GTPase EngA [Tolypothrix sp. PCC 7601]
Length=453

 Score =   142 bits (359),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 99/150 (66%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+ ++ +L    WA  ++ +A+ G  V+KI+       +   RR++T+++N
Sbjct  302  KDSYTIYDYEKTMQSRLHFTEWADTIFVSALTGQRVEKILELVNQAAESHKRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +AV++ SPP  RGG++GR+YY TQ + +PPT   FVNDAK F+E YRRY+E+Q R 
Sbjct  362  EVLEDAVSWHSPPTSRGGRQGRIYYGTQVSSQPPTIALFVNDAKRFNENYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRLLWRS++  + +   ++R T
Sbjct  422  QLGFKGTPIRLLWRSKKVRDAEVASINRAT  451


 Score =   135 bits (341),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRDAIDT F   DGQ YRLIDTAGIRKK ++      TE  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDAIDTMFE-RDGQTYRLIDTAGIRKKKSIEYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV +VI+A+  +TEQD K+A R+  EG+ C+VVVNKWD +
Sbjct  253   FKAIRRADVVLMVIDALDGVTEQDQKLAGRVIDEGRACIVVVNKWDAV  300



>gb|KDO61267.1| hypothetical protein CISIN_1g005504mg [Citrus sinensis]
Length=693

 Score =   232 bits (591),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 142/209 (68%), Gaps = 30/209 (14%)
 Frame = -1

Query  931  QDCRKDREGRQRLPRCCK*VGH---NSNKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIA  761
            QDCR      Q    C   V       NKNQ TATYYEQDVR KLR L WAPIVYSTAIA
Sbjct  474  QDCRIAERIEQEGKGCLIVVNKWDTIPNKNQQTATYYEQDVREKLRALDWAPIVYSTAIA  533

Query  760  GHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCT-----  596
            G SVDKIIV A  V+KERSRRL+TA +NQVV+EAVAFKSPPR RGG+RGRVYYCT     
Sbjct  534  GQSVDKIIVAAEMVDKERSRRLSTATINQVVQEAVAFKSPPRTRGGRRGRVYYCTQLLLG  593

Query  595  ----------------------QAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFS  482
                                  QAA+RPPTFVFFVNDAKLF ETYRRYMEKQLR+ AGFS
Sbjct  594  IFVRSAFRYGALGPLHIKYDLLQAAVRPPTFVFFVNDAKLFPETYRRYMEKQLRADAGFS  653

Query  481  GTPIRLLWRSRRKMEKDGGKVSRETSTSL  395
            GTPIRLLWRSRRKME   GK +  T  +L
Sbjct  654  GTPIRLLWRSRRKMEMKEGKSASRTQANL  682


 Score =   210 bits (534),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEFTG +GQK+RLIDTAGIRK+A +ASSGS TEALSVN+A
Sbjct  392   VGEDRTIVSPISGTTRDAIDTEFTGPEGQKFRLIDTAGIRKRAAIASSGSTTEALSVNRA  451

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQDC+IAERIE+EGKGCL+VVNKWDTIP K  Q
Sbjct  452   FRAIRRSDVVALVIEAMACITEQDCRIAERIEQEGKGCLIVVNKWDTIPNKNQQ  505



>ref|WP_015139682.1| ribosome-associated GTPase EngA [Nostoc sp. PCC 7524]
 gb|AFY49252.1| ribosome-associated GTPase EngA [Nostoc sp. PCC 7524]
Length=453

 Score =   142 bits (358),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 97/150 (65%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+++  +L    WA  ++ +A+ G  V+KI+        E  RR++T+++N
Sbjct  302  KDSYTIYDYEKNLEARLHFTEWADTIFVSALTGQRVEKILELVNQAAVEHKRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +AV + SPP  RGGK+GR+YY TQ   +PPT   FVN+AK F++ YRRY+E+Q R 
Sbjct  362  EVLEDAVKWHSPPTSRGGKQGRIYYGTQVTTQPPTIALFVNEAKRFNDNYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRLLWRS++  + + G  +R T
Sbjct  422  QLGFKGTPIRLLWRSKKVRDMEIGSANRAT  451


 Score =   135 bits (340),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRDAIDT F   DGQ YRLIDTAGIRKK  V       E  S+N+A
Sbjct  197   VGEERVIVSPISGTTRDAIDT-FLERDGQAYRLIDTAGIRKKKNVEYG---PEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LV++A+  +TEQD K+A RI +EG+ C++VVNKWD +
Sbjct  253   FKAIRRADVVLLVLDALDGVTEQDQKLAGRIIEEGRACIIVVNKWDAV  300



>gb|KCW51184.1| hypothetical protein EUGRSUZ_J00770 [Eucalyptus grandis]
Length=525

 Score =   204 bits (518),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEF G+DGQK+RLIDTAGIR++A VASSGS TEALSVN+A
Sbjct  378   VGEDRTIVSPISGTTRDAIDTEFVGADGQKFRLIDTAGIRRRAAVASSGSTTEALSVNRA  437

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
              RAIRRSDVVALVIEAM+CITEQD +IAERIEKEGKGCL+VVNKWDTIP K  Q
Sbjct  438   IRAIRRSDVVALVIEAMACITEQDYRIAERIEKEGKGCLIVVNKWDTIPNKNQQ  491


 Score = 73.2 bits (178),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 33/39 (85%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDK  743
            NKNQ +ATYYEQDVR KLR L WAPIVYSTAIAGHSV+K
Sbjct  487  NKNQQSATYYEQDVREKLRSLDWAPIVYSTAIAGHSVEK  525



>ref|WP_039752516.1| ribosome-associated GTPase EngA [Hassallia byssoidea]
 gb|KIF28918.1| GTPase Der [Hassallia byssoidea VB512170]
Length=454

 Score =   145 bits (365),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 65/150 (43%), Positives = 98/150 (65%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+ +  KL    WA  ++ +A+ G  V+KI+       +   RR++T+++N
Sbjct  302  KDSYTIYDYEKILTEKLHFTDWAETIFVSAVTGQRVEKILELVNTASEAHKRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV++ SPP  RGG++G++YY TQ   +PPT   FVN+AK F+E YRRY+E+Q R 
Sbjct  362  EVLEEAVSWHSPPATRGGRQGKIYYGTQVTSQPPTIALFVNEAKRFNENYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRLLWRS++  + + G V+R T
Sbjct  422  QLGFKGTPIRLLWRSKKVRDMESGNVNRAT  451


 Score =   131 bits (330),  Expect(2) = 7e-65, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRDAIDT     DGQ YRLIDTAGIRKK  +      TE  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDAIDT-VVERDGQIYRLIDTAGIRKKKHIEYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LV++A+  +TEQD K+A RI +EG+ C+VVVNKWD +
Sbjct  253   FKAIRRADVVLLVLDAVDGVTEQDQKLAGRIIEEGRACVVVVNKWDAV  300



>ref|WP_029633792.1| ribosome-associated GTPase EngA [[Scytonema hofmanni] UTEX B 
1581]
Length=454

 Score =   142 bits (359),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 97/150 (65%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+ ++  L    WA  ++ +A+ G  V+KI+       +   RR++T+++N
Sbjct  302  KDSYTIYDYEKVLQQNLHFTDWAETIFVSAVKGQRVEKILELVNTAAESHKRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV++ SPP  RGG++G++YY TQ   +PPT   FVN+AK F+E YRRY+E Q R 
Sbjct  362  EVLEEAVSWHSPPATRGGRQGKIYYGTQVTSQPPTIALFVNEAKRFNENYRRYIEGQFRK  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRLLWRS++  + + G V+R T
Sbjct  422  QLGFKGTPIRLLWRSKKVRDMESGNVNRAT  451


 Score =   133 bits (334),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRDAIDT     DGQ YRLIDTAGIRKK  +      TE  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDAIDT-VVERDGQTYRLIDTAGIRKKKHIEYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +TEQD K+A RI +EG+ C+VVVNKWD +
Sbjct  253   FKAIRRADVVLLVIDAVDGVTEQDQKLAGRIIEEGRACIVVVNKWDLV  300



>ref|WP_013192173.1| ribosome-associated GTPase EngA [Trichormus azollae]
 gb|ADI65159.1| ribosome-associated GTPase EngA ['Nostoc azollae' 0708]
Length=454

 Score =   145 bits (367),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 100/150 (67%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+ +  +L    WA I++ +A+ G  V+KI+       +   RR+TT+++N
Sbjct  302  KDSYTIYDYEKGLEARLHFTEWADIIFVSAVTGQRVEKILELVNKAAQAHKRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +AV++ SPP  RGG++G++YY TQ + +PPTF  FVNDA+ F++ YRRY+E+Q R 
Sbjct  362  EVLTDAVSWHSPPTSRGGRQGKIYYGTQVSTQPPTFALFVNDAQRFNDNYRRYIERQFRK  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRL WRS++  E + G ++R T
Sbjct  422  QLGFDGTPIRLFWRSKKVREMELGSLNRAT  451


 Score =   129 bits (324),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRD IDTE    +GQ YRLIDTAGIRKK  +      TE  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDTIDTEIV-RNGQTYRLIDTAGIRKKKHIEYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LV++A    TEQD K+A RI +EG+ C++VVNKWD +
Sbjct  253   FKAIRRADVVLLVLDAEDGATEQDQKLAGRITEEGRACIIVVNKWDAV  300



>ref|WP_015206775.1| ribosome-associated GTPase EngA [Cylindrospermum stagnale]
 gb|AFZ23519.1| ribosome-associated GTPase EngA [Cylindrospermum stagnale PCC 
7417]
Length=454

 Score =   142 bits (359),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 100/150 (67%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+ ++ +L    WA  ++ +A+ G  V+K++       +   RR++T+++N
Sbjct  302  KDSYTIYDYEKALQERLHFTEWADTIFVSALTGQRVEKVLELVNQAAEAHKRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +AV++ SPP  RGG++G++YY TQ   +PPT   FVN+AK F+E YRRY+E+Q R 
Sbjct  362  EVLTDAVSWHSPPASRGGRQGKIYYGTQVTSQPPTIALFVNEAKRFNENYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRLLWRS++  + +GG V+R T
Sbjct  422  QLGFKGTPIRLLWRSKKVRDMEGGNVNRAT  451


 Score =   129 bits (325),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRDAIDT     +GQ YRLIDTAGIRKK  +      TE  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDAIDT-VVERNGQTYRLIDTAGIRKKKHIEYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LV++A    TEQD K+A RI +EG+ C++VVNKWDT+
Sbjct  253   FKAIRRADVVLLVLDAQDGATEQDQKLAGRILEEGRACIIVVNKWDTV  300



>ref|WP_016876204.1| ribosome-associated GTPase EngA [Chlorogloeopsis fritschii]
Length=453

 Score =   140 bits (353),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 98/150 (65%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+ ++ +L    WA  ++ +A+ G  V+KI+   +   +E  RR++T+++N
Sbjct  302  KDSYTIYDYEKHLQERLHFSEWAETIFVSALTGQRVEKILELVSKSAEEHKRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV + SPP  R GK+G++YY TQ + +PPT   FVNDAK F++ YRRY+E+Q R 
Sbjct  362  EVLEEAVRWHSPPVSRSGKQGKLYYGTQVSTQPPTIALFVNDAKRFNDNYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIR  WRS++  + +G  V+R T
Sbjct  422  QLGFKGTPIRFFWRSKKARDVEGANVNRAT  451


 Score =   132 bits (331),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE R IVSP+SGTTRDAIDT     +GQ YRLIDTAGIRKK  V      TE  S+N+A
Sbjct  197   VGEQRAIVSPISGTTRDAIDT-VIEHNGQTYRLIDTAGIRKKKNVEYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +TEQD K+A RI +EG+ C++VVNKWD +
Sbjct  253   FKAIRRADVVLLVIDALDGVTEQDQKLAGRIIEEGRACVIVVNKWDAV  300



>ref|WP_017319096.1| ribosome-associated GTPase EngA [Mastigocladopsis repens]
Length=453

 Score =   142 bits (358),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 99/150 (66%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+ ++ +     WA  ++ +A++G  V+KI+       +   RR++TA++N
Sbjct  302  KDSHTIYDYEKHLQERFHFTEWAQTIFVSALSGQRVEKILELVNKAAESHKRRVSTAVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA++  SPP  RGG++GR+YY TQ + +PPT   FVND+K F++ YRRY+E+Q R 
Sbjct  362  EVLEEALSRHSPPVSRGGRQGRIYYGTQVSTQPPTIALFVNDSKRFNDNYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIR+LWRS++  + + G V+R T
Sbjct  422  HLGFQGTPIRILWRSKKSRDVESGNVNRAT  451


 Score =   129 bits (324),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRDAIDT      GQ YRLIDTAGIRKK  V       E  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDAIDT-VVERQGQTYRLIDTAGIRKKKNVEYGA---EFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV +VI+A+  +TEQD K+A RI +EG+ C++VVNKWD +
Sbjct  253   FKAIRRADVVLMVIDALDGVTEQDQKLAGRIIEEGRACIIVVNKWDAV  300



>ref|WP_011432890.1| GTPase Der [Synechococcus sp. JA-2-3B'a(2-13)]
 sp|Q2JM09.1|DER_SYNJB RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Synechococcus sp. JA-2-3B'a(2-13)]
 gb|ABD02238.1| GTP-binding protein EngA [Synechococcus sp. JA-2-3B'a(2-13)]
Length=459

 Score =   141 bits (355),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 100/158 (63%), Gaps = 2/158 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NK+  T   + +++R +L  + WAP+++ +A+ G    KI      V     +R+ TA++
Sbjct  304  NKDTHTINEFTREIRDRLYFIEWAPLLFVSALTGQRTHKIFEQVNTVVAAHRKRVPTAVV  363

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+++A+A++SPP  R GK+GR+YY TQ A RPPTFV FVND  LF + YRR++EK  R
Sbjct  364  NEVLQDALAWQSPPTNRQGKQGRIYYGTQVADRPPTFVLFVNDPDLFKDNYRRFLEKHFR  423

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSLERR  386
             +  F+GTPIR LWR   K E+  G+  R+   SL  R
Sbjct  424  QNLDFTGTPIRFLWRG--KSERLVGRAVRKLERSLTSR  459


 Score =   130 bits (326),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 83/111 (75%), Gaps = 4/111 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VG +R IVSP+SGTTRDAIDT  T  +GQ YRLIDTAGIRKK  V       E  S+N+A
Sbjct  199   VGSERAIVSPISGTTRDAIDTVVT-WEGQPYRLIDTAGIRKKNRVQYG---IEFFSINRA  254

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTK  853
             F+AI+RSD V LVI+A+  +TEQD ++A RIE+EG+ C+VVVNKWD +  K
Sbjct  255   FKAIQRSDAVLLVIDALEGVTEQDQRLAGRIEEEGRACVVVVNKWDAVENK  305



>ref|WP_006277473.1| ribosome-associated GTPase EngA [Cylindrospermopsis raciborskii]
 gb|EFA69687.1| Small GTP-binding protein domain protein [Cylindrospermopsis 
raciborskii CS-505]
Length=453

 Score =   142 bits (358),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 99/150 (66%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   +E+ +  +L    WA  ++ +AI G  V+KI+       +   RR++T+++N
Sbjct  302  KDSYTIYDHEKSLEARLHFTEWADTIFVSAITGQRVEKILDLVNKAAESHKRRVSTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +AV++ SPP  R GK+G++YY TQ + +PPTF  FVNDAK F+E YRRY+E+Q R 
Sbjct  362  EVLTDAVSWHSPPASRSGKQGKIYYGTQVSSQPPTFALFVNDAKRFNENYRRYIERQFRK  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIR+LWRS++  E + G ++R T
Sbjct  422  QLGFEGTPIRILWRSKKVREMEVGTLNRAT  451


 Score =   128 bits (322),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRD IDT     +GQ YRLIDTAGIRKK  V      TE  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDTIDT-LIEREGQAYRLIDTAGIRKKKHVEYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LV++A+  +TEQD K+A RI ++G+ C++VVNKWD +
Sbjct  253   FKAIRRADVVLLVLDALDGVTEQDQKLAGRIVEDGRACIIVVNKWDVV  300



>ref|WP_012408391.1| GTPase Der [Nostoc punctiforme]
 sp|B2J1L2.1|DER_NOSP7 RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Nostoc punctiforme PCC 73102]
 gb|ACC80373.1| small GTP-binding protein [Nostoc punctiforme PCC 73102]
Length=456

 Score =   139 bits (351),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 62/154 (40%), Positives = 101/154 (66%), Gaps = 0/154 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+ ++ +L    WA  ++ +A++G  V+KI+       +   RR++T+++N
Sbjct  302  KDSYTIYDYEKTLQSRLHFTEWAETIFVSALSGQRVEKILELVKTAAESHKRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +AV++ SPP  RGG++G++YY TQ + +PPT   FVND+K F++ YRRY+E+Q R 
Sbjct  362  EVLTDAVSWHSPPASRGGRQGKIYYGTQVSSQPPTIALFVNDSKRFNDNYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSL  395
              GF GTPI LLWRS++  + + G V+R T   L
Sbjct  422  QLGFKGTPIILLWRSKKVRDAEIGNVNRATRVKL  455


 Score =   131 bits (330),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRDAIDT     DGQ YRLIDTAGIRKK  +      TE  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDAIDTVIE-RDGQTYRLIDTAGIRKKKHIEYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LV++A+  +TEQD K+A RI +EG+ C++VVNKWD +
Sbjct  253   FKAIRRADVVLLVLDAVDGVTEQDQKLAGRIIEEGRACIIVVNKWDAV  300



>ref|WP_016953465.1| ribosome-associated GTPase EngA [Anabaena sp. PCC 7108]
Length=454

 Score =   145 bits (367),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 100/150 (67%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+ + G+L    WA I++ +A+ G  V+KI+       +   RR+TT+++N
Sbjct  302  KDSYTIYDYEKTLEGRLHFTEWAEIIFVSAVTGQRVEKILDLVNKAAEAHKRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +A+++ SPP  RGG++G++YY TQ + +PPTF  FVNDA  F++ YRRY+E+Q R 
Sbjct  362  EVLTDAISWHSPPTSRGGRQGKIYYGTQVSTQPPTFALFVNDAHRFNDNYRRYIERQFRK  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRL WRS++  + + G ++R T
Sbjct  422  QLGFDGTPIRLFWRSKKVRDAEIGNLNRAT  451


 Score =   125 bits (313),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRD+IDT    S GQ YRLIDTAGIRKK  +      TE  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDSIDTVIERS-GQTYRLIDTAGIRKKKHIDYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LV++A    TEQD K+A RI +EG+ C++VVNKWD +
Sbjct  253   FKAIRRADVVLLVLDAEDGATEQDQKLAGRIIEEGRACIIVVNKWDAV  300



>ref|WP_009341396.1| ribosome-associated GTPase EngA [Raphidiopsis brookii]
 gb|EFA74324.1| GTP-binding protein engA [Raphidiopsis brookii D9]
Length=453

 Score =   141 bits (356),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 99/150 (66%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   +E+ +  +L    WA  ++ +A+ G  V+KI+       +   RR++T+++N
Sbjct  302  KDSYTIYDHEKSLEARLHFTEWADTIFVSAVTGQRVEKILDLVNKAAESHKRRVSTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +AV++ SPP  R GK+G++YY TQ + +PPTF  FVNDAK F+E YRRY+E+Q R 
Sbjct  362  EVLTDAVSWHSPPASRSGKQGKIYYGTQVSSQPPTFALFVNDAKRFNENYRRYIERQFRK  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIR+LWRS++  E + G ++R T
Sbjct  422  QLGFEGTPIRILWRSKKVREMEVGTLNRAT  451


 Score =   128 bits (322),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRD IDT     +GQ YRLIDTAGIRKK  V      TE  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDTIDT-LIEREGQAYRLIDTAGIRKKKHVEYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LV++A+  +TEQD K+A RI ++G+ C++VVNKWD +
Sbjct  253   FKAIRRADVVLLVLDALDGVTEQDQKLAGRIIEDGRACIIVVNKWDAV  300



>ref|WP_006198540.1| ribosome-associated GTPase EngA [Nodularia spumigena]
 gb|EAW43316.1| Small GTP-binding protein domain [Nodularia spumigena CCY9414]
 gb|AHJ29755.1| GTP-binding protein EngA [Nodularia spumigena CCY9414]
Length=454

 Score =   142 bits (359),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 98/150 (65%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+ +  +L    WA  ++ +A  G  VDKI+       +   RR++T+++N
Sbjct  302  KDSYTIYDYEKTIESRLHFTEWAETIFVSASTGQRVDKILDLVNEAAESHKRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +AV++ SPP  RGG++G++YY TQ  I+PPT   FVN+AK F++ YRRY+E+Q R 
Sbjct  362  EVLTDAVSWHSPPASRGGRQGKIYYGTQVGIQPPTIALFVNEAKRFNDNYRRYIERQFRK  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTP+RLLWRS++  E + G V+R T
Sbjct  422  QLGFKGTPMRLLWRSKKVREMEVGSVNRAT  451


 Score =   127 bits (319),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R+IVSP+SGTTRDAIDT  + +D Q YRLIDTAGIR+K  +      TE  S+N+A
Sbjct  197   VGEERSIVSPISGTTRDAIDTVISRND-QVYRLIDTAGIRRKKQIDYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV +VI+A+  +T+QD K+A RI  EG+ C++VVNKWD I
Sbjct  253   FKAIRRADVVLMVIDALDGVTDQDQKLAGRIIDEGRACIIVVNKWDAI  300



>ref|WP_019498611.1| ribosome-associated GTPase EngA [Pseudanabaena sp. PCC 6802]
Length=454

 Score =   144 bits (362),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 100/148 (68%), Gaps = 0/148 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   Y Q+V  ++  + +API++ +A+ G  V KI+     V ++  RR++TA+LN
Sbjct  303  KDSYTIYDYTQEVTSRMMFVDYAPIIFVSALTGQRVAKILDQVDIVAEQHRRRVSTAVLN  362

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA ++ SPP  R GK+GR+YY TQ +  PP  V FVND K F++ YRRY+EKQ RS
Sbjct  363  EVLTEASSWHSPPVTRQGKQGRIYYGTQISASPPAIVLFVNDPKRFNDNYRRYIEKQFRS  422

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSR  413
            S GF+GTP+RL+WR ++  E +G  ++R
Sbjct  423  SLGFTGTPLRLIWRGKKSREVEGKSMNR  450


 Score =   125 bits (315),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 63/107 (59%), Positives = 80/107 (75%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE+R IVSP++GTTRDAID+  T  +GQKYRLIDTAGIR+K  V       E   +N+AF
Sbjct  199   GEERCIVSPIAGTTRDAIDSIVT-RNGQKYRLIDTAGIRRKKNVEYGA---EFFGINRAF  254

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             +AI RSDVV LVI+A+  +TEQD K+A RI  EG+ C++VVNKWD +
Sbjct  255   KAINRSDVVLLVIDALDGVTEQDQKLAGRINDEGRACVIVVNKWDAV  301



>gb|ERT04166.1| ribosome-associated GTPase EngA [Lyngbya aestuarii BL J]
Length=434

 Score =   144 bits (363),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 95/150 (63%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE++V+ +L  + WA  ++ +AI G  V+KII        E  RR++TA++N
Sbjct  283  KDTYTILEYEREVKARLYFMDWAKTIFVSAITGQRVEKIIDLVDQAVAEHQRRVSTAVIN  342

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV + SPP  R GK+G++YY TQ + +PPT V FVND K F+E YRRYME Q R 
Sbjct  343  EVIEEAVRWHSPPTTRQGKQGKIYYGTQVSSQPPTMVLFVNDPKRFNENYRRYMESQFRQ  402

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRL+WR +   E +    +R T
Sbjct  403  QLGFLGTPIRLIWRGKPAREVERNTANRAT  432


