BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2995

Length=795
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009800228.1|  PREDICTED: protein transport protein SEC23         352   4e-112   Nicotiana sylvestris
ref|XP_009629158.1|  PREDICTED: protein transport protein SEC23         351   1e-111   Nicotiana tomentosiformis
ref|XP_006354587.1|  PREDICTED: protein transport protein SEC23-like    350   3e-111   Solanum tuberosum [potatoes]
emb|CDP09314.1|  unnamed protein product                                348   8e-111   Coffea canephora [robusta coffee]
ref|XP_004229519.1|  PREDICTED: protein transport protein SEC23         346   6e-110   Solanum lycopersicum
ref|XP_008375667.1|  PREDICTED: protein transport protein SEC23-like    323   4e-108   
ref|XP_004145019.2|  PREDICTED: protein transport protein SEC23         333   9e-105   Cucumis sativus [cucumbers]
ref|XP_006445524.1|  hypothetical protein CICLE_v10019144mg             330   2e-104   
ref|XP_002526529.1|  protein transport protein sec23, putative          332   2e-104   Ricinus communis
ref|XP_007011443.1|  Sec23/Sec24 protein transport family protein...    332   2e-104   Theobroma cacao [chocolate]
ref|XP_011093425.1|  PREDICTED: protein transport protein SEC23 i...    332   3e-104   Sesamum indicum [beniseed]
gb|KJB72952.1|  hypothetical protein B456_011G205900                    331   3e-104   Gossypium raimondii
ref|XP_006464334.1|  PREDICTED: protein transport protein SEC23-like    330   9e-104   Citrus sinensis [apfelsine]
ref|XP_008460075.1|  PREDICTED: protein transport protein SEC23         330   1e-103   Cucumis melo [Oriental melon]
ref|XP_010939452.1|  PREDICTED: protein transport protein SEC23 i...    329   2e-103   Elaeis guineensis
ref|XP_004307298.1|  PREDICTED: protein transport protein SEC23         329   2e-103   Fragaria vesca subsp. vesca
ref|XP_010052697.1|  PREDICTED: protein transport protein SEC23         329   2e-103   Eucalyptus grandis [rose gum]
ref|XP_009361354.1|  PREDICTED: protein transport protein SEC23-like    329   3e-103   Pyrus x bretschneideri [bai li]
ref|XP_009376310.1|  PREDICTED: protein transport protein SEC23-like    328   4e-103   Pyrus x bretschneideri [bai li]
gb|KJB78638.1|  hypothetical protein B456_013G010400                    328   5e-103   Gossypium raimondii
ref|XP_008344985.1|  PREDICTED: protein transport protein SEC23         328   5e-103   
ref|XP_012087535.1|  PREDICTED: protein transport protein SEC23         328   5e-103   Jatropha curcas
gb|KJB78634.1|  hypothetical protein B456_013G010400                    328   6e-103   Gossypium raimondii
gb|EEC83731.1|  hypothetical protein OsI_29579                          320   8e-103   Oryza sativa Indica Group [Indian rice]
ref|XP_008232223.1|  PREDICTED: protein transport protein SEC23         327   9e-103   Prunus mume [ume]
gb|KHG07260.1|  Protein transport SEC23                                 327   9e-103   Gossypium arboreum [tree cotton]
ref|XP_007011442.1|  Sec23/Sec24 protein transport family protein...    332   1e-102   
ref|XP_007220245.1|  hypothetical protein PRUPE_ppa001813mg             327   1e-102   Prunus persica
ref|XP_011010741.1|  PREDICTED: protein transport protein SEC23-like    327   1e-102   Populus euphratica
ref|XP_010097714.1|  Protein transport protein SEC23                    327   1e-102   
ref|XP_006375610.1|  hypothetical protein POPTR_0014s17660g             327   2e-102   Populus trichocarpa [western balsam poplar]
ref|XP_002320574.1|  transport family protein                           327   2e-102   
gb|EYU42283.1|  hypothetical protein MIMGU_mgv1a001723mg                325   8e-102   Erythranthe guttata [common monkey flower]
ref|XP_010255698.1|  PREDICTED: protein transport protein SEC23-like    325   9e-102   Nelumbo nucifera [Indian lotus]
ref|XP_011024746.1|  PREDICTED: protein transport protein SEC23-l...    325   9e-102   Populus euphratica
ref|XP_011024747.1|  PREDICTED: protein transport protein SEC23-l...    325   1e-101   Populus euphratica
ref|XP_009387153.1|  PREDICTED: protein transport protein SEC23         324   1e-101   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE68856.1|  hypothetical protein OsJ_27655                          317   2e-101   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002265101.1|  PREDICTED: protein transport protein SEC23         323   4e-101   Vitis vinifera
gb|EPS65594.1|  hypothetical protein M569_09173                         323   5e-101   Genlisea aurea
emb|CBI38071.3|  unnamed protein product                                323   8e-101   Vitis vinifera
ref|XP_008797246.1|  PREDICTED: protein transport protein SEC23 i...    320   4e-100   Phoenix dactylifera
ref|NP_001062030.1|  Os08g0474700                                       320   1e-99    
ref|XP_004510207.1|  PREDICTED: protein transport protein SEC23-like    318   4e-99    Cicer arietinum [garbanzo]
ref|XP_003626854.1|  Protein transport protein SEC23                    317   6e-99    Medicago truncatula
ref|XP_010531432.1|  PREDICTED: protein transport protein SEC23         317   1e-98    Tarenaya hassleriana [spider flower]
ref|XP_006854134.1|  PREDICTED: protein transport protein SEC23         316   2e-98    Amborella trichopoda
ref|XP_003521007.1|  PREDICTED: protein transport protein SEC23-like    316   2e-98    Glycine max [soybeans]
ref|XP_007134267.1|  hypothetical protein PHAVU_010G032700g             316   3e-98    Phaseolus vulgaris [French bean]
ref|XP_004502261.1|  PREDICTED: protein transport protein Sec23A-...    303   3e-98    Cicer arietinum [garbanzo]
ref|XP_010691934.1|  PREDICTED: protein transport protein SEC23         315   3e-98    Beta vulgaris subsp. vulgaris [field beet]
gb|KDO52831.1|  hypothetical protein CISIN_1g0042382mg                  303   4e-98    Citrus sinensis [apfelsine]
ref|XP_003547758.1|  PREDICTED: protein transport protein SEC23-like    314   1e-97    Glycine max [soybeans]
gb|KHN32738.1|  Protein transport protein SEC23                         314   1e-97    Glycine soja [wild soybean]
ref|XP_006659495.1|  PREDICTED: protein transport protein SEC23-like    312   6e-97    Oryza brachyantha
ref|XP_003574621.1|  PREDICTED: protein transport protein SEC23-l...    311   9e-97    Brachypodium distachyon [annual false brome]
ref|XP_004973674.1|  PREDICTED: protein transport protein SEC23-l...    311   1e-96    Setaria italica
ref|NP_001170490.1|  uncharacterized protein LOC100384491               297   4e-96    
gb|EMS46122.1|  Protein transport protein SEC23                         308   1e-95    Triticum urartu
gb|EMT03462.1|  Protein transport protein SEC23                         308   6e-95    
gb|AFW60720.1|  hypothetical protein ZEAMMB73_153144                    294   7e-95    
ref|XP_010270294.1|  PREDICTED: protein transport protein SEC23-like    305   4e-94    Nelumbo nucifera [Indian lotus]
ref|XP_007153808.1|  hypothetical protein PHAVU_003G066300g             305   5e-94    Phaseolus vulgaris [French bean]
ref|XP_010278782.1|  PREDICTED: protein transport protein SEC23-l...    304   7e-94    Nelumbo nucifera [Indian lotus]
ref|XP_007221956.1|  hypothetical protein PRUPE_ppa001742mg             304   1e-93    Prunus persica
tpg|DAA38855.1|  TPA: hypothetical protein ZEAMMB73_253363              293   1e-93    
ref|NP_001130412.1|  uncharacterized protein LOC100191508               294   1e-93    
gb|AFX67018.1|  protein transport protein Sec23                         286   1e-93    Solanum tuberosum [potatoes]
gb|EMS56835.1|  Protein transport protein SEC23                         289   1e-93    Triticum urartu
ref|XP_012078435.1|  PREDICTED: protein transport protein SEC23-like    303   2e-93    Jatropha curcas
ref|XP_001774442.1|  predicted protein                                  303   2e-93    
ref|XP_008785319.1|  PREDICTED: protein transport protein SEC23-like    303   3e-93    Phoenix dactylifera
ref|XP_006492989.1|  PREDICTED: protein transport protein SEC23-like    303   3e-93    Citrus sinensis [apfelsine]
ref|XP_006421049.1|  hypothetical protein CICLE_v10004373mg             303   4e-93    Citrus clementina [clementine]
ref|XP_010028115.1|  PREDICTED: protein transport protein SEC23-like    302   4e-93    Eucalyptus grandis [rose gum]
ref|XP_002444510.1|  hypothetical protein SORBIDRAFT_07g023060          302   5e-93    Sorghum bicolor [broomcorn]
ref|XP_008797249.1|  PREDICTED: protein transport protein sec23 i...    300   6e-93    
gb|KJB37898.1|  hypothetical protein B456_006G225300                    301   7e-93    Gossypium raimondii
ref|XP_009349001.1|  PREDICTED: protein transport protein SEC23-like    301   8e-93    Pyrus x bretschneideri [bai li]
ref|XP_009378161.1|  PREDICTED: protein transport protein SEC23-like    301   8e-93    Pyrus x bretschneideri [bai li]
ref|NP_001067798.1|  Os11g0433500                                       290   8e-93    
ref|XP_008222792.1|  PREDICTED: protein transport protein SEC23         301   1e-92    Prunus mume [ume]
ref|XP_009420223.1|  PREDICTED: protein transport protein SEC23-like    301   1e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009373604.1|  PREDICTED: protein transport protein SEC23-like    301   1e-92    Pyrus x bretschneideri [bai li]
ref|XP_004502262.1|  PREDICTED: protein transport protein SEC23-l...    300   2e-92    Cicer arietinum [garbanzo]
ref|XP_010908064.1|  PREDICTED: protein transport protein SEC23-l...    301   2e-92    Elaeis guineensis
emb|CDP15130.1|  unnamed protein product                                300   2e-92    Coffea canephora [robusta coffee]
ref|XP_002300208.1|  transport family protein                           300   3e-92    Populus trichocarpa [western balsam poplar]
ref|XP_003601724.1|  Protein transport protein Sec23                    300   3e-92    Medicago truncatula
ref|XP_002516399.1|  protein transport protein sec23, putative          300   3e-92    Ricinus communis
ref|XP_008337484.1|  PREDICTED: protein transport protein SEC23         300   3e-92    
ref|XP_011045698.1|  PREDICTED: protein transport protein SEC23-like    300   4e-92    Populus euphratica
gb|KDP24898.1|  hypothetical protein JCGZ_24276                         305   4e-92    Jatropha curcas
ref|XP_009139544.1|  PREDICTED: protein transport protein SEC23-like    300   4e-92    Brassica rapa
gb|KJB71965.1|  hypothetical protein B456_011G150700                    300   4e-92    Gossypium raimondii
emb|CDY01197.1|  BnaA04g06220D                                          299   6e-92    
emb|CDY12738.1|  BnaC04g29030D                                          298   7e-92    Brassica napus [oilseed rape]
ref|XP_007034166.1|  Sec23/Sec24 protein transport family protein       299   8e-92    Theobroma cacao [chocolate]
gb|KFK22996.1|  hypothetical protein AALP_AAs50735U000600               298   1e-91    Arabis alpina [alpine rockcress]
gb|KHG15352.1|  Protein transport SEC23                                 298   1e-91    Gossypium arboreum [tree cotton]
gb|EMT11313.1|  Protein transport protein Sec23A                        289   2e-91    
ref|XP_010097955.1|  Protein transport protein SEC23                    298   2e-91    Morus notabilis
ref|XP_008791501.1|  PREDICTED: protein transport protein SEC23-like    298   2e-91    Phoenix dactylifera
emb|CBI39378.3|  unnamed protein product                                296   3e-91    Vitis vinifera
ref|XP_004964627.1|  PREDICTED: protein transport protein SEC23-l...    297   3e-91    
ref|XP_010269071.1|  PREDICTED: protein transport protein SEC23-like    297   4e-91    Nelumbo nucifera [Indian lotus]
gb|KHN24039.1|  Protein transport protein Sec23A                        292   4e-91    Glycine soja [wild soybean]
ref|XP_001751286.1|  predicted protein                                  296   5e-91    
ref|XP_010934372.1|  PREDICTED: protein transport protein SEC23-l...    297   5e-91    Elaeis guineensis
ref|XP_006414783.1|  hypothetical protein EUTSA_v10024465mg             297   6e-91    Eutrema salsugineum [saltwater cress]
ref|XP_006370915.1|  transport family protein                           296   8e-91    
ref|XP_007163794.1|  hypothetical protein PHAVU_001G264700g             296   8e-91    Phaseolus vulgaris [French bean]
ref|XP_010650390.1|  PREDICTED: protein transport protein SEC23-like    296   8e-91    Vitis vinifera
ref|XP_010490077.1|  PREDICTED: protein transport protein SEC23-like    293   1e-90    
ref|NP_849541.2|  sec23/sec24-like transport protein                    296   1e-90    Arabidopsis thaliana [mouse-ear cress]
ref|NP_193152.2|  sec23/sec24-like transport protein                    296   1e-90    Arabidopsis thaliana [mouse-ear cress]
gb|AAM10394.1|  AT4g14160/dl3120w                                       296   1e-90    Arabidopsis thaliana [mouse-ear cress]
emb|CAB10195.1|  transport protein                                      295   2e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011651107.1|  PREDICTED: protein transport protein SEC23         295   2e-90    Cucumis sativus [cucumbers]
ref|XP_008439044.1|  PREDICTED: protein transport protein SEC23         295   2e-90    Cucumis melo [Oriental melon]
ref|XP_011046336.1|  PREDICTED: protein transport protein SEC23-like    295   2e-90    Populus euphratica
ref|XP_002489340.1|  hypothetical protein SORBIDRAFT_0010s021250        296   2e-90    Sorghum bicolor [broomcorn]
gb|KFK39665.1|  hypothetical protein AALP_AA3G273400                    295   2e-90    Arabis alpina [alpine rockcress]
ref|XP_008668489.1|  PREDICTED: uncharacterized protein LOC100384...    298   2e-90    
ref|XP_001774792.1|  predicted protein                                  295   3e-90    
ref|XP_004973675.1|  PREDICTED: protein transport protein SEC23-l...    293   3e-90    Setaria italica
ref|XP_009414536.1|  PREDICTED: protein transport protein SEC23-like    295   3e-90    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003578242.1|  PREDICTED: protein transport protein SEC23-like    295   3e-90    Brachypodium distachyon [annual false brome]
ref|XP_002460346.1|  hypothetical protein SORBIDRAFT_02g026780          294   3e-90    Sorghum bicolor [broomcorn]
gb|EEE67142.1|  hypothetical protein OsJ_24197                          294   4e-90    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006418018.1|  hypothetical protein EUTSA_v10006857mg             295   5e-90    Eutrema salsugineum [saltwater cress]
ref|NP_563741.1|  sec23/sec24-like transport protein                    295   5e-90    Arabidopsis thaliana [mouse-ear cress]
gb|AAL08282.1|  At1g05520/T25N20_16                                     295   5e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004296961.1|  PREDICTED: protein transport protein SEC23-like    294   6e-90    Fragaria vesca subsp. vesca
gb|KHG16267.1|  Protein transport Sec23A                                294   6e-90    Gossypium arboreum [tree cotton]
ref|XP_008678116.1|  PREDICTED: protein transport protein SEC23-like    294   7e-90    Zea mays [maize]
ref|XP_004239847.1|  PREDICTED: protein transport protein SEC23-like    294   7e-90    Solanum lycopersicum
gb|KFK32877.1|  hypothetical protein AALP_AA6G299000                    293   8e-90    Arabis alpina [alpine rockcress]
ref|XP_006663401.1|  PREDICTED: protein transport protein SEC23-like    293   8e-90    
emb|CDX90271.1|  BnaA08g17130D                                          293   8e-90    
gb|KFK42891.1|  hypothetical protein AALP_AA1G052100                    293   1e-89    Arabis alpina [alpine rockcress]
ref|XP_006827919.1|  PREDICTED: protein transport protein SEC23         293   1e-89    Amborella trichopoda
ref|XP_002892293.1|  hypothetical protein ARALYDRAFT_470552             293   1e-89    
gb|KJB30032.1|  hypothetical protein B456_005G128200                    293   1e-89    Gossypium raimondii
emb|CDY12077.1|  BnaC03g59930D                                          292   2e-89    Brassica napus [oilseed rape]
ref|XP_010527422.1|  PREDICTED: protein transport protein SEC23-l...    293   2e-89    Tarenaya hassleriana [spider flower]
gb|KJB28027.1|  hypothetical protein B456_005G022700                    293   2e-89    Gossypium raimondii
ref|XP_003538532.1|  PREDICTED: protein transport protein SEC23-l...    292   3e-89    Glycine max [soybeans]
ref|XP_009419583.1|  PREDICTED: protein transport protein SEC23-like    292   3e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006365462.1|  PREDICTED: protein transport protein SEC23-like    292   3e-89    Solanum tuberosum [potatoes]
gb|EEC82002.1|  hypothetical protein OsI_25948                          292   4e-89    Oryza sativa Indica Group [Indian rice]
ref|XP_010532714.1|  PREDICTED: protein transport protein SEC23-l...    292   4e-89    Tarenaya hassleriana [spider flower]
ref|XP_001762459.1|  predicted protein                                  292   4e-89    
gb|EAY80788.1|  hypothetical protein OsI_35968                          292   6e-89    Oryza sativa Indica Group [Indian rice]
ref|XP_010522277.1|  PREDICTED: protein transport protein SEC23         291   6e-89    Tarenaya hassleriana [spider flower]
ref|XP_006283156.1|  hypothetical protein CARUB_v10004186mg             291   7e-89    Capsella rubella
ref|XP_010466720.1|  PREDICTED: protein transport protein SEC23-like    291   7e-89    Camelina sativa [gold-of-pleasure]
ref|XP_009111051.1|  PREDICTED: protein transport protein SEC23         291   8e-89    Brassica rapa
ref|XP_009799069.1|  PREDICTED: protein transport protein SEC23-like    291   9e-89    Nicotiana sylvestris
emb|CDX86574.1|  BnaC08g01290D                                          291   9e-89    
ref|XP_009622558.1|  PREDICTED: protein transport protein SEC23-like    291   1e-88    Nicotiana tomentosiformis
ref|XP_003552491.1|  PREDICTED: protein transport protein SEC23-l...    290   1e-88    Glycine max [soybeans]
ref|XP_010512680.1|  PREDICTED: protein transport protein SEC23-l...    290   1e-88    Camelina sativa [gold-of-pleasure]
ref|XP_009417946.1|  PREDICTED: protein transport protein SEC23-like    291   1e-88    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_189008.1|  Sec23/Sec24 protein transport family protein          290   1e-88    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004979229.1|  PREDICTED: protein transport protein SEC23-like    291   2e-88    Setaria italica
ref|XP_002870333.1|  hypothetical protein ARALYDRAFT_493493             290   3e-88    
ref|XP_003577593.1|  PREDICTED: protein transport protein SEC23-like    290   3e-88    Brachypodium distachyon [annual false brome]
ref|XP_002885585.1|  hypothetical protein ARALYDRAFT_479878             290   3e-88    
ref|NP_001189956.1|  Sec23/Sec24 protein transport family protein       290   3e-88    Arabidopsis thaliana [mouse-ear cress]
gb|AAX96396.1|  At1g05520/T25N20_16                                     289   6e-88    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006303716.1|  hypothetical protein CARUB_v10011838mg             288   8e-88    Capsella rubella
ref|XP_006297004.1|  hypothetical protein CARUB_v10012995mg             288   2e-87    Capsella rubella
ref|XP_011084141.1|  PREDICTED: protein transport protein SEC23-like    288   2e-87    Sesamum indicum [beniseed]
ref|XP_010485034.1|  PREDICTED: protein transport protein SEC23-like    287   2e-87    Camelina sativa [gold-of-pleasure]
dbj|BAK01218.1|  predicted protein                                      287   2e-87    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010435181.1|  PREDICTED: protein transport protein SEC23-like    287   2e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010440522.1|  PREDICTED: protein transport protein SEC23-like    287   3e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010457640.1|  PREDICTED: protein transport protein SEC23-l...    287   3e-87    
ref|XP_010475248.1|  PREDICTED: protein transport protein SEC23-like    286   4e-87    Camelina sativa [gold-of-pleasure]
ref|XP_010450096.1|  PREDICTED: protein transport protein SEC23-like    286   5e-87    Camelina sativa [gold-of-pleasure]
ref|XP_006358773.1|  PREDICTED: protein transport protein SEC23-like    286   7e-87    Solanum tuberosum [potatoes]
ref|XP_003080891.1|  protein transport protein Sec23 (ISS)              286   1e-86    Ostreococcus tauri
dbj|BAJ85358.1|  predicted protein                                      285   2e-86    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS72601.1|  hypothetical protein M569_02145                         285   2e-86    Genlisea aurea
emb|CDY13800.1|  BnaA09g43020D                                          284   3e-86    Brassica napus [oilseed rape]
ref|XP_010683601.1|  PREDICTED: protein transport protein SEC23-like    285   3e-86    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004247906.1|  PREDICTED: protein transport protein SEC23-like    283   4e-86    Solanum lycopersicum
ref|XP_009117382.1|  PREDICTED: protein transport protein SEC23         283   6e-86    Brassica rapa
ref|XP_001419416.1|  predicted protein                                  282   2e-85    Ostreococcus lucimarinus CCE9901
ref|NP_179757.1|  sec23/sec24-like transport protein                    281   4e-85    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002508348.1|  predicted protein                                  281   5e-85    Micromonas commoda
ref|XP_006404618.1|  hypothetical protein EUTSA_v10000056mg             281   5e-85    Eutrema salsugineum [saltwater cress]
ref|XP_010472160.1|  PREDICTED: protein transport protein SEC23-like    280   1e-84    Camelina sativa [gold-of-pleasure]
ref|XP_002878562.1|  hypothetical protein ARALYDRAFT_481031             280   1e-84    
emb|CDY59754.1|  BnaC08g49290D                                          282   3e-84    Brassica napus [oilseed rape]
gb|AAF79733.1|AC005106_14  T25N20.17                                    280   3e-84    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006296197.1|  hypothetical protein CARUB_v10025362mg             278   5e-84    Capsella rubella
gb|EYU38948.1|  hypothetical protein MIMGU_mgv1a001629mg                278   5e-84    Erythranthe guttata [common monkey flower]
ref|XP_010429086.1|  PREDICTED: protein transport protein SEC23-like    278   6e-84    Camelina sativa [gold-of-pleasure]
ref|XP_010416920.1|  PREDICTED: protein transport protein SEC23-like    277   1e-83    Camelina sativa [gold-of-pleasure]
gb|EMT27989.1|  Protein transport protein sec-23                        278   8e-83    
ref|XP_007515183.1|  predicted protein                                  273   2e-81    Bathycoccus prasinos
ref|XP_006297005.1|  hypothetical protein CARUB_v10012995mg             272   2e-81    
ref|XP_002982254.1|  hypothetical protein SELMODRAFT_155031             270   8e-81    Selaginella moellendorffii
ref|XP_002966180.1|  hypothetical protein SELMODRAFT_168140             270   9e-81    Selaginella moellendorffii
gb|KHG04907.1|  Protein transport SEC23                                 270   1e-80    Gossypium arboreum [tree cotton]
ref|XP_003059046.1|  predicted protein                                  269   3e-80    Micromonas pusilla CCMP1545
ref|XP_002880424.1|  hypothetical protein ARALYDRAFT_481081             259   2e-77    
gb|KJB72956.1|  hypothetical protein B456_011G205900                    254   3e-75    Gossypium raimondii
ref|XP_001765516.1|  predicted protein                                  254   3e-75    
gb|KJB78639.1|  hypothetical protein B456_013G010400                    252   1e-74    Gossypium raimondii
ref|XP_006386863.1|  hypothetical protein POPTR_0002s23950g             251   1e-74    
gb|KJB78636.1|  hypothetical protein B456_013G010400                    252   1e-74    Gossypium raimondii
gb|KDD74127.1|  hypothetical protein H632_c1547p0                       244   7e-74    Helicosporidium sp. ATCC 50920
emb|CEG81644.1|  Putative Protein transporter sec23                     241   2e-73    Rhizopus microsporus
emb|CDY12241.1|  BnaC04g12710D                                          245   8e-73    Brassica napus [oilseed rape]
gb|ABS72191.1|  transport protein                                       234   1e-72    Corchorus olitorius [Nalta jute]
ref|XP_002977937.1|  hypothetical protein SELMODRAFT_107900             248   2e-72    
ref|XP_002986965.1|  hypothetical protein SELMODRAFT_124893             248   2e-72    
ref|XP_001743552.1|  hypothetical protein                               247   2e-72    Monosiga brevicollis MX1
ref|XP_003081259.1|  Vesicle coat complex COPII, subunit SEC23 (ISS)    236   3e-72    
gb|KDO85349.1|  hypothetical protein CISIN_1g004199mg                   246   3e-72    Citrus sinensis [apfelsine]
gb|KIJ05426.1|  hypothetical protein PAXINDRAFT_103792                  233   5e-72    Paxillus involutus ATCC 200175
emb|CDO71073.1|  hypothetical protein BN946_scf184844.g77               242   1e-71    Trametes cinnabarina
ref|XP_001419581.1|  predicted protein                                  245   1e-71    Ostreococcus lucimarinus CCE9901
ref|XP_002946892.1|  hypothetical protein VOLCADRAFT_103128             245   1e-71    Volvox carteri f. nagariensis
emb|CEP06830.1|  hypothetical protein                                   245   1e-71    Parasitella parasitica
emb|CCO26912.1|  Protein transport protein SEC23                        229   2e-71    Rhizoctonia solani AG-1 IB
gb|KDQ13407.1|  hypothetical protein BOTBODRAFT_33712                   244   2e-71    Botryobasidium botryosum FD-172 SS1
gb|AFW67664.1|  hypothetical protein ZEAMMB73_006275                    232   2e-71    
ref|XP_001702936.1|  COP-II coat subunit                                244   3e-71    Chlamydomonas reinhardtii
emb|CDH50391.1|  protein transporter sec23                              244   3e-71    Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS13505.1|  Putative Protein transporter SEC23                     244   3e-71    Lichtheimia ramosa
emb|CDS13951.1|  Putative Protein transporter SEC23                     244   3e-71    Lichtheimia ramosa
ref|XP_002408825.1|  vesicle coat complex COPII, subunit SEC23, p...    236   4e-71    Ixodes scapularis [blacklegged tick]
emb|CEF99093.1|  von Willebrand factor, type A                          238   1e-70    Ostreococcus tauri
gb|EXX77374.1|  Sec23p                                                  242   2e-70    Rhizophagus irregularis DAOM 197198w
gb|EIE91302.1|  protein transporter SEC23                               241   3e-70    Rhizopus delemar RA 99-880
gb|KKA73276.1|  sec-23                                                  228   4e-70    
emb|CEG75338.1|  Putative Podospora anserina S mat genomic DNA ch...    241   4e-70    Rhizopus microsporus
emb|CDH54361.1|  protein transporter sec23                              241   5e-70    Lichtheimia corymbifera JMRC:FSU:9682
gb|KIY93781.1|  hypothetical protein MNEG_14181                         226   5e-70    Monoraphidium neglectum
ref|XP_010522501.1|  PREDICTED: protein transport protein sec23-1       240   1e-69    Tarenaya hassleriana [spider flower]
dbj|GAN07318.1|  copii coat protein                                     240   1e-69    Mucor ambiguus
gb|EPQ62665.1|  hypothetical protein BGT96224_4934B                     232   1e-69    Blumeria graminis f. sp. tritici 96224
ref|XP_003321108.2|  protein transporter SEC23                          239   1e-69    Puccinia graminis f. sp. tritici CRL 75-36-700-3
gb|EGO04011.1|  hypothetical protein SERLA73DRAFT_69806                 239   2e-69    Serpula lacrymans var. lacrymans S7.3
ref|XP_007314172.1|  hypothetical protein SERLADRAFT_413215             239   2e-69    Serpula lacrymans var. lacrymans S7.9
gb|KDQ58302.1|  hypothetical protein JAAARDRAFT_34105                   239   2e-69    Jaapia argillacea MUCL 33604
gb|KIM86120.1|  hypothetical protein PILCRDRAFT_816653                  238   3e-69    Piloderma croceum F 1598
ref|XP_005717382.1|  vesicle coat complex COPII, subunit Sec23          238   6e-69    Chondrus crispus [carageen]
ref|XP_007879432.1|  hypothetical protein PFL1_03722                    237   6e-69    Anthracocystis flocculosa PF-1
gb|KJA25434.1|  hypothetical protein HYPSUDRAFT_134756                  238   7e-69    Hypholoma sublateritium FD-334 SS-4
gb|KFH71468.1|  protein transporter SEC23                               238   7e-69    Mortierella verticillata NRRL 6337
ref|XP_002289774.1|  hypothetical protein THAPSDRAFT_22248              237   9e-69    Thalassiosira pseudonana CCMP1335
gb|ESA11223.1|  hypothetical protein GLOINDRAFT_192153                  237   1e-68    
gb|KFH65233.1|  protein transporter SEC23                               237   1e-68    Mortierella verticillata NRRL 6337
emb|CCF53565.1|  probable SEC23-component of COPII coat of ER-gol...    237   1e-68    Ustilago hordei
gb|KIK10721.1|  hypothetical protein PISMIDRAFT_577792                  234   1e-68    Pisolithus microcarpus 441
ref|XP_003027779.1|  hypothetical protein SCHCODRAFT_79176              237   1e-68    Schizophyllum commune H4-8
gb|KII87913.1|  hypothetical protein PLICRDRAFT_111718                  237   1e-68    Plicaturopsis crispa FD-325 SS-3
ref|XP_008042194.1|  copii coat protein                                 236   2e-68    Trametes versicolor FP-101664 SS1
gb|EPS96173.1|  hypothetical protein FOMPIDRAFT_1167779                 236   3e-68    Fomitopsis pinicola FP-58527 SS1
dbj|GAC76580.1|  vesicle coat complex COPII, subunit SEC23              235   3e-68    Moesziomyces antarcticus T-34
ref|XP_011387617.1|  putative GTPase-activating protein SEC23           236   3e-68    Ustilago maydis 521
ref|XP_007370480.1|  hypothetical protein DICSQDRAFT_183604             236   4e-68    Dichomitus squalens LYAD-421 SS1
dbj|GAC96354.1|  potential SEC23-like GTPase-activating protein         236   4e-68    Pseudozyma hubeiensis SY62
ref|XP_007404362.1|  hypothetical protein MELLADRAFT_41731              235   5e-68    Melampsora larici-populina 98AG31
gb|EJK54034.1|  hypothetical protein THAOC_26419                        236   5e-68    Thalassiosira oceanica
gb|KDN53244.1|  hypothetical protein K437DRAFT_253260                   235   5e-68    Tilletiaria anomala UBC 951
gb|EIE85757.1|  protein transporter SEC23                               238   5e-68    Rhizopus delemar RA 99-880
ref|XP_007869503.1|  copii coat protein                                 235   7e-68    Gloeophyllum trabeum ATCC 11539
gb|KIK06438.1|  hypothetical protein K443DRAFT_674416                   235   7e-68    Laccaria amethystina LaAM-08-1
gb|KJB37899.1|  hypothetical protein B456_006G225300                    234   7e-68    Gossypium raimondii
gb|KDE07582.1|  protein transporter SEC23                               235   8e-68    Microbotryum lychnidis-dioicae p1A1 Lamole
dbj|GAK63456.1|  copii coat protein                                     235   8e-68    Moesziomyces antarcticus
gb|EWM26428.1|  protein transport protein sec23a                        229   8e-68    Nannochloropsis gaditana
gb|EFA84122.1|  putative transport protein                              233   9e-68    Heterostelium album PN500
ref|XP_006651804.1|  PREDICTED: protein transport protein sec23-1...    232   9e-68    
gb|EPB84990.1|  protein transporter SEC23                               234   9e-68    
gb|KIM70808.1|  hypothetical protein SCLCIDRAFT_1143124                 234   9e-68    
ref|XP_002177155.1|  predicted protein                                  234   1e-67    
gb|KIY72708.1|  hypothetical protein CYLTODRAFT_417712                  234   1e-67    
gb|KIP01777.1|  hypothetical protein PHLGIDRAFT_96685                   234   1e-67    
ref|XP_005834053.1|  secretory protein 23A                              234   1e-67    
gb|ETS62844.1|  hypothetical protein PaG_02599                          235   1e-67    
gb|KIJ36358.1|  hypothetical protein M422DRAFT_261312                   234   1e-67    
ref|XP_002118001.1|  hypothetical protein TRIADDRAFT_51161              234   1e-67    
ref|XP_012052144.1|  protein transporter SEC23                          234   1e-67    
ref|XP_567493.1|  hypothetical protein CNJ01150                         234   1e-67    
ref|XP_007771283.1|  copii coat protein                                 234   1e-67    
gb|KHF97532.1|  Protein transport SEC23                                 234   2e-67    
gb|KIK20449.1|  hypothetical protein PISMIDRAFT_592982                  234   2e-67    
ref|XP_007852178.1|  gtpase activating protein sec23a                   234   2e-67    
ref|XP_001881130.1|  copii coat protein                                 234   2e-67    
gb|EMD35658.1|  copii coat protein                                      233   3e-67    
gb|KIK93986.1|  hypothetical protein PAXRUDRAFT_33778                   233   3e-67    
ref|XP_003559833.1|  PREDICTED: protein transport protein sec23-1       233   4e-67    
gb|KIO08685.1|  hypothetical protein M404DRAFT_996932                   233   4e-67    
dbj|GAM25763.1|  hypothetical protein SAMD00019534_089380               233   4e-67    
ref|XP_007272113.1|  copii coat protein                                 233   5e-67    
ref|XP_008644516.1|  PREDICTED: protein transport protein sec23-1...    233   5e-67    
ref|XP_009549822.1|  hypothetical protein HETIRDRAFT_435796             233   5e-67    
ref|XP_010494350.1|  PREDICTED: protein transport protein SEC23-like    224   6e-67    
gb|EEE59907.1|  hypothetical protein OsJ_12522                          233   6e-67    
ref|XP_002466477.1|  hypothetical protein SORBIDRAFT_01g008490          232   6e-67    
ref|XP_001832200.2|  protein transporter SEC23                          232   7e-67    
gb|EMS18549.1|  protein transport protein SEC23                         232   7e-67    
gb|EEC76158.1|  hypothetical protein OsI_13460                          232   8e-67    
ref|NP_001051229.1|  Os03g0742800                                       232   8e-67    
gb|EMS58353.1|  Protein transport protein SEC23                         230   8e-67    
ref|XP_008366852.1|  PREDICTED: protein transport protein SEC23-like    226   9e-67    
ref|XP_004981818.1|  PREDICTED: protein transport protein sec23-1...    232   9e-67    
ref|XP_003193878.1|  protein transport protein SEC23                    232   1e-66    
gb|KGB75135.1|  protein transporter SEC23                               232   1e-66    
ref|XP_007301896.1|  hypothetical protein STEHIDRAFT_166914             232   1e-66    
ref|XP_011401500.1|  Protein transport protein SEC23                    229   1e-66    
gb|KIR89126.1|  protein transporter SEC23                               231   1e-66    
emb|CDR44779.1|  RHTO0S10e00320g1_1                                     232   1e-66    
gb|KIR68781.1|  protein transporter SEC23                               231   1e-66    
ref|XP_002405954.1|  protein transport protein sec23, putative          227   1e-66    
ref|XP_010679945.1|  PREDICTED: protein transport protein SEC23         231   1e-66    
gb|KIK40341.1|  hypothetical protein CY34DRAFT_765799                   231   1e-66    
ref|XP_003746313.1|  PREDICTED: protein transport protein Sec23A        231   2e-66    
gb|KIO19135.1|  hypothetical protein M407DRAFT_246276                   231   2e-66    
ref|XP_010235206.1|  PREDICTED: protein transport protein SEC23-l...    231   2e-66    
ref|XP_005648317.1|  COP-II coat subunit                                231   2e-66    
gb|KIJ62122.1|  hypothetical protein HYDPIDRAFT_95130                   231   2e-66    
ref|XP_003283278.1|  hypothetical protein DICPUDRAFT_44673              231   2e-66    
gb|KDR80172.1|  hypothetical protein GALMADRAFT_277426                  231   2e-66    
ref|XP_011113273.1|  hypothetical protein H072_7519                     231   3e-66    
ref|XP_008224182.1|  PREDICTED: protein transport protein SEC23         231   3e-66    
ref|XP_002902508.1|  protein transport Sec23/Sec24-like protein         231   3e-66    
ref|XP_007225252.1|  hypothetical protein PRUPE_ppa001670mg             231   3e-66    
emb|CCA74741.1|  probable SEC23-component of COPII coat of ER-gol...    230   3e-66    
ref|XP_008666564.1|  PREDICTED: uncharacterized protein LOC100191...    230   3e-66    
emb|CBQ71835.1|  probable SEC23-component of COPII coat of ER-gol...    231   3e-66    
ref|XP_007332071.1|  hypothetical protein AGABI1DRAFT_115330            230   3e-66    
gb|ETK83379.1|  hypothetical protein L915_11429                         231   3e-66    
ref|XP_009524464.1|  vesicle coat complex COPII subunit SEC23           230   3e-66    
ref|XP_006957323.1|  copii coat protein                                 230   3e-66    
gb|KDQ31722.1|  hypothetical protein PLEOSDRAFT_1091812                 230   3e-66    
ref|XP_006969162.1|  predicted protein                                  230   4e-66    
gb|ETO71962.1|  hypothetical protein F444_11823                         231   4e-66    
ref|XP_008907931.1|  hypothetical protein PPTG_12936                    231   4e-66    
gb|ETI43311.1|  hypothetical protein F443_11739                         231   4e-66    
gb|KIR49625.1|  protein transporter SEC23                               230   4e-66    
gb|KEQ75339.1|  hypothetical protein M436DRAFT_41639                    230   4e-66    
ref|XP_007875371.1|  hypothetical protein PNEG_03296                    230   4e-66    
gb|ETM43199.1|  hypothetical protein L914_11272                         231   4e-66    
ref|XP_001729570.1|  hypothetical protein MGL_3114                      229   4e-66    
ref|XP_001557404.1|  protein transport protein sec23                    228   4e-66    
gb|EMT06708.1|  Protein transport protein SEC23                         229   4e-66    
ref|XP_007392773.1|  hypothetical protein PHACADRAFT_251062             230   4e-66    
gb|KEQ62401.1|  hypothetical protein M437DRAFT_49639                    230   4e-66    
ref|XP_006463484.1|  copii coat protein                                 229   5e-66    
ref|XP_011123651.1|  hypothetical protein AOL_s00083g170                230   6e-66    
gb|ABN12069.1|  putative sec23 protein                                  218   7e-66    
gb|EUC66788.1|  protein transporter Sec23                               232   7e-66    
gb|KEP48063.1|  protein transporter Sec23                               232   7e-66    
gb|AAI33239.1|  Unknown (protein for IMAGE:6939089)                     217   7e-66    
gb|EST07588.1|  vesicle coat complex COPII, subunit SEC23               229   8e-66    
ref|XP_001934768.1|  GTPase activating protein Sec23a                   229   9e-66    
ref|XP_003000127.1|  transport protein SEC23                            229   9e-66    
ref|XP_009222266.1|  protein transporter SEC23                          229   9e-66    
gb|KEQ81856.1|  hypothetical protein M438DRAFT_324106                   229   1e-65    
ref|XP_003298437.1|  hypothetical protein PTT_09161                     229   1e-65    
dbj|BAJ95802.1|  predicted protein                                      229   1e-65    
ref|XP_004291791.1|  PREDICTED: protein transport protein SEC23         229   1e-65    
ref|XP_004362791.1|  putative transport protein                         229   1e-65    
ref|XP_007163831.1|  hypothetical protein PHAVU_001G267800g             228   1e-65    
gb|KER00109.1|  hypothetical protein AUEXF2481DRAFT_61372               229   1e-65    
emb|CCU80400.1|  transport protein                                      229   1e-65    
gb|EFX01356.1|  protein transport protein                               229   1e-65    
emb|CCT72372.1|  probable SEC23                                         226   2e-65    
ref|XP_003709644.1|  protein transporter SEC23                          229   2e-65    
gb|EHJ75117.1|  putative protein transport protein sec23                218   2e-65    
gb|KIK68656.1|  hypothetical protein GYMLUDRAFT_36135                   228   2e-65    
ref|XP_011091114.1|  PREDICTED: protein transport protein SEC23         228   2e-65    
gb|KFZ10543.1|  hypothetical protein V501_05148                         228   3e-65    
ref|XP_009373956.1|  PREDICTED: protein transport protein SEC23-l...    228   3e-65    
gb|KFY72660.1|  hypothetical protein V499_07211                         228   3e-65    
ref|XP_009373957.1|  PREDICTED: protein transport protein SEC23-l...    228   3e-65    
gb|ELR06387.1|  protein transporter sec-23                              228   3e-65    
ref|XP_002863641.1|  hypothetical protein ARALYDRAFT_494637             228   3e-65    
ref|XP_009268230.1|  Protein transport protein SEC23                    230   3e-65    
gb|KFY87807.1|  hypothetical protein V500_06746                         228   4e-65    
ref|XP_007686622.1|  hypothetical protein COCMIDRAFT_25186              228   4e-65    
gb|KHN81869.1|  Protein transport protein Sec23A                        224   4e-65    
gb|EHK27502.1|  sec23 protein                                           228   4e-65    
gb|EMD97715.1|  hypothetical protein COCHEDRAFT_1125504                 228   4e-65    
ref|XP_007711298.1|  hypothetical protein COCCADRAFT_93636              228   4e-65    
gb|KFX85737.1|  hypothetical protein V490_09445                         228   4e-65    
ref|XP_007587909.1|  putative transport protein sec23 protein           228   4e-65    
ref|XP_010278785.1|  PREDICTED: protein transport protein SEC23-l...    227   5e-65    
gb|EPB71524.1|  Sec23/Sec24 beta-sandwich domain protein                223   5e-65    
ref|XP_007919045.1|  putative transport protein sec23 protein           227   5e-65    
emb|CCM06023.1|  predicted protein                                      227   6e-65    
gb|ETW31113.1|  hypothetical protein PFFCH_01453                        225   6e-65    
emb|CCV00167.1|  unnamed protein product                                227   6e-65    
ref|XP_007704296.1|  hypothetical protein COCSADRAFT_99733              227   6e-65    
ref|XP_003551946.1|  PREDICTED: protein transport protein SEC23-like    226   6e-65    
gb|EJD76794.1|  hypothetical protein, variant                           226   7e-65    
ref|XP_003835218.1|  similar to transport protein sec23                 227   7e-65    
ref|XP_008816457.1|  hypothetical protein C922_02636                    227   7e-65    
emb|CCJ29761.1|  unnamed protein product                                231   7e-65    
ref|XP_004055157.1|  PREDICTED: protein transport protein Sec23A-...    215   7e-65    
ref|XP_011030584.1|  PREDICTED: protein transport protein sec23-1       227   7e-65    
gb|KIM46795.1|  hypothetical protein M413DRAFT_422161                   227   8e-65    
ref|XP_009046400.1|  hypothetical protein LOTGIDRAFT_185711             226   1e-64    
ref|XP_009814731.1|  PREDICTED: protein transport protein Sec23A-...    213   1e-64    
ref|XP_011317768.1|  transporter SEC23                                  226   1e-64    
ref|XP_003047534.1|  predicted protein                                  226   1e-64    
ref|XP_002837992.1|  hypothetical protein                               226   1e-64    
gb|KFH43248.1|  Protein transport protein-like protein                  226   1e-64    
ref|XP_010301473.1|  PREDICTED: protein transport protein Sec23A-...    213   1e-64    
gb|KFA60662.1|  hypothetical protein S40285_08705                       226   1e-64    
dbj|BAB08946.1|  protein transport protein SEC23                        226   1e-64    
ref|XP_010206458.1|  PREDICTED: protein transport protein Sec23A-...    213   1e-64    
gb|KEY65788.1|  hypothetical protein S7711_08726                        226   1e-64    
sp|Q0US25.2|SEC23_PHANO  RecName: Full=Protein transport protein ...    226   1e-64    
ref|XP_007373143.1|  hypothetical protein SPAPADRAFT_58928              223   1e-64    
ref|XP_004221115.1|  protein transport protein Sec23A                   226   1e-64    
gb|KFY10457.1|  hypothetical protein V491_07641                         226   1e-64    
ref|XP_004328968.1|  PREDICTED: protein transport protein Sec23A-...    214   1e-64    
gb|KFY11619.1|  hypothetical protein V492_04364                         226   1e-64    
gb|KFY39879.1|  hypothetical protein V494_03783                         226   1e-64    
gb|KFY47709.1|  hypothetical protein V496_10491                         226   1e-64    
gb|KIH68911.1|  Sec23/Sec24 beta-sandwich domain protein                223   1e-64    
gb|EPE09476.1|  protein transporter sec23                               226   1e-64    
ref|XP_008388605.1|  PREDICTED: protein transport protein SEC23-like    226   2e-64    
ref|XP_010278781.1|  PREDICTED: protein transport protein SEC23-l...    226   2e-64    
ref|XP_006489507.1|  PREDICTED: protein transport protein SEC23-l...    226   2e-64    
ref|XP_010278787.1|  PREDICTED: protein transport protein SEC23-l...    225   2e-64    
ref|XP_002638488.1|  C. briggsae CBR-SEC-23 protein                     226   2e-64    
ref|XP_002258097.1|  Transport protein (PfSec23 protein)                226   2e-64    
gb|KDO53915.1|  hypothetical protein CISIN_1g004188mg                   226   2e-64    
gb|EMR81480.1|  putative transport protein sec23 protein                226   2e-64    
emb|CCD50997.1|  similar to transport protein sec23                     226   2e-64    
gb|KJP89574.1|  hypothetical protein AK88_00785                         226   2e-64    
dbj|BAG61466.1|  unnamed protein product                                217   2e-64    
ref|XP_741253.1|  transport protein                                     222   2e-64    
ref|XP_009396065.1|  PREDICTED: protein transport protein sec23-1       226   2e-64    
ref|XP_007289136.1|  Sec23/Sec24 trunk domain-containing protein        226   2e-64    
gb|EYC30996.1|  hypothetical protein Y032_0004g1894                     223   2e-64    
ref|NP_568626.1|  sec23/sec24-like transport protein                    226   2e-64    
ref|XP_001586493.1|  conserved hypothetical protein                     226   2e-64    
ref|XP_007384113.1|  protein transporter SEC23                          226   2e-64    
ref|XP_001795844.1|  hypothetical protein SNOG_05439                    226   2e-64    
gb|KIL64158.1|  hypothetical protein M378DRAFT_24750                    225   2e-64    
ref|XP_001901956.1|  putative Sec23 protein                             225   2e-64    
ref|XP_011416351.1|  PREDICTED: protein transport protein Sec23A-...    226   2e-64    
ref|XP_006420097.1|  hypothetical protein CICLE_v10004380mg             225   2e-64    
gb|KIY53247.1|  hypothetical protein FISHEDRAFT_69101                   225   2e-64    
gb|KIH94271.1|  protein transport protein SEC23                         225   3e-64    
ref|XP_003138682.1|  hypothetical protein LOAG_03100                    226   3e-64    
gb|KJR83115.1|  protein transport protein SEC23                         225   3e-64    
gb|EFO25389.2|  hypothetical protein LOAG_03100                         226   3e-64    
ref|XP_007597309.1|  Sec23/Sec24 trunk domain-containing protein        225   3e-64    
ref|XP_006280033.1|  hypothetical protein CARUB_v10025910mg             225   3e-64    
gb|KDN69341.1|  putative Sec23/Sec24 trunk domain-containing protein    225   3e-64    
gb|EFX88498.1|  hypothetical protein DAPPUDRAFT_190968                  225   3e-64    
ref|XP_002505986.1|  predicted protein                                  225   3e-64    
emb|CCF38744.1|  protein transporter SEC23                              225   3e-64    
gb|ERS99207.1|  protein transporter SEC23                               226   3e-64    
ref|XP_007798672.1|  putative transport protein sec23 protein           225   3e-64    
gb|ELU41713.1|  protein transport protein Sec23, putative               228   3e-64    
emb|CEF61227.1|  Sec23                                                  225   3e-64    
ref|XP_001349299.1|  Pfsec23                                            225   3e-64    
gb|ETW18961.1|  hypothetical protein PFFVO_02168                        225   3e-64    
emb|CAJ83841.1|  Sec23 homolog B (S. cerevisiae)                        217   3e-64    
emb|CDO63994.1|  protein transport protein SEC23                        225   3e-64    
ref|XP_007835137.1|  Protein transport protein SEC23                    225   3e-64    
gb|KIL90562.1|  protein transporter sec23                               225   4e-64    
ref|XP_009335644.1|  PREDICTED: protein transport protein SEC23-like    225   4e-64    
ref|XP_008874437.1|  hypothetical protein H310_09985                    226   4e-64    
gb|EMT66388.1|  Protein transport protein SEC23                         225   4e-64    
gb|EWG47121.1|  protein transporter SEC23                               225   4e-64    
ref|XP_002102258.1|  GD19806                                            219   4e-64    
gb|EJT48333.1|  protein transport protein SEC23                         224   4e-64    
ref|XP_001901955.1|  putative Sec23 protein                             225   5e-64    
ref|XP_001652784.1|  AAEL007484-PA                                      224   5e-64    
gb|KDO23972.1|  hypothetical protein SPRG_10669                         225   5e-64    
gb|EKC99299.1|  protein transport protein SEC23                         224   5e-64    
gb|EKG21478.1|  Zinc finger Sec23/Sec24-type protein                    224   5e-64    
gb|EGU81214.1|  hypothetical protein FOXB_08247                         226   5e-64    
ref|XP_008613148.1|  hypothetical protein SDRG_09016                    225   5e-64    
gb|ETN64439.1|  protein transport protein sec23                         224   5e-64    
ref|XP_011416353.1|  PREDICTED: protein transport protein Sec23A-...    224   5e-64    
gb|EZF25246.1|  protein transporter SEC23                               224   5e-64    
gb|EKC40209.1|  transport protein Sec23A                                224   6e-64    
emb|CDQ90486.1|  unnamed protein product                                219   6e-64    
emb|CDP96400.1|  Protein Bm13927, isoform b                             224   6e-64    
gb|EZF33856.1|  protein transporter SEC23                               223   6e-64    
gb|EZG08537.1|  protein transporter SEC23                               223   6e-64    
gb|EZF25245.1|  protein transporter SEC23                               224   6e-64    
gb|EHK50497.1|  sec23 protein                                           224   7e-64    
ref|XP_004923360.1|  PREDICTED: protein transport protein Sec23A-...    224   7e-64    
gb|EEQ86379.1|  protein transporter sec23                               224   7e-64    