 Score =   125 bits (314),  Expect(2) = 8e-63, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 83/112 (74%), Gaps = 4/112 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE+R IVSP+SGTTRDAIDT     +G+ YRL+DTAGIR+K  V       E   +N+A
Sbjct  178   LGENRAIVSPISGTTRDAIDT-VVERNGKTYRLVDTAGIRRKKNVEYGA---EFFGINRA  233

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKT  850
             F+AIRR+++V L+I+A+  +TEQD K+A RI +EG+ C++VVNKWDTI   T
Sbjct  234   FKAIRRANIVLLIIDAIDRVTEQDLKLANRILEEGRACVIVVNKWDTIEKDT  285



>ref|WP_009788122.1| ribosome-associated GTPase EngA [Lyngbya sp. PCC 8106]
 gb|EAW33297.1| GTP-binding protein EngA [Lyngbya sp. PCC 8106]
Length=453

 Score =   144 bits (364),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 67/150 (45%), Positives = 96/150 (64%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE++V+ +L  + WA  ++ +A+ G  V+KII        E  RR++TA++N
Sbjct  302  KDTYTILEYEREVKARLYFMDWAKTIFVSAMTGQRVEKIIDLVDQAVAEHQRRVSTAVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV++ SPP  R GK+G++YY TQ + +PPT V FVND K F+E YRRYME Q R 
Sbjct  362  EVIEEAVSWHSPPTTRQGKQGKIYYGTQVSSQPPTLVLFVNDPKRFNENYRRYMESQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRL+WR +   E +    +R T
Sbjct  422  QLGFLGTPIRLIWRGKPAREVERNTANRAT  451


 Score =   124 bits (312),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 82/112 (73%), Gaps = 4/112 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE+R IVSP+SGTTRDAIDT     +G+ YRL+DTAGIR+K  V       E   +N+A
Sbjct  197   LGENRAIVSPISGTTRDAIDT-VVERNGKTYRLVDTAGIRRKKNVEYGA---EFFGINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKT  850
             F+AIRRS++V L+I+A+  +TEQD K+A R+ +EG+ C++VVNKWD I   T
Sbjct  253   FKAIRRSNIVLLIIDAIDRVTEQDLKLANRVSEEGRACVIVVNKWDIIEKDT  304



>ref|WP_040484699.1| ribosome-associated GTPase EngA [Lyngbya aestuarii]
Length=453

 Score =   144 bits (363),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 95/150 (63%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE++V+ +L  + WA  ++ +AI G  V+KII        E  RR++TA++N
Sbjct  302  KDTYTILEYEREVKARLYFMDWAKTIFVSAITGQRVEKIIDLVDQAVAEHQRRVSTAVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV + SPP  R GK+G++YY TQ + +PPT V FVND K F+E YRRYME Q R 
Sbjct  362  EVIEEAVRWHSPPTTRQGKQGKIYYGTQVSSQPPTMVLFVNDPKRFNENYRRYMESQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRL+WR +   E +    +R T
Sbjct  422  QLGFLGTPIRLIWRGKPAREVERNTANRAT  451


 Score =   125 bits (314),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 83/112 (74%), Gaps = 4/112 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE+R IVSP+SGTTRDAIDT     +G+ YRL+DTAGIR+K  V       E   +N+A
Sbjct  197   LGENRAIVSPISGTTRDAIDT-VVERNGKTYRLVDTAGIRRKKNVEYGA---EFFGINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKT  850
             F+AIRR+++V L+I+A+  +TEQD K+A RI +EG+ C++VVNKWDTI   T
Sbjct  253   FKAIRRANIVLLIIDAIDRVTEQDLKLANRILEEGRACVIVVNKWDTIEKDT  304



>gb|EDX86223.1| GTPase, putative [Synechococcus sp. PCC 7335]
Length=449

 Score =   138 bits (348),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 92/137 (67%), Gaps = 0/137 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   +++ +  K+  LGWA  +Y +A+ G  + KI+        E  RR++T+++
Sbjct  288  DKDSHTIYEFDKKIEAKIHFLGWAKRLYVSALTGQRLPKILDAVDMAVSEHRRRVSTSVV  347

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ +AV++ +PP  R G++GR+YY TQ   +PP+F  FVND KLF E+YRRY+EKQ R
Sbjct  348  NEVLEDAVSWHTPPTTRQGRQGRIYYGTQVRSQPPSFALFVNDPKLFGESYRRYIEKQFR  407

Query  499  SSAGFSGTPIRLLWRSR  449
             + G+ GTPIRLLWR +
Sbjct  408  QNLGYDGTPIRLLWRGK  424


 Score =   130 bits (328),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 84/111 (76%), Gaps = 6/111 (5%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAID---TEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSV  1015
             VGE+R+IVSP+SGTTRDAID   T   G D ++YRLIDTAGIRKK  V       E   +
Sbjct  180   VGENRSIVSPISGTTRDAIDMVVTRGDGDDQKRYRLIDTAGIRKKKNVDFG---PEYFGI  236

Query  1014  NQAFRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             N+AF+AI+R+DVV LVI+A+  +TEQD K+A RIE+EG+ C++VVNKWD I
Sbjct  237   NRAFKAIKRADVVLLVIDALDGVTEQDQKLAGRIEEEGRACVIVVNKWDAI  287



>ref|WP_038015372.1| ribosome-associated GTPase EngA [Synechococcus sp. PCC 7335]
Length=466

 Score =   138 bits (348),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 92/137 (67%), Gaps = 0/137 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   +++ +  K+  LGWA  +Y +A+ G  + KI+        E  RR++T+++
Sbjct  305  DKDSHTIYEFDKKIEAKIHFLGWAKRLYVSALTGQRLPKILDAVDMAVSEHRRRVSTSVV  364

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ +AV++ +PP  R G++GR+YY TQ   +PP+F  FVND KLF E+YRRY+EKQ R
Sbjct  365  NEVLEDAVSWHTPPTTRQGRQGRIYYGTQVRSQPPSFALFVNDPKLFGESYRRYIEKQFR  424

Query  499  SSAGFSGTPIRLLWRSR  449
             + G+ GTPIRLLWR +
Sbjct  425  QNLGYDGTPIRLLWRGK  441


 Score =   131 bits (329),  Expect(2) = 9e-63, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 84/111 (76%), Gaps = 6/111 (5%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFT---GSDGQKYRLIDTAGIRKKATVASSGSITEALSV  1015
             VGE+R+IVSP+SGTTRDAID   T   G D ++YRLIDTAGIRKK  V       E   +
Sbjct  197   VGENRSIVSPISGTTRDAIDMVVTRGDGDDQKRYRLIDTAGIRKKKNVDFG---PEYFGI  253

Query  1014  NQAFRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             N+AF+AI+R+DVV LVI+A+  +TEQD K+A RIE+EG+ C++VVNKWD I
Sbjct  254   NRAFKAIKRADVVLLVIDALDGVTEQDQKLAGRIEEEGRACVIVVNKWDAI  304



>ref|WP_009454105.1| MULTISPECIES: ribosome-associated GTPase EngA [Fischerella]
 gb|EHC19496.1| GTP-binding protein engA [Fischerella sp. JSC-11]
Length=453

 Score =   136 bits (343),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 93/138 (67%), Gaps = 0/138 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   YE+ ++ +L    W+  ++ +A+ G  V+KI+       +E  RR++T+++
Sbjct  301  DKDSYTIYDYEKHLQERLHFTEWSETIFVSALTGQRVEKILELVNQAAEEHKRRVSTSVI  360

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ EAV + SPP  R GK+G++YY TQ + +PPT   FVNDAK F++ YRRY+E+Q R
Sbjct  361  NEVLEEAVRWHSPPVSRSGKQGKIYYGTQVSTQPPTIALFVNDAKRFNDNYRRYIERQFR  420

Query  499  SSAGFSGTPIRLLWRSRR  446
               GF GTPIRL+WRS++
Sbjct  421  QQLGFKGTPIRLIWRSKK  438


 Score =   132 bits (333),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRDAIDTE    +GQ YRLIDTAGIRKK  V       E  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDAIDTEIE-RNGQTYRLIDTAGIRKKKNVEYG---PEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +TEQD K+A R+ +EG+ C+VVVNKWD +
Sbjct  253   FKAIRRADVVLLVIDAIDGVTEQDQKLAGRVIEEGRACVVVVNKWDAV  300



>ref|WP_015166473.1| ribosome-associated GTPase EngA [Pseudanabaena sp. PCC 7367]
 gb|AFY71519.1| GTP-binding protein engA [Pseudanabaena sp. PCC 7367]
Length=454

 Score =   144 bits (363),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 103/161 (64%), Gaps = 9/161 (6%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   Y + VR +L  L +AP+++ +A+ G  V KI+       ++  RR+TT+++
Sbjct  303  DKDSYTIYEYTEKVRSQLYFLDYAPLIFVSALTGQRVAKILDQVDIAAEQHVRRVTTSVI  362

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+++ +AVA+ SPP  R GK+GR+YY TQ + +PPT V FVND K F++ YRRY+E+Q R
Sbjct  363  NEIIEDAVAWHSPPTSRQGKQGRIYYGTQVSSQPPTIVLFVNDPKRFNDNYRRYIERQFR  422

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSLERRLEV  377
             S GF+GTP+RL+WR         GK  RE   SL R  +V
Sbjct  423  ESLGFTGTPLRLIWR---------GKNQREVERSLNRATKV  454


 Score =   125 bits (313),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 83/111 (75%), Gaps = 4/111 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE R+IVSP++GTTRDAIDT+    D +KYRLIDTAGIR+K +V       E   +N+A
Sbjct  198   LGEQRSIVSPIAGTTRDAIDTQVIRGD-RKYRLIDTAGIRRKRSVNYG---PEFFGINRA  253

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTK  853
             F+AI RSDVV +VI+A+  +T+QD K+A R  +EG+GC++VVNKWD +  K
Sbjct  254   FKAINRSDVVLMVIDALEGVTDQDQKLAHRAVEEGRGCIIVVNKWDAVEDK  304



>ref|WP_017653411.1| ribosome-associated GTPase EngA [Microchaete sp. PCC 7126]
Length=454

 Score =   143 bits (361),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 100/150 (67%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+ ++ +L    WA  ++ +A+ G  V+KI+       +   RR+TT+++N
Sbjct  302  KDSYTIYDYEKTLQARLHFTEWADTIFVSALTGQRVEKILELVNTAAEAHKRRVTTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +AV++ SPP  RGG++G++YY TQ + +PPT   FVN+AK F+E YRRY+E+Q R 
Sbjct  362  EVLTDAVSWHSPPASRGGRQGKIYYGTQVSTQPPTIALFVNEAKRFNENYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRLLWRS++  + + G ++R T
Sbjct  422  HLGFKGTPIRLLWRSKKVRDVESGNLNRAT  451


 Score =   125 bits (314),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VG++R IVSP+SGTTRDAIDT     +GQ Y LIDTAGIRKK ++      TE  S+N+A
Sbjct  197   VGQERAIVSPISGTTRDAIDTTIE-RNGQTYCLIDTAGIRKKKSIEYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LV++A+  +TEQD K+A RI +EG+ C++VVNKWD +
Sbjct  253   FKAIRRADVVLLVLDAVDGVTEQDQKLAGRIIEEGRACIIVVNKWDAV  300



>ref|WP_016865529.1| ribosome-associated GTPase EngA [Fischerella muscicola]
Length=453

 Score =   138 bits (347),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 98/151 (65%), Gaps = 0/151 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   YE+ ++ +L    W+  ++ +A+ G  V+KI+       +E  RR++T+++
Sbjct  301  DKDSYTIYDYEKHLQERLHFTEWSETIFVSALTGQRVEKILELVNQAAEEHKRRVSTSVI  360

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ EAV + SPP  R GK+G++YY TQ + +PPT   FVNDAK F++ YRRY+E+Q R
Sbjct  361  NEVLEEAVRWHSPPVSRSGKQGKIYYGTQVSTQPPTIALFVNDAKRFNDNYRRYIERQFR  420

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
               GF GTPIRL+WRS++  + +    +R T
Sbjct  421  QQLGFKGTPIRLIWRSKKARDVENANNNRAT  451


 Score =   130 bits (327),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 83/108 (77%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRDAIDTE    +GQ YRLIDTAGIRKK  V       E  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDAIDTEIE-RNGQIYRLIDTAGIRKKKNVEYG---PEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +T+QD K+A R+ +EG+ C+VVVNKWD +
Sbjct  253   FKAIRRADVVLLVIDAIDGVTDQDQKLAGRVIEEGRACVVVVNKWDAV  300



>ref|WP_011430082.1| GTPase Der [Synechococcus sp. JA-3-3Ab]
 sp|Q2JV46.1|DER_SYNJA RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Synechococcus sp. JA-3-3Ab]
 gb|ABC99401.1| GTP-binding protein EngA [Synechococcus sp. JA-3-3Ab]
Length=459

 Score =   138 bits (348),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 99/158 (63%), Gaps = 2/158 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            NK+  T   Y +++R +L  + WAP+++ +A+ G    KI            +R+ T+++
Sbjct  304  NKDTHTINEYTREIRERLYFIDWAPLLFVSALTGQRTHKIFAEVNTAVAAHRKRIATSVV  363

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+++A+A++SPP  R GK+G++YY TQ A RPPTF+ FVND  LF E YRRY+EK  R
Sbjct  364  NEVLQDALAWQSPPANRQGKQGKIYYGTQVAERPPTFLLFVNDPDLFKENYRRYLEKHFR  423

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSLERR  386
             +  F+GTPIR  WRS  K E+  G+  ++   SL  R
Sbjct  424  QNLDFTGTPIRFRWRS--KSERLVGRAVQKLEGSLASR  459


 Score =   129 bits (325),  Expect(2) = 3e-62, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 84/111 (76%), Gaps = 4/111 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VG +R IVSP++GTTRDA+DT     +GQ YRLIDTAGIR+K+ V       E  S+N+A
Sbjct  199   VGSERAIVSPIAGTTRDAVDT-LVEWEGQSYRLIDTAGIRRKSRVEYG---VEFFSINRA  254

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTK  853
             F+AI+RSDVV LVI+A+  +TEQD ++A RIE+EG+ C++VVNKWD +  K
Sbjct  255   FKAIQRSDVVLLVIDALEGVTEQDQRLAGRIEEEGRACIIVVNKWDAVENK  305



>ref|WP_015216887.1| ribosome-associated GTPase EngA [Anabaena cylindrica]
 gb|AFZ60271.1| GTP-binding protein engA [Anabaena cylindrica PCC 7122]
Length=454

 Score =   140 bits (352),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 99/150 (66%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+ +  +L    WA I++ +A  G  V+KI+       +   RR+TT+++N
Sbjct  302  KDSYTIYDYEKTLETRLHFTEWADIIFVSATTGQRVEKILELVNKAAEAHKRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +A+++ SPP  RGG++G++YY TQ + +PPTF  FVNDA+ F++ YRRY+E+Q R 
Sbjct  362  EVLTDAISWHSPPTSRGGRQGKIYYGTQVSSQPPTFALFVNDAQRFNDNYRRYIERQFRK  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIR+ WRS++  + + G ++R T
Sbjct  422  QLGFDGTPIRVFWRSKKVRDAEIGNLNRAT  451


 Score =   127 bits (320),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRD IDTE    +GQ YRLIDTAGIRKK  +      TE  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDTIDTEIE-RNGQTYRLIDTAGIRKKKHIEYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LV++A    TEQD K+A RI +EG+ C++VVNKWD +
Sbjct  253   FKAIRRADVVLLVLDAEDGATEQDQKLAGRIIEEGRACIIVVNKWDAV  300



>ref|WP_026731732.1| ribosome-associated GTPase EngA [Fischerella sp. PCC 9605]
Length=453

 Score =   139 bits (349),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 96/148 (65%), Gaps = 0/148 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+ ++ +L    WA  ++ +A+ G  V+KI+       +E  RR++T+++N
Sbjct  302  KDSYTIYDYEKHLQERLHFTEWAETIFVSALTGQRVEKILELVNQAAEEHKRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA  + SPP  R GK+G++YY TQ + +PPT   FVN+AK F++ YRRY+E+Q R 
Sbjct  362  EVLEEATRWHSPPVSRSGKQGKIYYGTQVSTQPPTIALFVNEAKRFNDNYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSR  413
              GF GTPIRLLWRS++  E +   V+R
Sbjct  422  QLGFKGTPIRLLWRSKKAREVENANVNR  449


 Score =   128 bits (322),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRDAIDT     +GQ YRLIDTAGIRKK  V       E  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDAIDT-IVERNGQTYRLIDTAGIRKKKNVEYG---PEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR++VV LVI+A+  +TEQD K+A R+ +EG+ C++VVNKWD +
Sbjct  253   FKAIRRAEVVLLVIDALDGVTEQDQKLAGRVIEEGRACILVVNKWDAV  300



>ref|WP_011610203.1| GTPase Der [Trichodesmium erythraeum]
 sp|Q119L7.1|DER_TRIEI RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Trichodesmium erythraeum IMS101]
 gb|ABG49807.1| small GTP-binding protein [Trichodesmium erythraeum IMS101]
Length=453

 Score =   144 bits (364),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 97/150 (65%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YEQ+VR +L  + WA +++ +A+ G  V+KII        E  RR+TT+++N
Sbjct  302  KDNYTIYTYEQEVRSRLYFVEWAEMIFVSALTGKRVEKIINLIDNAANEYQRRVTTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA+++ SPP  R G++G++YY TQ   +PPT   FVND K F E YRRY++ Q R 
Sbjct  362  EVLEEAISWNSPPTNRQGRQGKIYYGTQVTSKPPTIALFVNDPKRFPENYRRYIQSQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF+GTPIRLLWR ++  E +   V+R T
Sbjct  422  HLGFTGTPIRLLWRGKKAREVEQNTVNRAT  451


 Score =   122 bits (307),  Expect(2) = 4e-62, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 79/108 (73%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE R IVSP+SGTTRDAIDT     +G+ YRLIDTAGIRKK  V       E   +N+A
Sbjct  197   IGEKRAIVSPISGTTRDAIDT-VVERNGKTYRLIDTAGIRKKKNVEYGA---EFFGINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR++VV  VI+A+  +TEQD K+A RI ++G+ C++VVNKWD I
Sbjct  253   FKAIRRAEVVMFVIDALDGVTEQDQKLANRIIEDGRACVIVVNKWDAI  300



>ref|WP_006634202.1| ribosome-associated GTPase EngA [Microcoleus vaginatus]
 gb|EGK86068.1| GTP-binding protein engA [Microcoleus vaginatus FGP-2]
Length=453

 Score =   139 bits (351),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 90/137 (66%), Gaps = 0/137 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE++VR +L  L WA +++ +A++G  V+KII        E  RR+ TA++N
Sbjct  301  KDSDTIYEYEREVRTRLYFLDWAEMIFVSAMSGQRVEKIIELVDKASDEHKRRVPTAVIN  360

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA ++ S P  R GK+G++YY TQ   +PPT   FVND K F+E YRRYME Q R 
Sbjct  361  EVIEEATSWHSAPVTRQGKQGKIYYGTQVRSQPPTIALFVNDPKRFTENYRRYMESQFRK  420

Query  496  SAGFSGTPIRLLWRSRR  446
              GF+GTP+RLLWR ++
Sbjct  421  HLGFTGTPMRLLWRGKK  437


 Score =   127 bits (318),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE+R IVSP+SGTTRDAIDT     +G+ YRLIDTAGIRKK  V       E   +N+A
Sbjct  196   LGENRAIVSPISGTTRDAIDT-LVERNGKTYRLIDTAGIRKKKNVEYGA---EFFGINRA  251

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DV+ LVI+A+  +T+QD K+A+RI +EG+ C++VVNKWD +
Sbjct  252   FKAIRRADVILLVIDAIDGVTDQDQKLADRISEEGRACIIVVNKWDAV  299



>ref|WP_019488832.1| ribosome-associated GTPase EngA [Calothrix sp. PCC 7103]
Length=455

 Score =   137 bits (344),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 84/108 (78%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRDAIDT F   DG KYRLIDTAGIR+K ++      TE  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDAIDT-FIERDGHKYRLIDTAGIRRKKSIEYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRRSDVV LVI+A+  +T+QD K+A RI  EG+ C++VVNKWD I
Sbjct  253   FKAIRRSDVVLLVIDALDGVTDQDQKLAGRIVDEGRACIIVVNKWDAI  300


 Score =   129 bits (324),  Expect(2) = 8e-62, Method: Compositional matrix adjust.
 Identities = 60/153 (39%), Positives = 99/153 (65%), Gaps = 2/153 (1%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKII-VTAAAVEKERSRRLTTAIL  680
            K+  T   Y++ +  +L    WA  ++ +A  G  V+KI+ +  ++VE  R RR++T+++
Sbjct  302  KDSHTIYDYQKALEERLHFTEWADTIFVSAQTGQRVEKILELVVSSVESHR-RRVSTSVI  360

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ +AV + SPP  R GK+G++YY TQ    PPT   FVN++K F++ YRRY+E+Q R
Sbjct  361  NEVLEDAVHWHSPPVSRSGKQGKIYYGTQVTTAPPTIALFVNESKRFNDNYRRYIERQFR  420

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETST  401
               GF GTPIR+LWRS++  + +G  ++   +T
Sbjct  421  QQLGFKGTPIRILWRSKKVRDAEGSVINTNRAT  453



>ref|WP_039715879.1| ribosome-associated GTPase EngA [Scytonema millei]
 gb|KIF18353.1| GTPase Der [Scytonema millei VB511283]
Length=452

 Score =   139 bits (351),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 100/150 (67%), Gaps = 2/150 (1%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+++R +++ L WA  ++ +A+ G  V+KI+       +   RR++TA++N
Sbjct  302  KDTYTIYDYEKNLRERMQFLDWAEAIFVSAMTGQRVEKILELVDRAAESHKRRVSTAVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA+ + SPP  R G++GR+YY TQ +++PP    FVNDAK F++ YRRY+E+Q R 
Sbjct  362  EVLEEALRWHSPPVTRQGRQGRIYYGTQVSVQPPAIALFVNDAKRFNDNYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSR--RKMEKDGGKVSR  413
              GF+GTPIRL WRS+  R +EK   + +R
Sbjct  422  QLGFTGTPIRLFWRSKQARDVEKSTNRATR  451


 Score =   126 bits (317),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 80/112 (71%), Gaps = 4/112 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE R IVSP+SGTTRD+IDT      GQ YRLIDTAGIRKK  V       E   +N+A
Sbjct  197   VGESRAIVSPISGTTRDSIDT-VVEHQGQTYRLIDTAGIRKKKNVEYG---PEFFGINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKT  850
             F+AIRR+DVV LVI+A+  +TEQD K+A RI +EG+ C++VVNKWD I   T
Sbjct  253   FKAIRRADVVLLVIDALDGVTEQDQKLAGRIVEEGRACVLVVNKWDAIEKDT  304



>ref|WP_041038340.1| ribosome-associated GTPase EngA [Tolypothrix campylonemoides]
 gb|KIJ75141.1| GTPase Der [Tolypothrix campylonemoides VB511288]
Length=454

 Score =   137 bits (345),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 93/144 (65%), Gaps = 0/144 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+ ++ ++    WA  ++ +A+ G  V+KI+       +   RR++TA++N
Sbjct  302  KDSHTIYDYEKHLQERMHFTEWAQTIFVSALTGQRVEKILELVNTAAESHKRRVSTAVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV   SPP  RGG++GR+YY TQ + +PPT   FVND K F++ YRRY+E+Q R 
Sbjct  362  EVLEEAVGRHSPPVSRGGRQGRIYYGTQVSAQPPTIALFVNDGKRFNDNYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGG  425
              GF GTPIR+LWRS++  + + G
Sbjct  422  HLGFQGTPIRILWRSKKTRDVESG  445


 Score =   128 bits (322),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE R IVSP+SGTTRDAIDT     +GQ YRLIDTAGIRKK  V       E  S+N+A
Sbjct  197   VGEARAIVSPISGTTRDAIDT-VVERNGQIYRLIDTAGIRKKKNVDYG---PEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV +VI+A+  +TEQD K+A RI +EG+ C++VVNKWD I
Sbjct  253   FKAIRRADVVLMVIDALDGVTEQDQKLAGRIVEEGRACIIVVNKWDAI  300



>ref|WP_024125807.1| ribosome-associated GTPase EngA [Thermosynechococcus sp. NK55a]
 gb|AHB89432.1| GTP-binding protein EngA [Thermosynechococcus sp. NK55a]
Length=449

 Score =   140 bits (353),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 93/141 (66%), Gaps = 0/141 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   Y   +  +L  L WA  ++ +A  G  +DKI     A  ++  RR++TA++
Sbjct  302  DKDTYTINAYRDRLYQRLHFLEWADALFVSAHTGQRLDKIFAAVDAAVEQHRRRVSTAVV  361

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V++EA+ + +PP  R G++G++YY TQ A +PPTF  FVNDAKLF + YRRY+E Q+R
Sbjct  362  NEVIQEALRWHTPPATRQGRQGKIYYATQVATQPPTFAIFVNDAKLFKDNYRRYIESQIR  421

Query  499  SSAGFSGTPIRLLWRSRRKME  437
               GF GTPIRLLWRS++  E
Sbjct  422  QQLGFRGTPIRLLWRSKKPRE  442


 Score =   125 bits (314),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 80/111 (72%), Gaps = 4/111 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +G DR IVSP+SGTTRDAIDT     +G +YR IDTAGIRK+  VA      E  SV++A
Sbjct  197   IGSDRAIVSPISGTTRDAIDTVIE-HEGTQYRFIDTAGIRKRTHVAYG---PEMFSVHRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTK  853
             F+AI RSDVV LV++A+  ITEQD ++A  I  +G+ C+++VNKWD +P K
Sbjct  253   FKAIHRSDVVLLVLDALEDITEQDQRLAGHIADQGRACVLIVNKWDAVPDK  303



>ref|WP_011244073.1| MULTISPECIES: GTPase Der [Synechococcus]
 sp|Q5N167.1|DER_SYNP6 RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Synechococcus elongatus PCC 6301]
 sp|Q31KP9.1|DER_SYNE7 RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Synechococcus elongatus PCC 7942]
 dbj|BAD79953.1| GTP-binding protein engA [Synechococcus elongatus PCC 6301]
 gb|ABB58370.1| Small GTP-binding protein domain [Synechococcus elongatus PCC 
7942]
 gb|AJD57166.1| GTPase Der [Synechococcus sp. UTEX 2973]
Length=453

 Score =   149 bits (375),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 104/150 (69%), Gaps = 2/150 (1%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+ ST    E+ +R +L  L WAP+++ +A+ G  V+KI+     V ++  RR+ T+++N
Sbjct  303  KDSSTIYEVERQLRDRLYFLDWAPMIFVSALTGQRVEKILDQVNTVVEQHRRRVGTSVIN  362

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +A+A+++PP  R G++GR+YY TQ   +PP+F  FVND KLF E+YRRY+E+Q R 
Sbjct  363  EVLGDAIAWRTPPTTRQGRQGRIYYGTQVTTQPPSFTLFVNDPKLFGESYRRYIERQFRE  422

Query  496  SAGFSGTPIRLLWRSR--RKMEKDGGKVSR  413
            S GFSGTPIRL WR +  R++E+   + +R
Sbjct  423  SLGFSGTPIRLFWRGKKSRELERGANRATR  452


 Score =   116 bits (291),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 57/106 (54%), Positives = 79/106 (75%), Gaps = 4/106 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE R IVSP++GTTRDAIDT    +D Q+YRL+DTAGIR+K  V       E   +N++
Sbjct  198   LGEQRAIVSPIAGTTRDAIDTVIERND-QRYRLVDTAGIRRKRGVDYG---PEFFGINRS  253

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWD  868
             F+AIRR+DV  LVI+ +  +T+QD K+A RIE++G+ C++VVNKWD
Sbjct  254   FKAIRRADVCLLVIDVLDGVTDQDQKLAGRIEEDGRACVIVVNKWD  299



>ref|WP_028082829.1| ribosome-associated GTPase EngA [Dolichospermum circinale]
Length=454

 Score =   137 bits (345),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 97/150 (65%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+D+  +L    WA  ++ +A+ G  V+KI+       +   RR++T+++N
Sbjct  302  KDSYTIYDYEKDLESRLHFTEWADTIFVSAVTGLRVEKILELVNEAAESHKRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +A+++ SPP  RGG++G++YY TQ + +PP+   FVNDA  F+E YRRY+E+Q R 
Sbjct  362  EVLEDAISWHSPPTSRGGRQGKIYYGTQVSSQPPSIALFVNDASRFNENYRRYIERQFRK  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRL WRS++  + + G  +R T
Sbjct  422  QLGFQGTPIRLFWRSKKVRDMEIGGPNRAT  451


 Score =   127 bits (320),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRD IDT      GQ YRLIDTAGIRKK  +      TE  S+N+A
Sbjct  197   VGENRAIVSPISGTTRDTIDT-IVERGGQTYRLIDTAGIRKKKHIEYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +TEQD K+A R+ +EG+ C++V+NKWD I
Sbjct  253   FKAIRRADVVLLVIDAIDGVTEQDQKLAGRVLEEGRACVIVINKWDAI  300



>ref|WP_015153762.1| ribosome-associated GTPase EngA [Chroococcidiopsis thermalis]
 gb|AFY87214.1| ribosome-associated GTPase EngA [Chroococcidiopsis thermalis 
PCC 7203]
Length=452

 Score =   138 bits (348),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 99/150 (66%), Gaps = 2/150 (1%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+++R +++ L WA  ++ +A  G  V+KI+       +   RR++TA++N
Sbjct  302  KDTYTIYDYEKNLRERMQFLDWAEAIFVSATTGQRVEKILELVNRAAESHKRRVSTAVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA+ + SPP  R G++GR+YY TQ +++PP    FVNDAK F++ YRRY+E+Q R 
Sbjct  362  EVIEEALRWHSPPVTRQGRQGRIYYGTQVSVQPPAIALFVNDAKRFNDNYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSR--RKMEKDGGKVSR  413
              G++GTPIRL WRS+  R +EK   + +R
Sbjct  422  QLGYTGTPIRLFWRSKQARDVEKSSNRATR  451


 Score =   126 bits (317),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 66/112 (59%), Positives = 80/112 (71%), Gaps = 4/112 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE R IVSP+SGTTRD+IDT      GQ YRLIDTAGIRKK  V       E   +N+A
Sbjct  197   VGESRAIVSPISGTTRDSIDT-VVEHQGQTYRLIDTAGIRKKKNVEYG---PEFFGINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKT  850
             F+AIRR+DVV LVI+A+  +TEQD K+A RI +EG+ C++VVNKWD I   T
Sbjct  253   FKAIRRADVVLLVIDALDGVTEQDQKLAGRIVEEGRACVLVVNKWDAIEKDT  304



>ref|WP_015178472.1| ribosome-associated GTPase EngA [Oscillatoria nigro-viridis]
 gb|AFZ09244.1| GTP-binding protein engA [Oscillatoria nigro-viridis PCC 7112]
Length=453

 Score =   139 bits (350),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 89/137 (65%), Gaps = 0/137 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE++VR +L  L WA +++ +A++G  V+KII        E  RR+ TA++N
Sbjct  301  KDSDTIYEYEREVRTRLYFLDWAEMIFVSAMSGQRVEKIIELVDKASDEHKRRVPTAVIN  360

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA  + S P  R GK+G++YY TQ   +PPT   FVND K F+E YRRYME Q R 
Sbjct  361  EVIEEATTWHSAPVTRQGKQGKIYYGTQVRSQPPTIALFVNDPKRFTENYRRYMESQFRK  420

Query  496  SAGFSGTPIRLLWRSRR  446
              GF+GTP+RLLWR ++
Sbjct  421  HLGFTGTPMRLLWRGKK  437


 Score =   125 bits (314),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE+R IVSP+SGTTRDAIDT     +G+ YRLIDTAGIRKK  V       E   +N+A
Sbjct  196   LGENRAIVSPISGTTRDAIDT-LVERNGKTYRLIDTAGIRKKKNVEYGA---EFFGINRA  251

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR++V+ LVI+A+  +T+QD K+A+RI +EG+ C++VVNKWD +
Sbjct  252   FKAIRRANVILLVIDAIDGVTDQDQKLADRISQEGRACIIVVNKWDAV  299



>ref|WP_028091329.1| ribosome-associated GTPase EngA [Dolichospermum circinale]
Length=454

 Score =   137 bits (345),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 97/150 (65%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+D+  +L    WA  ++ +A+ G  V+KI+       +   RR++T+++N
Sbjct  302  KDSYTIYDYEKDLESRLHFTEWADTIFVSAVTGLRVEKILELVNEAAESHKRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +A+++ SPP  RGG++G++YY TQ + +PP+   FVNDA  F+E YRRY+E+Q R 
Sbjct  362  EVLEDAISWHSPPTSRGGRQGKIYYGTQVSSQPPSIALFVNDATRFNENYRRYIERQFRK  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRL WRS++  + + G  +R T
Sbjct  422  QLGFQGTPIRLFWRSKKVRDMEIGGPNRAT  451


 Score =   127 bits (319),  Expect(2) = 3e-61, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRD IDT      GQ YRLIDTAGIRKK  +      TE  S+N+A
Sbjct  197   VGENRAIVSPISGTTRDTIDT-IVERGGQTYRLIDTAGIRKKKHIEYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +TEQD K+A R+ +EG+ C++V+NKWD +
Sbjct  253   FKAIRRADVVLLVIDAIDGVTEQDQKLAGRVLEEGRACVIVINKWDAV  300



>ref|WP_012593504.1| MULTISPECIES: GTPase Der [Cyanothece]
 sp|B7K1S0.1|DER_CYAP8 RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Cyanothece sp. PCC 8801]
 gb|ACK64227.1| small GTP-binding protein [Cyanothece sp. PCC 8801]
 gb|ACU99088.1| small GTP-binding protein [Cyanothece sp. PCC 8802]
Length=452

 Score =   144 bits (364),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 101/151 (67%), Gaps = 2/151 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   Y+ ++  +L  + WAPI++ +A+ G  V+KI+    +  +E  RR+TTA++
Sbjct  301  DKDSYTIYEYKTNIFSRLYFMEWAPIIFVSAMTGQRVNKILELVNSSTEEHRRRVTTAVI  360

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V++EAV + SPP  R GK+G++YY TQ + +PPT   FVND K F+E YRRY+E Q R
Sbjct  361  NEVLQEAVTWHSPPTTRQGKQGKIYYGTQVSTQPPTIALFVNDPKRFNENYRRYIESQFR  420

Query  499  SSAGFSGTPIRLLWRSR--RKMEKDGGKVSR  413
               GF GTPIRLLWR +  R++E+   + ++
Sbjct  421  KQLGFPGTPIRLLWRGKKVREVEQSANRATK  451


 Score =   119 bits (298),  Expect(2) = 4e-61, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 80/108 (74%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE+R IVSP+SGTTRDAIDT    ++ Q YRLIDTAGIR+K  V       E  S+N+A
Sbjct  197   LGENRAIVSPISGTTRDAIDTVIQHNE-QTYRLIDTAGIRRKKNVEYGA---EFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR DVV  VI+A+  +T+QD K+A+RI +EG+  ++V+NKWD +
Sbjct  253   FKAIRRCDVVLFVIDAIDGVTDQDLKLADRIIEEGRSVVLVINKWDAV  300



>ref|WP_037221902.1| ribosome-associated GTPase EngA [Richelia intracellularis]
 emb|CDN14632.1| GTP-binding protein EngA [Richelia intracellularis]
Length=453

 Score =   137 bits (346),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 96/150 (64%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+ +  +L    WA  ++ +A+ G  V+KI+       +E  RR++T+++N
Sbjct  302  KDSYTIYDYEKMLSQRLNFTNWAETIFVSAMTGQRVEKILYLVNYAAEEHKRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA+ + SPP  R GK+G++YY TQ + +PP+   FVNDAK F++ YRRY+E+Q R 
Sbjct  362  EVLEEAIRWHSPPVSRSGKQGKIYYGTQVSTQPPSIALFVNDAKRFNDNYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRL WRS++  + +   V+R T
Sbjct  422  QLGFKGTPIRLFWRSKKARDVENATVNRAT  451


 Score =   125 bits (313),  Expect(2) = 9e-61, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE+R IVSP+SGTTRDAIDT F    GQ YRLIDTAGIRKK  V       E  S+N++
Sbjct  197   MGEERAIVSPISGTTRDAIDT-FIERQGQTYRLIDTAGIRKKKNVEYG---PEFFSINRS  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  IT+QD K+A RI ++G+  ++VVNKWD I
Sbjct  253   FKAIRRADVVLLVIDALDGITDQDQKLAGRIVEDGRAFVLVVNKWDAI  300



>ref|WP_044107095.1| GTPase Der [cyanobacterium endosymbiont of Epithemia turgida]
 dbj|BAP18279.1| GTP-binding protein EngA [cyanobacterium endosymbiont of Epithemia 
turgida isolate EtSB Lake Yunoko]
Length=452

 Score =   136 bits (342),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 98/151 (65%), Gaps = 2/151 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +KN  T   Y   V  +L  + W+PI++ +A+ G  V +++    +  +E  RR++TA++
Sbjct  301  DKNSYTIYEYTTRVFSRLYFMEWSPIIFVSAMTGQRVKRVLSLVKSSAEEHRRRVSTAVI  360

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V++EAV++ SPP  R GK+G++YY TQ + +PPT   FVND K F++ YRRY+E Q R
Sbjct  361  NEVLQEAVSWHSPPTNRQGKQGKIYYGTQVSSQPPTIALFVNDPKRFNDNYRRYIEGQFR  420

Query  499  SSAGFSGTPIRLLWRSR--RKMEKDGGKVSR  413
               GF GTPIRLLWR +  R +E+   + +R
Sbjct  421  QQLGFPGTPIRLLWRGKKVRDLEQPVNRAAR  451


 Score =   126 bits (317),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 80/108 (74%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +G+ R IVSP+SGTTRDAIDT F   DGQ YRLIDTAGIR+K  V       E  S+N++
Sbjct  197   LGKKRAIVSPISGTTRDAIDTVFE-QDGQSYRLIDTAGIRRKKNVEYGA---EFFSINRS  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AI RSDVV  VI+A+  ITEQD K+A+RI  EG+  ++VVNKWDTI
Sbjct  253   FKAICRSDVVLFVIDAIDGITEQDLKLADRIINEGRAAVIVVNKWDTI  300



>ref|WP_009629189.1| ribosome-associated GTPase EngA [Pseudanabaena biceps]
 gb|ELS30741.1| GTP-binding protein engA [Pseudanabaena biceps PCC 7429]
Length=452

 Score =   135 bits (340),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 60/147 (41%), Positives = 93/147 (63%), Gaps = 0/147 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   Y  +V+ +L  + +API++ +A+ G  V +I+       ++  RR+ TAILN
Sbjct  303  KDSYTIYDYTAEVKSRLMFVEYAPIIFVSALTGQRVTQILDRIDIAAEQHKRRVPTAILN  362

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            + + EAV + +PP  RGGK+G+VYYCTQ +  PPT + FVND   F++ Y+RY+E Q R 
Sbjct  363  EALNEAVTWHAPPTSRGGKQGKVYYCTQISDSPPTIILFVNDPHRFNDNYKRYIENQFRK  422

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVS  416
            + GF GTP+R +WR ++  E +  K S
Sbjct  423  TLGFDGTPLRFIWRGKKDREVEKSKNS  449


 Score =   127 bits (318),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE+R+IVSP+SGTTRDAID      DG+KYRLIDTAG+R+K  +       E  S+N+A
Sbjct  198   IGENRSIVSPISGTTRDAIDMSVE-RDGKKYRLIDTAGVRRKKNIDYG---IEFFSINRA  253

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AI RSDVV LVI+A+  +T+QD K+A RI  EGK C++VVNKWD I
Sbjct  254   FKAIGRSDVVLLVIDALDGVTDQDQKLAGRINDEGKACVIVVNKWDAI  301



>ref|WP_017743501.1| ribosome-associated GTPase EngA [Scytonema hofmanni]
Length=453

 Score =   134 bits (338),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 97/150 (65%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   Y++ +  +L    WA I++ +A+ G  V+KII       +   RR++TA++N
Sbjct  302  KDSYTIYDYQKHLEERLHFTEWAEIIFVSALTGLRVEKIIELVDRAAESHKRRVSTAVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA+   +PP  RGG++GR+YY TQ + +PPT   FVN+AK F++ YRRY+E+Q R 
Sbjct  362  EVLEEALNRHTPPVSRGGRQGRIYYGTQVSTQPPTIALFVNEAKRFNDNYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
            + GF GTPIR+LWRS++  + +    +R T
Sbjct  422  NLGFQGTPIRILWRSKKTRDVESTNANRAT  451


 Score =   127 bits (319),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRDAIDT     +GQ YRLIDTAGIRKK  V       E  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDAIDT-VVERNGQTYRLIDTAGIRKKKNVDYG---PEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR++VV LVI+A+  +TEQD K+A RI +EG+ C++VVNKWD +
Sbjct  253   FKAIRRANVVLLVIDAIDGVTEQDQKLAGRIIEEGRACVLVVNKWDAV  300



>ref|WP_027249351.1| ribosome-associated GTPase EngA [Planktothrix agardhii]
Length=454

 Score =   138 bits (348),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 96/150 (64%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE++VR KL  + WA +++ +A  G  V+KI+       +   RR++TA++N
Sbjct  302  KDTYTILDYEKEVRAKLYFMDWAELIFISAKTGQRVEKILNLVDTAAEGHERRVSTAVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA+++ SPP  R GK+G++YY TQ + +PPT V FVND K F++ YRRY++ Q R 
Sbjct  362  EVIEEAISWHSPPVTRQGKQGKIYYGTQVSSKPPTLVLFVNDPKRFNDNYRRYIDGQFRK  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPI+L+WR +   E +    +R T
Sbjct  422  QLGFKGTPIKLIWRGKSAREIERNPANRAT  451


 Score =   123 bits (308),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 82/112 (73%), Gaps = 4/112 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE+R IVSP+SGTTRDAIDT     DG+ YRLIDTAGIR+K  V       E   +N+A
Sbjct  197   LGENRAIVSPISGTTRDAIDTVIE-RDGKTYRLIDTAGIRRKKNVEYGA---EFFGINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKT  850
             F+AI R+DVV LVI+A+  +T+QD K+A+RI +EG+ C++VVNKWD I   T
Sbjct  253   FKAINRADVVLLVIDAIDQVTDQDQKLADRIIEEGRSCVIVVNKWDAIEKDT  304



>ref|WP_026786940.1| MULTISPECIES: ribosome-associated GTPase EngA [Planktothrix]
Length=454

 Score =   138 bits (348),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 96/150 (64%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE++VR KL  + WA +++ +A  G  V+KI+       +   RR++TA++N
Sbjct  302  KDTYTILDYEKEVRAKLYFMDWAELIFISAKTGQRVEKILNLVDTAAEGHERRVSTAVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA+++ SPP  R GK+G++YY TQ + +PPT V FVND K F++ YRRY++ Q R 
Sbjct  362  EVIEEAISWHSPPVTRQGKQGKIYYGTQVSSKPPTLVLFVNDPKRFNDNYRRYIDGQFRK  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPI+L+WR +   E +    +R T
Sbjct  422  QLGFKGTPIKLIWRGKSAREIERNPANRAT  451


 Score =   123 bits (308),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 82/112 (73%), Gaps = 4/112 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE+R IVSP+SGTTRDAIDT     DG+ YRLIDTAGIR+K  V       E   +N+A
Sbjct  197   LGENRAIVSPISGTTRDAIDTVIE-RDGKTYRLIDTAGIRRKKNVEYGA---EFFGINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKT  850
             F+AI R+DVV LVI+A+  +T+QD K+A+RI +EG+ C++VVNKWD I   T
Sbjct  253   FKAINRADVVLLVIDAIDQVTDQDQKLADRIIEEGRSCVIVVNKWDAIEKDT  304



>gb|KIE12801.1| GTPase Der [Tolypothrix bouteillei VB521301]
Length=453

 Score =   133 bits (335),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 96/150 (64%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   Y++ +  +L    WA I++ +A+ G  V+KI+       +   RR++TA++N
Sbjct  302  KDSYTIYDYQKHLEERLHFTEWAEIIFVSALTGQRVEKILELVDRAAQSHKRRVSTAVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA+   +PP  R G++GR+YY TQ + +PPT   FVN+AK F++ YRRY+E+Q R 
Sbjct  362  EVLEEAIGRHTPPVSRSGRQGRIYYGTQVSTQPPTIALFVNEAKRFNDNYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
            + GF GTPIR+LWRS++  + +    +R T
Sbjct  422  NLGFQGTPIRILWRSKKTRDVESTNANRAT  451


 Score =   128 bits (321),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRDAIDT     DG+ YRLIDTAGIRKK  V       E  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDAIDT-VVERDGKTYRLIDTAGIRKKKNVEYG---PEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +TEQD K+A RI ++G+ C++VVNKWD +
Sbjct  253   FKAIRRADVVLLVIDALDGVTEQDQKLAGRIIEDGRACVLVVNKWDAV  300



>ref|WP_015171009.1| ribosome-associated GTPase EngA [Geitlerinema sp. PCC 7407]
 gb|AFY65442.1| ribosome-associated GTPase EngA [Geitlerinema sp. PCC 7407]
Length=453

 Score =   139 bits (351),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 63/144 (44%), Positives = 98/144 (68%), Gaps = 2/144 (1%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   +E+ VR +L  + WA +++++A+ G  V KI     A  ++  RR++T+++N
Sbjct  302  KDSYTIYDFERMVRDRLYFVNWADMIFTSALTGQRVPKIFDLVDAAAEQNQRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +A+ ++SPP  R GK+GR+YY TQ   +PPT   FVN+  LF E YRRY+E+Q R 
Sbjct  362  EVLEDALRWQSPPATRQGKQGRIYYGTQVQSKPPTITLFVNNPALFKENYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSR--RKMEKD  431
            S GFSGTPIRL+WR +  R++E+D
Sbjct  422  SLGFSGTPIRLIWRGKKSRELERD  445


 Score =   122 bits (305),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 78/108 (72%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSPVSGTTRDAID      D + YRLIDTAGIRKK  V       E   +N++
Sbjct  197   VGENRAIVSPVSGTTRDAIDMLVERGD-KTYRLIDTAGIRKKKNVDYG---PEFFGINRS  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +TEQD K+A RI  EG+ C+VVVNKWD +
Sbjct  253   FKAIRRADVVLLVIDAVDGVTEQDQKLAGRIADEGRACVVVVNKWDAV  300



>ref|WP_017718897.1| ribosome-associated GTPase EngA [Oscillatoria sp. PCC 10802]
Length=452

 Score =   132 bits (331),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 61/150 (41%), Positives = 94/150 (63%), Gaps = 2/150 (1%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   Y++ V+ +L    WA I++ +A  G  V+KI+       ++  RR+TTA++N
Sbjct  302  KDSYTIYDYQEHVKDRLGFFEWAEIIFVSAKNGQRVEKILELVNTAAEQHKRRVTTAVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV + SPP  R G++G++YY TQ + +PP    FVND    ++ YRRYME Q R 
Sbjct  362  EVIEEAVRWHSPPTNRQGRQGKIYYGTQVSSQPPAIALFVNDPNRINDNYRRYMESQFRK  421

Query  496  SAGFSGTPIRLLWRSR--RKMEKDGGKVSR  413
              GF+GTPIRLLWR +  R++E+   + +R
Sbjct  422  QLGFTGTPIRLLWRGKKTREVERSNNRAAR  451