>ref|XP_009800228.1| PREDICTED: protein transport protein SEC23 [Nicotiana sylvestris]
Length=764

 Score =   352 bits (903),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 166/180 (92%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVFGNSPDETAY+RMILNRENV+NSVVMIQPSLISYSF S PEPVLLDV 
Sbjct  584  MFHLRRSQFVQVFGNSPDETAYFRMILNRENVANSVVMIQPSLISYSFQSGPEPVLLDVA  643

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDS+FTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLL+TPREDAE+IIR+RF
Sbjct  644  AIAADRILLLDSFFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLKTPREDAEAIIRERF  703

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQ+GSQARF+LAKLNPSATYNSDAPP+PGGDIIFTDDVSFEVFLDHLQRLAV
Sbjct  704  PVPRLVICDQYGSQARFMLAKLNPSATYNSDAPPIPGGDIIFTDDVSFEVFLDHLQRLAV  763



>ref|XP_009629158.1| PREDICTED: protein transport protein SEC23 [Nicotiana tomentosiformis]
Length=764

 Score =   351 bits (900),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 165/180 (92%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVFGNSPDETAY+RMILNRENV+NSVVMIQPSLISYSF S PEPVLLDV 
Sbjct  584  MFHLRRSQFVQVFGNSPDETAYFRMILNRENVANSVVMIQPSLISYSFQSGPEPVLLDVA  643

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDS+FTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLL+TPREDAE+IIR+RF
Sbjct  644  AIAADRILLLDSFFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLKTPREDAEAIIRERF  703

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQ+GSQARF+LAKLNPSATYNSDAPP+PGGDIIFTDDVSFEVFLDHLQRLAV
Sbjct  704  PVPRLVLCDQYGSQARFMLAKLNPSATYNSDAPPIPGGDIIFTDDVSFEVFLDHLQRLAV  763



>ref|XP_006354587.1| PREDICTED: protein transport protein SEC23-like [Solanum tuberosum]
Length=764

 Score =   350 bits (897),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 164/180 (91%), Positives = 177/180 (98%), Gaps = 0/180 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVFGNSPDETAY+RMILNRENV+NSVVMIQPSLISYSFHS PEPVLLDV 
Sbjct  584  IFHLRRSQFVQVFGNSPDETAYFRMILNRENVANSVVMIQPSLISYSFHSGPEPVLLDVA  643

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFTIVVFHGSTIAQWRK GYHEQPEHQAFA+LL++PREDAE+I+R+RF
Sbjct  644  AIAADRILLLDSYFTIVVFHGSTIAQWRKLGYHEQPEHQAFAELLKSPREDAEAIVRERF  703

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQ+GSQARF+LAKLNPSATYNSDAPP+PGGDIIFTDDVSFEVFLDHLQRLAV
Sbjct  704  PVPRLVICDQYGSQARFMLAKLNPSATYNSDAPPIPGGDIIFTDDVSFEVFLDHLQRLAV  763



>emb|CDP09314.1| unnamed protein product [Coffea canephora]
Length=773

 Score =   348 bits (894),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 165/181 (91%), Positives = 175/181 (97%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSLISYSFHS PEPVLLDV 
Sbjct  593  VFHLRRSQFVQVFNNSPDETAYFRMILNRENVANSVVMIQPSLISYSFHSAPEPVLLDVA  652

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFTIV+FHGSTIAQWRKAGYH+QPEHQAFAQLLQ+PR+DA SIIR+RF
Sbjct  653  AIAADRILLLDSYFTIVIFHGSTIAQWRKAGYHQQPEHQAFAQLLQSPRDDANSIIRERF  712

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLL KLNPSATYNSDAPP PGGDIIFTDDVSFEVFL+HLQRLAV
Sbjct  713  PVPRLVICDQHGSQARFLLVKLNPSATYNSDAPPAPGGDIIFTDDVSFEVFLEHLQRLAV  772

Query  191  Q  189
            Q
Sbjct  773  Q  773



>ref|XP_004229519.1| PREDICTED: protein transport protein SEC23 [Solanum lycopersicum]
Length=764

 Score =   346 bits (888),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 162/180 (90%), Positives = 176/180 (98%), Gaps = 0/180 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVFGNSPDETAY+RMILNRENV+NSVVMIQPSLISYSFHS PEPVLLDV 
Sbjct  584  MFHLRRSQFVQVFGNSPDETAYFRMILNRENVANSVVMIQPSLISYSFHSGPEPVLLDVA  643

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAA+RILLLDSYFTIVVFHGSTIAQWRK GYHEQPEHQAFA+LL++PREDAE+I+ +RF
Sbjct  644  AIAAERILLLDSYFTIVVFHGSTIAQWRKLGYHEQPEHQAFAELLKSPREDAEAIVHERF  703

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQ+GSQARF+LAKLNPSATYNSDAPP+PGGDIIFTDDVSFEVFLDHLQRLAV
Sbjct  704  PVPRLVICDQYGSQARFMLAKLNPSATYNSDAPPIPGGDIIFTDDVSFEVFLDHLQRLAV  763



>ref|XP_008375667.1| PREDICTED: protein transport protein SEC23-like [Malus domestica]
Length=208

 Score =   323 bits (829),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSLISYSFHS PEP LLDV 
Sbjct  29   MFHLRRSQFVQVFNNSPDETAYFRMILNRENVTNSVVMIQPSLISYSFHSGPEPALLDVA  88

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLD+YFT+V+FHGSTIAQWRKAGY + PEHQAFAQLLQ PR+D + I ++RF
Sbjct  89   AIAADRILLLDAYFTVVIFHGSTIAQWRKAGYQDLPEHQAFAQLLQAPRDDGDQISKERF  148

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYN++A P+PGGD+IFTDDVSFEVFLDHLQRLAV
Sbjct  149  PVPRLVICDQHGSQARFLLAKLNPSATYNNEA-PLPGGDVIFTDDVSFEVFLDHLQRLAV  207

Query  191  Q  189
            Q
Sbjct  208  Q  208



>ref|XP_004145019.2| PREDICTED: protein transport protein SEC23 [Cucumis sativus]
 gb|KGN46272.1| hypothetical protein Csa_6G078680 [Cucumis sativus]
Length=761

 Score =   333 bits (853),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 173/181 (96%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSLISY+FHS PEPVLLDV 
Sbjct  582  IFHLRRSQFVQVFNNSPDETAYFRMILNRENVANSVVMIQPSLISYTFHSAPEPVLLDVA  641

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLD+YFT+V+FHG+TIAQWRKAGYH QPEHQAFAQLLQ PR+DA++ I++RF
Sbjct  642  AIAADRILLLDAYFTVVIFHGATIAQWRKAGYHNQPEHQAFAQLLQAPRDDADATIKERF  701

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYN+++ P+PGGDIIFTDDVSFEVFLDHLQRL V
Sbjct  702  PVPRLVICDQHGSQARFLLAKLNPSATYNTES-PLPGGDIIFTDDVSFEVFLDHLQRLTV  760

Query  191  Q  189
            Q
Sbjct  761  Q  761



>ref|XP_006445524.1| hypothetical protein CICLE_v10019144mg [Citrus clementina]
 gb|ESR58764.1| hypothetical protein CICLE_v10019144mg [Citrus clementina]
Length=683

 Score =   330 bits (845),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSLISYSFHS PEP LLDV 
Sbjct  504  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVTNSVVMIQPSLISYSFHSGPEPALLDVA  563

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHG+TIAQWRKAGYH QPEHQAFAQLLQ P +DA  I+++RF
Sbjct  564  AIAADRILLLDSYFTVVIFHGATIAQWRKAGYHNQPEHQAFAQLLQAPHDDAGVIMKERF  623

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYNSDA  +PGGDIIFTDDVSFEVFLDHLQRLAV
Sbjct  624  PVPRLVICDQHGSQARFLLAKLNPSATYNSDA-QIPGGDIIFTDDVSFEVFLDHLQRLAV  682

Query  191  Q  189
            Q
Sbjct  683  Q  683



>ref|XP_002526529.1| protein transport protein sec23, putative [Ricinus communis]
 gb|EEF35920.1| protein transport protein sec23, putative [Ricinus communis]
Length=761

 Score =   332 bits (850),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 174/181 (96%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+R+ILNRENV+NSVVMIQPSLISYSFHSVP P LLDV 
Sbjct  582  MFNLRRSQFVQVFNNSPDETAYFRVILNRENVANSVVMIQPSLISYSFHSVPGPALLDVA  641

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHG+TIAQWRKAGYH QPEHQAFAQLLQ PR+DA++II++RF
Sbjct  642  AIAADRILLLDSYFTVVIFHGATIAQWRKAGYHNQPEHQAFAQLLQAPRDDADAIIKERF  701

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+DA P+PGGDI+FTDDVSFEVFLDHLQRLAV
Sbjct  702  PVPRLVVCDQHGSQARFLLAKLNPSATYNTDA-PLPGGDILFTDDVSFEVFLDHLQRLAV  760

Query  191  Q  189
            Q
Sbjct  761  Q  761



>ref|XP_007011443.1| Sec23/Sec24 protein transport family protein isoform 2 [Theobroma 
cacao]
 gb|EOY20253.1| Sec23/Sec24 protein transport family protein isoform 2 [Theobroma 
cacao]
Length=761

 Score =   332 bits (850),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSLISYSF S PEP LLDV 
Sbjct  582  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVANSVVMIQPSLISYSFQSAPEPALLDVA  641

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFTIV+FHGSTIAQWRKAGYH QPEHQAFAQLLQ PR DA++II++RF
Sbjct  642  AIAADRILLLDSYFTIVIFHGSTIAQWRKAGYHNQPEHQAFAQLLQAPRGDADAIIKERF  701

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYNSD    PGGDIIFTDDVSFEVFLDHLQRLAV
Sbjct  702  PVPRLVICDQHGSQARFLLAKLNPSATYNSDGHH-PGGDIIFTDDVSFEVFLDHLQRLAV  760

Query  191  Q  189
            Q
Sbjct  761  Q  761



>ref|XP_011093425.1| PREDICTED: protein transport protein SEC23 isoform X1 [Sesamum 
indicum]
 ref|XP_011093426.1| PREDICTED: protein transport protein SEC23 isoform X2 [Sesamum 
indicum]
 ref|XP_011093427.1| PREDICTED: protein transport protein SEC23 isoform X1 [Sesamum 
indicum]
 ref|XP_011093428.1| PREDICTED: protein transport protein SEC23 isoform X1 [Sesamum 
indicum]
Length=768

 Score =   332 bits (850),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNREN++NSVVMIQPSLISYSF S PEP LLDV 
Sbjct  589  MFHLRRSQFVQVFNNSPDETAYFRMILNRENIANSVVMIQPSLISYSFQSGPEPALLDVA  648

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHE PEHQAFA LLQ PR+DA++IIR+RF
Sbjct  649  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHELPEHQAFAHLLQAPRDDADAIIRERF  708

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYNSD    PGGD+IFTDDVSFEVFLDHLQRLAV
Sbjct  709  PVPRLVICDQHGSQARFLLAKLNPSATYNSDG-VAPGGDVIFTDDVSFEVFLDHLQRLAV  767

Query  191  Q  189
            Q
Sbjct  768  Q  768



>gb|KJB72952.1| hypothetical protein B456_011G205900 [Gossypium raimondii]
 gb|KJB72953.1| hypothetical protein B456_011G205900 [Gossypium raimondii]
Length=761

 Score =   331 bits (849),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 160/181 (88%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSLISYSF S PEP LLDV 
Sbjct  582  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVANSVVMIQPSLISYSFQSAPEPALLDVA  641

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFTIV+FHGSTIAQWRKAGYH QPEHQAFAQLLQ PR+DA++II +RF
Sbjct  642  AIAADRILLLDSYFTIVIFHGSTIAQWRKAGYHNQPEHQAFAQLLQAPRDDADAIINERF  701

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYNSD    PGGDIIFTDDVSFEVFLDHLQRLAV
Sbjct  702  PVPRLVICDQHGSQARFLLAKLNPSATYNSDGHH-PGGDIIFTDDVSFEVFLDHLQRLAV  760

Query  191  Q  189
            Q
Sbjct  761  Q  761



>ref|XP_006464334.1| PREDICTED: protein transport protein SEC23-like [Citrus sinensis]
 gb|KDO85348.1| hypothetical protein CISIN_1g004199mg [Citrus sinensis]
Length=769

 Score =   330 bits (846),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 158/181 (87%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSLISYSFHS PEP LLDV 
Sbjct  590  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVTNSVVMIQPSLISYSFHSGPEPALLDVA  649

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHG+TIAQWRKAGYH QPEHQAFAQLLQ P +DA  I+++RF
Sbjct  650  AIAADRILLLDSYFTVVIFHGATIAQWRKAGYHNQPEHQAFAQLLQAPHDDAGVIMKERF  709

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYNSDA  +PGGDIIFTDDVSFEVFLDHLQRLAV
Sbjct  710  PVPRLVICDQHGSQARFLLAKLNPSATYNSDA-QIPGGDIIFTDDVSFEVFLDHLQRLAV  768

Query  191  Q  189
            Q
Sbjct  769  Q  769



>ref|XP_008460075.1| PREDICTED: protein transport protein SEC23 [Cucumis melo]
Length=761

 Score =   330 bits (845),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 172/181 (95%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSLISY+FHS PEPVLLDV 
Sbjct  582  IFHLRRSQFVQVFNNSPDETAYFRMILNRENVANSVVMIQPSLISYTFHSAPEPVLLDVA  641

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLD+YFT+V+FHG+TIAQWRKAGYH QPEHQAFAQLLQ PR+DA++ I++RF
Sbjct  642  AIAADRILLLDAYFTVVIFHGATIAQWRKAGYHNQPEHQAFAQLLQAPRDDADATIKERF  701

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYN+++  +PGGDIIFTDDVSFEVFLDHLQRL V
Sbjct  702  PVPRLVICDQHGSQARFLLAKLNPSATYNTES-SLPGGDIIFTDDVSFEVFLDHLQRLTV  760

Query  191  Q  189
            Q
Sbjct  761  Q  761



>ref|XP_010939452.1| PREDICTED: protein transport protein SEC23 isoform X1 [Elaeis 
guineensis]
 ref|XP_010939453.1| PREDICTED: protein transport protein SEC23 isoform X1 [Elaeis 
guineensis]
 ref|XP_010939454.1| PREDICTED: protein transport protein SEC23 isoform X1 [Elaeis 
guineensis]
Length=763

 Score =   329 bits (844),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAYYRMILNRENV+NSVVMIQPSLISYSFHSVPEP LLDV 
Sbjct  583  MFHLRRSQFVQVFNNSPDETAYYRMILNRENVANSVVMIQPSLISYSFHSVPEPALLDVT  642

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+VVFHG++IAQWR AGY  Q EHQ FAQLLQ PR+DA++II++RF
Sbjct  643  AIAADRILLLDSYFTVVVFHGASIAQWRNAGYQNQAEHQTFAQLLQAPRDDADAIIKERF  702

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQ+GSQARFLLAKLNPS TYNSD PP PGGD+IFTDDVSF+VFLDHLQRLAV
Sbjct  703  PVPRLVICDQYGSQARFLLAKLNPSVTYNSDNPPPPGGDVIFTDDVSFQVFLDHLQRLAV  762

Query  191  Q  189
            Q
Sbjct  763  Q  763



>ref|XP_004307298.1| PREDICTED: protein transport protein SEC23 [Fragaria vesca subsp. 
vesca]
Length=761

 Score =   329 bits (844),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 172/181 (95%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAYYRMILNRENV+NSVVMIQPSLISYSFHS PEP LLDV 
Sbjct  582  MFHLRRSQFVQVFNNSPDETAYYRMILNRENVTNSVVMIQPSLISYSFHSSPEPALLDVA  641

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDS+FT+V+FHGSTIAQWRKAGY + PEHQAFAQLLQ PR+D+++II++RF
Sbjct  642  AIAADRILLLDSFFTVVIFHGSTIAQWRKAGYQDLPEHQAFAQLLQAPRDDSDTIIKERF  701

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN++  P+PGGD+IFTDDVSFEVFLDHLQRLAV
Sbjct  702  PVPRLVVCDQHGSQARFLLAKLNPSATYNNEG-PLPGGDVIFTDDVSFEVFLDHLQRLAV  760

Query  191  Q  189
            Q
Sbjct  761  Q  761



>ref|XP_010052697.1| PREDICTED: protein transport protein SEC23 [Eucalyptus grandis]
 gb|KCW76763.1| hypothetical protein EUGRSUZ_D01124 [Eucalyptus grandis]
Length=762

 Score =   329 bits (843),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV NSVVMIQPSLISYSFHS PEP  LDV 
Sbjct  583  IFHLRRSQFVQVFNNSPDETAYFRMILNRENVVNSVVMIQPSLISYSFHSGPEPAFLDVA  642

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHG+TIAQWRKAGY  QPEHQAFAQLLQ P +DA++II++RF
Sbjct  643  AIAADRILLLDSYFTVVIFHGATIAQWRKAGYQNQPEHQAFAQLLQAPCDDADTIIKERF  702

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYNS+A PVPGGD+IFTDDVSFEVFLDHLQRLAV
Sbjct  703  PVPRLVVCDQHGSQARFLLAKLNPSATYNSEA-PVPGGDVIFTDDVSFEVFLDHLQRLAV  761

Query  191  Q  189
            Q
Sbjct  762  Q  762



>ref|XP_009361354.1| PREDICTED: protein transport protein SEC23-like [Pyrus x bretschneideri]
Length=761

 Score =   329 bits (843),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 155/181 (86%), Positives = 171/181 (94%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSLISYSFHS PEP LLDV 
Sbjct  582  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVTNSVVMIQPSLISYSFHSGPEPALLDVA  641

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLD+YFT+V+FHGSTIAQWRKAGY + PEHQAFAQLLQ PR+D + II++RF
Sbjct  642  AIAADRILLLDAYFTVVIFHGSTIAQWRKAGYQDLPEHQAFAQLLQAPRDDGDQIIKERF  701

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYN++A P+PGGD+IFTDDVSFEVFLDHLQRLAV
Sbjct  702  PVPRLVICDQHGSQARFLLAKLNPSATYNNEA-PLPGGDVIFTDDVSFEVFLDHLQRLAV  760

Query  191  Q  189
            Q
Sbjct  761  Q  761



>ref|XP_009376310.1| PREDICTED: protein transport protein SEC23-like [Pyrus x bretschneideri]
Length=761

 Score =   328 bits (841),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 171/181 (94%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVM+QPSLISYSFHS PEP LLDV 
Sbjct  582  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVTNSVVMLQPSLISYSFHSGPEPALLDVA  641

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLD+YFT+V+FHGSTIAQWRKAGY + PEHQAFAQLLQ PR+D + II++RF
Sbjct  642  AIAADRILLLDAYFTVVIFHGSTIAQWRKAGYQDLPEHQAFAQLLQAPRDDGDQIIKERF  701

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYN++A P+PGGD+IFTDDVSFEVFLDHLQRLAV
Sbjct  702  PVPRLVICDQHGSQARFLLAKLNPSATYNNEA-PLPGGDVIFTDDVSFEVFLDHLQRLAV  760

Query  191  Q  189
            Q
Sbjct  761  Q  761



>gb|KJB78638.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=745

 Score =   328 bits (840),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSL+SYSF SVPEP LLDV 
Sbjct  566  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVANSVVMIQPSLVSYSFQSVPEPALLDVT  625

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHGSTIAQWRKAGYH+QPEHQAFAQLLQ PR+DA++II +RF
Sbjct  626  AIAADRILLLDSYFTVVIFHGSTIAQWRKAGYHDQPEHQAFAQLLQAPRDDADAIINERF  685

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSA+ NSD    PGGDIIFTDDVSFEVFLDHLQRLAV
Sbjct  686  PVPRLVICDQHGSQARFLLAKLNPSASCNSDGHG-PGGDIIFTDDVSFEVFLDHLQRLAV  744

Query  191  Q  189
            Q
Sbjct  745  Q  745



>ref|XP_008344985.1| PREDICTED: protein transport protein SEC23 [Malus domestica]
Length=761

 Score =   328 bits (841),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 171/181 (94%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVM+QPSLISYSFHS PEP LLDV 
Sbjct  582  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVTNSVVMLQPSLISYSFHSGPEPALLDVA  641

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLD+YFT+V+FHGSTIAQWRKAGY + PEHQAFAQLLQ PR+D + II++RF
Sbjct  642  AIAADRILLLDAYFTVVIFHGSTIAQWRKAGYQDLPEHQAFAQLLQAPRDDGDQIIKERF  701

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYN++A P+PGGD+IFTDDVSFEVFLDHLQRLAV
Sbjct  702  PVPRLVICDQHGSQARFLLAKLNPSATYNNEA-PLPGGDVIFTDDVSFEVFLDHLQRLAV  760

Query  191  Q  189
            Q
Sbjct  761  Q  761



>ref|XP_012087535.1| PREDICTED: protein transport protein SEC23 [Jatropha curcas]
 ref|XP_012087536.1| PREDICTED: protein transport protein SEC23 [Jatropha curcas]
Length=761

 Score =   328 bits (841),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 156/181 (86%), Positives = 171/181 (94%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+R+ILNRENV+NSVVMIQPSLISYSFHS PEP LLDV 
Sbjct  582  MFHLRRSQFVQVFNNSPDETAYFRVILNRENVANSVVMIQPSLISYSFHSGPEPSLLDVA  641

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHGSTIAQWRKAGYH QPEHQAFAQLLQ PR+D ++II++RF
Sbjct  642  AIAADRILLLDSYFTVVIFHGSTIAQWRKAGYHNQPEHQAFAQLLQAPRDDVDAIIKERF  701

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYN+DA  + GGDI+FTDDVSFEVFLDHLQRLAV
Sbjct  702  PVPRLVICDQHGSQARFLLAKLNPSATYNTDA-ALSGGDILFTDDVSFEVFLDHLQRLAV  760

Query  191  Q  189
            Q
Sbjct  761  Q  761



>gb|KJB78634.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
 gb|KJB78635.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
 gb|KJB78637.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=757

 Score =   328 bits (840),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSL+SYSF SVPEP LLDV 
Sbjct  578  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVANSVVMIQPSLVSYSFQSVPEPALLDVT  637

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHGSTIAQWRKAGYH+QPEHQAFAQLLQ PR+DA++II +RF
Sbjct  638  AIAADRILLLDSYFTVVIFHGSTIAQWRKAGYHDQPEHQAFAQLLQAPRDDADAIINERF  697

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSA+ NSD    PGGDIIFTDDVSFEVFLDHLQRLAV
Sbjct  698  PVPRLVICDQHGSQARFLLAKLNPSASCNSDGHG-PGGDIIFTDDVSFEVFLDHLQRLAV  756

Query  191  Q  189
            Q
Sbjct  757  Q  757



>gb|EEC83731.1| hypothetical protein OsI_29579 [Oryza sativa Indica Group]
Length=478

 Score =   320 bits (819),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRENV+N+VVMIQPSLISYSF S PEPVLLDV 
Sbjct  298  MFNLRRSQFVQVFNNSPDETAYFRMMLNRENVANAVVMIQPSLISYSFQSGPEPVLLDVT  357

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFTIV+FHG TIAQWRKAGY +Q  H+AFAQLL+ PRE+ +SII++RF
Sbjct  358  AIAADRILLLDSYFTIVIFHGITIAQWRKAGYQDQQGHEAFAQLLKAPREETDSIIKERF  417

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQ+GSQARFLLAKLNPS TYNSD PP PGGD+IFTDDVSFEVF+DHLQRLAV
Sbjct  418  PVPRLVVCDQYGSQARFLLAKLNPSVTYNSDNPPPPGGDVIFTDDVSFEVFMDHLQRLAV  477

Query  191  Q  189
            Q
Sbjct  478  Q  478



>ref|XP_008232223.1| PREDICTED: protein transport protein SEC23 [Prunus mume]
 ref|XP_008232224.1| PREDICTED: protein transport protein SEC23 [Prunus mume]
Length=761

 Score =   327 bits (839),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSLISYSFHS PEP LLDV 
Sbjct  582  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVANSVVMIQPSLISYSFHSGPEPALLDVA  641

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLD+YFT+V+FHGSTIAQWRKAGY + PEHQAFAQLLQ PR+D + II++RF
Sbjct  642  AIAADRILLLDAYFTVVIFHGSTIAQWRKAGYQDLPEHQAFAQLLQAPRDDGDQIIKERF  701

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYN++A P+PGGD+IFTDDV FEVFLDHLQRLAV
Sbjct  702  PVPRLVICDQHGSQARFLLAKLNPSATYNNEA-PLPGGDVIFTDDVGFEVFLDHLQRLAV  760

Query  191  Q  189
            Q
Sbjct  761  Q  761



>gb|KHG07260.1| Protein transport SEC23 [Gossypium arboreum]
Length=761

 Score =   327 bits (839),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 157/181 (87%), Positives = 171/181 (94%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSLISYSF SVPEP LLDV 
Sbjct  582  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVANSVVMIQPSLISYSFQSVPEPALLDVT  641

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHGSTIAQWRKAGYH+QPEHQAFAQLLQ PR+DA++II++RF
Sbjct  642  AIAADRILLLDSYFTVVIFHGSTIAQWRKAGYHDQPEHQAFAQLLQAPRDDADAIIKERF  701

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQ+GSQARFLLAKLNPSA+ NSD    PGGDIIFTDDVSFEVFLDHLQRLAV
Sbjct  702  PVPRLVICDQYGSQARFLLAKLNPSASCNSDGHR-PGGDIIFTDDVSFEVFLDHLQRLAV  760

Query  191  Q  189
            Q
Sbjct  761  Q  761



>ref|XP_007011442.1| Sec23/Sec24 protein transport family protein isoform 1 [Theobroma 
cacao]
 gb|EOY20252.1| Sec23/Sec24 protein transport family protein isoform 1 [Theobroma 
cacao]
Length=998

 Score =   332 bits (852),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 170/183 (93%), Gaps = 1/183 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSLISYSF S PEP LLDV 
Sbjct  582  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVANSVVMIQPSLISYSFQSAPEPALLDVA  641

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFTIV+FHGSTIAQWRKAGYH QPEHQAFAQLLQ PR DA++II++RF
Sbjct  642  AIAADRILLLDSYFTIVIFHGSTIAQWRKAGYHNQPEHQAFAQLLQAPRGDADAIIKERF  701

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYNSD    PGGDIIFTDDVSFEVFLDHLQRLAV
Sbjct  702  PVPRLVICDQHGSQARFLLAKLNPSATYNSDGHH-PGGDIIFTDDVSFEVFLDHLQRLAV  760

Query  191  Q*K  183
            Q K
Sbjct  761  QTK  763



>ref|XP_007220245.1| hypothetical protein PRUPE_ppa001813mg [Prunus persica]
 gb|EMJ21444.1| hypothetical protein PRUPE_ppa001813mg [Prunus persica]
Length=761

 Score =   327 bits (839),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSLISYSFHS PEP LLDV 
Sbjct  582  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVANSVVMIQPSLISYSFHSGPEPALLDVA  641

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLD+YFT+V+FHGSTIAQWRKAGY + PEHQAFAQLLQ PR+D + II++RF
Sbjct  642  AIAADRILLLDAYFTVVIFHGSTIAQWRKAGYQDLPEHQAFAQLLQAPRDDGDQIIKERF  701

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYN++A P+PGGD+IFTDDV FEVFLDHLQRLAV
Sbjct  702  PVPRLVICDQHGSQARFLLAKLNPSATYNNEA-PLPGGDVIFTDDVGFEVFLDHLQRLAV  760

Query  191  Q  189
            Q
Sbjct  761  Q  761



>ref|XP_011010741.1| PREDICTED: protein transport protein SEC23-like [Populus euphratica]
Length=765

 Score =   327 bits (838),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+R+ILNRENV+NS VMIQPSLISYSFHS PEP LLDV 
Sbjct  586  MFHLRRSQFVQVFNNSPDETAYFRVILNRENVANSAVMIQPSLISYSFHSGPEPALLDVA  645

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHG+TIAQWRKAGYH QPEHQAFAQLLQ P +DA+ II++RF
Sbjct  646  AIAADRILLLDSYFTVVIFHGATIAQWRKAGYHNQPEHQAFAQLLQAPHDDADEIIKERF  705

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYNSD+  +PGGD++FTDDVSFEVFLDHLQRLAV
Sbjct  706  PVPRLVICDQHGSQARFLLAKLNPSATYNSDS-LLPGGDVLFTDDVSFEVFLDHLQRLAV  764

Query  191  Q  189
            Q
Sbjct  765  Q  765



>ref|XP_010097714.1| Protein transport protein SEC23 [Morus notabilis]
 gb|EXB70669.1| Protein transport protein SEC23 [Morus notabilis]
Length=756

 Score =   327 bits (838),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAYYRMILNRENV+NSVVMIQPSLISYSFH+ PEP  LDV 
Sbjct  577  VFHLRRSQFVQVFNNSPDETAYYRMILNRENVANSVVMIQPSLISYSFHTAPEPAFLDVA  636

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+VVFHGSTIAQWRKAGYH  PEH AFA LLQ PR+DA++I+++RF
Sbjct  637  AIAADRILLLDSYFTVVVFHGSTIAQWRKAGYHTMPEHLAFALLLQAPRDDADAIVKERF  696

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLA+LNPSATYN+DA P+PGGDIIFTDDVSFEVF+DHL+RLAV
Sbjct  697  PVPRLVVCDQHGSQARFLLARLNPSATYNNDA-PLPGGDIIFTDDVSFEVFMDHLKRLAV  755

Query  191  Q  189
            Q
Sbjct  756  Q  756



>ref|XP_006375610.1| hypothetical protein POPTR_0014s17660g [Populus trichocarpa]
 gb|ERP53407.1| hypothetical protein POPTR_0014s17660g [Populus trichocarpa]
Length=765

 Score =   327 bits (837),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+R+ILNRENV+NS VMIQPSLISYSFHS PEP LLDV 
Sbjct  586  MFHLRRSQFVQVFNNSPDETAYFRVILNRENVANSAVMIQPSLISYSFHSGPEPALLDVA  645

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHG+TIAQWRKAGYH QPEHQAFAQLLQ P +DA+ II++RF
Sbjct  646  AIAADRILLLDSYFTVVIFHGATIAQWRKAGYHNQPEHQAFAQLLQAPHDDADEIIKERF  705

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYNSD+  +PGGD++FTDDVSFEVFLDHLQRLAV
Sbjct  706  PVPRLVICDQHGSQARFLLAKLNPSATYNSDS-LLPGGDVLFTDDVSFEVFLDHLQRLAV  764

Query  191  Q  189
            Q
Sbjct  765  Q  765



>ref|XP_002320574.1| transport family protein [Populus trichocarpa]
 gb|EEE98889.1| transport family protein [Populus trichocarpa]
Length=773

 Score =   327 bits (838),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+R+ILNRENV+NS VMIQPSLISYSFHS PEP LLDV 
Sbjct  594  MFHLRRSQFVQVFNNSPDETAYFRVILNRENVANSAVMIQPSLISYSFHSGPEPALLDVA  653

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHG+TIAQWRKAGYH QPEHQAFAQLLQ P +DA+ II++RF
Sbjct  654  AIAADRILLLDSYFTVVIFHGATIAQWRKAGYHNQPEHQAFAQLLQAPHDDADEIIKERF  713

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYNSD+  +PGGD++FTDDVSFEVFLDHLQRLAV
Sbjct  714  PVPRLVICDQHGSQARFLLAKLNPSATYNSDS-LLPGGDVLFTDDVSFEVFLDHLQRLAV  772

Query  191  Q  189
            Q
Sbjct  773  Q  773



>gb|EYU42283.1| hypothetical protein MIMGU_mgv1a001723mg [Erythranthe guttata]
Length=769

 Score =   325 bits (833),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RMILNRENVSNSVVMIQPSLISYSFHS PEP LLDV 
Sbjct  589  MFNLRRSQFVQVFNNSPDETAYFRMILNRENVSNSVVMIQPSLISYSFHSGPEPALLDVI  648

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYFT+VVFHGST+AQWRKAGYH+ PEH AFA LL+ PR++A++II++RF
Sbjct  649  SIAADRILLLDSYFTVVVFHGSTVAQWRKAGYHDLPEHHAFANLLKAPRDEADAIIKERF  708

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYNS+    PGGDIIFTDDVSFEVFLDHLQRL V
Sbjct  709  PVPRLVICDQHGSQARFLLAKLNPSATYNSNGAVAPGGDIIFTDDVSFEVFLDHLQRLTV  768

Query  191  Q  189
            Q
Sbjct  769  Q  769



>ref|XP_010255698.1| PREDICTED: protein transport protein SEC23-like [Nelumbo nucifera]
 ref|XP_010255700.1| PREDICTED: protein transport protein SEC23-like [Nelumbo nucifera]
Length=764

 Score =   325 bits (833),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENVSNSVVMIQPSLISYSFH+ PEP LLDV 
Sbjct  585  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVSNSVVMIQPSLISYSFHTGPEPALLDVA  644