 Score =   129 bits (325),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRDAIDT    S GQ YRLIDTAGIRKK  V       E   +N+A
Sbjct  197   VGENRAIVSPISGTTRDAIDTVVERS-GQTYRLIDTAGIRKKKNVEYG---PEFFGINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRRSDVV L+I+A+  +TEQD K+A RI +EG+ C++VVNKWD +
Sbjct  253   FKAIRRSDVVLLLIDALDGVTEQDQKLAGRIAEEGRACVIVVNKWDAV  300



>ref|XP_011401550.1| GTPase Der [Auxenochlorella protothecoides]
 gb|KFM22528.1| GTPase Der [Auxenochlorella protothecoides]
Length=612

 Score =   134 bits (336),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +G+DR+IVS ++GTTRDA+DTEFT  DG +Y LIDTAG+R++  VA+S    E LSVN+A
Sbjct  354   IGQDRSIVSDMAGTTRDAVDTEFTAPDGTRYTLIDTAGVRRRTAVAASPDGAETLSVNRA  413

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTK  853
              RA+RR+DV  LV++A   I +QD ++AE +  EG+ C++VVNKWD +  K
Sbjct  414   LRAVRRADVAVLVLDATEGIAQQDFRLAEYVAAEGRACVIVVNKWDAVAGK  464


 Score =   127 bits (319),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 94/151 (62%), Gaps = 0/151 (0%)
 Frame = -1

Query  862  SNKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAI  683
            + K  ++   +E +VR +LR + WA +V+ +A  G  + +I+    A   E  RR+ TA 
Sbjct  462  AGKGAASLAEFETNVRAELRPVEWANMVFCSATTGLRIPRILDAVRAACAEHRRRVPTAT  521

Query  682  LNQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQL  503
            LN VVR+AVA+++PP +   K+ RVYY TQ A+ PPTFV F N  + F E Y+RY+++QL
Sbjct  522  LNMVVRDAVAWRAPPALSKNKQARVYYATQTAVAPPTFVLFTNVNEKFPEDYKRYIQRQL  581

Query  502  RSSAGFSGTPIRLLWRSRRKMEKDGGKVSRE  410
            R   GF G+P+R+ WR +    ++G +  R+
Sbjct  582  REHIGFPGSPLRVYWRGKTPRGEEGPRKGRK  612



>gb|KIJ80624.1| GTPase Der [Scytonema tolypothrichoides VB-61278]
Length=453

 Score =   134 bits (337),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 96/150 (64%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+ ++ +L    WA  ++ +A+ G  V+KI+       +   RR++TA++N
Sbjct  302  KDSYTIYDYEKHLQERLHFTEWAETIFVSALTGQRVEKILELVDKAAESHKRRVSTAVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA+ + SP   R G++G++YY TQ + +PPT   FVND+K F++ YRRY+E+Q R 
Sbjct  362  EVLEEAMGWHSPTVSRSGRQGKIYYGTQVSSQPPTIALFVNDSKRFNDNYRRYIERQFRE  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIR+LWRS++  E +G   +R T
Sbjct  422  HLGFQGTPIRILWRSKKVREVEGTNANRAT  451


 Score =   126 bits (316),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 79/108 (73%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE R IVSP+SGTTRDAIDT      GQ YRLIDTAGIRKK  V       E  S+N+A
Sbjct  197   VGETRAIVSPISGTTRDAIDT-VVERKGQIYRLIDTAGIRKKKNVEYG---PEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +TEQD K+  R+ +EG+ C++VVNKWD +
Sbjct  253   FKAIRRADVVLLVIDALDGVTEQDQKLVGRVTEEGRACIIVVNKWDAV  300



>ref|XP_002509246.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70504.1| predicted protein [Micromonas sp. RCC299]
Length=468

 Score =   154 bits (388),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 70/137 (51%), Positives = 97/137 (71%), Gaps = 1/137 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  +   Y + +R KLRV  WA +VY++A+ G  V K++  AA       +RL+TA L
Sbjct  327  DKDTYSMNEYTKTLRSKLRVFEWASVVYTSALTGQRVQKVLQAAAEASVHHRKRLSTATL  386

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N V++EA  +KSPP  + G++GRVYY TQA+ RPPTFVFFVND KLF +TY+RYME+ LR
Sbjct  387  NSVIQEATLWKSPPS-KAGRKGRVYYVTQASTRPPTFVFFVNDPKLFPDTYKRYMERSLR  445

Query  499  SSAGFSGTPIRLLWRSR  449
             + GF G+PIR+LWR +
Sbjct  446  DNIGFPGSPIRILWRGK  462


 Score =   106 bits (265),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 79/108 (73%), Gaps = 1/108 (1%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             G+ R+IVS  SGTTRD ID++  G+DG+KY LIDTAGIR++ +VA+S    E+L+V +A 
Sbjct  219   GDARSIVSDYSGTTRDTIDSDVIGADGKKYTLIDTAGIRRRTSVAASKDAPESLAVGRAL  278

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIE-KEGKGCLVVVNKWDTI  862
             +A+RR+DVV LVI+A    ++QD  ++ER   +EG   ++ VNKWD I
Sbjct  279   QAMRRADVVVLVIDAEEGPSQQDFVLSERAAVQEGCALVLCVNKWDRI  326



>ref|WP_011056722.1| GTPase Der [Thermosynechococcus elongatus]
 ref|NP_681668.1| GTP-binding protein EngA [Thermosynechococcus elongatus BP-1]
 sp|Q8DKI1.1|DER_THEEB RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Thermosynechococcus elongatus BP-1]
 dbj|BAC08430.1| GTP-binding protein [Thermosynechococcus elongatus BP-1]
Length=449

 Score =   140 bits (354),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 92/141 (65%), Gaps = 0/141 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   Y   +  +L  L WA  ++ +A  G  ++KI     A  ++  RR+TTA++
Sbjct  302  DKDTYTINAYRDRLYQRLHFLEWADALFVSAHTGQRLEKIFAAVDAAVEQHRRRVTTAVV  361

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N V++EA+ + +PP  R G++G++YY TQ A +PPTF  FVNDAKLF E YRRY+E Q+R
Sbjct  362  NDVIQEALHWHTPPATRQGRQGKIYYATQVATQPPTFAIFVNDAKLFKENYRRYIESQIR  421

Query  499  SSAGFSGTPIRLLWRSRRKME  437
               GF GTPIRLLWRS++  E
Sbjct  422  QQLGFRGTPIRLLWRSKKPRE  442


 Score =   119 bits (299),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 77/108 (71%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +G DR IVSP+SGTTRDAIDT      G +YR IDTAGIRK+  VA      E  SV++A
Sbjct  197   IGSDRAIVSPISGTTRDAIDTVIE-HGGTQYRFIDTAGIRKRTHVAYG---PEMFSVHRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AI RSDVV LV++A+  ITEQD ++A  I  +G+ C+++VNKWD +
Sbjct  253   FKAIHRSDVVLLVLDALEEITEQDQRLAGHIADQGRACVLIVNKWDAV  300



>ref|WP_026721377.1| ribosome-associated GTPase EngA [Fischerella sp. PCC 9431]
Length=453

 Score =   136 bits (342),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 92/138 (67%), Gaps = 0/138 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   YE+ ++ +L    W+  ++ +A+ G  V+KI+       +E  RR++T+++
Sbjct  301  DKDSYTIYDYEKHLQERLHFTEWSETIFVSALTGQRVEKILELVNQAAEEHKRRVSTSVI  360

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ EAV + SPP  R GK+G++YY TQ + +PPT   FVNDAK F++ YRRY+E+Q R
Sbjct  361  NEVLEEAVRWHSPPVSRSGKQGKIYYGTQVSTQPPTIALFVNDAKRFNDNYRRYIERQFR  420

Query  499  SSAGFSGTPIRLLWRSRR  446
               GF GTPIRL WRS++
Sbjct  421  QQLGFKGTPIRLFWRSKK  438


 Score =   124 bits (311),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE R IVSP+SGTTRDAIDT+    DG+ Y LIDTAGIRKK  V       E  S+N+A
Sbjct  197   VGEQRAIVSPISGTTRDAIDTKIE-RDGKTYLLIDTAGIRKKKNVEYG---PEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +T+QD K+A R+ +EG+ C++VVNKWD +
Sbjct  253   FKAIRRADVVLLVIDAIDGVTDQDQKLAGRVIEEGRACVLVVNKWDAV  300



>ref|WP_016859054.1| ribosome-associated GTPase EngA [Fischerella muscicola]
Length=453

 Score =   132 bits (333),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 95/149 (64%), Gaps = 0/149 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   YE+ ++ +L    W+  ++ +A+ G  V+KI+       +E  RR++T+++
Sbjct  301  DKDSYTIYDYEKHLQERLHFTEWSETIFVSALTGQRVEKILELVNQAAEEHKRRVSTSVI  360

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ EAV + SP   R GK+G++YY TQ + +PPT   FVNDAK F++ YRRY+E+Q R
Sbjct  361  NEVLEEAVRWHSPSVSRSGKQGKIYYGTQVSTQPPTIALFVNDAKRFNDNYRRYIERQFR  420

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSR  413
               GF GTPIRL WRS++  + +    +R
Sbjct  421  QQLGFKGTPIRLFWRSKKARDVENASNNR  449


 Score =   126 bits (317),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE R IVSP+SGTTRDAIDT+    DG+ Y LIDTAGIRKK  V       E  S+N+A
Sbjct  197   VGEQRAIVSPISGTTRDAIDTKIE-RDGKTYLLIDTAGIRKKKNVEYG---PEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +TEQD K+A RI +EG+ C++VVNKWD +
Sbjct  253   FKAIRRADVVLLVIDAIDGVTEQDQKLAGRIIEEGRACVLVVNKWDAV  300



>ref|WP_042151580.1| ribosome-associated GTPase EngA [Planktothrix agardhii]
Length=454

 Score =   135 bits (340),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 95/150 (63%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE++VR KL  + WA +++ +A  G  V+KI+       +   RR++TA++N
Sbjct  302  KDTYTILDYEKEVRAKLYFMDWAELIFISAKTGQRVEKILNLVDTAAEGHERRVSTAVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV++ S P  R GK+G++YY TQ + +PPT V FVND K F++ YRRY++ Q R 
Sbjct  362  EVIEEAVSWHSAPVTRQGKQGKIYYGTQVSSKPPTLVLFVNDPKRFNDNYRRYIDGQFRK  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPI+L+WR +   E +    +R T
Sbjct  422  QLGFKGTPIKLIWRGKSAREIERNPANRAT  451


 Score =   123 bits (309),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 82/112 (73%), Gaps = 4/112 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE+R IVSP+SGTTRDAIDT     DG+ YRLIDTAGIR+K  V       E   +N+A
Sbjct  197   LGENRAIVSPISGTTRDAIDTVIE-RDGKTYRLIDTAGIRRKKNVEYGA---EFFGINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKT  850
             F+AI R+DVV LVI+A+  +T+QD K+A+RI +EG+ C++VVNKWD I   T
Sbjct  253   FKAINRADVVLLVIDAIDQVTDQDQKLADRIIEEGRSCVIVVNKWDAIEKDT  304



>ref|WP_015150727.1| ribosome-associated GTPase EngA [Oscillatoria acuminata]
 gb|AFY84106.1| ribosome-associated GTPase EngA [Oscillatoria acuminata PCC 6304]
Length=454

 Score =   130 bits (328),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 56/137 (41%), Positives = 90/137 (66%), Gaps = 0/137 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+D++ +L  L WA  ++ +A  G  V+ I+        E  RR++T+++N
Sbjct  302  KDSYTIYDYERDIKSRLYFLEWAEAIFVSAATGKRVENILDLVDKSADEHRRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+++A+ + SPP  R GK+G++YY TQ   +PPT   FVND K F++ YRRY+E+Q R 
Sbjct  362  EVLKDALHWHSPPTSRQGKQGKIYYGTQVTSQPPTIALFVNDPKRFNDNYRRYIERQFRE  421

Query  496  SAGFSGTPIRLLWRSRR  446
              GF+G+P+RLLWR ++
Sbjct  422  QLGFTGSPLRLLWRGKK  438


 Score =   127 bits (320),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE R IVSP+SGTTRD+IDT F   +G  YR+IDTAGIRKK  V       E   +N+A
Sbjct  197   VGEKRAIVSPISGTTRDSIDT-FVERNGTNYRIIDTAGIRKKKNVEYG---PEFFGINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +TEQD K+A RIE++G+ C++V+NKWD I
Sbjct  253   FKAIRRADVVLLVIDAIDGVTEQDQKLAGRIEEDGRACVIVINKWDAI  300



>ref|WP_044451605.1| GTPase Der, partial [Mastigocladus laminosus]
 gb|KIY11131.1| GTPase Der, partial [Mastigocladus laminosus UU774]
Length=351

 Score =   132 bits (333),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 93/149 (62%), Gaps = 0/149 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   YE+ ++ +L    W+  ++ +A+ G  V+KI+       +E  RR++T+++
Sbjct  199  DKDSYTIYDYEKHLQERLHFTEWSETIFVSALTGQRVEKILELVEQAAEEHKRRVSTSVI  258

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ EAV + SP   R GK+G++YY TQ   RPPT   FVNDAK F++ YRRY+E+Q R
Sbjct  259  NEVLEEAVRWHSPSVSRSGKQGKIYYGTQVTTRPPTIALFVNDAKRFNDNYRRYIERQFR  318

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSR  413
               GF GTPIR  WRS++  + +    +R
Sbjct  319  QQLGFKGTPIRFFWRSKKARDVENASNNR  347


 Score =   125 bits (315),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE R IVSP+SGTTRDAIDT+    DG+ Y LIDTAGIRKK  V       E  S+N+A
Sbjct  95    VGEQRAIVSPISGTTRDAIDTKIE-RDGKTYLLIDTAGIRKKKNVEYG---PEFFSINRA  150

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LV++A+  +TEQD K+A RI +EG+ C++VVNKWD +
Sbjct  151   FKAIRRADVVLLVVDAIDGVTEQDQKLAGRIIEEGRACVLVVNKWDAV  198



>ref|WP_039202145.1| ribosome-associated GTPase EngA [Aphanizomenon flos-aquae]
 gb|KHG41079.1| GTPase Der [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=454

 Score =   129 bits (325),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRD IDT      GQ YRLIDTAGIRKK  +      TE  S+N+A
Sbjct  197   VGENRAIVSPISGTTRDTIDT-IVERGGQTYRLIDTAGIRKKKHIEYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRRSDVV LVI+A+  +TEQD K+A R+ +EG+ C+VVVNKWD +
Sbjct  253   FKAIRRSDVVLLVIDALDGVTEQDQKLAGRVLEEGRACVVVVNKWDAV  300


 Score =   129 bits (324),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 95/150 (63%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   +E+++  +L    WA  ++ +A  G  V+KI+       +   RR++T+++N
Sbjct  302  KDSYTIYDHEKELESRLHFTEWADTIFVSANTGLRVEKILELVNQAAEAHKRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +A+++ SPP  RGG++G++YY TQ + +PP+   FVND   F++ YRRY+E+Q R 
Sbjct  362  EVLEDAISWHSPPTSRGGRQGKIYYGTQVSSQPPSIALFVNDNTRFNDNYRRYIERQFRK  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRL WRS++  E + G  +R T
Sbjct  422  QLGFQGTPIRLFWRSKKVREMEIGGPNRAT  451



>ref|WP_027401964.1| ribosome-associated GTPase EngA [Aphanizomenon flos-aquae]
Length=454

 Score =   129 bits (325),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRD IDT      GQ YRLIDTAGIRKK  +      TE  S+N+A
Sbjct  197   VGENRAIVSPISGTTRDTIDT-IVERGGQTYRLIDTAGIRKKKHIEYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRRSDVV LVI+A+  +TEQD K+A R+ +EG+ C+VVVNKWD +
Sbjct  253   FKAIRRSDVVLLVIDALDGVTEQDQKLAGRVLEEGRACVVVVNKWDAV  300


 Score =   129 bits (323),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 95/150 (63%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   +E+++  +L    WA  ++ +A  G  V+KI+       +   RR++T+++N
Sbjct  302  KDSYTIYDHEKELESRLHFTEWADTIFVSANTGLRVEKILELVNQAAEAHKRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +A+++ SPP  RGG++G++YY TQ + +PP+   FVND   F++ YRRY+E+Q R 
Sbjct  362  EVLEDAISWHSPPTSRGGRQGKIYYGTQVSSQPPSIALFVNDNTRFNDNYRRYIERQFRK  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRL WRS++  E + G  +R T
Sbjct  422  QLGFQGTPIRLFWRSKKVREMEIGGPNRAT  451



>gb|KEI65594.1| EngA [Planktothrix agardhii NIVA-CYA 126/8]
Length=495

 Score =   135 bits (340),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 95/150 (63%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE++VR KL  + WA +++ +A  G  V+KI+       +   RR++TA++N
Sbjct  343  KDTYTILDYEKEVRAKLYFMDWAELIFISAKTGQRVEKILNLVDTAAEGHERRVSTAVIN  402

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV++ S P  R GK+G++YY TQ + +PPT V FVND K F++ YRRY++ Q R 
Sbjct  403  EVIEEAVSWHSAPVTRQGKQGKIYYGTQVSSKPPTLVLFVNDPKRFNDNYRRYIDGQFRK  462

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPI+L+WR +   E +    +R T
Sbjct  463  QLGFKGTPIKLIWRGKSAREIERNPANRAT  492


 Score =   123 bits (308),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE+R IVSP+SGTTRDAIDT     DG+ YRLIDTAGIR+K  V       E   +N+A
Sbjct  238   LGENRAIVSPISGTTRDAIDTVIE-RDGKTYRLIDTAGIRRKKNVEYGA---EFFGINRA  293

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AI R+DVV LVI+A+  +T+QD K+A+RI +EG+ C++VVNKWD I
Sbjct  294   FKAINRADVVLLVIDAIDQVTDQDQKLADRIIEEGRSCVIVVNKWDAI  341



>ref|WP_009556849.1| ribosome-associated GTPase EngA [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ68084.1| ribosome-associated GTPase EngA [Oscillatoriales cyanobacterium 
JSC-12]
Length=452

 Score =   137 bits (345),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 100/160 (63%), Gaps = 9/160 (6%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+++  +L  + WA +++ +A  G  V+KI+       ++  RR+TT+++N
Sbjct  302  KDSHTIYDYEREITSRLHFIEWAEVIFISAKTGQRVEKILDLVNGAAEQHRRRVTTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +A+++ +PP  RGG++G++YY TQ + +PP+   FVND  LF+++YRRY+E+Q R 
Sbjct  362  EVLEDAISWHTPPTTRGGRQGKIYYGTQVSTQPPSIALFVNDPNLFNDSYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSLERRLEV  377
            + GF GTPIRL WR         GK  R+   SL R   V
Sbjct  422  ALGFKGTPIRLFWR---------GKKVRDAERSLNRATNV  452


 Score =   120 bits (302),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 77/108 (71%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRDAID      +GQ YR+IDTAGIRKK  V       E   +N+A
Sbjct  197   VGENRAIVSPISGTTRDAIDM-VVERNGQTYRIIDTAGIRKKKNVEYG---PEFFGINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AI R+DVV  VI+A+  +TEQD K+A RI  EG+ C++VVNKWD +
Sbjct  253   FKAIARADVVLFVIDALDGVTEQDQKLAGRIADEGRACVLVVNKWDAV  300



>ref|WP_017309647.1| ribosome-associated GTPase EngA [Fischerella sp. PCC 9339]
Length=453

 Score =   132 bits (332),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 59/149 (40%), Positives = 93/149 (62%), Gaps = 0/149 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   YE+ ++ +L    W+  ++ +A+ G  V+KI+       +E  RR++T+++
Sbjct  301  DKDSYTIYDYEKHLQERLHFTEWSETIFVSALTGQRVEKILELVEQAAEEHKRRVSTSVI  360

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ EAV + SP   R GK+G++YY TQ   RPPT   FVNDAK F++ YRRY+E+Q R
Sbjct  361  NEVLEEAVRWHSPSVSRSGKQGKIYYGTQVTTRPPTIALFVNDAKRFNDNYRRYIERQFR  420

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSR  413
               GF GTPIR  WRS++  + +    +R
Sbjct  421  QQLGFKGTPIRFFWRSKKARDVENASNNR  449


 Score =   125 bits (315),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE R IVSP+SGTTRDAIDT+    DG+ Y LIDTAGIRKK  V       E  S+N+A
Sbjct  197   VGEQRAIVSPISGTTRDAIDTKIE-RDGKTYLLIDTAGIRKKKNVEYG---PEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LV++A+  +TEQD K+A RI +EG+ C++VVNKWD +
Sbjct  253   FKAIRRADVVLLVVDAIDGVTEQDQKLAGRIIEEGRACVLVVNKWDAV  300



>ref|WP_015121858.1| ribosome-associated GTPase EngA [Rivularia sp. PCC 7116]
 gb|AFY58306.1| ribosome-associated GTPase EngA [Rivularia sp. PCC 7116]
Length=456

 Score =   130 bits (326),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 96/143 (67%), Gaps = 2/143 (1%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKII-VTAAAVEKERSRRLTTAIL  680
            K+  +   Y++ + G+L    W+  ++ +A+ G  V KI+ +   A+E+ R RR++T+++
Sbjct  302  KDSYSVYDYQKYLSGRLHFSDWSETIFVSALTGQRVLKILDLVNQAIEQHR-RRVSTSVI  360

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ EAV + SPP  R GK+GR+YY TQ + +PPT   FVN+ K F++ YRRY+E+Q R
Sbjct  361  NEVLEEAVRWHSPPASRSGKQGRIYYGTQVSTQPPTIALFVNEEKRFNDNYRRYIERQFR  420

Query  499  SSAGFSGTPIRLLWRSRRKMEKD  431
               GF GTPIRLLWRS++  E +
Sbjct  421  EQLGFRGTPIRLLWRSKKVRETE  443


 Score =   127 bits (320),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 78/105 (74%), Gaps = 4/105 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE+R IVSP+SGTTRDAIDT F   D Q YRLIDTAGIRKK  +      TE  S+N+AF
Sbjct  198   GEERAIVSPISGTTRDAIDT-FIEKDEQVYRLIDTAGIRKKKNIDYG---TEFFSINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWD  868
             +AIRRSDVV  VI+A+  IT+QD K+A RI  EG+ C+ VVNKWD
Sbjct  254   KAIRRSDVVLFVIDALDGITDQDQKLAGRIIDEGRACITVVNKWD  298



>ref|WP_015197239.1| ribosome-associated GTPase EngA [Calothrix parietina]
 gb|AFZ00591.1| GTP-binding protein engA [Calothrix sp. PCC 6303]
Length=455

 Score =   129 bits (323),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 93/152 (61%), Gaps = 2/152 (1%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   +++ V  +L    WA +++ +A +G  VDKI+       +   RR++T+++N
Sbjct  302  KDSYTIYDHQKQVEQRLNFTEWADMIFVSAQSGQRVDKILDLVKPAAESHKRRVSTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV + SPP  R GK+G++YY TQ +  PP    FVNDA  F++ Y+RY+E+Q R 
Sbjct  362  EVLEEAVRWHSPPVSRSGKQGKIYYGTQVSSGPPAIALFVNDATRFNDNYKRYIERQFRE  421

Query  496  SAGFSGTPIRLLWRSR--RKMEKDGGKVSRET  407
              GF GTPIRL WRS+  R ME  G   +R T
Sbjct  422  QLGFKGTPIRLFWRSKKVRDMESVGPGSNRAT  453


 Score =   128 bits (321),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 82/108 (76%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRDAIDT     DGQ YR+IDTAGIRKK  V       E  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDAIDT-IVEHDGQTYRIIDTAGIRKKKNVEYGA---EFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRRSDVV +VI+A+  +T+QD K+A RI ++G+ C++VVNKWD +
Sbjct  253   FKAIRRSDVVLMVIDAIDGVTDQDQKLAGRIIEDGRACVIVVNKWDAV  300