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +I ADRILLLDSYFT+V+FHG TIAQWRKAGY +Q EH+AFAQLLQ PR+DA++I+++RF
Sbjct  645  AIGADRILLLDSYFTVVIFHGVTIAQWRKAGYQDQAEHKAFAQLLQAPRDDADAILKERF  704

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PV RLV+CDQHGSQARFLLAKLNPSATYNS +PP PGGDIIFTDDVSFEVFLDHLQRLAV
Sbjct  705  PVARLVVCDQHGSQARFLLAKLNPSATYNSTSPP-PGGDIIFTDDVSFEVFLDHLQRLAV  763

Query  191  Q  189
            Q
Sbjct  764  Q  764



>ref|XP_011024746.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Populus 
euphratica]
Length=766

 Score =   325 bits (832),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+R+ LNRENV+NSVVMIQPSLISYSFHS PEP LLDV 
Sbjct  587  MFHLRRSQFVQVFNNSPDETAYFRVTLNRENVANSVVMIQPSLISYSFHSGPEPALLDVA  646

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHG+TIAQWRKAGYH QPEHQAFAQLLQ PR+D + II++RF
Sbjct  647  AIAADRILLLDSYFTVVIFHGATIAQWRKAGYHNQPEHQAFAQLLQAPRDDTDEIIKERF  706

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSA+YNSD+ P+P GD++FTDDVSFEVFLDHLQRL V
Sbjct  707  PVPRLVICDQHGSQARFLLAKLNPSASYNSDS-PLPSGDVLFTDDVSFEVFLDHLQRLVV  765

Query  191  Q  189
            Q
Sbjct  766  Q  766



>ref|XP_011024747.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Populus 
euphratica]
Length=765

 Score =   325 bits (832),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+R+ LNRENV+NSVVMIQPSLISYSFHS PEP LLDV 
Sbjct  586  MFHLRRSQFVQVFNNSPDETAYFRVTLNRENVANSVVMIQPSLISYSFHSGPEPALLDVA  645

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHG+TIAQWRKAGYH QPEHQAFAQLLQ PR+D + II++RF
Sbjct  646  AIAADRILLLDSYFTVVIFHGATIAQWRKAGYHNQPEHQAFAQLLQAPRDDTDEIIKERF  705

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSA+YNSD+ P+P GD++FTDDVSFEVFLDHLQRL V
Sbjct  706  PVPRLVICDQHGSQARFLLAKLNPSASYNSDS-PLPSGDVLFTDDVSFEVFLDHLQRLVV  764

Query  191  Q  189
            Q
Sbjct  765  Q  765



>ref|XP_009387153.1| PREDICTED: protein transport protein SEC23 [Musa acuminata subsp. 
malaccensis]
Length=763

 Score =   324 bits (831),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAYYRMILNRENV+N+VVMIQPSLISYSFHS PEPVLLDV 
Sbjct  583  MFHLRRSQFVQVFNNSPDETAYYRMILNRENVANAVVMIQPSLISYSFHSAPEPVLLDVT  642

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+VVFHG +IAQWR AGY  QPEH+ FA LLQ PR++A++I ++RF
Sbjct  643  AIAADRILLLDSYFTVVVFHGISIAQWRNAGYQNQPEHETFAHLLQAPRDEADAITKERF  702

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLL KLNPS TYNSD PP PGGDIIFTDDVSF+VFLDHLQRLAV
Sbjct  703  PVPRLVVCDQHGSQARFLLVKLNPSVTYNSDNPPPPGGDIIFTDDVSFQVFLDHLQRLAV  762

Query  191  Q  189
            Q
Sbjct  763  Q  763



>gb|EEE68856.1| hypothetical protein OsJ_27655 [Oryza sativa Japonica Group]
Length=528

 Score =   317 bits (813),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRENV+N+VVMIQPSLISYSF S PEPVLLDV 
Sbjct  348  MFNLRRSQFVQVFNNSPDETAYFRMMLNRENVANAVVMIQPSLISYSFQSGPEPVLLDVT  407

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFTIV+FHG TIAQWRKAGY +Q  H+AFAQLL+ PRE+ +SII++RF
Sbjct  408  AIAADRILLLDSYFTIVIFHGITIAQWRKAGYQDQQGHEAFAQLLKAPREETDSIIKERF  467

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQ+GSQARFLLAKLNPS TYNSD PP PGGD+IFTDDVSFEVF+DHLQRLAV
Sbjct  468  PVPRLVVCDQYGSQARFLLAKLNPSVTYNSDNPPPPGGDVIFTDDVSFEVFMDHLQRLAV  527

Query  191  Q  189
            Q
Sbjct  528  Q  528



>ref|XP_002265101.1| PREDICTED: protein transport protein SEC23 [Vitis vinifera]
Length=761

 Score =   323 bits (828),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSLISYSFHS PEP LLDV 
Sbjct  582  IFHLRRSQFVQVFNNSPDETAYFRMILNRENVANSVVMIQPSLISYSFHSGPEPALLDVA  641

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+VVFHG+TIAQWR AGY  QPEH+ FAQLL+ PR+DA++II++RF
Sbjct  642  AIAADRILLLDSYFTVVVFHGATIAQWRNAGYQNQPEHEVFAQLLRAPRDDADAIIKERF  701

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYNS A  +PGGDI+FTDDVSFEVFLDHLQRLAV
Sbjct  702  PVPRLVICDQHGSQARFLLAKLNPSATYNS-ASSLPGGDILFTDDVSFEVFLDHLQRLAV  760

Query  191  Q  189
            Q
Sbjct  761  Q  761



>gb|EPS65594.1| hypothetical protein M569_09173 [Genlisea aurea]
Length=769

 Score =   323 bits (828),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY++MILNRE+V+NSVVMIQPSLISYSF S PEPVLLDV 
Sbjct  589  MFHLRRSQFVQVFNNSPDETAYFQMILNRESVTNSVVMIQPSLISYSFQSEPEPVLLDVA  648

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAAD+IL+LDSYF +V+FHGSTIAQWRKAGY E PEHQAFA LLQ P  D+++IIRDRF
Sbjct  649  SIAADKILVLDSYFAVVIFHGSTIAQWRKAGYQELPEHQAFASLLQMPVNDSDAIIRDRF  708

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYNSD    PGGDIIFTDDVSFEVFLDHLQRLAV
Sbjct  709  PVPRLVICDQHGSQARFLLAKLNPSATYNSDKQAAPGGDIIFTDDVSFEVFLDHLQRLAV  768

Query  191  Q  189
            Q
Sbjct  769  Q  769



>emb|CBI38071.3| unnamed protein product [Vitis vinifera]
Length=800

 Score =   323 bits (828),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 154/181 (85%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSLISYSFHS PEP LLDV 
Sbjct  621  IFHLRRSQFVQVFNNSPDETAYFRMILNRENVANSVVMIQPSLISYSFHSGPEPALLDVA  680

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+VVFHG+TIAQWR AGY  QPEH+ FAQLL+ PR+DA++II++RF
Sbjct  681  AIAADRILLLDSYFTVVVFHGATIAQWRNAGYQNQPEHEVFAQLLRAPRDDADAIIKERF  740

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYNS A  +PGGDI+FTDDVSFEVFLDHLQRLAV
Sbjct  741  PVPRLVICDQHGSQARFLLAKLNPSATYNS-ASSLPGGDILFTDDVSFEVFLDHLQRLAV  799

Query  191  Q  189
            Q
Sbjct  800  Q  800



>ref|XP_008797246.1| PREDICTED: protein transport protein SEC23 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008797247.1| PREDICTED: protein transport protein SEC23 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008797248.1| PREDICTED: protein transport protein SEC23 isoform X1 [Phoenix 
dactylifera]
Length=763

 Score =   320 bits (821),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 151/181 (83%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAYYRMILNRENV+NSVVMIQPSLISYSF S PEP LLDV 
Sbjct  583  MFHLRRSQFVQVFNNSPDETAYYRMILNRENVANSVVMIQPSLISYSFQSDPEPALLDVT  642

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYF +VVFHG++IAQWR AGY  Q EHQ FAQLLQ PR+DA++I ++RF
Sbjct  643  AIAADRILLLDSYFIVVVFHGASIAQWRNAGYQNQAEHQPFAQLLQAPRDDADAIAKERF  702

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQ+GSQARFLLAKLNPS TYNSD PP PGGD+IFTDDVSF+VFLDHLQRLAV
Sbjct  703  PVPRLVICDQYGSQARFLLAKLNPSVTYNSDNPPAPGGDVIFTDDVSFQVFLDHLQRLAV  762

Query  191  Q  189
            Q
Sbjct  763  Q  763



>ref|NP_001062030.1| Os08g0474700 [Oryza sativa Japonica Group]
 dbj|BAD09341.1| putative SEC23 [Oryza sativa Japonica Group]
 dbj|BAF23944.1| Os08g0474700 [Oryza sativa Japonica Group]
Length=763

 Score =   320 bits (819),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 168/181 (93%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRENV+N+VVMIQPSLISYSF S PEPVLLDV 
Sbjct  583  MFNLRRSQFVQVFNNSPDETAYFRMMLNRENVANAVVMIQPSLISYSFQSGPEPVLLDVT  642

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFTIV+FHG TIAQWRKAGY +Q  H+AFAQLL+ PRE+ +SII++RF
Sbjct  643  AIAADRILLLDSYFTIVIFHGITIAQWRKAGYQDQQGHEAFAQLLKAPREETDSIIKERF  702

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQ+GSQARFLLAKLNPS TYNSD PP PGGD+IFTDDVSFEVF+DHLQRLAV
Sbjct  703  PVPRLVVCDQYGSQARFLLAKLNPSVTYNSDNPPPPGGDVIFTDDVSFEVFMDHLQRLAV  762

Query  191  Q  189
            Q
Sbjct  763  Q  763



>ref|XP_004510207.1| PREDICTED: protein transport protein SEC23-like [Cicer arietinum]
Length=762

 Score =   318 bits (814),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVM+QPSLISYSFHS PEP LLDV 
Sbjct  583  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVTNSVVMVQPSLISYSFHSGPEPALLDVA  642

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADR+LLLDS+FT+V+FHGSTIAQWRKAGYH +PEHQAFAQLL+ P +D++ I+++RF
Sbjct  643  AIAADRVLLLDSFFTVVIFHGSTIAQWRKAGYHNEPEHQAFAQLLRAPHDDSDLIMKERF  702

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATY ++A  +PGGDIIFTDDVSFEVFLDHLQRL V
Sbjct  703  PVPRLVVCDQHGSQARFLLAKLNPSATYTTEA-SLPGGDIIFTDDVSFEVFLDHLQRLVV  761

Query  191  Q  189
            Q
Sbjct  762  Q  762



>ref|XP_003626854.1| Protein transport protein SEC23 [Medicago truncatula]
 gb|AET01330.1| protein transporter Sec23-like protein [Medicago truncatula]
Length=763

 Score =   317 bits (813),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 170/181 (94%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVM+QPSLISYSFHS PEP LLDV 
Sbjct  584  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVTNSVVMVQPSLISYSFHSGPEPTLLDVA  643

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADR+LLLD++FT+V+FHGSTIAQWRKAGYH +PEHQAFAQLL+ P +D++ I+++RF
Sbjct  644  AIAADRVLLLDAFFTVVIFHGSTIAQWRKAGYHNEPEHQAFAQLLRAPHDDSDLIMKERF  703

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN++A  +PGGDIIFTDDVSF+VFLDHLQRL V
Sbjct  704  PVPRLVVCDQHGSQARFLLAKLNPSATYNTEA-SLPGGDIIFTDDVSFDVFLDHLQRLVV  762

Query  191  Q  189
            Q
Sbjct  763  Q  763



>ref|XP_010531432.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
Length=766

 Score =   317 bits (811),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 152/181 (84%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RMILNRENVSNSVVMIQPSLIS+SFHS PEP++LDV 
Sbjct  585  MFNLRRSQFVQVFNNSPDETAYFRMILNRENVSNSVVMIQPSLISFSFHSEPEPIILDVS  644

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYFT+V+FHG TIAQWRKAGYH QPEHQAFA LLQ PR+ A  II +RF
Sbjct  645  SIAADRILLLDSYFTVVIFHGMTIAQWRKAGYHNQPEHQAFAHLLQAPRDYANVIISERF  704

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P PRLVICDQHGSQARFLLAKLNPSAT N+DAP   GGDIIFTDD SFEVFLDHLQRL V
Sbjct  705  PSPRLVICDQHGSQARFLLAKLNPSATCNTDAPIGGGGDIIFTDDASFEVFLDHLQRLVV  764

Query  191  Q  189
            Q
Sbjct  765  Q  765



>ref|XP_006854134.1| PREDICTED: protein transport protein SEC23 [Amborella trichopoda]
 gb|ERN15601.1| hypothetical protein AMTR_s00048p00165750 [Amborella trichopoda]
Length=762

 Score =   316 bits (810),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 166/181 (92%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRENV+NSVVMIQPSLISYSFHS PEP LLDV 
Sbjct  583  IFNLRRSQFVQVFNNSPDETAYFRMVLNRENVTNSVVMIQPSLISYSFHSGPEPALLDVA  642

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYFT+V+FHG T+AQWR AGY  Q EH+ FA LLQ PR++A++II++RF
Sbjct  643  SIAADRILLLDSYFTVVIFHGVTVAQWRNAGYQNQEEHKIFALLLQAPRDEADTIIKERF  702

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLL KLNPSATYNSDA P PGGDIIFTDDVSFEVF+DHLQRLAV
Sbjct  703  PVPRLVICDQHGSQARFLLVKLNPSATYNSDARP-PGGDIIFTDDVSFEVFMDHLQRLAV  761

Query  191  Q  189
            Q
Sbjct  762  Q  762



>ref|XP_003521007.1| PREDICTED: protein transport protein SEC23-like [Glycine max]
Length=767

 Score =   316 bits (810),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 148/181 (82%), Positives = 169/181 (93%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVM+QPSLISYSFH+ PEP LLDV 
Sbjct  588  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVANSVVMVQPSLISYSFHAGPEPALLDVA  647

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAAD+ILLLDS+FT+V+FHGSTIAQWRKAGYH +PEHQAFAQLL+ P +DA+ II++RF
Sbjct  648  AIAADKILLLDSFFTVVIFHGSTIAQWRKAGYHNEPEHQAFAQLLRAPHDDADLIIKERF  707

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+++   PGGDIIFTDDVSF+VFLDHLQRL V
Sbjct  708  PVPRLVVCDQHGSQARFLLAKLNPSATYNTESYN-PGGDIIFTDDVSFDVFLDHLQRLVV  766

Query  191  Q  189
            Q
Sbjct  767  Q  767



>ref|XP_007134267.1| hypothetical protein PHAVU_010G032700g [Phaseolus vulgaris]
 gb|ESW06261.1| hypothetical protein PHAVU_010G032700g [Phaseolus vulgaris]
Length=764

 Score =   316 bits (809),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 149/181 (82%), Positives = 167/181 (92%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FH RRSQFVQVF NSPDETAY+RMILNRENV+NSVVM+QPSLISYSFHS PEP LLDV 
Sbjct  585  MFHFRRSQFVQVFNNSPDETAYFRMILNRENVANSVVMVQPSLISYSFHSGPEPALLDVA  644

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAAD+ILLLDS+FT+V+FHGSTIAQWRKAGYH +PEHQAFAQLL+ P +D++ II++RF
Sbjct  645  AIAADKILLLDSFFTVVIFHGSTIAQWRKAGYHNEPEHQAFAQLLRAPHDDSDLIIKERF  704

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYN++    PGGDIIFTDDVSFEVFLDHLQRL V
Sbjct  705  PVPRLVICDQHGSQARFLLAKLNPSATYNTENYN-PGGDIIFTDDVSFEVFLDHLQRLVV  763

Query  191  Q  189
            Q
Sbjct  764  Q  764



>ref|XP_004502261.1| PREDICTED: protein transport protein Sec23A-like [Cicer arietinum]
Length=339

 Score =   303 bits (776),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+ VMIQPSLISYSF+S+P P LLDV 
Sbjct  158  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNAAVMIQPSLISYSFNSLPAPALLDVA  217

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF++V+FHG TIAQWR  GY  QPEHQAFAQLL+ P++DA+++IRDRF
Sbjct  218  SIAADRILLLDSYFSVVIFHGMTIAQWRNLGYQNQPEHQAFAQLLRAPQDDAQAVIRDRF  277

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  278  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMAAGSDVIFTDDVSLQVFFEHLQRLAV  337

Query  191  Q  189
            Q
Sbjct  338  Q  338



>ref|XP_010691934.1| PREDICTED: protein transport protein SEC23 [Beta vulgaris subsp. 
vulgaris]
Length=769

 Score =   315 bits (808),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 166/181 (92%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSLISYSF S PEP LLDV 
Sbjct  589  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVANSVVMIQPSLISYSFQSSPEPALLDVA  648

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            S+AADRILLLDSYFTIV+FHG+T+AQWRKAGY + PEH+AFA+LLQ P++D +++I++RF
Sbjct  649  SVAADRILLLDSYFTIVIFHGATVAQWRKAGYQDMPEHKAFAELLQAPKDDVDALIKERF  708

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P PRLVICDQ+GSQARFLLAKLNPSATYNS +   PGGD+IFTDDVSFEVFLDHLQRL V
Sbjct  709  PAPRLVICDQYGSQARFLLAKLNPSATYNSGSALQPGGDLIFTDDVSFEVFLDHLQRLTV  768

Query  191  Q  189
            Q
Sbjct  769  Q  769



>gb|KDO52831.1| hypothetical protein CISIN_1g0042382mg, partial [Citrus sinensis]
Length=353

 Score =   303 bits (777),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN++N+ VMIQPSLISYSF+S+P+P LLDV 
Sbjct  172  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVA  231

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++V+FHG TIAQWR  GY  QPEHQAFAQLL+ P +DAE IIRDRF
Sbjct  232  SIAADRILLLDTYFSVVIFHGMTIAQWRNMGYQNQPEHQAFAQLLRAPHDDAELIIRDRF  291

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF++HLQRLAV
Sbjct  292  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEIAAGSDIIFTDDVSLQVFIEHLQRLAV  351

Query  191  Q  189
            Q
Sbjct  352  Q  352



>ref|XP_003547758.1| PREDICTED: protein transport protein SEC23-like [Glycine max]
Length=765

 Score =   314 bits (805),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 167/181 (92%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVM+QPSLI YSFH+ PEP LLDV 
Sbjct  586  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVTNSVVMVQPSLICYSFHAGPEPALLDVA  645

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAAD+ILLLDS+FT+V+FHGSTIAQWRKAGYH +PEHQAFAQLL  P +D++ II++RF
Sbjct  646  AIAADKILLLDSFFTVVIFHGSTIAQWRKAGYHNEPEHQAFAQLLLAPHDDSDLIIKERF  705

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+++   PGGDIIFTDDVSFEVFLDHLQRL V
Sbjct  706  PVPRLVVCDQHGSQARFLLAKLNPSATYNTESYN-PGGDIIFTDDVSFEVFLDHLQRLVV  764

Query  191  Q  189
            Q
Sbjct  765  Q  765



>gb|KHN32738.1| Protein transport protein SEC23 [Glycine soja]
Length=765

 Score =   314 bits (804),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 147/181 (81%), Positives = 167/181 (92%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVM+QPSLI YSFH+ PEP LLDV 
Sbjct  586  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVTNSVVMVQPSLICYSFHAGPEPALLDVA  645

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAAD+ILLLDS+FT+V+FHGSTIAQWRKAGYH +PEHQAFAQLL  P +D++ II++RF
Sbjct  646  AIAADKILLLDSFFTVVIFHGSTIAQWRKAGYHNEPEHQAFAQLLLAPHDDSDLIIKERF  705

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+++   PGGDIIFTDDVSFEVFLDHLQRL V
Sbjct  706  PVPRLVVCDQHGSQARFLLAKLNPSATYNTESYN-PGGDIIFTDDVSFEVFLDHLQRLVV  764

Query  191  Q  189
            Q
Sbjct  765  Q  765



>ref|XP_006659495.1| PREDICTED: protein transport protein SEC23-like [Oryza brachyantha]
Length=763

 Score =   312 bits (800),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+V+N+VVMIQPSLISYSF S PEPVLLDV 
Sbjct  583  MFNLRRSQFVQVFNNSPDETAYFRMMLNREDVTNAVVMIQPSLISYSFQSGPEPVLLDVT  642

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFTIV+FHG TIAQWRKAGY +   H+AFAQLLQ P+E+A+SII++RF
Sbjct  643  AIAADRILLLDSYFTIVIFHGITIAQWRKAGYQDHEGHEAFAQLLQAPQEEADSIIKERF  702

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQ+GSQARFLLAKLNPS TYNSD P  PGGD+IFTDDVSF+VF+DHLQRLAV
Sbjct  703  PVPRLVVCDQYGSQARFLLAKLNPSVTYNSDNPAPPGGDVIFTDDVSFQVFMDHLQRLAV  762

Query  191  Q  189
            Q
Sbjct  763  Q  763



>ref|XP_003574621.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Brachypodium 
distachyon]
Length=763

 Score =   311 bits (798),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRENV+N+VVMIQPSLISYSF S PEPVLLDV 
Sbjct  583  IFNLRRSQFVQVFNNSPDETAYFRMMLNRENVANAVVMIQPSLISYSFQSGPEPVLLDVT  642

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHG TIAQWRKAGY +Q  H+ FAQLLQ P+E+A++II++RF
Sbjct  643  AIAADRILLLDSYFTVVIFHGITIAQWRKAGYQDQEGHEVFAQLLQAPQEEADTIIKERF  702

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQ+GSQARFLLAKLNPS TY+S  PP PGGD+IFTDDVSF+VF+DHLQRLAV
Sbjct  703  PVPRLVVCDQYGSQARFLLAKLNPSVTYDSATPPPPGGDVIFTDDVSFQVFMDHLQRLAV  762

Query  191  Q  189
            Q
Sbjct  763  Q  763



>ref|XP_004973674.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Setaria 
italica]
Length=763

 Score =   311 bits (798),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 167/181 (92%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQV  NSPDETAY+ M+LNRENV+N+VVMIQPSLISYSF S PEPVLLDV 
Sbjct  583  MFNLRRSQFVQVSNNSPDETAYFTMMLNRENVANAVVMIQPSLISYSFQSGPEPVLLDVT  642

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHG TIAQWRKAGY +Q  H+AFAQLLQ P+E+A+++I++RF
Sbjct  643  AIAADRILLLDSYFTVVIFHGVTIAQWRKAGYQDQEGHEAFAQLLQAPKEEADAVIKERF  702

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQ+GSQARFLLAKLNPS TYNSD PP PGGD++FTDDVSF+VF+DHLQRLAV
Sbjct  703  PVPRLVVCDQYGSQARFLLAKLNPSVTYNSDNPPPPGGDVLFTDDVSFQVFMDHLQRLAV  762

Query  191  Q  189
            Q
Sbjct  763  Q  763



>ref|NP_001170490.1| uncharacterized protein LOC100384491 [Zea mays]
 gb|ACR33847.1| unknown [Zea mays]
Length=316

 Score =   297 bits (760),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 162/181 (90%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+L+RENV+N+VVMIQPSLISYSF S PEPVLLD  
Sbjct  137  IFNLRRSQFVQVFNNSPDETAYFRMMLDRENVTNTVVMIQPSLISYSFQSGPEPVLLDAT  196

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IA+D+ILLLDSYFT+V+FHG TIAQWR AGY +Q  H+ FAQLL+ P E+A  II++RF
Sbjct  197  AIASDKILLLDSYFTVVIFHGVTIAQWRNAGYQDQEGHEVFAQLLKAPHEEANLIIKERF  256

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQ+GSQARFLLAKLNPS TYNSD P  PGGD+IFTDDVSF+VF+DHLQRLAV
Sbjct  257  PVPRLVVCDQYGSQARFLLAKLNPSVTYNSDNPS-PGGDVIFTDDVSFQVFMDHLQRLAV  315

Query  191  Q  189
            Q
Sbjct  316  Q  316



>gb|EMS46122.1| Protein transport protein SEC23 [Triticum urartu]
Length=720

 Score =   308 bits (788),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQF+QVF NSPDETAY+RM+LNRENV+N+VVMIQPSLISYSF S PEPVLLDV 
Sbjct  540  IFNLRRSQFIQVFNNSPDETAYFRMMLNRENVANAVVMIQPSLISYSFQSGPEPVLLDVS  599

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IA DRILLLDSYFT+V+FHG TIAQWRKAGY  Q  H+ FAQLLQ P+E+A+SII++RF
Sbjct  600  AIAGDRILLLDSYFTVVIFHGITIAQWRKAGYQHQEGHEVFAQLLQAPQEEADSIIKERF  659

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQ+GSQARFLLAKLNPS TY+SD PP PGGD+IFTDD SF+VF++HLQRLAV
Sbjct  660  PVPRLVVCDQYGSQARFLLAKLNPSVTYDSDTPPPPGGDMIFTDDASFQVFMEHLQRLAV  719

Query  191  Q  189
            Q
Sbjct  720  Q  720



>gb|EMT03462.1| Protein transport protein SEC23 [Aegilops tauschii]
Length=829

 Score =   308 bits (790),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQF+QVF NSPDETAY+RM+LNRENV+N+VVMIQPSLISYSF S PEPVLLDV 
Sbjct  649  IFNLRRSQFIQVFNNSPDETAYFRMMLNRENVANAVVMIQPSLISYSFQSGPEPVLLDVS  708

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IA DRILLLDSYFT+V+FHG TIAQWRKAGY  Q  H+ FAQLLQ P+E+A+SII++RF
Sbjct  709  AIAGDRILLLDSYFTVVIFHGITIAQWRKAGYQHQEGHEVFAQLLQAPQEEADSIIKERF  768

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQ+GSQARFLLAKLNPS TY+SD PP PGGD+IFTDD SF+VF++HLQRLAV
Sbjct  769  PVPRLVVCDQYGSQARFLLAKLNPSVTYDSDTPPPPGGDMIFTDDASFQVFMEHLQRLAV  828

Query  191  Q  189
            Q
Sbjct  829  Q  829



>gb|AFW60720.1| hypothetical protein ZEAMMB73_153144 [Zea mays]
Length=333

 Score =   294 bits (753),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+++NSV MIQPSLIS+SF S P PV LDV 
Sbjct  152  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESITNSVAMIQPSLISFSFDSPPSPVFLDVA  211

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++V+FHG TIAQWR  GY  QPEH+ FAQLLQ P E+A+ II+ RF
Sbjct  212  SIAADRILLLDAYFSVVIFHGMTIAQWRNMGYQNQPEHEQFAQLLQAPHEEAQMIIKGRF  271

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYNS     PG DIIFTDDVSF+VF +HLQRLAV
Sbjct  272  PVPRLVVCDQHGSQARFLLAKLNPSATYNSAHDVAPGSDIIFTDDVSFQVFCEHLQRLAV  331

Query  191  Q  189
            Q
Sbjct  332  Q  332



>ref|XP_010270294.1| PREDICTED: protein transport protein SEC23-like [Nelumbo nucifera]
Length=769

 Score =   305 bits (781),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+ N+VVMIQPSLI+YSFHS+P+P LLDV 
Sbjct  588  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENILNTVVMIQPSLIAYSFHSLPKPALLDVS  647

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI++++ILLLD+YF+IV+FHG TIAQWR AGY  QPEHQAFAQLLQ PR+DA+ IIRDRF
Sbjct  648  SISSEQILLLDAYFSIVIFHGMTIAQWRNAGYQNQPEHQAFAQLLQAPRDDAQMIIRDRF  707

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYNS     PG D+IFTDDVS +VF++HLQRLAV
Sbjct  708  PVPRLVVCDQHGSQARFLLAKLNPSATYNSAHDVAPGSDVIFTDDVSLQVFIEHLQRLAV  767

Query  191  Q  189
            Q
Sbjct  768  Q  768



>ref|XP_007153808.1| hypothetical protein PHAVU_003G066300g [Phaseolus vulgaris]
 gb|ESW25802.1| hypothetical protein PHAVU_003G066300g [Phaseolus vulgaris]
Length=767

 Score =   305 bits (780),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+VVMIQPSLISYSF+S+P P LLDV 
Sbjct  586  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNAVVMIQPSLISYSFNSLPAPALLDVA  645

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+ADRILLLDSYF++V+FHG TIAQWR  GYH QPEHQAFAQLLQ P++DA+ IIR+RF
Sbjct  646  SISADRILLLDSYFSVVIFHGMTIAQWRNMGYHNQPEHQAFAQLLQAPQDDAQVIIRERF  705

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF DHLQ+LAV
Sbjct  706  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMAAGSDVIFTDDVSLQVFFDHLQKLAV  765

Query  191  Q  189
            Q
Sbjct  766  Q  766



>ref|XP_010278782.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010278783.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Nelumbo 
nucifera]
 ref|XP_010278784.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Nelumbo 
nucifera]
Length=766

 Score =   304 bits (779),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 163/181 (90%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQ+F NSPDETAY+RMIL RENVSNSVVMIQPSLISY+    PEP LLDV 
Sbjct  587  MFHLRRSQFVQIFNNSPDETAYFRMILYRENVSNSVVMIQPSLISYTLQKDPEPALLDVA  646

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +I ADRILLLDSYFT+V+FHG TIAQWR AGY + PEH+AFAQLLQ PR+DA++I+++RF
Sbjct  647  AIGADRILLLDSYFTVVIFHGMTIAQWRNAGYQDLPEHKAFAQLLQDPRDDADAILKERF  706

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PV RLVICDQ+GSQARFLLAKLNPSATYN +AP  PGG++IFTDDVSFEVFLDHLQRLAV
Sbjct  707  PVTRLVICDQYGSQARFLLAKLNPSATYNLNAPS-PGGNVIFTDDVSFEVFLDHLQRLAV  765

Query  191  Q  189
            Q
Sbjct  766  Q  766



>ref|XP_007221956.1| hypothetical protein PRUPE_ppa001742mg [Prunus persica]
 ref|XP_007221957.1| hypothetical protein PRUPE_ppa001742mg [Prunus persica]
 gb|EMJ23155.1| hypothetical protein PRUPE_ppa001742mg [Prunus persica]
 gb|EMJ23156.1| hypothetical protein PRUPE_ppa001742mg [Prunus persica]
Length=772

 Score =   304 bits (778),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN++N+ VMIQPSLISYSF+S+P+P LLDV 
Sbjct  591  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVA  650

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF+IV+FHG TIAQWR  GY  QPEHQAFAQLLQ P +D +SIIRDRF
Sbjct  651  SIAADRILLLDSYFSIVIFHGMTIAQWRNMGYQNQPEHQAFAQLLQAPHDDTQSIIRDRF  710

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  711  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMAAGSDVIFTDDVSLQVFFEHLQRLAV  770

Query  191  Q  189
            Q
Sbjct  771  Q  771



>tpg|DAA38855.1| TPA: hypothetical protein ZEAMMB73_253363 [Zea mays]
Length=404

 Score =   293 bits (751),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+++NSV MIQPSLIS+SF S P PV LDV 
Sbjct  223  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESITNSVAMIQPSLISFSFDSPPSPVFLDVA  282

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            S+AADRILLLD+YF++V+FHG TIAQWR  GY  QPEH+ FAQLLQ P EDA+ II+ RF
Sbjct  283  SLAADRILLLDAYFSVVIFHGMTIAQWRNMGYQNQPEHEQFAQLLQAPHEDAQMIIKGRF  342

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYNS     PG DIIFTDDVSF VF +HLQRLAV
Sbjct  343  PVPRLVVCDQHGSQARFLLAKLNPSATYNSAHDVAPGSDIIFTDDVSFLVFCEHLQRLAV  402

Query  191  Q  189
            Q
Sbjct  403  Q  403



>ref|NP_001130412.1| uncharacterized protein LOC100191508 [Zea mays]
 gb|ACF78611.1| unknown [Zea mays]
Length=417

 Score =   294 bits (752),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+++NSV MIQPSLIS+SF S P PV LDV 
Sbjct  236  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESITNSVAMIQPSLISFSFDSPPSPVFLDVA  295

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            S+AADRILLLD+YF++V+FHG TIAQWR  GY  QPEH+ FAQLLQ P EDA+ II+ RF
Sbjct  296  SLAADRILLLDAYFSVVIFHGMTIAQWRNMGYQNQPEHEQFAQLLQAPHEDAQMIIKGRF  355

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYNS     PG DIIFTDDVSF VF +HLQRLAV
Sbjct  356  PVPRLVVCDQHGSQARFLLAKLNPSATYNSAHDVAPGSDIIFTDDVSFLVFCEHLQRLAV  415

Query  191  Q  189
            Q
Sbjct  416  Q  416



>gb|AFX67018.1| protein transport protein Sec23, partial [Solanum tuberosum]
Length=192

 Score =   286 bits (731),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETAY+RM+L RE++SN+VVMIQP+L+++SF+++P P LLDV 
Sbjct  10   MFHLRRSQFLQVFNNSPDETAYFRMLLYRESISNAVVMIQPTLMAFSFNTLPSPALLDVA  69

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF++V+FHG TIAQWR  GY  QPEHQAFA LLQ P ++A+++I++RF
Sbjct  70   SIAADRILLLDSYFSVVIFHGMTIAQWRNLGYQNQPEHQAFAHLLQVPHDEAQALIQERF  129

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF  HLQRLAV
Sbjct  130  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANDMAAGSDVIFTDDVSLQVFFQHLQRLAV  189

Query  191  Q  189
            Q
Sbjct  190  Q  190



>gb|EMS56835.1| Protein transport protein SEC23 [Triticum urartu]
Length=287

 Score =   289 bits (740),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+V+NSV MIQPSLIS+SF S P PV LDV 
Sbjct  106  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESVTNSVAMIQPSLISFSFDSPPSPVFLDVA  165

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIA DRILLLD+YF++V+FHG TIAQWR   Y  QPEHQ FAQLLQ P+E+A+ II  RF
Sbjct  166  SIAVDRILLLDAYFSVVIFHGMTIAQWRNMCYQNQPEHQQFAQLLQAPQEEAQVIINGRF  225

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYNS     PG DIIFTDDVSF+VF +HLQRLAV
Sbjct  226  PVPRLVVCDQHGSQARFLLAKLNPSATYNSAHDVPPGSDIIFTDDVSFQVFCEHLQRLAV  285

Query  191  Q  189
            Q
Sbjct  286  Q  286



>ref|XP_012078435.1| PREDICTED: protein transport protein SEC23-like [Jatropha curcas]
 gb|KDP32574.1| hypothetical protein JCGZ_13124 [Jatropha curcas]
Length=778

 Score =   303 bits (777),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN++N+ VMIQPSLISYSF+S+P+P LLDV 
Sbjct  597  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVA  656

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF++V+FHG TIAQWR  GY  QPEHQAFAQLLQ P+EDA  IIRDRF
Sbjct  657  SIAADRILLLDSYFSVVIFHGMTIAQWRNMGYQNQPEHQAFAQLLQAPQEDAALIIRDRF  716

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  717  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMAAGSDVIFTDDVSLQVFFEHLQRLAV  776

Query  191  Q  189
            Q
Sbjct  777  Q  777



>ref|XP_001774442.1| predicted protein [Physcomitrella patens]
 gb|EDQ60805.1| predicted protein [Physcomitrella patens]
Length=779

 Score =   303 bits (777),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+L+RE V+NS+VMIQPSL+SYSF+S PEP LLDV 
Sbjct  598  MFNLRRSQFVQVFNNSPDETAYFRMVLHRETVTNSLVMIQPSLLSYSFNSPPEPALLDVA  657

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++VVFHG TIAQWR AGYH+  EH AFAQLLQ P++DA++II++RF
Sbjct  658  SIAADRILLLDAYFSVVVFHGMTIAQWRNAGYHKHEEHTAFAQLLQAPQDDAQAIIKERF  717

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQ+GSQARFLLAKLNPSATYNS   P PGGDIIFTDDVS +VF++HL+RLAV
Sbjct  718  PVPRLVVCDQYGSQARFLLAKLNPSATYNSANGPAPGGDIIFTDDVSLQVFMEHLKRLAV  777

Query  191  Q  189
            Q
Sbjct  778  Q  778



>ref|XP_008785319.1| PREDICTED: protein transport protein SEC23-like [Phoenix dactylifera]
 ref|XP_008785320.1| PREDICTED: protein transport protein SEC23-like [Phoenix dactylifera]
 ref|XP_008785321.1| PREDICTED: protein transport protein SEC23-like [Phoenix dactylifera]
Length=785

 Score =   303 bits (775),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+V+NSVVMIQPSL+SYSF+S P P LLDV 
Sbjct  604  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESVTNSVVMIQPSLLSYSFNSPPAPALLDVA  663

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+ADRILLLD+YF++V+FHG TIAQWR  GY  QPEHQAFAQLLQ P++DA+ IIRDRF
Sbjct  664  SISADRILLLDTYFSVVIFHGMTIAQWRNMGYQNQPEHQAFAQLLQAPQDDAQMIIRDRF  723

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYNS     PG DIIFTDDVS +VF +HLQRLAV
Sbjct  724  PVPRLVICDQHGSQARFLLAKLNPSATYNSAHEVAPGSDIIFTDDVSLQVFYEHLQRLAV  783

Query  191  Q  189
            Q
Sbjct  784  Q  784



>ref|XP_006492989.1| PREDICTED: protein transport protein SEC23-like [Citrus sinensis]
Length=774

 Score =   303 bits (775),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN++N+ VMIQPSLISYSF+S+P+P LLDV 
Sbjct  593  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVA  652

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++V+FHG TIAQWR  GY  QPEHQAFAQLL+ P +DAE IIRDRF
Sbjct  653  SIAADRILLLDTYFSVVIFHGMTIAQWRNMGYQNQPEHQAFAQLLRAPHDDAELIIRDRF  712

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF++HLQRLAV
Sbjct  713  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEIAAGSDIIFTDDVSLQVFIEHLQRLAV  772

Query  191  Q  189
            Q
Sbjct  773  Q  773



>ref|XP_006421049.1| hypothetical protein CICLE_v10004373mg [Citrus clementina]
 gb|ESR34289.1| hypothetical protein CICLE_v10004373mg [Citrus clementina]
Length=774

 Score =   303 bits (775),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN++N+ VMIQPSLISYSF+S+P+P LLDV 
Sbjct  593  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVA  652

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++V+FHG TIAQWR  GY  QPEHQAFAQLL+ P +DAE IIRDRF
Sbjct  653  SIAADRILLLDTYFSVVIFHGMTIAQWRNMGYQNQPEHQAFAQLLRAPHDDAELIIRDRF  712

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF++HLQRLAV
Sbjct  713  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEIAAGSDIIFTDDVSLQVFIEHLQRLAV  772

Query  191  Q  189
            Q
Sbjct  773  Q  773



>ref|XP_010028115.1| PREDICTED: protein transport protein SEC23-like [Eucalyptus grandis]
 gb|KCW54774.1| hypothetical protein EUGRSUZ_I00719 [Eucalyptus grandis]
Length=777

 Score =   302 bits (774),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            LF+LRRSQFVQVF NSPDETAY+RM+LNRENV+N+ VMIQPSLISYSF+S+P P LLDV 
Sbjct  596  LFNLRRSQFVQVFNNSPDETAYFRMLLNRENVANAAVMIQPSLISYSFNSLPAPALLDVA  655

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF++V+FHG TIAQWR  GY  QPEHQAFAQLLQ P++DA+ IIR+RF
Sbjct  656  SIAADRILLLDSYFSVVIFHGMTIAQWRNMGYQNQPEHQAFAQLLQAPQDDAQMIIRERF  715

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF++HLQRLAV
Sbjct  716  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMTAGSDVIFTDDVSLQVFIEHLQRLAV  775

Query  191  Q  189
            Q
Sbjct  776  Q  776



>ref|XP_002444510.1| hypothetical protein SORBIDRAFT_07g023060 [Sorghum bicolor]
 gb|EES14005.1| hypothetical protein SORBIDRAFT_07g023060 [Sorghum bicolor]
Length=763

 Score =   302 bits (773),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 164/181 (91%), Gaps = 2/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+ M+LNRENVSN+VVMIQPSLISYSF S PEPVLLDV 
Sbjct  585  IFNLRRSQFVQVFNNSPDETAYFTMMLNRENVSNAVVMIQPSLISYSFQSGPEPVLLDVT  644

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHG TIAQWRKAGY  Q  H++FAQLLQ P+E+A++II++RF
Sbjct  645  AIAADRILLLDSYFTVVIFHGITIAQWRKAGYQYQEGHESFAQLLQAPQEEADAIIKERF  704

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQ+GSQARFLLAKLNPS +Y  D PP PGGD+IFTDDVSF+VF+DHLQRLAV
Sbjct  705  PVPRLVVCDQYGSQARFLLAKLNPSVSY--DNPPAPGGDVIFTDDVSFQVFMDHLQRLAV  762

Query  191  Q  189
             
Sbjct  763  N  763



>ref|XP_008797249.1| PREDICTED: protein transport protein sec23 isoform X2 [Phoenix 
dactylifera]
Length=709

 Score =   300 bits (769),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 141/172 (82%), Positives = 156/172 (91%), Gaps = 0/172 (0%)
 Frame = -2

Query  704  VQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVGSIAADRILL  525
            ++VF NSPDETAYYRMILNRENV+NSVVMIQPSLISYSF S PEP LLDV +IAADRILL
Sbjct  538  MEVFNNSPDETAYYRMILNRENVANSVVMIQPSLISYSFQSDPEPALLDVTAIAADRILL  597

Query  524  LDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRFPVPRLVICD  345
            LDSYF +VVFHG++IAQWR AGY  Q EHQ FAQLLQ PR+DA++I ++RFPVPRLVICD
Sbjct  598  LDSYFIVVVFHGASIAQWRNAGYQNQAEHQPFAQLLQAPRDDADAIAKERFPVPRLVICD  657

Query  344  QHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
            Q+GSQARFLLAKLNPS TYNSD PP PGGD+IFTDDVSF+VFLDHLQRLAVQ
Sbjct  658  QYGSQARFLLAKLNPSVTYNSDNPPAPGGDVIFTDDVSFQVFLDHLQRLAVQ  709



>gb|KJB37898.1| hypothetical protein B456_006G225300 [Gossypium raimondii]
Length=770

 Score =   301 bits (772),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN++N+ VMIQPSLISYSF+S+P+P LLDV 
Sbjct  589  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVA  648

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+ADRILLLDSYF+IV+FHG TIAQWR  GY  QPEHQAFAQLLQ P++DA+ IIR+RF
Sbjct  649  SISADRILLLDSYFSIVIFHGMTIAQWRNMGYQNQPEHQAFAQLLQAPQDDAQMIIRERF  708

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  709  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMAAGSDVIFTDDVSLQVFFEHLQRLAV  768

Query  191  Q  189
            Q
Sbjct  769  Q  769



>ref|XP_009349001.1| PREDICTED: protein transport protein SEC23-like [Pyrus x bretschneideri]
Length=770

 Score =   301 bits (772),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+ VMIQPSLISYSF+S+P+P LLDV 
Sbjct  589  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNAAVMIQPSLISYSFNSLPQPALLDVA  648

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF+IV+FHG TIAQWR  GY  QPEHQAFAQLLQ P +D + I+RDRF
Sbjct  649  SIAADRILLLDSYFSIVIFHGMTIAQWRNMGYQNQPEHQAFAQLLQAPHDDTQLIVRDRF  708

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  709  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMAAGSDVIFTDDVSLQVFFEHLQRLAV  768

Query  191  Q  189
            Q
Sbjct  769  Q  769



>ref|XP_009378161.1| PREDICTED: protein transport protein SEC23-like [Pyrus x bretschneideri]
Length=773

 Score =   301 bits (772),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+ VMIQPSLISYSF+S+P+P LLDV 
Sbjct  592  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNAAVMIQPSLISYSFNSLPQPALLDVA  651

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF+IV+FHG TIAQWR  GY  QPEHQAFAQLLQ P +D + I+RDRF
Sbjct  652  SIAADRILLLDSYFSIVIFHGMTIAQWRNMGYQNQPEHQAFAQLLQAPHDDTQLIVRDRF  711

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  712  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMAAGSDVIFTDDVSLQVFFEHLQRLAV  771

Query  191  Q  189
            Q
Sbjct  772  Q  772



>ref|NP_001067798.1| Os11g0433500 [Oryza sativa Japonica Group]
 dbj|BAF28161.1| Os11g0433500, partial [Oryza sativa Japonica Group]
Length=351

 Score =   290 bits (741),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+++NSV MIQPSLIS+SF   P PV LDV 
Sbjct  170  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESITNSVAMIQPSLISFSFDLPPSPVFLDVA  229

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++V+FHG TIAQWR  GY  QPEHQ FAQLLQ P E+A+ II+ RF
Sbjct  230  SIAADRILLLDAYFSVVIFHGMTIAQWRNMGYQNQPEHQQFAQLLQAPHEEAQIIIKGRF  289

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P PRLV+CDQHGSQARFLLAKLNPSATYNS     PG DIIFTDDVSF+VF +HLQRLAV
Sbjct  290  PAPRLVVCDQHGSQARFLLAKLNPSATYNSAHDVPPGSDIIFTDDVSFQVFCEHLQRLAV  349

Query  191  Q  189
            Q
Sbjct  350  Q  350



>ref|XP_008222792.1| PREDICTED: protein transport protein SEC23 [Prunus mume]
 ref|XP_008222793.1| PREDICTED: protein transport protein SEC23 [Prunus mume]
Length=772

 Score =   301 bits (771),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+R++LNREN++N+ VMIQPSLISYSF+S+P+P LLDV 
Sbjct  591  MFNLRRSQFVQVFNNSPDETAYFRVLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVA  650

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF+IV+FHG TIAQWR  GY  QPEHQAFAQLLQ P +D +SIIRDRF
Sbjct  651  SIAADRILLLDSYFSIVIFHGMTIAQWRNMGYQNQPEHQAFAQLLQAPHDDTQSIIRDRF  710

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  711  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAHDMAAGSDVIFTDDVSLQVFFEHLQRLAV  770

Query  191  Q  189
            Q
Sbjct  771  Q  771



>ref|XP_009420223.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
Length=783

 Score =   301 bits (772),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 145/181 (80%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+VSNSVVMIQPSLISYSF+S P P LLDV 
Sbjct  602  IFNLRRSQFVQVFNNSPDETAYFRMLLNRESVSNSVVMIQPSLISYSFNSPPTPALLDVA  661

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+ADRILLLDSYF+IV+FHG TIAQWR  GY  QPEHQAFA LLQ P +DA+ IIR+RF
Sbjct  662  SISADRILLLDSYFSIVIFHGMTIAQWRNMGYQNQPEHQAFALLLQAPNDDAQMIIRERF  721

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYNS    VPG D+IFTDDVS  VF +HLQRLAV
Sbjct  722  PVPRLVICDQHGSQARFLLAKLNPSATYNSAQEVVPGSDVIFTDDVSLRVFCEHLQRLAV  781

Query  191  Q  189
            Q
Sbjct  782  Q  782



>ref|XP_009373604.1| PREDICTED: protein transport protein SEC23-like [Pyrus x bretschneideri]
Length=773

 Score =   301 bits (770),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+ VMIQPSLISYSF+S+P+P LLDV 
Sbjct  592  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNAAVMIQPSLISYSFNSLPQPALLDVA  651

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF++V+FHG TIAQWR  GY  QPEHQAFAQLLQ P +D + I+RDRF
Sbjct  652  SIAADRILLLDSYFSMVIFHGMTIAQWRNMGYQNQPEHQAFAQLLQAPHDDTQLIVRDRF  711

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  712  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMAAGSDVIFTDDVSLQVFFEHLQRLAV  771

Query  191  Q  189
            Q
Sbjct  772  Q  772



>ref|XP_004502262.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Cicer 
arietinum]
 ref|XP_004502263.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Cicer 
arietinum]
Length=762

 Score =   300 bits (769),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+ VMIQPSLISYSF+S+P P LLDV 
Sbjct  581  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNAAVMIQPSLISYSFNSLPAPALLDVA  640

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF++V+FHG TIAQWR  GY  QPEHQAFAQLL+ P++DA+++IRDRF
Sbjct  641  SIAADRILLLDSYFSVVIFHGMTIAQWRNLGYQNQPEHQAFAQLLRAPQDDAQAVIRDRF  700

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  701  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMAAGSDVIFTDDVSLQVFFEHLQRLAV  760

Query  191  Q  189
            Q
Sbjct  761  Q  761



>ref|XP_010908064.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Elaeis 
guineensis]
Length=790

 Score =   301 bits (770),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+++NSVVMIQPSL+SYSF+S P P LLDV 
Sbjct  609  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESITNSVVMIQPSLLSYSFNSPPAPALLDVA  668

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+ADRILLLD+YF++V+FHG TIAQWR  GY  QPEHQAFAQLLQ P++DA+ IIRDRF
Sbjct  669  SISADRILLLDAYFSVVIFHGMTIAQWRNMGYQNQPEHQAFAQLLQAPQDDAQMIIRDRF  728

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYNS     PG D+IFTDDVS +VF +HLQRLAV
Sbjct  729  PVPRLVICDQHGSQARFLLAKLNPSATYNSAHEVAPGSDVIFTDDVSLQVFCEHLQRLAV  788

Query  191  Q  189
            Q
Sbjct  789  Q  789



>emb|CDP15130.1| unnamed protein product [Coffea canephora]
Length=784

 Score =   300 bits (769),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE++SNSVVMIQPSL++YSFHS+P P LLDV 
Sbjct  602  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESISNSVVMIQPSLMAYSFHSLPTPALLDVA  661

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++V+FHG TIAQWR  GY  QPEHQ FAQ LQ P+EDA++IIRDRF
Sbjct  662  SIAADRILLLDTYFSVVIFHGMTIAQWRNMGYQNQPEHQVFAQFLQAPQEDAQTIIRDRF  721

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P PRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF +HLQRLAV
Sbjct  722  PTPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMAAGTDIIFTDDVSLQVFFEHLQRLAV  781

Query  191  Q  189
            Q
Sbjct  782  Q  782



>ref|XP_002300208.1| transport family protein [Populus trichocarpa]
 gb|EEE85013.1| transport family protein [Populus trichocarpa]
Length=775

 Score =   300 bits (769),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  725  HLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVGSI  546
            +LRRSQFVQVF NSPDETAY+RM+LNREN++N+ VMIQPSLISYSF+S+P+P LLDV SI
Sbjct  596  NLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVASI  655

Query  545  AADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRFPV  366
             ADRILLLDSYF++V+FHG TIAQWR  GY  QPEHQAFAQLLQ P+EDA+ II DRFPV
Sbjct  656  GADRILLLDSYFSVVIFHGMTIAQWRNLGYQNQPEHQAFAQLLQAPKEDAQMIIHDRFPV  715

Query  365  PRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
            PRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF +HLQRLAVQ
Sbjct  716  PRLVVCDQHGSQARFLLAKLNPSATYNNANEMAAGSDIIFTDDVSLQVFFEHLQRLAVQ  774



>ref|XP_003601724.1| Protein transport protein Sec23 [Medicago truncatula]
 gb|AES71975.1| protein transporter Sec23-like protein [Medicago truncatula]
Length=771

 Score =   300 bits (768),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+ VMIQPSLISYSF+S+P P LLDV 
Sbjct  590  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNAAVMIQPSLISYSFNSLPAPALLDVA  649

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF++V+FHG TIAQWR  GY  QPEHQAFAQLL+ P++D+++IIRDRF
Sbjct  650  SIAADRILLLDSYFSVVIFHGMTIAQWRNLGYQNQPEHQAFAQLLRAPQDDSQAIIRDRF  709

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  710  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMAAGSDVIFTDDVSLQVFFEHLQRLAV  769

Query  191  Q  189
            Q
Sbjct  770  Q  770



>ref|XP_002516399.1| protein transport protein sec23, putative [Ricinus communis]
 gb|EEF46016.1| protein transport protein sec23, putative [Ricinus communis]
Length=782

 Score =   300 bits (768),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN++N+ VMIQPSLISYSF+S+P+P LLDV 
Sbjct  601  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVA  660

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF++V+FHG TIAQWR  GY  QPEHQAFAQLL  P++DA  IIRDRF
Sbjct  661  SIAADRILLLDSYFSVVIFHGMTIAQWRNMGYQNQPEHQAFAQLLHAPQDDARLIIRDRF  720

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  721  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMAAGSDVIFTDDVSLQVFFEHLQRLAV  780

Query  191  Q  189
            Q
Sbjct  781  Q  781



>ref|XP_008337484.1| PREDICTED: protein transport protein SEC23 [Malus domestica]
Length=773

 Score =   300 bits (768),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+R++LNREN+SN+ VMIQPSLISYSF+S+P+P LLDV 
Sbjct  592  MFNLRRSQFVQVFNNSPDETAYFRVLLNRENISNAAVMIQPSLISYSFNSLPQPALLDVA  651

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF+IV+FHG TIAQWR  GY  QPEHQAFAQLLQ P +D + I+RDRF
Sbjct  652  SIAADRILLLDSYFSIVIFHGMTIAQWRNMGYQNQPEHQAFAQLLQAPHDDTQLIVRDRF  711

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  712  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMAAGSDVIFTDDVSLQVFFEHLQRLAV  771

Query  191  Q  189
            Q
Sbjct  772  Q  772



>ref|XP_011045698.1| PREDICTED: protein transport protein SEC23-like [Populus euphratica]
Length=775

 Score =   300 bits (768),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  725  HLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVGSI  546
            +LRRSQFVQVF NSPDETAY+RM+LNREN++N+ VMIQPSLISYSF+S+P+P LLDV SI
Sbjct  596  NLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVASI  655

Query  545  AADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRFPV  366
             ADRILLLDSYF++V+FHG TIAQWR  GY  QPEHQAFAQLLQ P+EDA+ II DRFPV
Sbjct  656  GADRILLLDSYFSVVIFHGMTIAQWRNLGYQNQPEHQAFAQLLQAPKEDAQMIIHDRFPV  715

Query  365  PRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
            PRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF +HLQRLAVQ
Sbjct  716  PRLVVCDQHGSQARFLLAKLNPSATYNNANEMAAGSDIIFTDDVSLQVFFEHLQRLAVQ  774



>gb|KDP24898.1| hypothetical protein JCGZ_24276 [Jatropha curcas]
Length=1052

 Score =   305 bits (780),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+R+ILNRENV+NSVVMIQPSLISYSFHS PEP LLDV 
Sbjct  586  MFHLRRSQFVQVFNNSPDETAYFRVILNRENVANSVVMIQPSLISYSFHSGPEPSLLDVA  645

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHGSTIAQWRKAGYH QPEHQAFAQLLQ PR+D ++II++RF
Sbjct  646  AIAADRILLLDSYFTVVIFHGSTIAQWRKAGYHNQPEHQAFAQLLQAPRDDVDAIIKERF  705

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEV  222
            PVPRLVICDQHGSQARFLLAKLNPSATYN+DA  + GGDI+FTDDVSFE 
Sbjct  706  PVPRLVICDQHGSQARFLLAKLNPSATYNTDA-ALSGGDILFTDDVSFEA  754



>ref|XP_009139544.1| PREDICTED: protein transport protein SEC23-like [Brassica rapa]
Length=772

 Score =   300 bits (767),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+ VMIQPSL SY+F S P+P LLDV 
Sbjct  591  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNATVMIQPSLTSYTFSSPPQPALLDVA  650

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++VVFHG TIAQWR  GYHEQPEH+AFAQLLQ P+ED++ I+R+RF
Sbjct  651  SIAADRILLLDAYFSVVVFHGMTIAQWRNMGYHEQPEHEAFAQLLQAPQEDSQMIVRERF  710

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYNS      G D+IFTDDVS +VF +HLQ+LAV
Sbjct  711  PVPRLVVCDQHGSQARFLLAKLNPSATYNSANEMSAGSDVIFTDDVSLQVFFEHLQKLAV  770

Query  191  Q  189
            Q
Sbjct  771  Q  771



>gb|KJB71965.1| hypothetical protein B456_011G150700 [Gossypium raimondii]
Length=771

 Score =   300 bits (767),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN++N+ VMIQPSLISYSF+S+P+P LLDV 
Sbjct  590  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVA  649