>ref|XP_003061511.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54141.1| predicted protein [Micromonas pusilla CCMP1545]
Length=470

 Score =   158 bits (400),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 95/137 (69%), Gaps = 1/137 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +KN  +   Y + +R KLRV  WA +VY +A+ G  V K++  A        +RL+TA L
Sbjct  329  DKNSYSMNEYTKSLRSKLRVFEWASVVYVSALTGQRVQKVLAAAVEASTHHRKRLSTATL  388

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N VV+EA  +KSPP  RGG++G+VYY TQA+ RPPTFVFF ND KLF ETYRRYME+ LR
Sbjct  389  NAVVQEATLWKSPPS-RGGRKGKVYYVTQASTRPPTFVFFCNDPKLFVETYRRYMERSLR  447

Query  499  SSAGFSGTPIRLLWRSR  449
             + GF GTP+R+LWR +
Sbjct  448  ENIGFPGTPVRILWRGK  464


 Score = 98.6 bits (244),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 73/108 (68%), Gaps = 1/108 (1%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             G+ R IVS  SGTTRD ID++ T +DG K+ LIDTAGIR++  VA+     E LSV +A 
Sbjct  221   GDARAIVSDHSGTTRDTIDSDVTDADGNKFTLIDTAGIRRRTAVAAGKDKPEELSVGRAL  280

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIE-KEGKGCLVVVNKWDTI  862
             +A+RR++VV LVI+A    ++QD  +AER    EG   ++ VNKWD I
Sbjct  281   QAMRRAEVVVLVIDAEEGPSQQDFVLAERAALTEGCALVLCVNKWDVI  328



>ref|WP_017299024.1| ribosome-associated GTPase EngA [Nodosilinea nodulosa]
Length=454

 Score =   129 bits (324),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 94/145 (65%), Gaps = 4/145 (3%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKII-VTAAAVEKERSRRLTTAIL  680
            K+  T   ++  +  +L  L WA  ++ +A  G  V KI+ +   AVE+ R RR++T+++
Sbjct  302  KDSHTIYDFDHQISARLNFLDWAKRIFVSAKTGQRVPKILELVDQAVEQHR-RRVSTSVV  360

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ +AV + +PP  R G++GR+YY TQ  +RPP+F  FVND  L  + YRRY+E+Q R
Sbjct  361  NEVLEDAVKWHTPPTTRQGRQGRIYYGTQVTVRPPSFTLFVNDPHLLKDNYRRYVERQFR  420

Query  499  SSAGFSGTPIRLLWRSR--RKMEKD  431
             + GF GTPIR+ WR +  R +E++
Sbjct  421  ENLGFEGTPIRIFWRGKAMRDLERN  445


 Score =   127 bits (319),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 80/108 (74%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE R IVSP+SGTTRDAID      D Q YRLIDTAGIRKK +V       E   +N+A
Sbjct  197   VGETRAIVSPISGTTRDAIDMRVQHGD-QIYRLIDTAGIRKKKSVEYG---PEFFGINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +TEQD K+A RIE++G+ C++VVNKWD +
Sbjct  253   FKAIRRADVVLLVIDALDGVTEQDQKLAGRIEEDGRACIIVVNKWDAV  300



>ref|WP_035154056.1| ribosome-associated GTPase EngA [Calothrix sp. 336/3]
 gb|KFB84034.1| GTPase Der [Calothrix sp. 336/3]
Length=453

 Score =   129 bits (324),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 94/150 (63%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   Y++ +  +L    W   ++ +A+ G  V+KI+       +   RR++T+++N
Sbjct  302  KDSYTIYEYQKHLEQRLHFTEWTETIFISALTGLRVEKILELVNNAAEAHKRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA+ + SPP  R GK+GR+YY TQ + +PP+   FVNDAK F++ Y+RY+E+Q R 
Sbjct  362  EVLEEALRWHSPPVSRSGKQGRIYYGTQVSCQPPSIALFVNDAKRFNDNYKRYIERQFRK  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRL WRS++  + +   ++R T
Sbjct  422  QLGFQGTPIRLFWRSKKVRDMENMSMNRAT  451


 Score =   127 bits (319),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRDAIDT     +GQ YRLIDTAGIRKK ++       E  S+N+A
Sbjct  197   VGEERAIVSPISGTTRDAIDT-CVERNGQAYRLIDTAGIRKKKSIDYG---PEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRRSDVV LVI+A+  +TEQD K+  R+  EG+ C++VVNKWD I
Sbjct  253   FKAIRRSDVVLLVIDALDGVTEQDQKLVGRVLDEGRACVLVVNKWDAI  300



>ref|WP_040054265.1| ribosome-associated GTPase EngA [Candidatus Atelocyanobacterium 
thalassa]
 gb|KFF42128.1| ribosome-associated GTPase EngA [Candidatus Atelocyanobacterium 
thalassa isolate SIO64986]
Length=452

 Score =   135 bits (339),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 91/137 (66%), Gaps = 0/137 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   ++++V  +L  + WA I++ +A +G  ++KI        KE  RR+ T+++N
Sbjct  302  KDAYTIYSHKKNVMNRLYFMEWADIIFISAKSGQRIEKIFPLVNTAVKEHRRRINTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA+ + SPP  R GK+G++YY TQ + +PPT V FVND K F++ YRRY+E Q R 
Sbjct  362  EVLEEAIRWHSPPTTRQGKQGKIYYGTQVSNQPPTIVLFVNDPKRFNDNYRRYIEGQFRQ  421

Query  496  SAGFSGTPIRLLWRSRR  446
              GFSGTPIRLLW+ ++
Sbjct  422  QIGFSGTPIRLLWKGKK  438


 Score =   121 bits (303),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 60/108 (56%), Positives = 80/108 (74%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE+R IVSP+SGTTRD IDT      G+ YRL+DTAGIR+K  V       E  S+N+A
Sbjct  197   LGENRAIVSPISGTTRDTIDT-VVERKGKVYRLVDTAGIRRKKNVEYGA---EFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +TEQD K+A+RI +EG+  ++VVNKWD +
Sbjct  253   FKAIRRADVVLLVIDAIDGVTEQDIKLADRIIEEGRSAIIVVNKWDAV  300



>ref|XP_001697913.1| hypothetical protein CHLREDRAFT_120661 [Chlamydomonas reinhardtii]
 gb|EDO99796.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=446

 Score =   141 bits (355),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 91/137 (66%), Gaps = 1/137 (1%)
 Frame = -1

Query  844  TATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILNQVVR  665
            T     ++VR +LR + WA +V ++AI G  V+ ++        +  RR+ TA LN V+R
Sbjct  310  TVEKMAENVRTQLRHVAWASVVCTSAIYGRHVEDVLEAVLDAGAQHRRRVPTATLNMVLR  369

Query  664  EAVAFKSPPRIRGG-KRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRSSAG  488
            EA  +KSPP  RG  ++GR+YY TQA  RPP+FVFFVND KLF + YRRYME+QLR + G
Sbjct  370  EATQWKSPPTQRGSLRKGRIYYATQAGARPPSFVFFVNDEKLFPDDYRRYMERQLRDNIG  429

Query  487  FSGTPIRLLWRSRRKME  437
            F G+P+RL WR + K E
Sbjct  430  FPGSPLRLFWRGKPKRE  446


 Score =   115 bits (287),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 79/107 (74%), Gaps = 0/107 (0%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE+R+IV  +SGTTRDA+DT+ T   G+K  LIDTAGIRK++ VA S    E +SV++A 
Sbjct  198   GEERSIVCDMSGTTRDAVDTKVTLPTGKKLTLIDTAGIRKRSRVADSPDGAEQISVDRAM  257

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             RA+RR+DV  LVI+A+  IT+QD +++E    EGK  +VVVNKWD +
Sbjct  258   RAVRRADVAVLVIDAVEGITQQDFRLSELFAAEGKAVVVVVNKWDRV  304



>ref|WP_009546754.1| MULTISPECIES: GTPase Der [Cyanothece]
 sp|B1X0B0.1|DER_CYAA5 RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Cyanothece sp. ATCC 51142]
 gb|ACB49611.1| GTP-binding protein [Cyanothece sp. ATCC 51142]
Length=452

 Score =   136 bits (343),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 97/160 (61%), Gaps = 9/160 (6%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   Y+Q V  +L  + WA I++ +A++G  V+ I        +E  RR+ T+++N
Sbjct  302  KDSYTIYDYKQKVMDRLYFMEWADIIFVSAMSGKRVENIFELVDVAVEEHRRRVNTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV + SPP  + GK+GR+YY TQ + +PPT   FVND K F++ YRRY+E+Q R 
Sbjct  362  EVLEEAVKWHSPPTTKQGKQGRIYYGTQVSSQPPTIALFVNDPKRFNDNYRRYIERQFRE  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSLERRLEV  377
              GF GTPIRLLWR         GK +R+   SL R  +V
Sbjct  422  QIGFPGTPIRLLWR---------GKKTRDVEPSLNRATKV  452


 Score =   119 bits (298),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 78/108 (72%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE R IVSP+SGTTRDAIDT     D   YRLIDTAGIR+K  V       E  S+N+A
Sbjct  197   LGEQRAIVSPISGTTRDAIDTVVERGD-NTYRLIDTAGIRRKKNVNYGA---EFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +T+QD K+A+RI  EG+  ++VVNKWD +
Sbjct  253   FKAIRRADVVLLVIDAIDGVTDQDIKLADRIIDEGRAAIIVVNKWDAV  300



>ref|WP_017290366.1| ribosome-associated GTPase EngA [Leptolyngbya boryana]
Length=454

 Score =   130 bits (327),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 55/145 (38%), Positives = 93/145 (64%), Gaps = 0/145 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   Y+Q +R +L  + WA  ++ +A  G  V+KI        ++  RR++T+++N
Sbjct  302  KDSHTIYEYDQQIRDRLHFVEWAESIFISAKTGQRVEKIFELVDRAAEQHKRRISTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +A+++ +PP  R G++G++YY TQ +  PPT   FVND  LF++ YRRY++++ R 
Sbjct  362  EVLEDALSWHTPPTTRQGRQGKIYYGTQVSSAPPTIALFVNDPHLFNDNYRRYIDRKFRE  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGK  422
            S GF GTP+RLLWR ++  E + G 
Sbjct  422  SLGFQGTPLRLLWRGKKLREVERGN  446


 Score =   125 bits (314),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 79/108 (73%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R+IVSP+SGTTRDAID      D + YRLIDTAGIRKK  V       E   +N+A
Sbjct  197   VGENRSIVSPISGTTRDAIDM-LVERDDKMYRLIDTAGIRKKKNVEYG---PEFFGINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AI RSDVV LVI+A+  +TEQD K+A RI+ EG+ C+V+VNKWD I
Sbjct  253   FKAIDRSDVVLLVIDALDGVTEQDQKLAGRIDDEGRACVVIVNKWDAI  300



>ref|WP_007358531.1| MULTISPECIES: ribosome-associated GTPase EngA [Kamptonema]
 emb|CBN59362.1| GTP-binding protein engA [ [[Oscillatoria] sp. PCC 6506]
Length=454

 Score =   131 bits (330),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 91/143 (64%), Gaps = 2/143 (1%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+ +T   YE++V+ +L  + WA +++ +A  G  V+KI+           RR+TTA++N
Sbjct  302  KDSTTIYDYEKEVKTRLYFVDWAEMIFVSATTGQRVEKILELVDTAATAHQRRVTTAVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA ++ SPP  R G++G++YY TQ   +PPT   FVND   F+E YRRY+E Q R 
Sbjct  362  EVIEEATSWHSPPVTRQGRQGKIYYGTQVRAQPPTIALFVNDPLRFNENYRRYIETQFRK  421

Query  496  SAGFSGTPIRLLWRSR--RKMEK  434
              GF GTP+RL+WR +  R +EK
Sbjct  422  QLGFIGTPMRLVWRGKKPRDLEK  444


 Score =   124 bits (311),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE R IVSP+SGTTRDAIDT     +G  YRLIDTAGIRKK  V       E   +N+A
Sbjct  197   LGETRAIVSPISGTTRDAIDT-VVERNGTTYRLIDTAGIRKKKNVEYG---PEFFGINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +T+QD K+A+RI +EG+ C++VVNKWD I
Sbjct  253   FKAIRRADVVLLVIDAVDGVTDQDQKLADRISEEGRACVIVVNKWDAI  300



>ref|WP_032524108.1| ribosome-associated GTPase EngA [Prochlorococcus marinus]
 gb|KGF88620.1| GTP-binding protein EngA [Prochlorococcus marinus str. GP2]
Length=457

 Score =   149 bits (375),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 97/140 (69%), Gaps = 0/140 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALDAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+RE++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLRESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRKME  437
            + GF GTP+ LLWR +++ E
Sbjct  422  NLGFEGTPLILLWRGKQQRE  441


 Score =   107 bits (266),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 76/107 (71%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D Q ++++DTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDLSGTTTDSIDTLIKKGDHQ-WKIVDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_009631866.1| ribosome-associated GTPase EngA [Synechocystis sp. PCC 7509]
Length=458

 Score =   129 bits (324),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 61/152 (40%), Positives = 95/152 (63%), Gaps = 2/152 (1%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   +E+ ++ +L  + WA +++ +A  G  V+KI+  A        RR+TT+++N
Sbjct  302  KDSYTIYDHEKTLKERLYFIEWAEMIFVSAKTGQRVEKILELADVAAAAHKRRVTTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV + SPP  R G++G++YY TQ + +PP    FVN+A  F E Y+RY+E+Q R 
Sbjct  362  EVLEEAVRWHSPPTSRQGRQGKIYYGTQVSTQPPAIALFVNEASRFPENYKRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSR--RKMEKDGGKVSRET  407
              GF GTPIRL WRS+  R++E  G   +R T
Sbjct  422  QLGFVGTPIRLFWRSKKVREVENTGSPTNRAT  453


 Score =   126 bits (316),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 80/108 (74%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R IVSP+SGTTRDAIDT     DG+ YRLIDTAGIR+K  V       E   +N+A
Sbjct  197   VGENRAIVSPISGTTRDAIDTVIE-RDGKTYRLIDTAGIRRKKNVEYGA---EFFGINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LV++A   +TEQD K+  RIE+EG+ C+VV+NKWD +
Sbjct  253   FKAIRRADVVLLVLDAEDGVTEQDQKLVARIEEEGRSCVVVINKWDAV  300



>ref|WP_015078384.1| ribosome-associated GTPase EngA [Anabaena sp. 90]
 gb|AFW93220.1| small GTP-binding protein [Anabaena sp. 90]
Length=454

 Score =   129 bits (325),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 95/150 (63%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   + +++  +L    WA  +Y +A+ G  V+KI+       +   RR++T+++N
Sbjct  302  KDSYTIYDHAKELESRLHFTEWADTIYVSAVTGQRVEKILELVNTAAEAHKRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +A+++ SPP  RGG++G++YY TQ + +PP+   FVND   F++ YRRY+E+Q R 
Sbjct  362  EVLEDAISWHSPPTSRGGRQGKIYYGTQVSSQPPSIALFVNDNTRFNDNYRRYIERQFRK  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRL WRS++  + + G  +R T
Sbjct  422  QLGFQGTPIRLFWRSKKVRDVEIGGPNRAT  451


 Score =   125 bits (314),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 80/108 (74%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE R IVSP+SGTTRD IDT     D Q YRLIDTAGIRKK  +      TE  S+N+A
Sbjct  197   VGEYRAIVSPISGTTRDTIDTVVERGD-QTYRLIDTAGIRKKKHIEYG---TEFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRRSDVV LVI+A+  +TEQD K+A R+ +EG+ C++VVNKWD +
Sbjct  253   FKAIRRSDVVLLVIDAVDGVTEQDQKLAGRVLEEGRACVIVVNKWDAV  300



>ref|XP_008813437.1| PREDICTED: uncharacterized protein LOC103724064 isoform X2 [Phoenix 
dactylifera]
Length=479

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEFTG DGQKY+LIDTAGIR++A VASSGS TEALSVN+A
Sbjct  277   VGEDRTIVSPISGTTRDAIDTEFTGPDGQKYKLIDTAGIRRRAAVASSGSTTEALSVNRA  336

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQDC+IAERIE+EGKGC++V+NKWDTIP K  Q
Sbjct  337   FRAIRRSDVVALVIEAMACITEQDCRIAERIEREGKGCIIVINKWDTIPNKNQQ  390


 Score =   144 bits (362),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 87/121 (72%), Gaps = 13/121 (11%)
 Frame = -1

Query  931  QDCRK----DREGRQRLPRCCK*VGHN----SNKNQSTATYYEQDVRGKLRVLGWAPIVY  776
            QDCR     +REG+      C  V +      NKNQ T TYYEQDVR KLR+L WAPIVY
Sbjct  359  QDCRIAERIEREGKG-----CIIVINKWDTIPNKNQQTTTYYEQDVREKLRILDWAPIVY  413

Query  775  STAIAGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCT  596
            STA +GHS +KII  A+ V KERSRRL T+ILNQVV+EA+AFK PPR RGGKRGRVYY T
Sbjct  414  STATSGHSAEKIITAASMVHKERSRRLGTSILNQVVQEALAFKPPPRTRGGKRGRVYYST  473

Query  595  Q  593
            Q
Sbjct  474  Q  474



>ref|WP_040929759.1| ribosome-associated GTPase EngA [Prochloron didemni]
Length=453

 Score =   136 bits (343),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 98/150 (65%), Gaps = 2/150 (1%)
 Frame = -1

Query  850  QSTATYYEQD--VRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            + + T YEQ   ++ ++  + WA +++ +A+ G  VDKI+        E  RR++TA++N
Sbjct  302  KDSYTIYEQKKILQHRIYYMDWAEMIFVSALTGKRVDKILDLVDIAAAEHRRRVSTAVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV++ SPP  R GK+G++YY TQ + +PPT   FVND + F E YRRY+++Q R 
Sbjct  362  EVIAEAVSWHSPPTSRQGKQGKIYYGTQVSSQPPTIALFVNDPQRFHENYRRYIDRQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF+GTPIRLLWR ++  E +   ++R T
Sbjct  422  QLGFAGTPIRLLWRGKKVREVEKNNLNRAT  451


 Score =   118 bits (296),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 77/107 (72%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE+R+IVSP+SGTTRDAID   +  + + YRLIDTAGIR+K  V       E  S+N+AF
Sbjct  198   GENRSIVSPISGTTRDAIDMVVSRQE-KTYRLIDTAGIRRKKNVKYGA---EFFSINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             +AIRRSDVV  VI+ +  ITEQD K+A RI  EG+  +VVVNKWD +
Sbjct  254   KAIRRSDVVLFVIDVLDGITEQDLKLAGRIIDEGRAAIVVVNKWDAV  300



>ref|WP_040939429.1| ribosome-associated GTPase EngA [Prochloron didemni]
Length=453

 Score =   136 bits (343),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 98/150 (65%), Gaps = 2/150 (1%)
 Frame = -1

Query  850  QSTATYYEQD--VRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            + + T YEQ   ++ ++  + WA +++ +A+ G  VDKI+        E  RR++TA++N
Sbjct  302  KDSYTIYEQKKILQHRIYYMDWAEMIFVSALTGKRVDKILDLVDIAAAEHRRRVSTAVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV++ SPP  R GK+G++YY TQ + +PPT   FVND + F E YRRY+++Q R 
Sbjct  362  EVIAEAVSWHSPPTSRQGKQGKIYYGTQVSSQPPTIALFVNDPQRFHENYRRYIDRQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF+GTPIRLLWR ++  E +   ++R T
Sbjct  422  QLGFAGTPIRLLWRGKKVREVEKNNLNRAT  451


 Score =   118 bits (296),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 77/107 (72%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE+R+IVSP+SGTTRDAID   +  + + YRLIDTAGIR+K  V       E  S+N+AF
Sbjct  198   GENRSIVSPISGTTRDAIDMVVSRQE-KTYRLIDTAGIRRKKNVKYGA---EFFSINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             +AIRRSDVV  VI+ +  ITEQD K+A RI  EG+  +VVVNKWD +
Sbjct  254   KAIRRSDVVLFVIDVLDGITEQDLKLAGRIIDEGRAAIVVVNKWDAV  300



>ref|WP_018396230.1| ribosome-associated GTPase EngA [filamentous cyanobacterium ESFC-1]
Length=452

 Score =   138 bits (348),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 60/150 (40%), Positives = 99/150 (66%), Gaps = 2/150 (1%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+ ++ +   L WA +++++ + G  VDKII       ++  RR++T+++N
Sbjct  302  KDSYTIYEYEKHIKDRFYFLEWAEMLFTSGLTGKRVDKIIDFVDRAAEQHQRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA+ + SPP  R GK+G++YY TQ + RPP    FVND K F++ YRRY+E+Q R+
Sbjct  362  EVLEEAILWHSPPTTRQGKQGKIYYGTQVSSRPPAIALFVNDPKRFNDNYRRYIERQFRT  421

Query  496  SAGFSGTPIRLLWRSR--RKMEKDGGKVSR  413
            S GF+GTPIR+ WR +  R+ME+   + ++
Sbjct  422  SLGFTGTPIRIFWRGKKAREMERSTNRATK  451


 Score =   115 bits (289),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 77/107 (72%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVSPVSGTTRDAID     +D + YR+IDTAGIR+K  V       E   +N+AF
Sbjct  198   GESRAIVSPVSGTTRDAIDMLVERND-KTYRIIDTAGIRRKKNVEYGA---EFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             +AIRR+DVV +VI+A+  ITEQD K+A R+ +EG+  ++VVNKWD +
Sbjct  254   KAIRRADVVLIVIDAVDGITEQDQKLANRVMEEGRAAVIVVNKWDAV  300



>ref|WP_008234921.1| ribosome-associated GTPase EngA [Richelia intracellularis]
 emb|CCH67844.1| GTP-binding protein EngA [Richelia intracellularis HH01]
Length=345

 Score =   135 bits (339),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 95/150 (63%), Gaps = 2/150 (1%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   Y++ +  +L  + W   ++ +A+ G  VDKI+    +   E  RR++T+++N
Sbjct  196  KDSYTIYDYQKILHQRLHFIEWVENIFISALTGQRVDKILDLVDSAAIEHKRRVSTSVIN  255

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV + SPP  R GK+GR+YY TQ + +PP+   FVNDAK F+E YRRY+E+Q R 
Sbjct  256  EVLNEAVRWHSPPTSRQGKQGRIYYGTQVSSQPPSIALFVNDAKRFNENYRRYIERQFRQ  315

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF GTPIRL WRS++   +D G  +  T
Sbjct  316  QLGFKGTPIRLFWRSKKA--RDIGNANHAT  343


 Score =   119 bits (298),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE R IVSP+SGTTRDAIDT F    G+ Y LIDTAGIRKK  V       E   +N++
Sbjct  91    LGEQRAIVSPISGTTRDAIDT-FIEYQGKNYCLIDTAGIRKKKNVEYG---PEFFGINRS  146

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  ITEQD K+A RI ++G+  ++VVNKWD I
Sbjct  147   FKAIRRADVVLLVIDALDGITEQDQKLAGRIVEDGRAFIIVVNKWDAI  194



>ref|WP_012953913.1| ribosome-associated GTPase EngA [Candidatus Atelocyanobacterium 
thalassa]
 gb|ADB95248.1| ribosome-associated GTPase EngA [Candidatus Atelocyanobacterium 
thalassa isolate ALOHA]
Length=452

 Score =   135 bits (339),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 91/137 (66%), Gaps = 0/137 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   Y+++V  +L  + WA +++ +A +G  ++KI        KE  RR+ T+I+N
Sbjct  302  KDAYTIYSYKKNVMNRLYFMEWANLIFISAKSGQRIEKIFPLVDIAVKEHRRRINTSIIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA+ + SPP  R GK+G++YY TQ + +PPT V FVND K F++ YRRY+E Q R 
Sbjct  362  EVLEEAIRWHSPPTTRQGKQGKIYYGTQVSNQPPTIVLFVNDPKRFNDNYRRYIEGQFRQ  421