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+ADRILLLDSYF+IVVFHG TIAQWR  GY  QPEHQAFA+LLQ P+ DA+ II++RF
Sbjct  650  SISADRILLLDSYFSIVVFHGMTIAQWRNMGYQNQPEHQAFAELLQAPQADAQMIIQERF  709

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+ +    G DIIFTDDVS +VF +HLQRLAV
Sbjct  710  PVPRLVVCDQHGSQARFLLAKLNPSATYNNSSDIAAGSDIIFTDDVSLQVFFEHLQRLAV  769

Query  191  Q  189
            Q
Sbjct  770  Q  770



>emb|CDY01197.1| BnaA04g06220D [Brassica napus]
Length=762

 Score =   299 bits (765),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+ VMIQPSL SY+F S P+P LLDV 
Sbjct  581  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNATVMIQPSLTSYTFSSPPQPALLDVA  640

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++VVFHG TIAQWR  GYHEQPEH+AFAQLLQ P+ED++ I+R+RF
Sbjct  641  SIAADRILLLDAYFSVVVFHGMTIAQWRNMGYHEQPEHEAFAQLLQAPQEDSQMIVRERF  700

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYNS      G D+IFTDDVS +VF +HLQ+LAV
Sbjct  701  PVPRLVVCDQHGSQARFLLAKLNPSATYNSANEMSAGSDVIFTDDVSLQVFFEHLQKLAV  760

Query  191  Q  189
            Q
Sbjct  761  Q  761



>emb|CDY12738.1| BnaC04g29030D [Brassica napus]
Length=736

 Score =   298 bits (763),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+ VMIQPSL SY+F S P+P LLDV 
Sbjct  555  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNATVMIQPSLTSYTFSSPPQPALLDVA  614

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++VVFHG TIAQWR  GYHEQPEH+AFAQLLQ P+ED++ I+R+RF
Sbjct  615  SIAADRILLLDAYFSVVVFHGMTIAQWRNMGYHEQPEHEAFAQLLQAPQEDSQMIVRERF  674

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQ+LAV
Sbjct  675  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSAGSDVIFTDDVSLQVFFEHLQKLAV  734

Query  191  Q  189
            Q
Sbjct  735  Q  735



>ref|XP_007034166.1| Sec23/Sec24 protein transport family protein [Theobroma cacao]
 gb|EOY05092.1| Sec23/Sec24 protein transport family protein [Theobroma cacao]
Length=772

 Score =   299 bits (765),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN++N+ VMIQPSLISYSF+S+P+P LLDV 
Sbjct  591  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVA  650

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+ADRILLLDSYF+IVVFHG TIAQWR  GY  QPEHQAFAQLLQ P++DA  IIR+RF
Sbjct  651  SISADRILLLDSYFSIVVFHGMTIAQWRNMGYQNQPEHQAFAQLLQAPQDDALVIIRERF  710

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  711  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANDIAAGSDVIFTDDVSLQVFFEHLQRLAV  770

Query  191  Q  189
            Q
Sbjct  771  Q  771



>gb|KFK22996.1| hypothetical protein AALP_AAs50735U000600 [Arabis alpina]
Length=775

 Score =   298 bits (764),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+ VMIQPSL SYSF+S P+P LLDV 
Sbjct  594  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNATVMIQPSLTSYSFNSAPQPALLDVA  653

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++VVFHG TIAQWR  GYH QPEH+AFAQLLQ P+ED++ ++R+RF
Sbjct  654  SIAADRILLLDAYFSVVVFHGMTIAQWRNMGYHHQPEHEAFAQLLQAPQEDSQMLVRERF  713

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF +HLQ+LAV
Sbjct  714  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSAGSDIIFTDDVSLQVFFEHLQKLAV  773

Query  191  Q  189
            Q
Sbjct  774  Q  774



>gb|KHG15352.1| Protein transport SEC23 [Gossypium arboreum]
Length=771

 Score =   298 bits (764),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN++N+ VMIQPSLISYSF+S+P+P LLDV 
Sbjct  590  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVA  649

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+ADRILLLDSYF+IVVFHG TIAQWR  GY  QPEH+AFA+LLQ P+ DA+ II++RF
Sbjct  650  SISADRILLLDSYFSIVVFHGMTIAQWRNMGYQNQPEHRAFAELLQAPQADAQMIIQERF  709

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+ +    G DIIFTDDVS +VF +HLQRLAV
Sbjct  710  PVPRLVVCDQHGSQARFLLAKLNPSATYNNSSDIAAGSDIIFTDDVSLQVFFEHLQRLAV  769

Query  191  Q  189
            Q
Sbjct  770  Q  770



>gb|EMT11313.1| Protein transport protein Sec23A [Aegilops tauschii]
Length=438

 Score =   289 bits (740),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+++NSV MIQPSLIS+SF S P PV LDV 
Sbjct  257  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESITNSVAMIQPSLISFSFDSPPSPVFLDVA  316

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIA DRILLLD+YF++V+FHG TIAQWR   Y  QPEHQ FAQLLQ P+E+A+ II  RF
Sbjct  317  SIAVDRILLLDAYFSVVIFHGMTIAQWRNMCYQNQPEHQQFAQLLQAPQEEAQVIINGRF  376

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYNS     PG DIIFTDDVSF+VF +HLQRLAV
Sbjct  377  PVPRLVVCDQHGSQARFLLAKLNPSATYNSAHDVPPGSDIIFTDDVSFQVFCEHLQRLAV  436

Query  191  Q  189
            Q
Sbjct  437  Q  437



>ref|XP_010097955.1| Protein transport protein SEC23 [Morus notabilis]
 gb|EXB73685.1| Protein transport protein SEC23 [Morus notabilis]
Length=775

 Score =   298 bits (763),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRENV+N+VVMIQPSL++YSF+S+P PV+LDV 
Sbjct  594  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENVTNAVVMIQPSLMAYSFNSLPRPVMLDVA  653

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAAD+ILLLDSYF++V+FHG TIAQWR  GY  QPEHQAFAQLLQ P+ DA+ II++RF
Sbjct  654  SIAADQILLLDSYFSVVIFHGMTIAQWRNMGYQNQPEHQAFAQLLQAPQGDAQVIIQERF  713

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF +HLQRLAV
Sbjct  714  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMAAGSDIIFTDDVSLQVFFEHLQRLAV  773

Query  191  Q  189
            Q
Sbjct  774  Q  774



>ref|XP_008791501.1| PREDICTED: protein transport protein SEC23-like [Phoenix dactylifera]
Length=791

 Score =   298 bits (763),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+++NSVVMIQPSL+SYSF+S P P LLDV 
Sbjct  610  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESITNSVVMIQPSLLSYSFNSPPAPALLDVA  669

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+AD ILLLD+YF++V+FHG TIAQWR  GY  QPEHQAFAQLLQ P++DA+ IIRDRF
Sbjct  670  SISADHILLLDAYFSVVIFHGMTIAQWRNMGYQNQPEHQAFAQLLQAPQDDAQIIIRDRF  729

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYNS     PG D+IFTDDVS +VF +HLQRLAV
Sbjct  730  PVPRLVICDQHGSQARFLLAKLNPSATYNSAHEVAPGSDVIFTDDVSLQVFCEHLQRLAV  789

Query  191  Q  189
            Q
Sbjct  790  Q  790



>emb|CBI39378.3| unnamed protein product [Vitis vinifera]
Length=707

 Score =   296 bits (758),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+ N+ VMIQPSLISYSF+S+P P LLDV 
Sbjct  526  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENIPNTAVMIQPSLISYSFNSLPAPALLDVA  585

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+ADRILLLDSYF++V+FHG TIAQWR  GY  QPEHQAFAQLLQ P++DA+ II DRF
Sbjct  586  SISADRILLLDSYFSVVIFHGMTIAQWRNMGYQNQPEHQAFAQLLQAPQDDAKLIIHDRF  645

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  646  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMATGSDVIFTDDVSLQVFFEHLQRLAV  705

Query  191  Q  189
            Q
Sbjct  706  Q  706



>ref|XP_004964627.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Setaria 
italica]
 ref|XP_004964628.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Setaria 
italica]
 ref|XP_004964629.1| PREDICTED: protein transport protein SEC23-like isoform X3 [Setaria 
italica]
 ref|XP_004964630.1| PREDICTED: protein transport protein SEC23-like isoform X4 [Setaria 
italica]
 ref|XP_004964631.1| PREDICTED: protein transport protein SEC23-like isoform X5 [Setaria 
italica]
 ref|XP_004964632.1| PREDICTED: protein transport protein SEC23-like isoform X6 [Setaria 
italica]
Length=762

 Score =   297 bits (761),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 163/181 (90%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+++RENV+N++VMIQPSLISY F S PEPVLLD  
Sbjct  583  IFNLRRSQFVQVFNNSPDETAYFRMMMDRENVANALVMIQPSLISYLFQSGPEPVLLDAT  642

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            ++A+D+ILLLDSYFT+V+FHG TIAQWR AGY +Q  H+AFAQLL+ P E+A SII++RF
Sbjct  643  AVASDKILLLDSYFTVVIFHGITIAQWRNAGYQDQEGHEAFAQLLKAPHEEAGSIIKERF  702

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQ+GSQARFLLAKLNPS TYNSD P  PGGD+IFTDDVSFEVF+DHLQRLAV
Sbjct  703  PVPRLVVCDQYGSQARFLLAKLNPSVTYNSDNPS-PGGDVIFTDDVSFEVFMDHLQRLAV  761

Query  191  Q  189
            Q
Sbjct  762  Q  762



>ref|XP_010269071.1| PREDICTED: protein transport protein SEC23-like [Nelumbo nucifera]
Length=770

 Score =   297 bits (761),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+ NSVVMIQPSLI+YSFHS+P+P LLDV 
Sbjct  589  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENILNSVVMIQPSLIAYSFHSLPKPALLDVA  648

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI++++ILLLD+YF++V+FHG TIAQWR AGY  QPEH+AFAQLLQ P +DA+ II+DRF
Sbjct  649  SISSEQILLLDAYFSVVIFHGMTIAQWRNAGYQNQPEHRAFAQLLQAPHDDAQMIIQDRF  708

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P+PRLV+CDQHGSQARFLLAKLNPS TYNS     PG D+IFTDDVS +VF++HLQRLAV
Sbjct  709  PIPRLVVCDQHGSQARFLLAKLNPSTTYNSAHDIAPGSDVIFTDDVSLQVFIEHLQRLAV  768

Query  191  Q  189
            Q
Sbjct  769  Q  769



>gb|KHN24039.1| Protein transport protein Sec23A [Glycine soja]
Length=586

 Score =   292 bits (748),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+L+REN+SN+ VMIQPSLISYSF+++P P LLDV 
Sbjct  405  MFNLRRSQFVQVFNNSPDETAYFRMLLDRENISNAAVMIQPSLISYSFNALPAPALLDVA  464

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAAD+ILLLDSYF++V+FHG TIAQWR  GY  Q EHQAFAQLL+ P +DA+ IIR+RF
Sbjct  465  SIAADKILLLDSYFSVVIFHGMTIAQWRNLGYQNQQEHQAFAQLLRAPHDDAQMIIRERF  524

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  525  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMAAGSDVIFTDDVSLQVFFEHLQRLAV  584

Query  191  Q  189
            Q
Sbjct  585  Q  585



>ref|XP_001751286.1| predicted protein [Physcomitrella patens]
 gb|EDQ83603.1| predicted protein [Physcomitrella patens]
Length=757

 Score =   296 bits (759),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 161/181 (89%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+L RE V+NS+VMIQPS++SYSF+S PEP LLDV 
Sbjct  577  MFNLRRSQFVQVFNNSPDETAYFRMVLCRETVTNSLVMIQPSVLSYSFNSPPEPALLDVS  636

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF+ VVFHG TIAQWR AGYH  PEH AFAQLLQ P +DA++II +RF
Sbjct  637  SIAADRILLLDAYFS-VVFHGMTIAQWRNAGYHRHPEHAAFAQLLQAPHDDAQAIIHERF  695

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYNS   P PGGDIIFTDDVS +VF++HL+RLAV
Sbjct  696  PVPRLVVCDQHGSQARFLLAKLNPSATYNSANGPPPGGDIIFTDDVSLQVFMEHLKRLAV  755

Query  191  Q  189
            Q
Sbjct  756  Q  756



>ref|XP_010934372.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Elaeis 
guineensis]
Length=782

 Score =   297 bits (760),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+++NSVVMIQPSL+SYSF+S P P LLDV 
Sbjct  601  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESITNSVVMIQPSLLSYSFNSPPAPALLDVA  660

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  DRILLLD+YF++V+FHG TIAQWR  GY  QPEHQAFAQLLQ P++DA+ IIRDRF
Sbjct  661  SILVDRILLLDAYFSVVIFHGMTIAQWRNMGYQNQPEHQAFAQLLQAPQDDAQMIIRDRF  720

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYNS     PG D+IFTDDVS +VF +HLQRLAV
Sbjct  721  PVPRLVICDQHGSQARFLLAKLNPSATYNSVHEVAPGSDVIFTDDVSLQVFCEHLQRLAV  780



>ref|XP_006414783.1| hypothetical protein EUTSA_v10024465mg [Eutrema salsugineum]
 gb|ESQ56236.1| hypothetical protein EUTSA_v10024465mg [Eutrema salsugineum]
Length=780

 Score =   297 bits (760),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+ VMIQPSL SY+F+S P+P LLDV 
Sbjct  599  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNATVMIQPSLTSYTFNSPPQPALLDVA  658

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++VVFHG TIAQWR  GYH QPEH+AFAQLLQ P+ED++ ++R+RF
Sbjct  659  SIAADRILLLDAYFSVVVFHGMTIAQWRNMGYHHQPEHEAFAQLLQAPQEDSQMLVRERF  718

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF +HLQ+LAV
Sbjct  719  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSAGSDIIFTDDVSLQVFFEHLQKLAV  778

Query  191  Q  189
            Q
Sbjct  779  Q  779



>ref|XP_006370915.1| transport family protein [Populus trichocarpa]
 gb|ERP48712.1| transport family protein [Populus trichocarpa]
Length=777

 Score =   296 bits (759),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  725  HLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVGSI  546
            +LRRSQFVQVF NSPDETAY+RM+LNREN++N+ VMIQPSLISYSF+S+P+P LLDV SI
Sbjct  598  NLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVASI  657

Query  545  AADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRFPV  366
             ADRILLLDSYF++VVFHG TIAQWR  GY  QPEHQ FAQLLQ P++DA++II +RFPV
Sbjct  658  GADRILLLDSYFSVVVFHGMTIAQWRNLGYQNQPEHQVFAQLLQAPKDDAQAIIHERFPV  717

Query  365  PRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
            PRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF +HLQRLAVQ
Sbjct  718  PRLVVCDQHGSQARFLLAKLNPSATYNNANEMAAGSDIIFTDDVSLQVFFEHLQRLAVQ  776



>ref|XP_007163794.1| hypothetical protein PHAVU_001G264700g [Phaseolus vulgaris]
 gb|ESW35788.1| hypothetical protein PHAVU_001G264700g [Phaseolus vulgaris]
Length=768

 Score =   296 bits (758),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+ VMIQPSLI+YSF+S+P P LLDV 
Sbjct  587  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNAAVMIQPSLIAYSFNSLPAPALLDVA  646

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF++V+FHG TIAQWR  GY +QPEHQAFAQLL+ P +D++ IIR+RF
Sbjct  647  SIAADRILLLDSYFSVVIFHGMTIAQWRNLGYQDQPEHQAFAQLLRAPHDDSQMIIRERF  706

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  707  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAQEMSAGSDVIFTDDVSLQVFFEHLQRLAV  766

Query  191  Q  189
            Q
Sbjct  767  Q  767



>ref|XP_010650390.1| PREDICTED: protein transport protein SEC23-like [Vitis vinifera]
Length=771

 Score =   296 bits (758),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+ N+ VMIQPSLISYSF+S+P P LLDV 
Sbjct  590  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENIPNTAVMIQPSLISYSFNSLPAPALLDVA  649

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+ADRILLLDSYF++V+FHG TIAQWR  GY  QPEHQAFAQLLQ P++DA+ II DRF
Sbjct  650  SISADRILLLDSYFSVVIFHGMTIAQWRNMGYQNQPEHQAFAQLLQAPQDDAKLIIHDRF  709

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  710  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMATGSDVIFTDDVSLQVFFEHLQRLAV  769

Query  191  Q  189
            Q
Sbjct  770  Q  770



>ref|XP_010490077.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=653

 Score =   293 bits (750),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+ M+LNREN+SN+ VMIQPSL  YSFHS P+P LLDV 
Sbjct  472  IFNLRRSQFVQVFNNSPDETAYFCMLLNRENISNATVMIQPSLTMYSFHSPPQPALLDVA  531

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++VVFHG T+AQWR  GYH Q EHQAFA+LLQ P+ED++ I+R+RF
Sbjct  532  SIAADRILLLDAYFSVVVFHGMTVAQWRNMGYHHQSEHQAFAELLQAPQEDSQMIVRERF  591

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQ+LAV
Sbjct  592  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSTGSDVIFTDDVSLQVFFEHLQKLAV  651

Query  191  Q  189
            Q
Sbjct  652  Q  652



>ref|NP_849541.2| sec23/sec24-like transport protein [Arabidopsis thaliana]
 gb|AEE83385.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
Length=773

 Score =   296 bits (757),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN++VMIQPSL SYSF+S P+  LLDV 
Sbjct  592  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNAIVMIQPSLTSYSFNSGPQAALLDVA  651

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAAD+ILLLD+YF++VVFHG TI+QWR  GYH QPEH+AFAQLLQ P+ED++ ++R+RF
Sbjct  652  SIAADKILLLDAYFSVVVFHGMTISQWRNMGYHHQPEHEAFAQLLQAPQEDSQMLVRERF  711

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF++HLQ+LAV
Sbjct  712  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSAGSDIIFTDDVSLQVFIEHLQKLAV  771

Query  191  Q  189
            Q
Sbjct  772  Q  772



>ref|NP_193152.2| sec23/sec24-like transport protein [Arabidopsis thaliana]
 gb|AAL67087.1| putative transport protein [Arabidopsis thaliana]
 gb|AAM67461.1| putative transport protein [Arabidopsis thaliana]
 gb|AEE83387.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
Length=772

 Score =   296 bits (757),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN++VMIQPSL SYSF+S P+  LLDV 
Sbjct  591  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNAIVMIQPSLTSYSFNSGPQAALLDVA  650

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAAD+ILLLD+YF++VVFHG TI+QWR  GYH QPEH+AFAQLLQ P+ED++ ++R+RF
Sbjct  651  SIAADKILLLDAYFSVVVFHGMTISQWRNMGYHHQPEHEAFAQLLQAPQEDSQMLVRERF  710

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF++HLQ+LAV
Sbjct  711  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSAGSDIIFTDDVSLQVFIEHLQKLAV  770

Query  191  Q  189
            Q
Sbjct  771  Q  771



>gb|AAM10394.1| AT4g14160/dl3120w [Arabidopsis thaliana]
Length=772

 Score =   296 bits (757),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN++VMIQPSL SYSF+S P+  LLDV 
Sbjct  591  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNAIVMIQPSLTSYSFNSGPQAALLDVA  650

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAAD+ILLLD+YF++VVFHG TI+QWR  GYH QPEH+AFAQLLQ P+ED++ ++R+RF
Sbjct  651  SIAADKILLLDAYFSVVVFHGMTISQWRNMGYHHQPEHEAFAQLLQAPQEDSQMLVRERF  710

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF++HLQ+LAV
Sbjct  711  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSAGSDIIFTDDVSLQVFIEHLQKLAV  770

Query  191  Q  189
            Q
Sbjct  771  Q  771



>emb|CAB10195.1| transport protein [Arabidopsis thaliana]
 emb|CAB78458.1| transport protein [Arabidopsis thaliana]
Length=769

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 161/181 (89%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN++VMIQPSL SYSF+S P+  LLDV 
Sbjct  588  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNAIVMIQPSLTSYSFNSGPQAALLDVA  647

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAAD+ILLLD+YF++VVFHG TI+QWR  GYH QPEH+AFAQLLQ P+ED++ ++R+RF
Sbjct  648  SIAADKILLLDAYFSVVVFHGMTISQWRNMGYHHQPEHEAFAQLLQAPQEDSQMLVRERF  707

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF++HLQ+LAV
Sbjct  708  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSAGSDIIFTDDVSLQVFIEHLQKLAV  767

Query  191  Q  189
            Q
Sbjct  768  Q  768



>ref|XP_011651107.1| PREDICTED: protein transport protein SEC23 [Cucumis sativus]
 gb|KGN57237.1| hypothetical protein Csa_3G172420 [Cucumis sativus]
Length=775

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN++N+ VMIQPSLISYSF+S+P P LLDV 
Sbjct  594  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPAPALLDVA  653

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF++V+FHG TIAQWR  GY  QPEHQAFAQLL  P +DA+ II +RF
Sbjct  654  SIAADRILLLDSYFSVVIFHGMTIAQWRNMGYQNQPEHQAFAQLLSAPHDDAQIIIHERF  713

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF +HLQRLAV
Sbjct  714  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAQEIAAGSDIIFTDDVSLQVFFEHLQRLAV  773

Query  191  Q  189
            Q
Sbjct  774  Q  774



>ref|XP_008439044.1| PREDICTED: protein transport protein SEC23 [Cucumis melo]
Length=775

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN++N+ VMIQPSLISYSF+S+P P LLDV 
Sbjct  594  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPAPALLDVA  653

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF++V+FHG TIAQWR  GY  QPEHQAFAQLL  P +DA+ II +RF
Sbjct  654  SIAADRILLLDSYFSVVIFHGMTIAQWRNMGYQNQPEHQAFAQLLSAPHDDAQIIIHERF  713

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF +HLQRLAV
Sbjct  714  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAQEIAAGSDIIFTDDVSLQVFFEHLQRLAV  773

Query  191  Q  189
            Q
Sbjct  774  Q  774



>ref|XP_011046336.1| PREDICTED: protein transport protein SEC23-like [Populus euphratica]
Length=777

 Score =   295 bits (756),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/179 (75%), Positives = 157/179 (88%), Gaps = 0/179 (0%)
 Frame = -2

Query  725  HLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVGSI  546
            +LRRSQF+QVF NSPDETAY+RM+LNREN++N+ VMIQPSLISYSF+S+P+P LLDV SI
Sbjct  598  NLRRSQFIQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVASI  657

Query  545  AADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRFPV  366
             ADRILLLDSYF++V+FHG TIAQWR  GY  QPEHQ FAQLLQ P++DA++II +RFPV
Sbjct  658  GADRILLLDSYFSVVIFHGMTIAQWRNLGYQNQPEHQVFAQLLQAPKDDAQAIIHERFPV  717

Query  365  PRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
            PRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF +HLQRLAVQ
Sbjct  718  PRLVVCDQHGSQARFLLAKLNPSATYNNANEMAAGSDIIFTDDVSLQVFFEHLQRLAVQ  776



>ref|XP_002489340.1| hypothetical protein SORBIDRAFT_0010s021250 [Sorghum bicolor]
 gb|EES20133.1| hypothetical protein SORBIDRAFT_0010s021250 [Sorghum bicolor]
Length=793

 Score =   296 bits (757),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+++NSV MIQPSLIS+SF S P PV LDV 
Sbjct  612  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESITNSVAMIQPSLISFSFDSPPSPVFLDVA  671

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++V+FHG TIAQWR  GY  QPEH+ FAQLLQ P EDA+ II+ RF
Sbjct  672  SIAADRILLLDAYFSVVIFHGMTIAQWRNMGYQNQPEHEQFAQLLQAPHEDAQMIIKGRF  731

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYNS     PG DIIFTDDVSF+VF +HLQRLAV
Sbjct  732  PVPRLVVCDQHGSQARFLLAKLNPSATYNSAHDVAPGSDIIFTDDVSFQVFCEHLQRLAV  791

Query  191  Q  189
            Q
Sbjct  792  Q  792



>gb|KFK39665.1| hypothetical protein AALP_AA3G273400 [Arabis alpina]
Length=773

 Score =   295 bits (755),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            LF+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+ VMIQPSL +YSF+S P+P LLDV 
Sbjct  592  LFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNATVMIQPSLTAYSFNSPPQPALLDVA  651

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRIL+LD+YF++VVFHG TIAQWR  GYH QPEHQAFA+LLQ P+ED++ ++R+RF
Sbjct  652  SIAADRILVLDAYFSVVVFHGMTIAQWRNMGYHHQPEHQAFAELLQAPQEDSQMMVRERF  711

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQ+LAV
Sbjct  712  PVPRLVVCDQHGSQARFLLAKLNPSATYNNTNEMSTGSDVIFTDDVSLQVFFEHLQKLAV  771

Query  191  Q  189
            Q
Sbjct  772  Q  772



>ref|XP_008668489.1| PREDICTED: uncharacterized protein LOC100384491 isoform X1 [Zea 
mays]
Length=895

 Score =   298 bits (762),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 162/181 (90%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+L+RENV+N+VVMIQPSLISYSF S PEPVLLD  
Sbjct  716  IFNLRRSQFVQVFNNSPDETAYFRMMLDRENVTNTVVMIQPSLISYSFQSGPEPVLLDAT  775

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IA+D+ILLLDSYFT+V+FHG TIAQWR AGY +Q  H+ FAQLL+ P E+A  II++RF
Sbjct  776  AIASDKILLLDSYFTVVIFHGVTIAQWRNAGYQDQEGHEVFAQLLKAPHEEANLIIKERF  835

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQ+GSQARFLLAKLNPS TYNSD P  PGGD+IFTDDVSF+VF+DHLQRLAV
Sbjct  836  PVPRLVVCDQYGSQARFLLAKLNPSVTYNSDNPS-PGGDVIFTDDVSFQVFMDHLQRLAV  894

Query  191  Q  189
            Q
Sbjct  895  Q  895



>ref|XP_001774792.1| predicted protein [Physcomitrella patens]
 gb|EDQ60463.1| predicted protein [Physcomitrella patens]
Length=772

 Score =   295 bits (755),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/180 (77%), Positives = 159/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRENVSNS+VMIQPSLISYS  S P+PVLLDV 
Sbjct  590  MFNLRRSQFVQVFNNSPDETAYFRMVLNRENVSNSLVMIQPSLISYSLSSPPDPVLLDVA  649

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIA DRILLLD+YF++V+FHG T+AQWR A YH QP+  A AQLLQ P++DA+ II DRF
Sbjct  650  SIAPDRILLLDAYFSVVIFHGMTVAQWRNAAYHLQPDQVALAQLLQVPQDDAQGIITDRF  709

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQH SQARFLLA+LNPSATYNS   PVPGGDIIFTDDVS +VF++HLQRLAV
Sbjct  710  PVPRLVVCDQHKSQARFLLARLNPSATYNSPNVPVPGGDIIFTDDVSLQVFVEHLQRLAV  769



>ref|XP_004973675.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Setaria 
italica]
Length=709

 Score =   293 bits (751),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/171 (78%), Positives = 157/171 (92%), Gaps = 0/171 (0%)
 Frame = -2

Query  701  QVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVGSIAADRILLL  522
            +V  NSPDETAY+ M+LNRENV+N+VVMIQPSLISYSF S PEPVLLDV +IAADRILLL
Sbjct  539  EVSNNSPDETAYFTMMLNRENVANAVVMIQPSLISYSFQSGPEPVLLDVTAIAADRILLL  598

Query  521  DSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRFPVPRLVICDQ  342
            DSYFT+V+FHG TIAQWRKAGY +Q  H+AFAQLLQ P+E+A+++I++RFPVPRLV+CDQ
Sbjct  599  DSYFTVVIFHGVTIAQWRKAGYQDQEGHEAFAQLLQAPKEEADAVIKERFPVPRLVVCDQ  658

Query  341  HGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
            +GSQARFLLAKLNPS TYNSD PP PGGD++FTDDVSF+VF+DHLQRLAVQ
Sbjct  659  YGSQARFLLAKLNPSVTYNSDNPPPPGGDVLFTDDVSFQVFMDHLQRLAVQ  709



>ref|XP_009414536.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009414537.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
Length=785

 Score =   295 bits (755),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 160/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+++NSVVMIQPSL+SYSF+S P P LLDV 
Sbjct  604  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESITNSVVMIQPSLLSYSFNSPPVPALLDVA  663

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI++DRILLLD+YF++V+FHG TIAQWR  GY  QPEHQAFAQLLQ P++DA  IIRDRF
Sbjct  664  SISSDRILLLDAYFSVVIFHGMTIAQWRNMGYQIQPEHQAFAQLLQAPQDDARVIIRDRF  723

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLLAKLNPSATYNS    VPG D+IFTDDVS +VF +HL+RL V
Sbjct  724  PVPRLVICDQHGSQARFLLAKLNPSATYNSAHEVVPGSDVIFTDDVSLQVFCEHLRRLVV  783

Query  191  Q  189
            Q
Sbjct  784  Q  784



>ref|XP_003578242.1| PREDICTED: protein transport protein SEC23-like [Brachypodium 
distachyon]
Length=762

 Score =   295 bits (754),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 159/181 (88%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+L RENV N+V MIQPSLISYSF S P PVLLDV 
Sbjct  583  MFNLRRSQFVQVFNNSPDETAYFRMMLERENVGNAVAMIQPSLISYSFQSGPAPVLLDVT  642

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAAD+ILLLDSYFT+V+FHG TIAQWR AGY +Q  H+ FAQLL+ P E+A +II++RF
Sbjct  643  AIAADKILLLDSYFTVVIFHGITIAQWRNAGYQDQEGHEVFAQLLKAPHEEAGTIIKERF  702

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQ+GSQARFLLAKLNPS  YNSD P  PGGD+IFTDDVSFEVF+DHLQRL+V
Sbjct  703  PVPRLVVCDQYGSQARFLLAKLNPSVAYNSDNPS-PGGDVIFTDDVSFEVFMDHLQRLSV  761

Query  191  Q  189
            Q
Sbjct  762  Q  762



>ref|XP_002460346.1| hypothetical protein SORBIDRAFT_02g026780 [Sorghum bicolor]
 gb|EER96867.1| hypothetical protein SORBIDRAFT_02g026780 [Sorghum bicolor]
Length=762

 Score =   294 bits (753),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 161/181 (89%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+L+RENV+N+VVMIQPSLISYSF S PEPVLLD  
Sbjct  583  IFNLRRSQFVQVFNNSPDETAYFRMMLDRENVANAVVMIQPSLISYSFQSGPEPVLLDAT  642

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IA+D+ILLLDSYFT+V+FHG TIAQWR AGY +Q  H+ FAQLL+ P E+A  II++RF
Sbjct  643  AIASDKILLLDSYFTVVIFHGVTIAQWRNAGYQDQEGHEVFAQLLKAPHEEANLIIKERF  702

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQ+GSQARFLLAKLNPS TYNSD    PGGD+IFTDDVSF+VF+DHLQRLAV
Sbjct  703  PVPRLVVCDQYGSQARFLLAKLNPSVTYNSDNAS-PGGDVIFTDDVSFQVFMDHLQRLAV  761

Query  191  Q  189
            Q
Sbjct  762  Q  762



>gb|EEE67142.1| hypothetical protein OsJ_24197 [Oryza sativa Japonica Group]
Length=768

 Score =   294 bits (753),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 164/181 (91%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+L+RE+V+N+VVMIQPSLISYSF S PEPVLLDV 
Sbjct  589  VFNLRRSQFVQVFNNSPDETAYFRMVLDREDVTNAVVMIQPSLISYSFQSGPEPVLLDVT  648

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAAD+ILLLDSYFT+V+FHG TIAQWR AGY +Q +H+ FAQLL++P E+A++IIR+RF
Sbjct  649  AIAADKILLLDSYFTVVIFHGITIAQWRNAGYQDQQDHEVFAQLLKSPHEEADTIIRERF  708

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQ+GSQARFLLAKLNPS TYNSD     GGD+IFTDDVSF+VF+DHL RLAV
Sbjct  709  PVPRLVVCDQYGSQARFLLAKLNPSVTYNSDNSS-HGGDVIFTDDVSFQVFMDHLMRLAV  767

Query  191  Q  189
            Q
Sbjct  768  Q  768



>ref|XP_006418018.1| hypothetical protein EUTSA_v10006857mg [Eutrema salsugineum]
 gb|ESQ36371.1| hypothetical protein EUTSA_v10006857mg [Eutrema salsugineum]
Length=780

 Score =   295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 158/180 (88%), Gaps = 0/180 (0%)
 Frame = -2

Query  728  FHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVGS  549
            F+LRRSQFVQVF NSPDETAY RM+LNREN+SN+ VMIQPSL +YSF+S+P+P LLDV S
Sbjct  600  FNLRRSQFVQVFNNSPDETAYNRMLLNRENISNAAVMIQPSLTTYSFNSIPQPALLDVAS  659

Query  548  IAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRFP  369
            IAADRILLLDSY ++V+FHG TIAQWR  GY +QPEHQAFAQLL+ P+EDA+ IIR+RFP
Sbjct  660  IAADRILLLDSYISVVIFHGMTIAQWRNMGYQDQPEHQAFAQLLEAPQEDAQMIIRERFP  719

Query  368  VPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
            VPRLV+CDQHGSQARFLLAKLNPSATYN+ +    G DIIFTDDVS +VF  HLQ+LAVQ
Sbjct  720  VPRLVVCDQHGSQARFLLAKLNPSATYNNASEMNAGSDIIFTDDVSLQVFFQHLQKLAVQ  779



>ref|NP_563741.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
 gb|AAN72246.1| At1g05520/T25N20_16 [Arabidopsis thaliana]
 gb|AEE27848.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
Length=783

 Score =   295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  728  FHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVGS  549
            F+LRRSQFVQVF NSPDETAY RM+LNREN+SN+ VMIQPSL +YSF+S+P+P LLDV S
Sbjct  603  FNLRRSQFVQVFNNSPDETAYNRMLLNRENISNAAVMIQPSLTTYSFNSLPQPALLDVAS  662

Query  548  IAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRFP  369
            I ADRILLLDSY ++VVFHG TIAQWR  GY  QPEHQAFAQLL+ P+EDA+ IIRDRFP
Sbjct  663  IGADRILLLDSYISVVVFHGMTIAQWRNLGYQNQPEHQAFAQLLEAPQEDAQMIIRDRFP  722

Query  368  VPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
            VPRLV+CDQHGSQARFLLAKLNPSATYN+ +    G DIIFTDDVS +VF  HLQ+LAVQ
Sbjct  723  VPRLVVCDQHGSQARFLLAKLNPSATYNNASEMNAGSDIIFTDDVSLQVFFQHLQKLAVQ  782



>gb|AAL08282.1| At1g05520/T25N20_16 [Arabidopsis thaliana]
Length=783

 Score =   295 bits (754),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  728  FHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVGS  549
            F+LRRSQFVQVF NSPDETAY RM+LNREN+SN+ VMIQPSL +YSF+S+P+P LLDV S
Sbjct  603  FNLRRSQFVQVFNNSPDETAYNRMLLNRENISNAAVMIQPSLTTYSFNSLPQPALLDVAS  662

Query  548  IAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRFP  369
            I ADRILLLDSY ++VVFHG TIAQWR  GY  QPEHQAFAQLL+ P+EDA+ IIRDRFP
Sbjct  663  IGADRILLLDSYISVVVFHGMTIAQWRNLGYQNQPEHQAFAQLLEAPQEDAQMIIRDRFP  722

Query  368  VPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
            VPRLV+CDQHGSQARFLLAKLNPSATYN+ +    G DIIFTDDVS +VF  HLQ+LAVQ
Sbjct  723  VPRLVVCDQHGSQARFLLAKLNPSATYNNASEMNAGSDIIFTDDVSLQVFFQHLQKLAVQ  782



>ref|XP_004296961.1| PREDICTED: protein transport protein SEC23-like [Fragaria vesca 
subsp. vesca]
Length=770

 Score =   294 bits (752),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN++N+ VMIQPSLISYSF+S+P+P LLDV 
Sbjct  589  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVA  648

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF+IV+FHG TIAQWR  GY  Q EH AFAQLLQ P +D + IIR+RF
Sbjct  649  SIAADRILLLDSYFSIVIFHGMTIAQWRNMGYQNQQEHVAFAQLLQAPHDDTQMIIRERF  708

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  709  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMAAGSDVIFTDDVSLQVFFEHLQRLAV  768

Query  191  Q  189
            Q
Sbjct  769  Q  769



>gb|KHG16267.1| Protein transport Sec23A [Gossypium arboreum]
Length=772

 Score =   294 bits (752),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN++N+ VMIQPSLISYSF+S+P+P LLDV 
Sbjct  591  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVA  650

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+ADRILLLD+YF+IV+FHG TIAQWR  GY  QPEHQAF+QLLQ P  DA+ II++RF
Sbjct  651  SISADRILLLDAYFSIVIFHGMTIAQWRNMGYQSQPEHQAFSQLLQAPHVDAQMIIQERF  710

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS ++F +HLQ+LAV
Sbjct  711  PVPRLVVCDQHGSQARFLLAKLNPSATYNNSIDMTAGSDVIFTDDVSLQIFFEHLQKLAV  770

Query  191  Q  189
            Q
Sbjct  771  Q  771



>ref|XP_008678116.1| PREDICTED: protein transport protein SEC23-like [Zea mays]
 gb|AFW60719.1| hypothetical protein ZEAMMB73_153144 [Zea mays]
Length=791

 Score =   294 bits (753),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+++NSV MIQPSLIS+SF S P PV LDV 
Sbjct  610  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESITNSVAMIQPSLISFSFDSPPSPVFLDVA  669

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++V+FHG TIAQWR  GY  QPEH+ FAQLLQ P E+A+ II+ RF
Sbjct  670  SIAADRILLLDAYFSVVIFHGMTIAQWRNMGYQNQPEHEQFAQLLQAPHEEAQMIIKGRF  729

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYNS     PG DIIFTDDVSF+VF +HLQRLAV
Sbjct  730  PVPRLVVCDQHGSQARFLLAKLNPSATYNSAHDVAPGSDIIFTDDVSFQVFCEHLQRLAV  789

Query  191  Q  189
            Q
Sbjct  790  Q  790



>ref|XP_004239847.1| PREDICTED: protein transport protein SEC23-like [Solanum lycopersicum]
Length=784

 Score =   294 bits (753),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETAY+RM+LNRE +SN+ VMIQP+L ++SF+S+P P LLDV 
Sbjct  602  MFHLRRSQFLQVFNNSPDETAYFRMLLNREGISNAAVMIQPTLTAFSFNSLPFPALLDVA  661

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++V+FHG TIAQWR  GY EQPEHQAFAQLLQ P ++A++IIR+RF
Sbjct  662  SIAADRILLLDAYFSVVIFHGMTIAQWRNMGYQEQPEHQAFAQLLQVPHDEAQAIIRERF  721

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  722  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMAAGSDVIFTDDVSLQVFFEHLQRLAV  781

Query  191  Q  189
            Q
Sbjct  782  Q  782



>gb|KFK32877.1| hypothetical protein AALP_AA6G299000 [Arabis alpina]
Length=769

 Score =   293 bits (751),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 141/181 (78%), Positives = 157/181 (87%), Gaps = 3/181 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENVSNS+VMIQPSL+S+SFHS PEP+LLDV 
Sbjct  592  VFHLRRSQFVQVFNNSPDETAYFRMILNRENVSNSIVMIQPSLVSFSFHSPPEPILLDVA  651

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYFT+V+FHG+TIAQWRKAGYH QPEHQAF  LLQ PR+ A +II +RF
Sbjct  652  SIAADRILLLDSYFTLVIFHGTTIAQWRKAGYHNQPEHQAFVHLLQLPRDYANTIISERF  711

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P PRLVICDQ+GSQARFLLAKLNPS+  N+   P  GG  +FTDDVS  VFLDHL RL V
Sbjct  712  PAPRLVICDQYGSQARFLLAKLNPSSDGNA---PFSGGSNVFTDDVSLSVFLDHLTRLIV  768

Query  191  Q  189
            Q
Sbjct  769  Q  769



>ref|XP_006663401.1| PREDICTED: protein transport protein SEC23-like, partial [Oryza 
brachyantha]
Length=748

 Score =   293 bits (750),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+++NSV MIQPSLIS+SF S P PV LDV 
Sbjct  567  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESITNSVAMIQPSLISFSFDSPPSPVFLDVA  626

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++V+FHG TIAQWR  GY  QPEHQ FAQLLQ P E+A+ II+ RF
Sbjct  627  SIAADRILLLDAYFSVVIFHGMTIAQWRNMGYQNQPEHQQFAQLLQAPHEEAQIIIKGRF  686

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYNS     PG DIIFTDDVSF+VF +HLQRLAV
Sbjct  687  PVPRLVVCDQHGSQARFLLAKLNPSATYNSAHDVPPGSDIIFTDDVSFQVFCEHLQRLAV  746

Query  191  Q  189
            Q
Sbjct  747  Q  747



>emb|CDX90271.1| BnaA08g17130D [Brassica napus]
Length=738

 Score =   293 bits (749),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+ VMIQPSL SY+F S P+P LLDV 
Sbjct  557  IFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNATVMIQPSLTSYTFSSPPQPALLDVA  616

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++VVFHG TIAQWR  GYH Q EH+AFAQLLQ P+ED++ I+R+RF
Sbjct  617  SIAADRILLLDAYFSVVVFHGMTIAQWRNMGYHHQAEHEAFAQLLQAPQEDSQMIVRERF  676

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQ+LAV
Sbjct  677  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSAGSDVIFTDDVSLQVFFEHLQKLAV  736

Query  191  Q  189
            Q
Sbjct  737  Q  737



>gb|KFK42891.1| hypothetical protein AALP_AA1G052100 [Arabis alpina]
Length=777

 Score =   293 bits (751),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 138/180 (77%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  728  FHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVGS  549
            F+LRRSQFVQVF NSPDETAY RM+LNREN+SN+ VMIQPSL +YSF+S+P+P LLDV S
Sbjct  597  FNLRRSQFVQVFNNSPDETAYNRMLLNRENISNAAVMIQPSLTTYSFNSLPQPALLDVAS  656

Query  548  IAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRFP  369
            IAADRILLLDSY ++VVFHG TIAQWR  GY  QPEHQAFAQLL+ P+EDA+ IIR+RFP
Sbjct  657  IAADRILLLDSYISVVVFHGMTIAQWRNLGYQNQPEHQAFAQLLEAPQEDAQMIIRERFP  716

Query  368  VPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
            VPRLV+CDQHGSQARFLLAKLNPSATYN+ +    G DIIFTDDVS +VF  HLQ+LAVQ
Sbjct  717  VPRLVVCDQHGSQARFLLAKLNPSATYNNASEMNAGSDIIFTDDVSLQVFFQHLQKLAVQ  776



>ref|XP_006827919.1| PREDICTED: protein transport protein SEC23 [Amborella trichopoda]
 gb|ERM95335.1| hypothetical protein AMTR_s00008p00163370 [Amborella trichopoda]
Length=762

 Score =   293 bits (750),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 140/181 (77%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRENV+NSVVMIQPSLISYSF+S P P LLDV 
Sbjct  581  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENVTNSVVMIQPSLISYSFNSPPSPALLDVA  640

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+AD ILLLD+YF+IVVFHG TIAQWR  GY  QPEH+AFAQLLQ P++DA  II++RF
Sbjct  641  SISADHILLLDAYFSIVVFHGMTIAQWRNMGYQNQPEHEAFAQLLQAPQDDARLIIKERF  700

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICDQHGSQARFLL KLNPSATYNS      G D+IFTDDVS +VF +HLQRLAV
Sbjct  701  PVPRLVICDQHGSQARFLLVKLNPSATYNSSHDVASGMDVIFTDDVSLQVFFEHLQRLAV  760

Query  191  Q  189
            Q
Sbjct  761  Q  761



>ref|XP_002892293.1| hypothetical protein ARALYDRAFT_470552 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68552.1| hypothetical protein ARALYDRAFT_470552 [Arabidopsis lyrata subsp. 
lyrata]
Length=780

 Score =   293 bits (751),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  728  FHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVGS  549
            F+LRRSQFVQVF NSPDETAY RM+LNRE++SN+ VMIQPSL +YSF+S+P+P LLDV S
Sbjct  600  FNLRRSQFVQVFNNSPDETAYSRMLLNRESISNAAVMIQPSLTTYSFNSLPQPALLDVAS  659

Query  548  IAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRFP  369
            I ADRILLLDSY ++VVFHG TIAQWR  GY  QPEHQAFAQLL+ P+EDA+ IIRDRFP
Sbjct  660  IGADRILLLDSYISVVVFHGMTIAQWRNMGYQNQPEHQAFAQLLEAPQEDAQMIIRDRFP  719

Query  368  VPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
            VPRLV+CDQHGSQARFLLAKLNPSATYN+ +    G DIIFTDDVS +VF  HLQ+LAVQ
Sbjct  720  VPRLVVCDQHGSQARFLLAKLNPSATYNNASETNAGSDIIFTDDVSLQVFFQHLQKLAVQ  779



>gb|KJB30032.1| hypothetical protein B456_005G128200 [Gossypium raimondii]
Length=769

 Score =   293 bits (750),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+R++LN+EN++N+ VM+QPSLISYSF+S P+P LLDV 
Sbjct  588  IFNLRRSQFVQVFNNSPDETAYFRVLLNKENITNAAVMVQPSLISYSFNSPPQPALLDVA  647

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+AD ILLLDSYF+IVVFHG TIAQWR  GY  QPEHQAFA LL+ P+ DA+ IIRDRF
Sbjct  648  SISADHILLLDSYFSIVVFHGMTIAQWRNMGYQNQPEHQAFALLLEAPQVDAQIIIRDRF  707

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+     PG DIIFTDDVS +VF +HLQRLAV
Sbjct  708  PVPRLVVCDQHGSQARFLLAKLNPSATYNNATDIAPGSDIIFTDDVSLQVFCEHLQRLAV  767

Query  191  Q  189
            Q
Sbjct  768  Q  768



>emb|CDY12077.1| BnaC03g59930D [Brassica napus]
Length=737

 Score =   292 bits (748),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+ VMIQPSL SY+F S P+P LLDV 
Sbjct  556  IFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNATVMIQPSLTSYTFSSPPQPALLDVA  615

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++VVFHG TIAQWR  GYH Q EH+AFAQLLQ P+ED++ I+R+RF
Sbjct  616  SIAADRILLLDAYFSVVVFHGMTIAQWRNMGYHHQAEHEAFAQLLQAPQEDSQMIVRERF  675

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQ+LAV
Sbjct  676  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSAGSDVIFTDDVSLQVFFEHLQKLAV  735

Query  191  Q  189
            Q
Sbjct  736  Q  736



>ref|XP_010527422.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010527423.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010527424.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Tarenaya 
hassleriana]
Length=776

 Score =   293 bits (750),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+ N+ VM+QPSL SYSF+S P+P LLDV 
Sbjct  595  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENIPNAAVMVQPSLTSYSFNSPPQPALLDVA  654

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF++VVFHG TIAQWR  GY  QPEH AFAQLLQ P EDA+ I++DRF
Sbjct  655  SIAADRILLLDSYFSVVVFHGMTIAQWRNMGYQHQPEHAAFAQLLQAPPEDAQMIVQDRF  714

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF +HLQ+LAV
Sbjct  715  PVPRLVVCDQHGSQARFLLAKLNPSATYNNSNEMAAGSDIIFTDDVSLQVFFEHLQKLAV  774

Query  191  Q  189
            Q
Sbjct  775  Q  775



>gb|KJB28027.1| hypothetical protein B456_005G022700 [Gossypium raimondii]
Length=772

 Score =   293 bits (749),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN++N+ VMIQPSLISYSF+S+P+P LLDV 
Sbjct  591  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVA  650

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+ADRILLLD+YF+IV+FHG TIAQWR  GY  QPEHQAF+QLLQ P  DA+ I+++RF
Sbjct  651  SISADRILLLDAYFSIVIFHGMTIAQWRNMGYQSQPEHQAFSQLLQAPHVDAQMILQERF  710

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS ++F +HLQ+LAV
Sbjct  711  PVPRLVVCDQHGSQARFLLAKLNPSATYNNSIDMAAGSDVIFTDDVSLQIFFEHLQKLAV  770

Query  191  Q  189
            Q
Sbjct  771  Q  771



>ref|XP_003538532.1| PREDICTED: protein transport protein SEC23-like isoform 1 [Glycine 
max]
Length=767

 Score =   292 bits (748),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+ VMIQPSLISYSF+++P P LLDV 
Sbjct  586  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNAAVMIQPSLISYSFNALPAPALLDVA  645

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAAD+ILLLDSYF++V+FHG TIAQWR  GY  Q EHQAFAQLL+ P +DA+ IIR+RF
Sbjct  646  SIAADKILLLDSYFSVVIFHGMTIAQWRNLGYQNQQEHQAFAQLLRAPHDDAQMIIRERF  705

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  706  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMAAGSDVIFTDDVSLQVFFEHLQRLAV  765

Query  191  Q  189
            Q
Sbjct  766  Q  766



>ref|XP_009419583.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
Length=783

 Score =   292 bits (748),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 160/182 (88%), Gaps = 1/182 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQV  NSPDETAY+RM+LNRE+++NSVVMIQPSL+SYSF+S P P LLDV 
Sbjct  601  MFNLRRSQFVQVSNNSPDETAYFRMLLNRESITNSVVMIQPSLLSYSFNSPPAPALLDVT  660

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+ADRILLLD+YF++V+FHG TIAQWR  GYH QPEHQAFAQLLQ P +DA+ II DRF
Sbjct  661  SISADRILLLDAYFSVVIFHGMTIAQWRNMGYHNQPEHQAFAQLLQAPHDDAQLIITDRF  720

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDA-PPVPGGDIIFTDDVSFEVFLDHLQRLA  195
            PVPRLVICDQHGSQARFLLAKLNPSATYNS +   VPG D+I TDDVS +VF +HLQRLA
Sbjct  721  PVPRLVICDQHGSQARFLLAKLNPSATYNSASHEVVPGSDVILTDDVSLQVFCEHLQRLA  780

Query  194  VQ  189
            VQ
Sbjct  781  VQ  782



>ref|XP_006365462.1| PREDICTED: protein transport protein SEC23-like [Solanum tuberosum]
Length=784

 Score =   292 bits (748),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETAY+RM+LNRE +SN+ VMIQP+L ++SF+S+P P LLDV 
Sbjct  602  MFHLRRSQFLQVFNNSPDETAYFRMLLNREGISNAAVMIQPTLTAFSFNSLPFPALLDVA  661

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++V+FHG TIAQWR  GY +QPEHQAFAQLLQ P ++A++IIR+RF
Sbjct  662  SIAADRILLLDAYFSVVIFHGMTIAQWRNMGYQDQPEHQAFAQLLQVPHDEAQAIIRERF  721

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  722  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMAAGSDVIFTDDVSLQVFFEHLQRLAV  781

Query  191  Q  189
            Q
Sbjct  782  Q  782



>gb|EEC82002.1| hypothetical protein OsI_25948 [Oryza sativa Indica Group]
Length=768

 Score =   292 bits (747),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 163/181 (90%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+L+RE+V+N+VVMIQPSLISYSF S PEPVLLDV 
Sbjct  589  VFNLRRSQFVQVFNNSPDETAYFRMVLDREDVTNAVVMIQPSLISYSFQSGPEPVLLDVT  648

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAAD+ILLLDSYFT+V+FHG TIAQWR AGY +Q +H+ FAQLL++P E+A++IIR+RF
Sbjct  649  AIAADKILLLDSYFTVVIFHGITIAQWRNAGYQDQQDHEVFAQLLKSPHEEADTIIRERF  708

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQ+GSQARFLLAKLNPS TYNSD     GGD+IFTD VSF+VF+DHL RLAV
Sbjct  709  PVPRLVVCDQYGSQARFLLAKLNPSVTYNSDNSS-HGGDVIFTDGVSFQVFMDHLMRLAV  767

Query  191  Q  189
            Q
Sbjct  768  Q  768



>ref|XP_010532714.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010532715.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010532716.1| PREDICTED: protein transport protein SEC23-like isoform X3 [Tarenaya 
hassleriana]
Length=778

 Score =   292 bits (747),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+ M+LNREN+ N+ VMIQPSL SYSF+S P+P LLDV 
Sbjct  597  MFNLRRSQFVQVFNNSPDETAYFCMLLNRENIPNAAVMIQPSLSSYSFNSPPQPALLDVA  656

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF++VVFHG TIAQWR  GY  QPEH AFAQLLQ P+EDA+ ++RDRF
Sbjct  657  SIAADRILLLDSYFSVVVFHGMTIAQWRNMGYQLQPEHAAFAQLLQAPQEDAQMVVRDRF  716

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF +HLQ+LAV
Sbjct  717  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMAAGSDIIFTDDVSLQVFFEHLQKLAV  776

Query  191  Q  189
            Q
Sbjct  777  Q  777



>ref|XP_001762459.1| predicted protein [Physcomitrella patens]
 gb|EDQ72582.1| predicted protein [Physcomitrella patens]
Length=774

 Score =   292 bits (747),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 157/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+V+NS+VMIQPSLISYS    PEPVLLDV 
Sbjct  592  MFNLRRSQFVQVFNNSPDETAYFRMVLNRESVTNSLVMIQPSLISYSLSDPPEPVLLDVA  651

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIA DRILLLD+YF++V+FHG T+AQWR AGYH QP+  AFAQLLQ P  DA+ II +RF
Sbjct  652  SIAPDRILLLDAYFSVVIFHGMTVAQWRNAGYHLQPDQVAFAQLLQVPHNDAQGIISERF  711

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQH SQARFLLA+LNPSATYNS   P PGGDIIFTDDVS +VF++HLQRLAV
Sbjct  712  PVPRLVVCDQHKSQARFLLARLNPSATYNSANVPAPGGDIIFTDDVSLQVFVEHLQRLAV  771



>gb|EAY80788.1| hypothetical protein OsI_35968 [Oryza sativa Indica Group]
Length=793

 Score =   292 bits (747),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 138/181 (76%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+++NSV MIQPSLIS+SF S P PV LDV 
Sbjct  612  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESITNSVAMIQPSLISFSFDSPPSPVFLDVA  671

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++V+FHG TIAQWR  GY  QPEHQ FAQLLQ P E+A+ II+ RF
Sbjct  672  SIAADRILLLDAYFSVVIFHGMTIAQWRNMGYQNQPEHQQFAQLLQAPHEEAQIIIKGRF  731

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P PRLV+CDQHGSQARFLLAKLNPSATYNS     PG DIIFTDDVSF+VF +HLQRLAV
Sbjct  732  PAPRLVVCDQHGSQARFLLAKLNPSATYNSAHDVPPGSDIIFTDDVSFQVFCEHLQRLAV  791

Query  191  Q  189
            Q
Sbjct  792  Q  792



>ref|XP_010522277.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
 ref|XP_010522278.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
 ref|XP_010522279.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
 ref|XP_010522280.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
 ref|XP_010522281.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
 ref|XP_010522282.1| PREDICTED: protein transport protein SEC23 [Tarenaya hassleriana]
Length=780

 Score =   291 bits (746),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY RM+LNREN++N+ VMIQPSL +Y+F+S+P+P LLDV 
Sbjct  599  MFNLRRSQFVQVFNNSPDETAYNRMLLNRENITNAAVMIQPSLTTYAFNSLPQPALLDVA  658

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSY ++V+FHG TIAQWR  GY  QPEH AFAQLLQ P EDA+ IIR+RF
Sbjct  659  SIAADRILLLDSYVSVVIFHGMTIAQWRNMGYQNQPEHTAFAQLLQAPHEDAQMIIRERF  718

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+ +    G DIIFTDDVS +VF  HLQ+LAV
Sbjct  719  PVPRLVVCDQHGSQARFLLAKLNPSATYNNASELTAGSDIIFTDDVSLQVFFQHLQKLAV  778

Query  191  Q  189
            Q
Sbjct  779  Q  779



>ref|XP_006283156.1| hypothetical protein CARUB_v10004186mg [Capsella rubella]
 gb|EOA16054.1| hypothetical protein CARUB_v10004186mg [Capsella rubella]
Length=781