Query  496  SAGFSGTPIRLLWRSRR  446
              GFSGTPIRLLW+ ++
Sbjct  422  QIGFSGTPIRLLWKGKK  438


 Score =   119 bits (298),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 78/108 (72%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE R IVSP++GTTRD IDT      G+ YRL+DTAGIR+K  V       E  S+N+A
Sbjct  197   LGEKRAIVSPIAGTTRDVIDT-IVERKGKVYRLVDTAGIRRKKNVEYGA---EFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +TEQD K+A+RI  EG+  ++VVNKWD +
Sbjct  253   FKAIRRADVVLLVIDAIDGVTEQDIKLADRIIDEGRSAIIVVNKWDAV  300



>ref|WP_025952411.1| ribosome-associated GTPase EngA [Prochlorococcus sp. scB243_495P20]
Length=457

 Score =   146 bits (368),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   108 bits (269),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTHIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAVDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>gb|ABE10748.1| GTP-binding protein [uncultured Prochlorococcus marinus clone 
ASNC1092]
Length=457

 Score =   147 bits (370),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTPI LLWR +++
Sbjct  422  NLGFEGTPIILLWRGKQQ  439


 Score =   107 bits (266),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>gb|KDO61269.1| hypothetical protein CISIN_1g005504mg [Citrus sinensis]
Length=549

 Score =   209 bits (533),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEFTG +GQK+RLIDTAGIRK+A +ASSGS TEALSVN+A
Sbjct  392   VGEDRTIVSPISGTTRDAIDTEFTGPEGQKFRLIDTAGIRKRAAIASSGSTTEALSVNRA  451

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQDC+IAERIE+EGKGCL+VVNKWDTIP K  Q
Sbjct  452   FRAIRRSDVVALVIEAMACITEQDCRIAERIEQEGKGCLIVVNKWDTIPNKNQQ  505


 Score = 75.5 bits (184),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 43/69 (62%), Gaps = 3/69 (4%)
 Frame = -1

Query  931  QDCRKDREGRQRLPRCCK*VGH---NSNKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIA  761
            QDCR      Q    C   V       NKNQ TATYYEQDVR KLR L WAPIVYSTAIA
Sbjct  474  QDCRIAERIEQEGKGCLIVVNKWDTIPNKNQQTATYYEQDVREKLRALDWAPIVYSTAIA  533

Query  760  GHSVDKIIV  734
            G SVDK ++
Sbjct  534  GQSVDKYVL  542



>ref|WP_035987429.1| ribosome-associated GTPase EngA [Leptolyngbya sp. KIOST-1]
Length=453

 Score =   128 bits (322),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 59/145 (41%), Positives = 94/145 (65%), Gaps = 4/145 (3%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKII-VTAAAVEKERSRRLTTAIL  680
            K+  T   ++  +  +L  L WA  ++ +A  G  V KI+ +   AVE+ R RR++T+++
Sbjct  302  KDSHTIYDFDHQIAARLNFLDWAKRIFVSAKTGQRVPKILELVDQAVEQHR-RRVSTSVV  360

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ +AV + +PP  R G++GR+YY TQ  +RPP+F  FVND  L  + YRRY+E+Q R
Sbjct  361  NEVLEDAVKWHTPPTTRQGRQGRIYYGTQVTVRPPSFTLFVNDPHLLKDNYRRYVERQFR  420

Query  499  SSAGFSGTPIRLLWRSR--RKMEKD  431
             + GF GTPIR+ WR +  R +E++
Sbjct  421  ENLGFEGTPIRIFWRGKAMRDLERN  445


 Score =   125 bits (313),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 64/109 (59%), Positives = 82/109 (75%), Gaps = 6/109 (6%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQK-YRLIDTAGIRKKATVASSGSITEALSVNQ  1009
             VGE R IVSP+SGTTRDAID +     G+K YRLIDTAGIRKK +V       E   +N+
Sbjct  197   VGEARAIVSPISGTTRDAIDMQV--QHGEKIYRLIDTAGIRKKKSVEYG---PEFFGINR  251

Query  1008  AFRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             AF+AIRR+DVV LVI+A+  +TEQD K+A RIE++G+ C++VVNKWD +
Sbjct  252   AFKAIRRADVVLLVIDALDGVTEQDQKLAGRIEEDGRACVIVVNKWDAV  300



>ref|WP_025971786.1| ribosome-associated GTPase EngA [Prochlorococcus sp. scB241_527L22]
Length=457

 Score =   145 bits (367),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSLVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   107 bits (268),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++GK C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGKACIIVVNKWDLV  300



>ref|WP_021829354.1| ribosome-associated GTPase EngA [Crocosphaera watsonii]
 emb|CCQ49296.1| GTP-binding protein EngA [Crocosphaera watsonii WH 8502]
Length=465

 Score =   132 bits (333),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 97/161 (60%), Gaps = 9/161 (6%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   Y++ V  +L  + WA +++ +A++G  V+KI        +E  RR++T+++
Sbjct  314  DKDSYTIYEYKKKVMSRLYFMEWADLIFVSAMSGKRVEKIFKLVDVAVEEHRRRVSTSVV  373

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ EA  + SPP  R GK+GR+YY TQ + +PPT   FVND K F++ YRRY+E+Q R
Sbjct  374  NEVLEEAAKWHSPPTTRQGKQGRIYYGTQVSSQPPTIALFVNDPKRFNDNYRRYIERQFR  433

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSLERRLEV  377
               GF GTPIRL WR         GK  R+   SL R  +V
Sbjct  434  EQIGFLGTPIRLFWR---------GKKMRDVEPSLNRATKV  465


 Score =   120 bits (302),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 79/108 (73%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +G+ R IVSP+SGTTRDAIDT F     + YRLIDTAGIR+K  V       E  S+N+A
Sbjct  210   LGKKRAIVSPISGTTRDAIDT-FVERGEKTYRLIDTAGIRRKKNVNYGA---EFFSINRA  265

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +T+QD K+A+RI  EGK  ++VVNKWD I
Sbjct  266   FKAIRRADVVLLVIDAIEGVTDQDIKLADRIIDEGKAAIIVVNKWDAI  313



>ref|WP_019504656.1| ribosome-associated GTPase EngA [Pleurocapsa sp. PCC 7319]
Length=453

 Score =   136 bits (343),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 58/151 (38%), Positives = 99/151 (66%), Gaps = 2/151 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   Y++ +  +L  + WA +++ +AI G  + KI+       +E  RR++T+++
Sbjct  301  DKDSGTIYEYKKQIMDRLYFMDWAEMIFVSAITGQRISKILDLVDTAAEEHRRRVSTSVI  360

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ EAV++ SPP  R GK+GR+YY TQ + +PPT   FVND K F++ YRRY+++Q R
Sbjct  361  NEVLEEAVSWHSPPTNRQGKQGRIYYGTQVSTQPPTIALFVNDPKRFNDNYRRYIDRQFR  420

Query  499  SSAGFSGTPIRLLWRSR--RKMEKDGGKVSR  413
               GF+GTP++L+WR +  R +E+   K ++
Sbjct  421  KQLGFTGTPMQLIWRGKKMRDLERGANKATK  451


 Score =   117 bits (292),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 76/107 (71%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R+IVSP+SGTTRDAID   T  D + YRLIDTAGIR+K  V       E  S+N+AF
Sbjct  198   GEQRSIVSPISGTTRDAIDMIVTRGD-RTYRLIDTAGIRRKKNVNYGA---EFFSINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             +AIRRSDVV  VI+ +  +TEQD K+A RI  EG+  ++V+NKWD +
Sbjct  254   KAIRRSDVVLFVIDILDGVTEQDLKLAARIIDEGRATILVLNKWDAV  300



>ref|WP_025943936.1| ribosome-associated GTPase EngA, partial [Prochlorococcus sp. 
scB241_526B22]
Length=407

 Score =   146 bits (369),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  252  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  311

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  312  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  371

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  372  NLGFEGTPLILLWRGKQQ  389


 Score =   107 bits (266),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  148   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  203

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  204   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  250



>gb|ABE11270.1| GTP-binding protein [uncultured Prochlorococcus marinus clone 
HF10-88F10]
Length=457

 Score =   147 bits (372),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   RPPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNRPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   105 bits (263),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNY-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDIV  300



>ref|WP_025944471.1| ribosome-associated GTPase EngA [Prochlorococcus sp. scB241_529C4]
Length=457

 Score =   147 bits (370),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 97/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++++A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFTSALTGKRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   106 bits (265),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAVDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_015142441.1| ribosome-associated GTPase EngA [Pleurocapsa minor]
 gb|AFY76133.1| ribosome-associated GTPase EngA [Pleurocapsa sp. PCC 7327]
Length=452

 Score =   137 bits (346),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 95/143 (66%), Gaps = 0/143 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   Y++ ++ +L  + WA  ++ +A+ G  V+KI+       +E  RR++TA++N
Sbjct  302  KDSYTIYDYQKLIQDRLYFMDWAEKIFVSAMTGQRVNKILDLIDTAAEEHGRRVSTAVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++EA+++ SPP  R GK+GR+YY TQ + +PPT   FVND   F++ YRRY+E Q R 
Sbjct  362  EVLQEAMSWHSPPATRQGKQGRIYYGTQVSTKPPTIALFVNDPDRFNDNYRRYIEGQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDG  428
              GF+GTPIRLLWR ++  E +G
Sbjct  422  QLGFTGTPIRLLWRGKKAREVEG  444


 Score =   115 bits (288),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 74/107 (69%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVSP+SGTTRDAIDT      G+ YRLIDTAGIR+K  V       E   +N+AF
Sbjct  198   GEKRAIVSPISGTTRDAIDTVIE-RKGKNYRLIDTAGIRRKKNVDYG---AEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             +AIRRSDVV  VI+ +  +T+QD K+A RI  +GK  ++VVNKWD +
Sbjct  254   KAIRRSDVVLFVIDVLDGVTDQDLKLAGRIIDDGKAAVIVVNKWDAV  300



>ref|WP_025953462.1| GTPase Der [Prochlorococcus sp. scB243_497N18]
Length=457

 Score =   146 bits (368),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   107 bits (266),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_025931428.1| MULTISPECIES: GTPase Der [Prochlorococcus]
Length=457

 Score =   146 bits (369),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPVILLWRGKQQ  439


 Score =   106 bits (265),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_032515588.1| MULTISPECIES: ribosome-associated GTPase EngA [Prochlorococcus]
 gb|AIQ94452.1| GTP-binding protein EngA [Prochlorococcus sp. MIT 0604]
 gb|KGG01754.1| GTP-binding protein EngA [Prochlorococcus marinus str. MIT 9314]
Length=457

 Score =   146 bits (368),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   107 bits (266),  Expect(2) = 7e-58, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_032517522.1| ribosome-associated GTPase EngA [Prochlorococcus marinus]
 gb|KGG04003.1| GTP-binding protein EngA [Prochlorococcus marinus str. MIT 9321]
 gb|KGG04909.1| GTP-binding protein EngA [Prochlorococcus marinus str. MIT 9322]
 gb|KGG07775.1| GTP-binding protein EngA [Prochlorococcus marinus str. MIT 9401]
Length=457

 Score =   147 bits (370),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFGHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++EA+++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKEAISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   106 bits (264),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LV++A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVVDAVDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_025964619.1| GTPase Der [Prochlorococcus sp. scB243_498P15]
Length=457

 Score =   146 bits (368),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   107 bits (266),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_025929191.1| MULTISPECIES: GTPase Der [Prochlorococcus]
Length=457

 Score =   146 bits (368),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   107 bits (266),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_025945041.1| MULTISPECIES: ribosome-associated GTPase EngA [Prochlorococcus]
Length=457

 Score =   146 bits (368),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   107 bits (266),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_011862416.1| MULTISPECIES: GTPase Der [Prochlorococcus]
 sp|A3PBA9.1|DER_PROM0 RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Prochlorococcus marinus str. MIT 9301]
 gb|ABO17034.1| GTP-binding protein (HSR1-related) [Prochlorococcus marinus str. 
MIT 9301]
Length=457

 Score =   146 bits (368),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   107 bits (266),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_025959358.1| ribosome-associated GTPase EngA [Prochlorococcus sp. scB241_527I9]
Length=457

 Score =   146 bits (368),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   107 bits (266),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_025962830.1| ribosome-associated GTPase EngA [Prochlorococcus sp. scB245a_521O20]
Length=457

 Score =   146 bits (368),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   107 bits (266),  Expect(2) = 8e-58, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_011817902.1| GTPase Der [Prochlorococcus marinus]
 sp|A2BPL9.1|DER_PROMS RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Prochlorococcus marinus str. AS9601]
 gb|ABM69730.1| GTP-binding protein (HSR1-related) [Prochlorococcus marinus str. 
AS9601]
Length=457

 Score =   146 bits (368),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   107 bits (266),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGD-NNWKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD I
Sbjct  254   KSIDRSDVCVLVIDAVDGVTDQDQKLAGRIEEQGRACIIVVNKWDLI  300



>ref|WP_025906324.1| MULTISPECIES: ribosome-associated GTPase EngA [Prochlorococcus]
Length=457

 Score =   146 bits (368),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   106 bits (265),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAVDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_025924200.1| GTPase Der [Prochlorococcus sp. scB243_495L20]
Length=457

 Score =   146 bits (368),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   106 bits (265),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_015204682.1| ribosome-associated GTPase EngA [Crinalium epipsammum]
 gb|AFZ14581.1| GTP-binding protein engA [Crinalium epipsammum PCC 9333]
Length=455

 Score =   133 bits (335),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 96/143 (67%), Gaps = 0/143 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   ++ ++  +L  + WA +++++A+ G  VDKI+       +E  RR++TA++N
Sbjct  302  KDSYTIYEHQANITTRLSFVEWAEVIFTSALTGQRVDKILGLVNTAAEEHKRRVSTAVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA+++ SP   R G++G++YY TQ + +PP+ V FVND + F++ YRRY+EKQ R 
Sbjct  362  EVLEEAISWHSPTVSRQGRQGKIYYGTQVSTQPPSIVLFVNDPQRFNDNYRRYIEKQFRQ  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDG  428
              GF G+PI+L+WR ++  E +G
Sbjct  422  QLGFKGSPIKLMWRGKKVREMEG  444


 Score =   119 bits (298),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 79/107 (74%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE+R+IVSP+SGTTRDAID+     +G  YRLIDTAGIR+K  V      +E   +N+AF
Sbjct  198   GENRSIVSPISGTTRDAIDS-VVERNGTTYRLIDTAGIRRKKNVEYG---SEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             +AIRR+DVV LVI+ +  +T+QD K+A RI +EG+ C+V+ NKWD +
Sbjct  254   KAIRRADVVLLVIDVLDGVTDQDQKLAGRIAEEGRACVVIANKWDAV  300



>ref|WP_032519539.1| ribosome-associated GTPase EngA [Prochlorococcus marinus]
 gb|KGG08144.1| GTP-binding protein EngA [Prochlorococcus marinus str. SB]
Length=457

 Score =   146 bits (368),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 66/138 (48%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+I+N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALYAVNQHRRRVTTSIVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   106 bits (265),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAVDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_025942178.1| MULTISPECIES: GTPase Der [Prochlorococcus]
Length=457

 Score =   146 bits (368),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   106 bits (264),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGD-NNWKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_035826190.1| ribosome-associated GTPase EngA [Crocosphaera watsonii]
Length=452

 Score =   133 bits (334),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 97/161 (60%), Gaps = 9/161 (6%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   Y++ V  +L  + WA +++ +A++G  V+KI        +E  RR++T+++
Sbjct  301  DKDSYTIYEYKKKVMSRLYFMEWADLIFVSAMSGKRVEKIFKLVDVAVEEHRRRVSTSVV  360

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ EA  + SPP  R GK+GR+YY TQ + +PPT   FVND K F++ YRRY+E+Q R
Sbjct  361  NEVLEEAAKWHSPPTTRQGKQGRIYYGTQVSSQPPTIALFVNDPKRFNDNYRRYIERQFR  420

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSLERRLEV  377
               GF GTPIRL WR         GK  R+   SL R  +V
Sbjct  421  EQIGFLGTPIRLFWR---------GKKMRDVEPSLNRATKV  452


 Score =   119 bits (298),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 80/109 (73%), Gaps = 6/109 (6%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQK-YRLIDTAGIRKKATVASSGSITEALSVNQ  1009
             +GE R IVSP+SGTTRDAIDT      G+K YRLIDTAGIR+K  V       E  S+N+
Sbjct  197   LGEKRAIVSPISGTTRDAIDT--VVERGEKTYRLIDTAGIRRKKNVNYGA---EFFSINR  251

Query  1008  AFRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             AF+AIRR+DVV LVI+A+  +T+QD K+A+RI  EG+  ++VVNKWD I
Sbjct  252   AFKAIRRADVVLLVIDAIEGVTDQDIKLADRIIDEGRAAIIVVNKWDAI  300



>ref|XP_001420333.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98626.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=555

 Score =   157 bits (398),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 97/137 (71%), Gaps = 1/137 (1%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   Y  D+R KLRV  +A IVY++A+ G  + KI+  A    +   +RLTTA L
Sbjct  412  DKDTHTMNKYTDDMRLKLRVFEYAEIVYTSALTGQRIQKILDAAQVASENHRKRLTTATL  471

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N VV+EA  +K PP  R  ++G++YY TQA+IRPPTFVFFVND KLF +TYRRYME+QLR
Sbjct  472  NSVVQEATLWKLPPS-RNSRKGKIYYITQASIRPPTFVFFVNDPKLFPDTYRRYMERQLR  530

Query  499  SSAGFSGTPIRLLWRSR  449
             + GF GTPIRLLWR +
Sbjct  531  ENIGFPGTPIRLLWRGK  547


 Score = 94.7 bits (234),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 77/119 (65%), Gaps = 7/119 (6%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDT----EFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSV  1015
             GE R+IVS  SGTTRD+IDT    ++TG   +K+ LIDTAGIR++  V S     E LSV
Sbjct  304   GEARSIVSDFSGTTRDSIDTLVEDKYTG---RKFTLIDTAGIRRRTQVKSGTDGAEKLSV  360

Query  1014  NQAFRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQLQ  838
              +A +A++R+DVV LVI+     ++QD  +AER  +EG   ++ +NKWD +   T+ + 
Sbjct  361   GRALQAMKRADVVVLVIDGTEGPSQQDFVLAERATQEGCAIVLCINKWDLVDKDTHTMN  419



>gb|KGF97332.1| GTP-binding protein EngA [Prochlorococcus marinus str. MIT 9302]
Length=438

 Score =   146 bits (368),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  283  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  342

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  343  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRL  402

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  403  NLGFEGTPLILLWRGKQQ  420


 Score =   106 bits (264),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+ID      D Q ++++DTAGIR+K  V      TE   +N+AF
Sbjct  179   GEKRAIVSDISGTTTDSIDMLIKKGDNQ-WKIVDTAGIRRKKNVKYG---TEFFGINRAF  234

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  235   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  281



>ref|WP_007310476.1| ribosome-associated GTPase EngA [Crocosphaera watsonii]
 gb|EHJ13122.1| GTP-binding protein EngA [Crocosphaera watsonii WH 0003]
 emb|CCQ59300.1| GTP-binding protein EngA [Crocosphaera watsonii WH 0005]
 emb|CCQ65110.1| GTP-binding protein EngA [Crocosphaera watsonii WH 0402]
Length=465

 Score =   133 bits (334),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 97/161 (60%), Gaps = 9/161 (6%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   Y++ V  +L  + WA +++ +A++G  V+KI        +E  RR++T+++
Sbjct  314  DKDSYTIYEYKKKVMSRLYFMEWADLIFVSAMSGKRVEKIFKLVDVAVEEHRRRVSTSVV  373

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ EA  + SPP  R GK+GR+YY TQ + +PPT   FVND K F++ YRRY+E+Q R
Sbjct  374  NEVLEEAAKWHSPPTTRQGKQGRIYYGTQVSSQPPTIALFVNDPKRFNDNYRRYIERQFR  433

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSLERRLEV  377
               GF GTPIRL WR         GK  R+   SL R  +V
Sbjct  434  EQIGFLGTPIRLFWR---------GKKMRDVEPSLNRATKV  465


 Score =   119 bits (298),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 80/109 (73%), Gaps = 6/109 (6%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQK-YRLIDTAGIRKKATVASSGSITEALSVNQ  1009
             +GE R IVSP+SGTTRDAIDT      G+K YRLIDTAGIR+K  V       E  S+N+
Sbjct  210   LGEKRAIVSPISGTTRDAIDT--VVERGEKTYRLIDTAGIRRKKNVNYGA---EFFSINR  264

Query  1008  AFRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             AF+AIRR+DVV LVI+A+  +T+QD K+A+RI  EG+  ++VVNKWD I
Sbjct  265   AFKAIRRADVVLLVIDAIEGVTDQDIKLADRIIDEGRAAIIVVNKWDAI  313



>ref|WP_008190660.1| ribosome-associated GTPase EngA [Moorea producens]
 gb|EGJ28840.1| ribosome-associated GTPase EngA [Moorea producens 3L]
Length=463

 Score =   130 bits (326),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 56/152 (37%), Positives = 97/152 (64%), Gaps = 0/152 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   Y++ V+ +L  + WA I++ +A+ G  V+ I+        +  RR++T+++N
Sbjct  310  KDSYTIYDYQKQVKDRLSFIEWAEIIFVSAMTGKRVETILDLVDTAANQHGRRVSTSVIN  369

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++EAV++ +PP  R G++G++YY TQ   +PPT   FVND K F E YRRY+E+Q R 
Sbjct  370  EVLQEAVSWYTPPTNRQGRQGKIYYGTQVRTKPPTIALFVNDPKRFKENYRRYIERQFRQ  429

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRETST  401
               F+GTP+RLLWR ++  + +  +++   +T
Sbjct  430  QLDFTGTPLRLLWRGKKVRDGEEAQINLNRAT  461


 Score =   122 bits (306),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 79/114 (69%), Gaps = 10/114 (9%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFT-------GSDGQKYRLIDTAGIRKKATVASSGSITEA  1024
             GE+R+IVSP+SGTTRDAID           G++ Q YRLIDTAGIRKK  V       E 
Sbjct  198   GENRSIVSPISGTTRDAIDMVVQRSADPEKGTEAQTYRLIDTAGIRKKKNVTYG---PEF  254

Query  1023  LSVNQAFRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
               +N+AF+AIRRSDVV LVI+A+  +TEQD K+A RI  EG+  ++VVNKWD I
Sbjct  255   FGINRAFKAIRRSDVVLLVIDAIDGVTEQDQKLAGRIADEGRAAVIVVNKWDAI  308



>ref|XP_008813436.1| PREDICTED: uncharacterized protein LOC103724064 isoform X1 [Phoenix 
dactylifera]
Length=587

 Score =   209 bits (531),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/114 (85%), Positives = 108/114 (95%), Gaps = 0/114 (0%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGEDRTIVSP+SGTTRDAIDTEFTG DGQKY+LIDTAGIR++A VASSGS TEALSVN+A
Sbjct  385   VGEDRTIVSPISGTTRDAIDTEFTGPDGQKYKLIDTAGIRRRAAVASSGSTTEALSVNRA  444

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             FRAIRRSDVVALVIEAM+CITEQDC+IAERIE+EGKGC++V+NKWDTIP K  Q
Sbjct  445   FRAIRRSDVVALVIEAMACITEQDCRIAERIEREGKGCIIVINKWDTIPNKNQQ  498


 Score =   144 bits (363),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 87/121 (72%), Gaps = 13/121 (11%)
 Frame = -1

Query  931  QDCRK----DREGRQRLPRCCK*VGHN----SNKNQSTATYYEQDVRGKLRVLGWAPIVY  776
            QDCR     +REG+      C  V +      NKNQ T TYYEQDVR KLR+L WAPIVY
Sbjct  467  QDCRIAERIEREGKG-----CIIVINKWDTIPNKNQQTTTYYEQDVREKLRILDWAPIVY  521

Query  775  STAIAGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCT  596
            STA +GHS +KII  A+ V KERSRRL T+ILNQVV+EA+AFK PPR RGGKRGRVYY T
Sbjct  522  STATSGHSAEKIITAASMVHKERSRRLGTSILNQVVQEALAFKPPPRTRGGKRGRVYYST  581

Query  595  Q  593
            Q
Sbjct  582  Q  582



>ref|WP_025880612.1| GTPase Der [Prochlorococcus sp. scB241_527E14]
Length=457

 Score =   146 bits (368),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   106 bits (264),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNY-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_017302885.1| ribosome-associated GTPase EngA [Spirulina subsalsa]
Length=453

 Score =   132 bits (331),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 90/150 (60%), Gaps = 2/150 (1%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YEQ VR +L    WA  ++ +A+ G  V++I+       +   RR+TTA++N
Sbjct  303  KDSYTIYDYEQQVRDRLYFCDWAETLFISAMTGQRVERILELVDRAAESHQRRVTTAVIN  362

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA+   SPP  R GK+G++YY TQ + RPP    FVND K F+E YRRY+EKQ R 
Sbjct  363  EVLEEALKRHSPPTTRQGKQGKIYYGTQVSTRPPAIALFVNDPKRFNENYRRYIEKQFRQ  422

Query  496  SAGFSGTPIRLLWRSR--RKMEKDGGKVSR  413
               F GTPIR  WR +  R +E+   + ++
Sbjct  423  QLAFPGTPIRFFWRGKKVRDVERSANRATK  452


 Score =   120 bits (300),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 76/107 (71%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVSP+SGTTRD ID      +G  YRLIDTAGIRKK  V       E  S+N+AF
Sbjct  199   GESRAIVSPISGTTRDTIDM-VVERNGTTYRLIDTAGIRKKKNVEYGA---EFFSINRAF  254

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             +AIRRSDVV LVI+A+  +TEQD K+A RI +EG+  +++VNKWD I
Sbjct  255   KAIRRSDVVLLVIDAVDGVTEQDQKLANRIMEEGRAAVIIVNKWDAI  301



>ref|XP_005535285.1| GTP-binding protein of engA family [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM78999.1| GTP-binding protein of engA family [Cyanidioschyzon merolae strain 
10D]
Length=668

 Score =   140 bits (353),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = -1

Query  820  VRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSP  641
            VR +L V+ WA +++ +A  G  + +I+    A   + +RR++TA+LN+V+ EAV +++P
Sbjct  531  VRERLPVIHWADMIFVSAKTGQRIPRILALVDAAAAQHARRVSTAVLNEVLLEAVQWQAP  590

Query  640  PRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLL  461
            P  R G+ G++YYCTQ A++PPT   FVND +LF +TY+RY+E++ R + GF+GTPIRLL
Sbjct  591  PTNRRGQGGKIYYCTQVAVQPPTLALFVNDPELFPDTYKRYLERKFREALGFTGTPIRLL  650

Query  460  WRSRRKMEK  434
            WR+R++  K
Sbjct  651  WRARKRRSK  659


 Score =   111 bits (278),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 78/121 (64%), Gaps = 8/121 (7%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQK-----YRLIDTAGIRKKATVASSGSITEAL  1021
             +GE+R IVS V GTTRDAID      D +      Y LIDTAGIR+K  V      TE  
Sbjct  407   LGEERVIVSAVPGTTRDAIDELLIQRDPRTGRETCYLLIDTAGIRRKKNVEYG---TEFF  463

Query  1020  SVNQAFRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQL  841
              +N+AF+AIRR+DVV LV++    IT+QD ++AERI  EGK C++V NKWD +  K N+L
Sbjct  464   MINRAFKAIRRADVVLLVLDMEEGITDQDAELAERIVDEGKACVIVGNKWDALGRKDNRL  523

Query  840   Q  838
              
Sbjct  524   H  524



>ref|WP_032526702.1| ribosome-associated GTPase EngA [Prochlorococcus marinus]
Length=457

 Score =   145 bits (367),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRL  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   105 bits (263),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+ID      D Q ++++DTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDMLIKKGDNQ-WKIVDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_025960871.1| ribosome-associated GTPase EngA [Prochlorococcus sp. scB245a_519L21]
Length=457

 Score =   145 bits (365),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++K+PP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKNPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   107 bits (266),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_017661046.1| ribosome-associated GTPase EngA [Geitlerinema sp. PCC 7105]
Length=453

 Score =   133 bits (334),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 95/149 (64%), Gaps = 0/149 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   Y++ +  +L  + WA  VY +A  G  V KI+        E  RR+ T+++
Sbjct  301  DKDSHTIYDYDRHLDDRLYYMSWAERVYVSAKTGQRVHKILDLVDVAASEHQRRVATSVI  360

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ EA+A+KSPP  R G++G++YY TQ   +PPT   FVND K F++ YRRY+E+Q+R
Sbjct  361  NEVLEEAIAWKSPPTNRQGRQGKIYYGTQVRTQPPTIALFVNDPKRFNDNYRRYIERQIR  420

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSR  413
               GF+GTP+RL+WR ++  + +   V+R
Sbjct  421  EQLGFTGTPMRLIWRGKKARDVEDRGVNR  449


 Score =   118 bits (296),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 78/108 (72%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VG+ R IVSP+SGTTRD IDT    +D  +YRLIDTAGIRKK  V       E  S+N+A
Sbjct  197   VGQTRAIVSPISGTTRDTIDTLIERND-TRYRLIDTAGIRKKKNVEYGA---EFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +TEQD K+  R+  EG+ C++VVNKWD +
Sbjct  253   FKAIRRADVVLLVIDAIDGVTEQDQKLIGRVVDEGRACVLVVNKWDAV  300



>ref|WP_002807087.1| GTPase Der [Prochlorococcus marinus]
 gb|EEE40425.1| small GTP-binding protein domain [Prochlorococcus marinus str. 
MIT 9202]
Length=457

 Score =   145 bits (367),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRL  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   105 bits (263),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNY-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAVDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_025941350.1| ribosome-associated GTPase EngA [Prochlorococcus sp. scB245a_518O7]
Length=457

 Score =   145 bits (365),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVIQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   107 bits (266),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_035996465.1| ribosome-associated GTPase EngA [Leptolyngbya sp. JSC-1]
Length=453

 Score =   134 bits (337),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 96/150 (64%), Gaps = 2/150 (1%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+ ++ +L    WA  ++ +A  G  V+KI+    +  ++  RR++T+++N
Sbjct  302  KDSHTIYDYERLLKERLHFTDWAETIFVSAHTGQRVEKILDLVDSAAEQHRRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            + + EA+ + +PP  R G++G++YY TQ A +PPT   FVND KLF+E YRRYME+Q R 
Sbjct  362  EALEEALKWHTPPTTRQGRQGKIYYGTQVASQPPTITLFVNDPKLFNENYRRYMERQFRQ  421

Query  496  SAGFSGTPIRLLWRSR--RKMEKDGGKVSR  413
              GF GTPIRL WR +  R++E+   + ++
Sbjct  422  QLGFQGTPIRLFWRGKKVRELEQSANRATK  451


 Score =   117 bits (293),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 77/108 (71%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE R IVSP+SGTTRD ID      D ++YRLIDTAGIRKK  V       E   +N++
Sbjct  197   VGEQRAIVSPISGTTRDTIDMIVERQD-RRYRLIDTAGIRKKKQVEYG---PEFFGINRS  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LV++A+  +TEQD K+A R+  +G+ C++VVNKWD I
Sbjct  253   FKAIRRADVVLLVLDALDGVTEQDQKLAGRVADDGRACVLVVNKWDAI  300



>ref|WP_025926052.1| ribosome-associated GTPase EngA [Prochlorococcus sp. scB241_528J8]
Length=457

 Score =   144 bits (362),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  V+ I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVENIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRL  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   107 bits (267),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 76/107 (71%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+ID  F   D Q ++++DTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDMLFKKDDIQ-WKIVDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_012007226.1| GTPase Der [Prochlorococcus marinus]
 sp|A8G3A3.1|DER_PROM2 RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Prochlorococcus marinus str. MIT 9215]
 gb|ABV50084.1| GTP-binding protein (HSR1-related) [Prochlorococcus marinus str. 
MIT 9215]
Length=457

 Score =   145 bits (367),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRL  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   105 bits (263),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNY-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAVDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_025933176.1| ribosome-associated GTPase EngA [Prochlorococcus sp. scB243_498A3]
Length=457

 Score =   145 bits (365),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+G++YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGKLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   106 bits (265),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDRVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_032513998.1| ribosome-associated GTPase EngA [Prochlorococcus marinus]
 gb|KGF90193.1| GTP-binding protein EngA [Prochlorococcus marinus str. MIT 9107]
 gb|KGF91218.1| GTP-binding protein EngA [Prochlorococcus marinus str. MIT 9116]
 gb|KGF94868.1| GTP-binding protein EngA [Prochlorococcus marinus str. MIT 9123]
Length=457

 Score =   143 bits (361),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 95/138 (69%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  V+ I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVENIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA+++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLTEAISWKSPPTKRSGKQGRLYYGTQVKNQPPTFTLFVNDPKLFGITYRRYIEKQIRL  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   107 bits (268),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 76/107 (71%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D Q ++++DTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNQ-WKIVDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_006529492.1| ribosome-associated GTPase EngA [Gloeocapsa sp. PCC 73106]
 gb|ELR97637.1| ribosome-associated GTPase EngA [Gloeocapsa sp. PCC 73106]
Length=453

 Score =   129 bits (324),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 91/151 (60%), Gaps = 0/151 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   Y + ++ +L  + WA I++ +A  G  V KI         E  RR+TTA++
Sbjct  301  DKDSYTIYEYTKLIKDRLYYMDWAEILFVSAKTGQRVPKIFDLIKTAATEHRRRVTTAVI  360

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V++EA++++SPP  R GK+G++YY TQ    PP    FVND + F+E YRRY+E Q R
Sbjct  361  NEVIQEAISWQSPPTTRQGKQGKIYYGTQVTTAPPAIALFVNDPQRFTENYRRYIEGQFR  420

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
               GF GTPIRL W+ ++  E +    +R T
Sbjct  421  KQLGFIGTPIRLFWKGKKVREAERETANRAT  451


 Score =   122 bits (306),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 78/107 (73%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE+R IVSP+SGTTRDAIDT     DGQ YRLIDTAGIRKK  V       E   +N++F
Sbjct  198   GENRCIVSPISGTTRDAIDT-VIEHDGQVYRLIDTAGIRKKKNVEYG---VEFFGINRSF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             RAI RSDVV LVI+A+  +T+QD K+A R+ +EG+  ++VVNKWD +
Sbjct  254   RAIHRSDVVLLVIDALDEVTDQDLKLAARVIEEGRAVILVVNKWDAV  300



>ref|WP_015185061.1| ribosome-associated GTPase EngA [Microcoleus sp. PCC 7113]
 gb|AFZ20928.1| ribosome-associated GTPase EngA [Microcoleus sp. PCC 7113]
Length=464

 Score =   134 bits (337),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 94/140 (67%), Gaps = 2/140 (1%)
 Frame = -1

Query  850  QSTATYYEQD--VRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            + + T YEQ+  V+ +L  + WA I++ +A  G  V+KI+       +   RR+TT+++N
Sbjct  310  KDSHTIYEQEKLVKDRLSFVDWAEIIFVSAQTGQRVEKILDLVDTAAEGHRRRVTTSVIN  369

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV++ SPP  R G++G++YY TQ A +PPT   FVN+ K F++ YRRY+E+Q R 
Sbjct  370  EVLEEAVSWHSPPTSRQGRQGKIYYGTQVASQPPTIALFVNEPKRFNDNYRRYIERQFRQ  429

Query  496  SAGFSGTPIRLLWRSRRKME  437
              GF+GTPIRLLWR ++  E
Sbjct  430  HLGFTGTPIRLLWRGKKARE  449


 Score =   117 bits (292),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 79/114 (69%), Gaps = 10/114 (9%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAID--TEFTG-----SDGQKYRLIDTAGIRKKATVASSGSITEA  1024
             GE+R IVSP+SGTTRDAID   E  G      + + YRLIDTAGIRKK  V       E 
Sbjct  198   GENRAIVSPISGTTRDAIDMVVERPGKAEKEGESKTYRLIDTAGIRKKKNVDYG---PEF  254

Query  1023  LSVNQAFRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
               +N+AF+AIRRSDVV +VI+A+  +TEQD K+A RI +EG+  ++VVNKWD +
Sbjct  255   FGINRAFKAIRRSDVVLMVIDALDGVTEQDQKLAGRIAEEGRAAVIVVNKWDAV  308



>ref|WP_015124686.1| ribosome-associated GTPase EngA [Synechococcus sp. PCC 6312]
 gb|AFY61143.1| ribosome-associated GTPase EngA [Synechococcus sp. PCC 6312]
Length=445

 Score =   135 bits (340),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 90/138 (65%), Gaps = 2/138 (1%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKII-VTAAAVEKERSRRLTTAIL  680
            K+  T   Y   V  +L  + WA  ++ +A+ G  VDK+      AVE+ R RR++TA++
Sbjct  302  KDTYTINDYRHRVYQRLNFVDWAEAIFVSALTGQRVDKVFDFVNQAVEQHR-RRVSTAVV  360

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+VV++AV   SPP  R G++G+VYY TQ + +PPT   FVND KLF + YRRY+EKQ R
Sbjct  361  NEVVQDAVNGHSPPATRQGRQGKVYYATQVSTQPPTMAIFVNDTKLFKDNYRRYLEKQFR  420

Query  499  SSAGFSGTPIRLLWRSRR  446
               GF GTPIRLLWR ++
Sbjct  421  EQLGFKGTPIRLLWRGKK  438


 Score =   115 bits (289),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 78/108 (72%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +G +R IVSP+SGTTRDAIDT     DGQ YRLIDTAGIR++ +V       E   V++A
Sbjct  197   LGAERAIVSPISGTTRDAIDT-VVERDGQTYRLIDTAGIRRRKSVDYG---PEMFGVHRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AI R+DVV  +++A+  ITEQD ++A  I ++G+ C++VVNKWD +
Sbjct  253   FQAIHRADVVLFILDALEDITEQDQRLAGHIAEQGRACVLVVNKWDAV  300



>gb|ABE10882.1| GTP-binding protein [uncultured Prochlorococcus marinus clone 
ASNC2259]
Length=457

 Score =   146 bits (369),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKKQ  439


 Score =   104 bits (260),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 74/107 (69%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V       E   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYGA---EFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAVDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_025929814.1| ribosome-associated GTPase EngA [Prochlorococcus sp. scB241_528O2]
Length=457

 Score =   143 bits (361),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 63/138 (46%), Positives = 97/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++++A+ G  V+ I   A     +  RR++T+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFTSALTGQRVENIFEHALNAVNQHRRRVSTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQIKNKPPTFTLFVNDPKLFGITYRRYIEKQIRI  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   107 bits (267),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 76/107 (71%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D Q ++++DTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKRGDNQ-WKIVDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_036482751.1| ribosome-associated GTPase EngA [Myxosarcina sp. GI1]
Length=452

 Score =   134 bits (338),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 94/138 (68%), Gaps = 0/138 (0%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   Y++ +  +L  + WA  ++ +A++G  VDKI+       +E  RR++T+++
Sbjct  301  DKDSGTIYEYQRQIMSRLYFMEWAETIFVSALSGKRVDKILDAVDKAYEEYRRRVSTSVI  360

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ +AV++ SPP  R GK+G++YY TQ + +PPT   FVND K F++ YRRY+++Q R
Sbjct  361  NEVLEDAVSWHSPPTSRQGKQGKIYYGTQVSSQPPTIALFVNDPKRFNDNYRRYIDRQFR  420

Query  499  SSAGFSGTPIRLLWRSRR  446
               GF+GTP+RLLWR ++
Sbjct  421  EQLGFTGTPVRLLWRGKK  438


 Score =   116 bits (291),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVSPVSGTTRDAID   T  D + YRLIDTAGIR+K  V       E  S+N+AF
Sbjct  198   GEQRAIVSPVSGTTRDAIDMVVTRQD-KTYRLIDTAGIRRKKNVDYGA---EFFSINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             +AIRR+DVV  V++ +  +TEQD K+A RI  EGK  ++V+NKWD +
Sbjct  254   KAIRRADVVLFVLDVLDGVTEQDLKLAGRIIDEGKATIIVLNKWDAV  300



>ref|WP_042711456.1| ribosome-associated GTPase EngA [Crocosphaera watsonii]
Length=452

 Score =   133 bits (334),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 97/161 (60%), Gaps = 9/161 (6%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   Y++ V  +L  + WA +++ +A++G  V+KI        +E  RR++T+++
Sbjct  301  DKDSYTIYEYKKKVMSRLYFMEWADLIFVSAMSGKRVEKIFKLVDVAVEEHRRRVSTSVV  360

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ EA  + SPP  R GK+GR+YY TQ + +PPT   FVND K F++ YRRY+E+Q R
Sbjct  361  NEVLEEAAKWHSPPTTRQGKQGRIYYGTQVSSQPPTIALFVNDPKRFNDNYRRYIERQFR  420

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSLERRLEV  377
               GF GTPIRL WR         GK  R+   SL R  +V
Sbjct  421  EQIGFLGTPIRLFWR---------GKKMRDVEPSLNRATKV  452


 Score =   117 bits (294),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 80/109 (73%), Gaps = 6/109 (6%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQK-YRLIDTAGIRKKATVASSGSITEALSVNQ  1009
             +G+ R IVSP+SGTTRDAIDT      G+K YRLIDTAGIR+K  V       E  S+N+
Sbjct  197   LGKKRAIVSPISGTTRDAIDT--VVERGEKTYRLIDTAGIRRKKNVNYGA---EFFSINR  251

Query  1008  AFRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             AF+AIRR+DVV LVI+A+  +T+QD K+A+RI  EG+  ++VVNKWD I
Sbjct  252   AFKAIRRADVVLLVIDAIEGVTDQDIKLADRIIDEGRAAIIVVNKWDAI  300



>ref|WP_025955243.1| ribosome-associated GTPase EngA [Prochlorococcus sp. scB243_498I20]
Length=457

 Score =   146 bits (368),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRV  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   104 bits (260),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 74/107 (69%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D   +++IDTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDNH-WKIIDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I R DV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRCDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_015187905.1| ribosome-associated GTPase EngA [Gloeocapsa sp. PCC 7428]
 gb|AFZ30030.1| GTP-binding protein engA [Gloeocapsa sp. PCC 7428]
Length=452

 Score =   130 bits (326),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 96/150 (64%), Gaps = 2/150 (1%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+  + +L  + WA +++ +A  G  V+KI+       +   RR++T+++N
Sbjct  302  KDSYTIYDYEKHTKERLHFVDWAEMIFVSAKTGQRVEKILELVMQAAEAHKRRVSTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +++ EAV + SPP  R G++G++YY TQ + +PP+   FVN+A+ F+  YRRY+E+Q R 
Sbjct  362  EILEEAVRWHSPPTTRQGRQGKIYYGTQVSTQPPSIALFVNEAERFNTNYRRYIERQFRQ  421

Query  496  SAGFSGTPIRLLWRSR--RKMEKDGGKVSR  413
              GF+GTPIRLLWRS+  R +E    + +R
Sbjct  422  QLGFNGTPIRLLWRSKKARDVENTANRATR  451


 Score =   120 bits (301),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 78/108 (72%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VG  R IVSP+SGTTRD+IDT     +G+ YRLIDTAGIRKK  V       E   +N+A
Sbjct  197   VGTQRAIVSPISGTTRDSIDT-VIEREGKVYRLIDTAGIRKKKNVEYG---PEFFGINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +TEQD K+  RI +EG+ C++VVNKWD I
Sbjct  253   FKAIRRADVVLLVIDALDGVTEQDQKLVGRIVEEGRACVIVVNKWDAI  300



>gb|EAM51161.1| Small GTP-binding protein domain:GTP-binding [Crocosphaera watsonii 
WH 8501]
 emb|CCQ63135.1| GTP-binding protein EngA [Crocosphaera watsonii WH 0401]
Length=465

 Score =   132 bits (333),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 97/161 (60%), Gaps = 9/161 (6%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   Y++ V  +L  + WA +++ +A++G  V+KI        +E  RR++T+++
Sbjct  314  DKDSYTIYEYKKKVMSRLYFMEWADLIFVSAMSGKRVEKIFKLVDVAVEEHRRRVSTSVV  373

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ EA  + SPP  R GK+GR+YY TQ + +PPT   FVND K F++ YRRY+E+Q R
Sbjct  374  NEVLEEAAKWHSPPTTRQGKQGRIYYGTQVSSQPPTIALFVNDPKRFNDNYRRYIERQFR  433

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSLERRLEV  377
               GF GTPIRL WR         GK  R+   SL R  +V
Sbjct  434  EQIGFLGTPIRLFWR---------GKKMRDVEPSLNRATKV  465


 Score =   117 bits (293),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 62/109 (57%), Positives = 80/109 (73%), Gaps = 6/109 (6%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQK-YRLIDTAGIRKKATVASSGSITEALSVNQ  1009
             +G+ R IVSP+SGTTRDAIDT      G+K YRLIDTAGIR+K  V       E  S+N+
Sbjct  210   LGKKRAIVSPISGTTRDAIDT--VVERGEKTYRLIDTAGIRRKKNVNYGA---EFFSINR  264

Query  1008  AFRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             AF+AIRR+DVV LVI+A+  +T+QD K+A+RI  EG+  ++VVNKWD I
Sbjct  265   AFKAIRRADVVLLVIDAIEGVTDQDIKLADRIIDEGRAAIIVVNKWDAI  313



>ref|WP_025914220.1| ribosome-associated GTPase EngA [Prochlorococcus sp. scB245a_520K10]
Length=457

 Score =   146 bits (368),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 65/138 (47%), Positives = 96/138 (70%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+TT+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALNAVNQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKSKPPTFTLFVNDPKLFGITYRRYIEKQIRL  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   104 bits (259),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 75/107 (70%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+ID      D Q ++++DTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDMLIKKDDIQ-WKIVDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++VVNKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVVNKWDLV  300



>ref|WP_011375948.1| GTPase Der [Prochlorococcus marinus]
 sp|Q31CE7.1|DER_PROM9 RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Prochlorococcus marinus str. MIT 9312]
 gb|ABB49448.1| Small GTP-binding protein domain [Prochlorococcus marinus str. 
MIT 9312]
 gb|KGG00773.1| GTP-binding protein EngA [Prochlorococcus marinus str. MIT 9311]
Length=457

 Score =   144 bits (362),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 64/138 (46%), Positives = 95/138 (69%), Gaps = 0/138 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            KN ST    E+++R KL  L W+ +++ +A+ G  VD I   A     +  RR+ T+++N
Sbjct  302  KNSSTIYQVEKELRSKLYFLHWSKMIFISALTGQRVDNIFEHALKAVNQHRRRVATSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++E++++KSPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ+R 
Sbjct  362  EVLKESISWKSPPTKRSGKQGRLYYGTQVKNKPPTFTLFVNDPKLFGITYRRYIEKQIRL  421

Query  496  SAGFSGTPIRLLWRSRRK  443
            + GF GTP+ LLWR +++
Sbjct  422  NLGFEGTPLILLWRGKQQ  439


 Score =   106 bits (265),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 76/107 (71%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVS +SGTT D+IDT     D Q ++++DTAGIR+K  V      TE   +N+AF
Sbjct  198   GEKRAIVSDISGTTTDSIDTLIKKGDTQ-WKIVDTAGIRRKKNVKYG---TEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             ++I RSDV  LVI+A+  +T+QD K+A RIE++G+ C++V+NKWD +
Sbjct  254   KSIDRSDVCVLVIDAIDGVTDQDQKLAGRIEEQGRACIIVINKWDLV  300



>ref|WP_006105990.1| ribosome-associated GTPase EngA [Coleofasciculus chthonoplastes]
 gb|EDX71079.1| GTPase, putative [Coleofasciculus chthonoplastes PCC 7420]
Length=461

 Score =   139 bits (351),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 97/148 (66%), Gaps = 0/148 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   YE+ ++ +L  + WAP+++ +A+ G  VDKI+     V  E  RR++T+++N
Sbjct  310  KDTYTIYEYEKLLKNRLYFVEWAPMIFVSALTGKRVDKILDLVDTVAAEHQRRVSTSVIN  369

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EA+ + SPP  R G++G++YY TQ   +PPT   FVND K F+E YRRY+E+Q R 
Sbjct  370  EVLAEAINWHSPPTNRQGRQGKIYYGTQVKSKPPTIALFVNDPKRFNENYRRYIERQFRQ  429

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSR  413
              GF+GTP+RLLWR ++  + +    +R
Sbjct  430  QLGFTGTPLRLLWRGKKVRDVESSNANR  457


 Score =   110 bits (274),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 76/114 (67%), Gaps = 10/114 (9%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAID-------TEFTGSDGQKYRLIDTAGIRKKATVASSGSITEA  1024
             GE R IVS VSGTTRDAID          T ++ Q YRLIDTAGIR+K  V       E 
Sbjct  198   GEKRAIVSSVSGTTRDAIDMIVERPGNPETETESQLYRLIDTAGIRRKKNVEYG---PEF  254

Query  1023  LSVNQAFRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
               +N+AF+AIRR+DVV  V++A+  +TEQD K+A RI ++G+  +++VNKWD I
Sbjct  255   FGINRAFKAIRRADVVLFVVDALDGVTEQDQKLAGRIAEDGRAAVILVNKWDAI  308



>ref|WP_012627022.1| GTPase Der [Cyanothece sp. PCC 7425]
 sp|B8HQE1.1|DER_CYAP4 RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Cyanothece sp. PCC 7425]
 gb|ACL43931.1| small GTP-binding protein [Cyanothece sp. PCC 7425]
Length=453

 Score =   127 bits (319),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 90/145 (62%), Gaps = 2/145 (1%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   Y+  V  +L  +GW+  ++ +A  G  V+KI        ++  RR++T+++N
Sbjct  303  KDSYTIYDYQHQVEQRLNFIGWSDHIFISAATGQRVEKIFERVHLAAEQHRRRVSTSVIN  362

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ +AV + SPP  R G++G++YY TQ + +PPT   FVND  LF + YR+Y+E Q R 
Sbjct  363  EVLEDAVGWHSPPASRQGRQGKIYYGTQVSSQPPTIALFVNDPALFKDNYRKYIEGQFRK  422

Query  496  SAGFSGTPIRLLWRSR--RKMEKDG  428
              GF GTPIRLLWR +  R+ E+ G
Sbjct  423  QLGFRGTPIRLLWRGKKVREAERKG  447


 Score =   122 bits (307),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 79/108 (73%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE R IVSP+SGTTRDAIDT     DGQ+YRLIDTAGIRK+  V       E   +N+A
Sbjct  198   VGEQRAIVSPISGTTRDAIDT-LVERDGQRYRLIDTAGIRKQKNVDYG---PEFFGINRA  253

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AI+R++VV LV++A+  +TEQD K+A RI  EG  C++VVNKWD +
Sbjct  254   FKAIQRAEVVLLVLDALDGVTEQDQKLAGRIVDEGCACVIVVNKWDAV  301



>ref|WP_008275747.1| ribosome-associated GTPase EngA [Cyanothece sp. CCY0110]
 gb|EAZ91137.1| GTP-binding protein EngA [Cyanothece sp. CCY0110]
Length=452

 Score =   134 bits (336),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 67/160 (42%), Positives = 96/160 (60%), Gaps = 9/160 (6%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   Y+Q V  +L  + WA I++ +A++G  V+ I        +E  RR+ T+++N
Sbjct  302  KDSYTIYEYKQRVMDRLYFMEWADIIFVSAMSGKRVENIFELVDLAVEEHRRRVNTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV + SPP  R GK+GR+YY TQ + +PPT   FVND K F++ Y+RY+E+Q R 
Sbjct  362  EVLEEAVKWHSPPTSRQGKQGRIYYGTQVSSQPPTITLFVNDPKRFNDNYKRYIERQFRE  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSLERRLEV  377
              GF GTPIRLLWR         GK  R+   SL R  +V
Sbjct  422  QIGFPGTPIRLLWR---------GKKMRDIEPSLNRATKV  452


 Score =   115 bits (289),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 77/108 (71%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE R IVSP+SGTTRD IDT     +   YRLIDTAGIR+K  V       E  S+N+A
Sbjct  197   LGEQRAIVSPISGTTRDTIDTVVERGE-NTYRLIDTAGIRRKKNVNYGA---EFFSINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRR+DVV LVI+A+  +T+QD K+A+RI  EG+  ++VVNKWD +
Sbjct  253   FKAIRRADVVLLVIDAIDGVTDQDIKLADRIIDEGRAAIIVVNKWDAV  300



>ref|WP_017327927.1| ribosome-associated GTPase EngA [Synechococcus sp. PCC 7336]
Length=453

 Score =   129 bits (325),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 93/151 (62%), Gaps = 0/151 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   Y + VR +L  + WA I++++A+ G  V+KI   A    +   RR++T+++N
Sbjct  302  KDSQTIYDYTRYVRERLYFVEWASIIFTSALTGQRVNKIFELAERAAESHRRRVSTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ E   + SPP  R GK+G++YY TQ +++PPTF  FVN   LF + YRRY+EKQ R 
Sbjct  362  EVLEETAMWHSPPTNRQGKQGKIYYGTQVSVQPPTFALFVNQPGLFKDNYRRYVEKQFRK  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRETS  404
               F GTPIR +WR + +   + G++  E S
Sbjct  422  VLSFDGTPIRFVWRGKTERSAERGRLKLEQS  452


 Score =   119 bits (299),  Expect(2) = 9e-57, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 78/107 (73%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE RTIVS V+GTTRDAIDT+    +G++YR IDTAGIRKK+ V       E  S+N+AF
Sbjct  198   GEQRTIVSDVAGTTRDAIDTQVE-HEGKRYRFIDTAGIRKKSRVDYG---VEFFSINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             +AI+RSDVV  VI+ +  I EQD K+A RI  EG+ C+VVVNKWD +
Sbjct  254   KAIQRSDVVLFVIDTLDGIGEQDQKLAGRIADEGRACVVVVNKWDAV  300



>ref|WP_015162474.1| ribosome-associated GTPase EngA [Chamaesiphon minutus]
 gb|AFY96391.1| ribosome-associated GTPase EngA [Chamaesiphon minutus PCC 6605]
Length=452

 Score =   127 bits (318),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 94/143 (66%), Gaps = 2/143 (1%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKII-VTAAAVEKERSRRLTTAIL  680
            K+  T   Y++ +  +L    WA  ++ +A+ G  VDKI+ +   AVE+ R RR++TA++
Sbjct  301  KDSYTIYDYQEQLNSRLNFTEWAENIFVSALTGQRVDKILEIVDRAVEQHR-RRVSTAVI  359

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N+V+ E+  + +P   R GK+G++YY TQ + +PPT   FVND   F++ YRRY+E Q R
Sbjct  360  NEVLEESTTWHNPLVTRQGKQGKIYYGTQVSSQPPTIALFVNDPSRFNDNYRRYIENQFR  419

Query  499  SSAGFSGTPIRLLWRSRRKMEKD  431
            +  GF+GTP+RLLWR +++ E +
Sbjct  420  TQLGFAGTPLRLLWRGKKQREGE  442


 Score =   121 bits (303),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 61/108 (56%), Positives = 79/108 (73%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             +GE+R+IVSP+SGTTRDAIDT  T  +G  YRLIDTAGIR+K  V       E   +N+A
Sbjct  196   LGENRSIVSPISGTTRDAIDTVIT-RNGANYRLIDTAGIRRKKNVDYG---PEFFGINRA  251

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AI R DVV LV+ A+  +TEQD K+A RI +EG+ C++VVNKWD +
Sbjct  252   FKAIDRCDVVLLVLNAVDGVTEQDQKLAGRISEEGRACVIVVNKWDAV  299



>ref|XP_007213298.1| hypothetical protein PRUPE_ppb024253mg [Prunus persica]
 gb|EMJ14497.1| hypothetical protein PRUPE_ppb024253mg [Prunus persica]
Length=143

 Score =   193 bits (490),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 110/127 (87%), Gaps = 3/127 (2%)
 Frame = -1

Query  745  KIIVTAAAVEKERSRRLTTAILNQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFV  566
            +II+ A+ VEKERSRRL+T+++NQVV+EA+AFKSPPR RGGKRGR+YYCTQAAIRPPTFV
Sbjct  16   RIIIAASTVEKERSRRLSTSVVNQVVQEALAFKSPPRTRGGKRGRIYYCTQAAIRPPTFV  75

Query  565  FFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIRLLWRSRRKMEKDGGKVSRETSTSL---  395
            FFVNDAKLF ETYRRYMEKQLRS AGF GTPIRLLW +RRK EK+ G+ +  T  +L   
Sbjct  76   FFVNDAKLFPETYRRYMEKQLRSDAGFLGTPIRLLWSNRRKTEKEEGRAATRTQANLVPR  135

Query  394  ERRLEVA  374
            +R+LE+A
Sbjct  136  DRKLELA  142



>ref|WP_010872829.1| GTPase Der [Synechocystis sp. PCC 6803]
 sp|P74120.1|DER_SYNY3 RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Synechocystis sp. PCC 6803 substr. Kazusa]
 dbj|BAA18206.1| slr1974 [Synechocystis sp. PCC 6803]
 dbj|BAK50379.1| slr1974 [Synechocystis sp. PCC 6803]
 dbj|BAL29378.1| slr1974 [Synechocystis sp. PCC 6803 substr. GT-I]
 dbj|BAL32547.1| slr1974 [Synechocystis sp. PCC 6803 substr. PCC-N]
 dbj|BAL35716.1| slr1974 [Synechocystis sp. PCC 6803 substr. PCC-P]
 dbj|BAM55084.1| GTP-binding protein EngA [Bacillus subtilis BEST7613]
 gb|AGF51894.1| hypothetical protein MYO_116460 [Synechocystis sp. PCC 6803]
Length=452

 Score =   130 bits (327),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 90/145 (62%), Gaps = 0/145 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   + + +  +L  + WA +++ +A  G  V KI+       +E  RR+TTA++N
Sbjct  302  KDSYTIYEHREQLMARLYFMDWAEMIFVSAQTGLRVQKILDCVDIAAQEHRRRVTTAVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV++ SPP  R GK+G++YY TQ + +PP    FVND   F++ YRRY+EKQ R 
Sbjct  362  EVLEEAVSWHSPPTTRQGKQGKIYYGTQVSTQPPAIALFVNDPNRFNDNYRRYIEKQFRK  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGK  422
              GF G+PIRL WR ++  E +G +
Sbjct  422  QLGFFGSPIRLFWRGKKVREMEGSR  446


 Score =   116 bits (291),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 76/107 (71%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVSP+SGTTRDAID      +GQKYRLIDTAGIR+K  V       E   +N+AF
Sbjct  198   GEQRAIVSPISGTTRDAIDM-VVERNGQKYRLIDTAGIRRKKNVDYG---AEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             +AIRR+DVV  V++ +  +TEQD K+A RI ++G+  ++V+NKWD +
Sbjct  254   KAIRRADVVLFVLDVLDGVTEQDLKLAGRIIEDGRAVVLVINKWDAV  300



>ref|WP_028949233.1| ribosome-associated GTPase EngA [Synechocystis sp. PCC 6714]
 gb|AIE73224.1| GTP-binding protein EngA [Synechocystis sp. PCC 6714]
Length=452

 Score =   129 bits (325),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 89/145 (61%), Gaps = 0/145 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   + + +  +L  + WA +++ +A  G  V KI+       +E  RR+TTA++N
Sbjct  302  KDSYTIYDHREQLMARLYFMDWAEMIFVSAQTGLRVQKILDCVDIAAQEHRRRVTTAVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV + SPP  R GK+G++YY TQ + +PP    FVND   F++ YRRY+EKQ R 
Sbjct  362  EVLEEAVGWHSPPTTRQGKQGKIYYGTQVSTQPPAIALFVNDPNRFNDNYRRYIEKQFRK  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGK  422
              GF G+PIRL WR ++  E +G +
Sbjct  422  QLGFFGSPIRLFWRGKKVREVEGNR  446


 Score =   116 bits (291),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 76/107 (71%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE R IVSP+SGTTRDAID      +GQKYRLIDTAGIR+K  V       E   +N+AF
Sbjct  198   GEQRAIVSPISGTTRDAIDM-VVERNGQKYRLIDTAGIRRKKNVDYG---AEFFGINRAF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             +AIRR+DVV  V++ +  +TEQD K+A RI ++G+  ++V+NKWD +
Sbjct  254   KAIRRADVVLFVLDVLDGVTEQDLKLAGRIIEDGRAVVLVINKWDAV  300



>ref|XP_005713928.1| unnamed protein product [Chondrus crispus]
 emb|CDF34109.1| unnamed protein product [Chondrus crispus]
Length=523

 Score =   130 bits (327),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 86/128 (67%), Gaps = 2/128 (2%)
 Frame = -1

Query  823  DVRGKLRVLGWAPIVYSTAIAGHSVDKII-VTAAAVEKERSRRLTTAILNQVVREAVAFK  647
            DV+ +   + WAP+   + +    + KII +   A+E+ R RR++TA+LN+++REAV + 
Sbjct  392  DVKDRTVCIPWAPVELVSVLEKKRIGKIIGLVEEALEQHR-RRVSTAVLNEILREAVEWH  450

Query  646  SPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRSSAGFSGTPIR  467
             PP  +  ++GR+YYCTQ A RPPT   FVN+ +LF E YRRYME Q R S GF GTPIR
Sbjct  451  KPPATKTARQGRIYYCTQVASRPPTIAMFVNEPRLFHENYRRYMEGQFRKSLGFQGTPIR  510

Query  466  LLWRSRRK  443
            L+WR + +
Sbjct  511  LVWRGKSR  518


 Score =   115 bits (287),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 61/113 (54%), Positives = 82/113 (73%), Gaps = 5/113 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             GE+R IVS + GTTRDA+D E    +G++YRLIDTAGIR++  V      TE   +N+AF
Sbjct  277   GENRAIVSEIPGTTRDAVD-EIITVNGKQYRLIDTAGIRRRTAVTFG---TEFFMINRAF  332

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTNQ  844
             +AIRR+DVV L+++ +S  +EQD KIA+RI  EGKGC+V+ NKWD I  K N+
Sbjct  333   KAIRRADVVLLMLD-VSEASEQDRKIADRIAAEGKGCIVLANKWDLITEKDNR  384



>ref|WP_022605295.1| ribosome-associated GTPase EngA [Rubidibacter lacunae]
 gb|ERN42321.1| ribosome-associated GTPase EngA [Rubidibacter lacunae KORDI 51-2]
Length=454

 Score =   132 bits (332),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 58/150 (39%), Positives = 96/150 (64%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+ +T   +E+++R +L  + WA  ++++A +G  V KI+        E  RR++TA +N
Sbjct  303  KDSNTIYTFEREIRARLHFMDWAEAIFASAQSGQRVGKILDLVDVAAAEHRRRVSTATIN  362

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++EA ++ +PP  R G++G++YY TQ + +PPT   FVND   F + YRRY+E+Q R 
Sbjct  363  EVLQEATSWYTPPTNRQGRQGKIYYGTQVSSQPPTIALFVNDPLRFKDDYRRYIERQFRE  422

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
              GF+GTP+RL+WR +R  E +    +R T
Sbjct  423  QLGFTGTPLRLIWRGKRAREAEPSSANRAT  452


 Score =   111 bits (277),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 77/112 (69%), Gaps = 4/112 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             G  R IVSP+SGTTRDA+D      +GQ YR+IDTAGIRKK  V       E   V +AF
Sbjct  199   GMTRAIVSPISGTTRDAVDWTVE-RNGQSYRIIDTAGIRKKKNVDYG---PEFFGVGRAF  254

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTIPTKTN  847
             +AIRR+DVV LV++A+  +T+QD K+A RI+ +G+  ++V+NKWD I   +N
Sbjct  255   KAIRRADVVLLVLDAIDGVTDQDLKLAGRIKDDGRAAVLVLNKWDAIEKDSN  306



>ref|WP_019475241.1| ribosome-associated GTPase EngA [Prochlorococcus sp. W2]
Length=457

 Score =   139 bits (350),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 97/151 (64%), Gaps = 2/151 (1%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+ ST    E+  R KL  L W+ +++ +A  G  V+ I   A +   +  RR+TT+++N
Sbjct  302  KDSSTIYSAEKKFRSKLYFLNWSKMIFISASTGKRVNDIFENAKSAIDQHRRRVTTSVVN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V++EA+ ++SPP  R GK+GR+YY TQ   +PPTF  FVND KLF  TYRRY+EKQ R 
Sbjct  362  EVIKEAITWRSPPTKRSGKQGRIYYGTQIKNQPPTFSLFVNDPKLFGSTYRRYIEKQFRM  421

Query  496  SAGFSGTPIRLLWR--SRRKMEKDGGKVSRE  410
            + GF GTP+  LWR   RR +++D  K + E
Sbjct  422  NLGFEGTPLIFLWRGKQRRSLDRDISKNNIE  452


 Score =   104 bits (259),  Expect(2) = 5e-55, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 74/107 (69%), Gaps = 4/107 (4%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQAF  1003
             G  R IVS +SGTT D+IDT     D + +++IDTAGIR+K  V      TE   +N++F
Sbjct  198   GNKRAIVSNISGTTTDSIDTYIKKED-KFWKIIDTAGIRRKKNVKYG---TEFFGINRSF  253

Query  1002  RAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             +AI RSD+  LV++A   +TEQD K+A RIE++GK CL+V+NKWD I
Sbjct  254   KAIDRSDICLLVLDAEDGVTEQDQKLAGRIEEQGKSCLIVINKWDLI  300



>ref|WP_010476306.1| GTPase Der [Acaryochloris sp. CCMEE 5410]
Length=453

 Score =   127 bits (318),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 95/150 (63%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   + + +R +L  + WA +++ +A  G  V+KI+       ++  +R+TT+++N
Sbjct  302  KDTYTINEFSKQIRSRLNFMEWAEMIFVSAQTGQRVEKILNLVDTAARQFEQRVTTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV++ +PP  R G++G++YY TQ + +PPT   FVN+   F + YRRY+E+Q R 
Sbjct  362  EVLEEAVSWHTPPTTRQGRQGKIYYGTQVSSQPPTIALFVNNPDHFKDNYRRYIERQFRE  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
            +  F+GTPIRLLWR ++  + +    +R T
Sbjct  422  NLDFTGTPIRLLWRGKKLRDVERNTANRAT  451


 Score =   115 bits (287),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 76/108 (70%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R+IVSP+SGTTRD ID      + Q YR IDTAGIR+K  V+      E   +N+A
Sbjct  197   VGENRSIVSPISGTTRDTIDMVVRRGE-QAYRFIDTAGIRRKKNVSYG---PEFFGINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRRS VV  VI+A+  +TEQD K+A RI  +G+ C++VVNKWD +
Sbjct  253   FKAIRRSQVVLFVIDALDGVTEQDQKLAGRIIDDGRACVLVVNKWDAV  300



>ref|WP_012166078.1| GTPase Der [Acaryochloris marina]
 sp|B0C1P2.1|DER_ACAM1 RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Acaryochloris marina MBIC11017]
 gb|ABW30876.1| GTP-binding protein engA [Acaryochloris marina MBIC11017]
Length=453

 Score =   127 bits (319),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 95/150 (63%), Gaps = 0/150 (0%)
 Frame = -1

Query  856  KNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAILN  677
            K+  T   + + +R +L  + WA +++ +A  G  V+KI+       ++  +R+TT+++N
Sbjct  302  KDTYTINEFSKQIRSRLNFMEWAEMIFVSAQTGQRVEKILNLVDTAARQFEQRVTTSVIN  361

Query  676  QVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLRS  497
            +V+ EAV++ +PP  R G++G++YY TQ + +PPT   FVN+   F + YRRY+E+Q R 
Sbjct  362  EVLEEAVSWHTPPTTRQGRQGKIYYGTQVSSQPPTIALFVNNPDHFKDNYRRYIERQFRE  421

Query  496  SAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
            +  F+GTPIRLLWR ++  + +    +R T
Sbjct  422  NLDFTGTPIRLLWRGKKLRDVERNTANRAT  451


 Score =   115 bits (287),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 76/108 (70%), Gaps = 4/108 (4%)
 Frame = -2

Query  1185  VGEDRTIVSPVSGTTRDAIDTEFTGSDGQKYRLIDTAGIRKKATVASSGSITEALSVNQA  1006
             VGE+R+IVSP+SGTTRD ID      + Q YR IDTAGIR+K  V+      E   +N+A
Sbjct  197   VGENRSIVSPISGTTRDTIDMVVRRGE-QTYRFIDTAGIRRKKNVSYG---PEFFGINRA  252

Query  1005  FRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
             F+AIRRS VV  VI+A+  +TEQD K+A RI  +G+ C++VVNKWD +
Sbjct  253   FKAIRRSQVVLFVIDALDGVTEQDQKLAGRIIDDGRACVLVVNKWDAV  300



>ref|XP_007509383.1| GTP-binding protein EngA [Bathycoccus prasinos]
 emb|CCO19186.1| GTP-binding protein EngA [Bathycoccus prasinos]
Length=816

 Score =   162 bits (410),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 78/151 (52%), Positives = 103/151 (68%), Gaps = 5/151 (3%)
 Frame = -1

Query  859  NKNQSTATYYEQDVRGKLRVLGWAPIVYSTAIAGHSVDKIIVTAAAVEKERSRRLTTAIL  680
            +K+  T   Y  D+R KLRV  WA I+Y++A+ G  + KI+  +        +RLTTA L
Sbjct  660  DKDTYTMNSYTDDLRSKLRVFEWASIIYTSALTGQRITKILDASYEASVIHKKRLTTATL  719

Query  679  NQVVREAVAFKSPPRIRGGKRGRVYYCTQAAIRPPTFVFFVNDAKLFSETYRRYMEKQLR  500
            N VV+EA  +K+PP  +  K+GR+YY TQAAIRPPTFVFF ND KLFS+TY+R+ME+QLR
Sbjct  720  NAVVQEATLWKAPP-AKANKKGRIYYTTQAAIRPPTFVFFCNDPKLFSDTYKRFMERQLR  778

Query  499  SSAGFSGTPIRLLWRSRRKMEKDGGKVSRET  407
             + GF GTPIRLLWR + K    GG ++  T
Sbjct  779  KNIGFDGTPIRLLWRGKSK----GGGLANAT  805


 Score = 79.0 bits (193),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 49/118 (42%), Positives = 71/118 (60%), Gaps = 11/118 (9%)
 Frame = -2

Query  1182  GEDRTIVSPVSGTTRDAIDTEFTGSDG--QKYRLIDTAGIRKKATVA-SSGSIT------  1030
             G  R+IVS  SGTTRD IDT+    +   +++ LIDTAGIR++  +   S SI       
Sbjct  542   GTPRSIVSDFSGTTRDTIDTDVVDKNHPDREFTLIDTAGIRRRTQIKRDSKSIKGEEKKF  601

Query  1029  --EALSVNQAFRAIRRSDVVALVIEAMSCITEQDCKIAERIEKEGKGCLVVVNKWDTI  862
               E  S+ +A +A++R+DVV LVI+A    T+QD  +AER  +EG   ++  NKWD +
Sbjct  602   GLEQQSIGRALQAMKRADVVVLVIDATEGATQQDFVLAERAVQEGCALVLCCNKWDLV  659



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3273291830007