 Score =   291 bits (746),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+ VMIQPSL SY+F++ P+P LLDV 
Sbjct  600  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNATVMIQPSLTSYTFNAPPQPALLDVA  659

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++VVFHG TIAQWR  GYH+QPEH+AFAQLLQ P+ED++ ++++RF
Sbjct  660  SIAADRILLLDAYFSVVVFHGMTIAQWRTMGYHDQPEHEAFAQLLQAPQEDSQMLVQERF  719

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P PRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF +HL +LAV
Sbjct  720  PAPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSAGSDIIFTDDVSLQVFFEHLSKLAV  779

Query  191  Q  189
            Q
Sbjct  780  Q  780



>ref|XP_010466720.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=770

 Score =   291 bits (745),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+ M+LNREN+SN+ VMIQPSL  YSFHS P+P LLDV 
Sbjct  589  IFNLRRSQFVQVFNNSPDETAYFCMLLNRENISNATVMIQPSLTMYSFHSPPQPALLDVA  648

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++VVFHG T+AQWR  GYH Q EHQAFA+LLQ P+ED++ I+R+RF
Sbjct  649  SIAADRILLLDAYFSVVVFHGMTVAQWRNMGYHHQSEHQAFAELLQAPQEDSQMIVRERF  708

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQ+LAV
Sbjct  709  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSTGSDVIFTDDVSLQVFFEHLQKLAV  768

Query  191  Q  189
            Q
Sbjct  769  Q  769



>ref|XP_009111051.1| PREDICTED: protein transport protein SEC23 [Brassica rapa]
 emb|CDY15544.1| BnaA08g28280D [Brassica napus]
Length=767

 Score =   291 bits (744),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  728  FHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVGS  549
            F+LRRSQFVQVF NSPDETAY RM+LNREN+SN+ VMIQPSL +YSF ++P+P LLDV S
Sbjct  587  FNLRRSQFVQVFNNSPDETAYNRMLLNRENISNAAVMIQPSLTTYSFSTLPQPALLDVAS  646

Query  548  IAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRFP  369
            IAADRILLLDSY ++V+FHG TIAQWR  GY  QPEHQAFAQLL+ P+EDA+ IIR+RFP
Sbjct  647  IAADRILLLDSYISVVIFHGMTIAQWRNLGYQNQPEHQAFAQLLEAPQEDAQMIIRERFP  706

Query  368  VPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
            VPRLV+CDQHGSQARFLLAKLNPSATYN+ +    G D+IFTDDVS +VF  HLQ+LAVQ
Sbjct  707  VPRLVVCDQHGSQARFLLAKLNPSATYNNPSEMNAGSDVIFTDDVSLQVFFQHLQKLAVQ  766



>ref|XP_009799069.1| PREDICTED: protein transport protein SEC23-like [Nicotiana sylvestris]
Length=770

 Score =   291 bits (744),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETAY+RM+LNRE +SN+ VMIQP+L ++ F+S+P P LLDV 
Sbjct  588  MFHLRRSQFLQVFNNSPDETAYFRMLLNREGISNAAVMIQPTLTAFQFNSLPAPALLDVA  647

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++V+FHG TIAQWR  GY  QPEHQAFAQLLQ P ++A++IIR+RF
Sbjct  648  SIAADRILLLDAYFSVVIFHGMTIAQWRNMGYQNQPEHQAFAQLLQVPHDEAQAIIRERF  707

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  708  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANDMAAGSDVIFTDDVSLQVFFEHLQRLAV  767

Query  191  Q  189
            Q
Sbjct  768  Q  768



>emb|CDX86574.1| BnaC08g01290D [Brassica napus]
Length=767

 Score =   291 bits (744),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 156/180 (87%), Gaps = 0/180 (0%)
 Frame = -2

Query  728  FHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVGS  549
            F+LRRSQFVQVF NSPDETAY RM+LNREN+SN+ VMIQPSL +YSF ++P+P LLDV S
Sbjct  587  FNLRRSQFVQVFNNSPDETAYNRMLLNRENISNAAVMIQPSLTTYSFSTLPQPALLDVAS  646

Query  548  IAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRFP  369
            IAADRILLLDSY ++V+FHG TIAQWR  GY  QPEHQAFAQLL+ P+EDA+ IIR+RFP
Sbjct  647  IAADRILLLDSYISVVIFHGMTIAQWRNLGYQNQPEHQAFAQLLEAPQEDAQMIIRERFP  706

Query  368  VPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
            VPRLV+CDQHGSQARFLLAKLNPSATYN+ +    G D+IFTDDVS +VF  HLQ+LAVQ
Sbjct  707  VPRLVVCDQHGSQARFLLAKLNPSATYNNPSEMNAGSDVIFTDDVSLQVFFQHLQKLAVQ  766



>ref|XP_009622558.1| PREDICTED: protein transport protein SEC23-like [Nicotiana tomentosiformis]
Length=774

 Score =   291 bits (744),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETAY+RM+LNRE +SN+ VMIQP+L ++ F+S+P P LLDV 
Sbjct  592  MFHLRRSQFLQVFNNSPDETAYFRMLLNREGISNAAVMIQPTLTAFQFNSLPAPALLDVA  651

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++V+FHG TIAQWR  GY  QPEHQAFAQLLQ P ++A++IIR+RF
Sbjct  652  SIAADRILLLDAYFSVVIFHGMTIAQWRNMGYQNQPEHQAFAQLLQVPHDEAQAIIRERF  711

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  712  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANDMAAGSDVIFTDDVSLQVFFEHLQRLAV  771

Query  191  Q  189
            Q
Sbjct  772  Q  772



>ref|XP_003552491.1| PREDICTED: protein transport protein SEC23-like isoform 1 [Glycine 
max]
Length=766

 Score =   290 bits (743),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+L+REN+SN+ VMIQPSLISYSF+++P P LLDV 
Sbjct  585  MFNLRRSQFVQVFNNSPDETAYFRMLLDRENISNAAVMIQPSLISYSFNALPAPALLDVA  644

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAAD+ILLLDSYF++V+FHG TIAQWR  GY  Q EHQAFAQLL+ P +DA+ IIR+RF
Sbjct  645  SIAADKILLLDSYFSVVIFHGMTIAQWRNLGYQNQQEHQAFAQLLRAPHDDAQMIIRERF  704

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQRLAV
Sbjct  705  PVPRLVVCDQHGSQARFLLAKLNPSATYNNAHEMAAGSDVIFTDDVSLQVFFEHLQRLAV  764

Query  191  Q  189
            Q
Sbjct  765  Q  765



>ref|XP_010512680.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Camelina 
sativa]
 ref|XP_010512688.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Camelina 
sativa]
Length=769

 Score =   290 bits (743),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+ M+LNREN+SN+ VMIQPSL  YSFHS P+P LLDV 
Sbjct  588  IFNLRRSQFVQVFNNSPDETAYFCMLLNRENISNATVMIQPSLTMYSFHSPPQPALLDVA  647

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++VVFHG T+AQWR  GYH Q EHQAFA+LLQ P+ED++ I+R+RF
Sbjct  648  SIAADRILLLDAYFSVVVFHGMTVAQWRNMGYHHQSEHQAFAELLQAPQEDSQMIVRERF  707

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS  VF +HLQ+LAV
Sbjct  708  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSTGSDVIFTDDVSLRVFFEHLQKLAV  767

Query  191  Q  189
            Q
Sbjct  768  Q  768



>ref|XP_009417946.1| PREDICTED: protein transport protein SEC23-like [Musa acuminata 
subsp. malaccensis]
Length=786

 Score =   291 bits (744),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQV  NSPDETAY+RM+LNRE++SNSVVMIQPSL+SYSF+S P P LLDV 
Sbjct  605  MFNLRRSQFVQVINNSPDETAYFRMLLNRESISNSVVMIQPSLLSYSFNSPPSPALLDVA  664

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+ADRILLLD+YF++V+FHG TIAQWR  GY  QPEHQ FAQLLQ P++DA+ II++RF
Sbjct  665  SISADRILLLDAYFSVVIFHGMTIAQWRNMGYQNQPEHQVFAQLLQAPQDDAQIIIKNRF  724

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLVICD HGSQARFLLAKLNPSATYNS     PG D+IFT+DVS ++F +HLQRLAV
Sbjct  725  PVPRLVICDHHGSQARFLLAKLNPSATYNSAHEVAPGSDVIFTNDVSLQIFCEHLQRLAV  784

Query  191  Q  189
            Q
Sbjct  785  Q  785



>ref|NP_189008.1| Sec23/Sec24 protein transport family protein [Arabidopsis thaliana]
 dbj|BAB02785.1| protein transport protein Sec23 [Arabidopsis thaliana]
 gb|AAO22730.1| putative transport protein [Arabidopsis thaliana]
 gb|AAO50656.1| putative transport protein [Arabidopsis thaliana]
 gb|AEE76796.1| Sec23/Sec24 protein transport family protein [Arabidopsis thaliana]
Length=765

 Score =   290 bits (743),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+ M+LNREN+SN+ VMIQPSL +YSF+S  EP LLDV 
Sbjct  584  IFNLRRSQFVQVFNNSPDETAYFCMLLNRENISNATVMIQPSLTTYSFNSPAEPALLDVA  643

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++VVFHG TIAQWR  GYH QPEHQAFA+LLQ P+ED++ I+R+RF
Sbjct  644  SIAADRILLLDAYFSVVVFHGMTIAQWRNMGYHHQPEHQAFAELLQAPQEDSQMIVRERF  703

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQ+L V
Sbjct  704  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSTGSDVIFTDDVSLQVFFEHLQKLVV  763

Query  191  Q  189
            Q
Sbjct  764  Q  764



>ref|XP_004979229.1| PREDICTED: protein transport protein SEC23-like [Setaria italica]
Length=791

 Score =   291 bits (744),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LN E V+NSV MIQPSLIS+SF S P PV LDV 
Sbjct  610  MFNLRRSQFVQVFNNSPDETAYFRMLLNCETVTNSVAMIQPSLISFSFDSPPSPVFLDVA  669

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++V+FHG TIAQWR  GY  QPEH+ FAQLLQ P E+A+ II+ RF
Sbjct  670  SIAADRILLLDAYFSVVIFHGMTIAQWRNMGYQNQPEHEQFAQLLQAPHEEAQMIIKGRF  729

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPS+TYNS     PG DIIFTDDVSF+VF +HLQRLAV
Sbjct  730  PVPRLVVCDQHGSQARFLLAKLNPSSTYNSAHDVAPGSDIIFTDDVSFQVFCEHLQRLAV  789

Query  191  Q  189
            Q
Sbjct  790  Q  790



>ref|XP_002870333.1| hypothetical protein ARALYDRAFT_493493 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46592.1| hypothetical protein ARALYDRAFT_493493 [Arabidopsis lyrata subsp. 
lyrata]
Length=763

 Score =   290 bits (741),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 132/181 (73%), Positives = 159/181 (88%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE++SN+ VMIQPSL SYSF++ P+P LLDV 
Sbjct  582  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESISNATVMIQPSLTSYSFNAPPQPALLDVA  641

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAAD+ILLLD+YF++VVFHG TIAQWR  GYH QPEH+AFAQLLQ P+ED++ ++++RF
Sbjct  642  SIAADKILLLDAYFSVVVFHGMTIAQWRNMGYHHQPEHEAFAQLLQAPQEDSQMLVQERF  701

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF +HL +LAV
Sbjct  702  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSAGSDIIFTDDVSLQVFFEHLSKLAV  761

Query  191  Q  189
            Q
Sbjct  762  Q  762



>ref|XP_003577593.1| PREDICTED: protein transport protein SEC23-like [Brachypodium 
distachyon]
Length=787

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+++NSV MIQPSLIS+SF S P PV LDV 
Sbjct  606  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESITNSVAMIQPSLISFSFDSPPSPVFLDVA  665

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++V+FHG TIAQWR   Y  QPEHQ FAQLLQ P+++A+ II  RF
Sbjct  666  SIAADRILLLDAYFSVVIFHGMTIAQWRNMCYQNQPEHQQFAQLLQAPQDEAQVIISGRF  725

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYNS     PG DIIFTDDVSF+VF +HLQRLAV
Sbjct  726  PVPRLVVCDQHGSQARFLLAKLNPSATYNSAHDVAPGSDIIFTDDVSFQVFCEHLQRLAV  785

Query  191  Q  189
            Q
Sbjct  786  Q  786



>ref|XP_002885585.1| hypothetical protein ARALYDRAFT_479878 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61844.1| hypothetical protein ARALYDRAFT_479878 [Arabidopsis lyrata subsp. 
lyrata]
Length=769

 Score =   290 bits (741),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+ M+LNREN+SN+ VMIQPSL +YSF+S  EP LLDV 
Sbjct  588  IFNLRRSQFVQVFNNSPDETAYFCMLLNRENISNATVMIQPSLTTYSFNSPAEPALLDVA  647

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++VVFHG TIAQWR  GYH QPEHQAFA+LLQ P+ED++ ++R+RF
Sbjct  648  SIAADRILLLDAYFSVVVFHGMTIAQWRNMGYHHQPEHQAFAELLQAPQEDSQMLVRERF  707

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQ+L V
Sbjct  708  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSTGSDVIFTDDVSLQVFFEHLQKLVV  767

Query  191  Q  189
            Q
Sbjct  768  Q  768



>ref|NP_001189956.1| Sec23/Sec24 protein transport family protein [Arabidopsis thaliana]
 gb|AEE76797.1| Sec23/Sec24 protein transport family protein [Arabidopsis thaliana]
Length=791

 Score =   290 bits (742),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 157/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+ M+LNREN+SN+ VMIQPSL +YSF+S  EP LLDV 
Sbjct  610  IFNLRRSQFVQVFNNSPDETAYFCMLLNRENISNATVMIQPSLTTYSFNSPAEPALLDVA  669

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++VVFHG TIAQWR  GYH QPEHQAFA+LLQ P+ED++ I+R+RF
Sbjct  670  SIAADRILLLDAYFSVVVFHGMTIAQWRNMGYHHQPEHQAFAELLQAPQEDSQMIVRERF  729

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQ+L V
Sbjct  730  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSTGSDVIFTDDVSLQVFFEHLQKLVV  789

Query  191  Q  189
            Q
Sbjct  790  Q  790



>gb|AAX96396.1| At1g05520/T25N20_16 [Oryza sativa Japonica Group]
 gb|ABA93126.1| Sec23/Sec24 trunk domain containing protein, expressed [Oryza 
sativa Japonica Group]
 gb|EEE52049.1| hypothetical protein OsJ_33782 [Oryza sativa Japonica Group]
Length=793

 Score =   289 bits (740),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 137/181 (76%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+++NSV MIQPSLIS+SF   P PV LDV 
Sbjct  612  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESITNSVAMIQPSLISFSFDLPPSPVFLDVA  671

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++V+FHG TIAQWR  GY  QPEHQ FAQLLQ P E+A+ II+ RF
Sbjct  672  SIAADRILLLDAYFSVVIFHGMTIAQWRNMGYQNQPEHQQFAQLLQAPHEEAQIIIKGRF  731

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P PRLV+CDQHGSQARFLLAKLNPSATYNS     PG DIIFTDDVSF+VF +HLQRLAV
Sbjct  732  PAPRLVVCDQHGSQARFLLAKLNPSATYNSAHDVPPGSDIIFTDDVSFQVFCEHLQRLAV  791

Query  191  Q  189
            Q
Sbjct  792  Q  792



>ref|XP_006303716.1| hypothetical protein CARUB_v10011838mg [Capsella rubella]
 gb|EOA36614.1| hypothetical protein CARUB_v10011838mg [Capsella rubella]
Length=780

 Score =   288 bits (738),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  728  FHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVGS  549
            F+LRRSQFVQVF NSPDETAY RM+LNREN+SN+ VMIQPSL +YSF+S+P+P LLDV S
Sbjct  600  FNLRRSQFVQVFNNSPDETAYNRMLLNRENISNAAVMIQPSLTTYSFNSLPQPALLDVAS  659

Query  548  IAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRFP  369
            I  DRILLLDSY ++V+FHG TIAQWR   Y  QPEHQAFAQLL+ P+EDA+ IIRDRFP
Sbjct  660  IGTDRILLLDSYISVVIFHGMTIAQWRNLEYQNQPEHQAFAQLLEAPQEDAQMIIRDRFP  719

Query  368  VPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
            VPRLV+CDQHGSQARFLLAKLNPSATYN+ +    G DIIFTDDVS +VF  HLQ+LAVQ
Sbjct  720  VPRLVVCDQHGSQARFLLAKLNPSATYNNASEMNTGSDIIFTDDVSLQVFFQHLQKLAVQ  779



>ref|XP_006297004.1| hypothetical protein CARUB_v10012995mg [Capsella rubella]
 gb|EOA29902.1| hypothetical protein CARUB_v10012995mg [Capsella rubella]
Length=782

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+ M+LNREN+SN+ VMIQPSL  YSF S P+P LLDV 
Sbjct  601  IFNLRRSQFVQVFNNSPDETAYFCMLLNRENISNATVMIQPSLTMYSFTSPPQPALLDVA  660

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++VVFHG TIAQWR   YH QPEHQAFA+LLQ P+ED++ I+R+RF
Sbjct  661  SIAADRILLLDAYFSVVVFHGMTIAQWRNMRYHHQPEHQAFAELLQAPQEDSQMIVRERF  720

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF +HLQ+LAV
Sbjct  721  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSTGSDVIFTDDVSLQVFFEHLQKLAV  780

Query  191  Q  189
            Q
Sbjct  781  Q  781



>ref|XP_011084141.1| PREDICTED: protein transport protein SEC23-like [Sesamum indicum]
Length=782

 Score =   288 bits (736),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 157/182 (86%), Gaps = 1/182 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+R++LNRE +SN+ VMIQPSLISY+F+S+P P LLDV 
Sbjct  599  MFNLRRSQFVQVFNNSPDETAYFRILLNRETISNAAVMIQPSLISYAFNSLPAPALLDVQ  658

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF++V+FHG TIAQWR  GY  QPEHQ FA LLQ P +DA+ IIRDRF
Sbjct  659  SIAADRILLLDSYFSVVIFHGMTIAQWRNMGYQNQPEHQGFALLLQAPHDDAQLIIRDRF  718

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATY-NSDAPPVPGGDIIFTDDVSFEVFLDHLQRLA  195
            PVPRLV+CDQHGSQARFLLAKLNPSATY N+      G D+IFTDDVS +VF+DHLQRLA
Sbjct  719  PVPRLVVCDQHGSQARFLLAKLNPSATYSNAHEMMNSGSDVIFTDDVSLQVFIDHLQRLA  778

Query  194  VQ  189
            VQ
Sbjct  779  VQ  780



>ref|XP_010485034.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=780

 Score =   287 bits (735),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  728  FHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVGS  549
            F+LRRSQFVQVF NSPDETAY RM+LNREN+SN+ VMIQPSL +YSF+S+P+P LLDV S
Sbjct  600  FNLRRSQFVQVFNNSPDETAYNRMLLNRENISNAAVMIQPSLTTYSFNSLPQPALLDVAS  659

Query  548  IAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRFP  369
            I  DRILLLDSY ++VVFHG +IAQWR  GY   P+HQAFAQLL+ P+EDA+ IIRDRFP
Sbjct  660  IGVDRILLLDSYISVVVFHGMSIAQWRNMGYQNHPDHQAFAQLLEAPQEDAQMIIRDRFP  719

Query  368  VPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
            VPRLV+CDQHGSQARFLLAKLNPSATYN+ +    G DIIFTDDVS +VF  HLQ+LAVQ
Sbjct  720  VPRLVVCDQHGSQARFLLAKLNPSATYNNASEMNEGSDIIFTDDVSLQVFFQHLQKLAVQ  779



>dbj|BAK01218.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=782

 Score =   287 bits (735),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 155/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+++NSV MIQPSLIS+SF S P PV LDV 
Sbjct  601  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESITNSVAMIQPSLISFSFDSPPSPVFLDVA  660

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIA DRILLLD+YF++V+FHG TIAQWR   Y  QPEHQ FAQLLQ P+E+A+ II  RF
Sbjct  661  SIAVDRILLLDAYFSVVIFHGMTIAQWRNMCYQNQPEHQQFAQLLQAPQEEAQVIINGRF  720

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYNS     PG DIIFTDDVSF+VF +HLQRL+V
Sbjct  721  PVPRLVVCDQHGSQARFLLAKLNPSATYNSAHDVPPGSDIIFTDDVSFQVFCEHLQRLSV  780

Query  191  Q  189
            Q
Sbjct  781  Q  781



>ref|XP_010435181.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=776

 Score =   287 bits (735),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+ VMIQPSL SY+F S P+P LLDV 
Sbjct  595  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNATVMIQPSLTSYTFGSPPQPALLDVA  654

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++VVFHG TIAQWR  GYH Q +H+ FAQLLQ P+ED++ ++++RF
Sbjct  655  SIAADRILLLDAYFSVVVFHGMTIAQWRNMGYHHQADHEGFAQLLQVPQEDSQMLVKERF  714

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF +HL +LAV
Sbjct  715  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSAGSDIIFTDDVSLQVFFEHLSKLAV  774

Query  191  Q  189
            Q
Sbjct  775  Q  775



>ref|XP_010440522.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=779

 Score =   287 bits (734),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+ VMIQPSL SY+F S P+P LLDV 
Sbjct  598  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNATVMIQPSLTSYTFGSPPQPALLDVA  657

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++VVFHG TIAQWR  GYH Q +H+ FAQLLQ P+ED++ ++++RF
Sbjct  658  SIAADRILLLDAYFSVVVFHGMTIAQWRNMGYHHQADHEGFAQLLQVPQEDSQMLVKERF  717

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF +HL +LAV
Sbjct  718  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSAGSDIIFTDDVSLQVFFEHLSKLAV  777

Query  191  Q  189
            Q
Sbjct  778  Q  778



>ref|XP_010457640.1| PREDICTED: protein transport protein SEC23-like isoform X1 [Camelina 
sativa]
 ref|XP_010457641.1| PREDICTED: protein transport protein SEC23-like isoform X2 [Camelina 
sativa]
Length=780

 Score =   287 bits (734),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  728  FHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVGS  549
            F+LRRSQFVQVF NSPDETAY RM+LNREN+SN+ VMIQPSL +YSF+S+P+P LLDV S
Sbjct  600  FNLRRSQFVQVFNNSPDETAYNRMLLNRENISNAAVMIQPSLTTYSFNSLPQPALLDVAS  659

Query  548  IAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRFP  369
            I  DRILLLDSY ++V+FHG +IAQWR  GY   P+HQAFAQLL+ P+EDA+ IIRDRFP
Sbjct  660  IGVDRILLLDSYISVVIFHGMSIAQWRNMGYQNHPDHQAFAQLLEAPQEDAQMIIRDRFP  719

Query  368  VPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
            VPRLV+CDQHGSQARFLLAKLNPSATYN+ +    G DIIFTDDVS +VF  HLQ+LAVQ
Sbjct  720  VPRLVVCDQHGSQARFLLAKLNPSATYNNASEMNEGSDIIFTDDVSLQVFFQHLQKLAVQ  779



>ref|XP_010475248.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=780

 Score =   286 bits (733),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  728  FHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVGS  549
            F+LRRSQFVQVF NSPDETAY RM+LNREN+SN+ VMIQPSL +YSF+S+P+P LLDV S
Sbjct  600  FNLRRSQFVQVFNNSPDETAYNRMLLNRENISNAAVMIQPSLTTYSFNSLPQPALLDVAS  659

Query  548  IAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRFP  369
            I  DRILLLDSY ++V+FHG +IAQWR  GY   P+HQAFAQLL+ P+EDA+ IIRDRFP
Sbjct  660  IGVDRILLLDSYISVVIFHGMSIAQWRNMGYQNHPDHQAFAQLLEAPQEDAQMIIRDRFP  719

Query  368  VPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
            VPRLV+CDQHGSQARFLLAKLNPSATYN+ +    G DIIFTDDVS +VF  HLQ+LAVQ
Sbjct  720  VPRLVVCDQHGSQARFLLAKLNPSATYNNASEMNEGSDIIFTDDVSLQVFFQHLQKLAVQ  779



>ref|XP_010450096.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=784

 Score =   286 bits (733),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN+SN+ VMIQPSL SY+F S P+P LLDV 
Sbjct  603  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENISNATVMIQPSLTSYAFDSPPQPALLDVA  662

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++VVFHG TIAQWR  GYH Q +H+ FAQLLQ P+ED++ ++++RF
Sbjct  663  SIAADRILLLDAYFSVVVFHGMTIAQWRNMGYHHQADHEGFAQLLQVPQEDSQMLVKERF  722

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF +HL +LAV
Sbjct  723  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMSAGSDIIFTDDVSLQVFFEHLSKLAV  782

Query  191  Q  189
            Q
Sbjct  783  Q  783



>ref|XP_006358773.1| PREDICTED: protein transport protein SEC23-like [Solanum tuberosum]
Length=764

 Score =   286 bits (731),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/181 (72%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETAY+RM+L RE++SN+VVMIQP+L+++SF+++P P LLDV 
Sbjct  582  MFHLRRSQFLQVFNNSPDETAYFRMLLYRESISNAVVMIQPTLMAFSFNTLPSPALLDVA  641

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF++V+FHG TIAQWR  GY  QPEHQAFA LLQ P ++A+++I++RF
Sbjct  642  SIAADRILLLDSYFSVVIFHGMTIAQWRNLGYQNQPEHQAFAHLLQVPHDEAQALIQERF  701

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF  HLQRLAV
Sbjct  702  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANDMAAGSDVIFTDDVSLQVFFQHLQRLAV  761

Query  191  Q  189
            Q
Sbjct  762  Q  762



>ref|XP_003080891.1| protein transport protein Sec23 (ISS) [Ostreococcus tauri]
 emb|CAL55059.1| Zinc finger, Sec23/Sec24-type [Ostreococcus tauri]
Length=796

 Score =   286 bits (731),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 137/180 (76%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RMIL RENV NS+VMIQP+L SYSF+  PEPVLLDV 
Sbjct  614  MFNLRRSQFVQVFNNSPDETAYFRMILQRENVYNSLVMIQPTLTSYSFNGPPEPVLLDVC  673

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRIL+LD+YFT+VVFHG TIAQWRKA Y +QPEH AF +LL  PR +A+ I+  RF
Sbjct  674  SIAADRILVLDAYFTVVVFHGMTIAQWRKANYQDQPEHVAFKELLAAPRVEADQILASRF  733

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRL+ CDQHGSQARFLLAKLNPSATYNS A    G DIIFTDDVS +VFLDHL+RLAV
Sbjct  734  PVPRLIDCDQHGSQARFLLAKLNPSATYNSSASMGGGSDIIFTDDVSLQVFLDHLKRLAV  793



>dbj|BAJ85358.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=782

 Score =   285 bits (729),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 154/181 (85%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRE+++NSV MIQPSLIS+SF S P P  LDV 
Sbjct  601  MFNLRRSQFVQVFNNSPDETAYFRMLLNRESITNSVAMIQPSLISFSFDSPPSPGFLDVA  660

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIA DRILLLD+YF++V+FHG TIAQWR   Y  QPEHQ FAQLLQ P+E+A+ II  RF
Sbjct  661  SIAVDRILLLDAYFSVVIFHGMTIAQWRNMCYQNQPEHQQFAQLLQAPQEEAQVIINGRF  720

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYNS     PG DIIFTDDVSF+VF +HLQRL+V
Sbjct  721  PVPRLVVCDQHGSQARFLLAKLNPSATYNSAHDVPPGSDIIFTDDVSFQVFCEHLQRLSV  780

Query  191  Q  189
            Q
Sbjct  781  Q  781



>gb|EPS72601.1| hypothetical protein M569_02145 [Genlisea aurea]
Length=773

 Score =   285 bits (728),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 159/181 (88%), Gaps = 2/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+R++LNRE++SNS VMIQPSLISY F+S+P P LLDV 
Sbjct  593  MFNLRRSQFVQVFNNSPDETAYFRILLNRESISNSAVMIQPSLISYGFNSLPAPALLDVS  652

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+ADRILLLDSYF++V+FHG TIAQWR  GY  Q EHQ FA LL+TP EDAE+IIR+RF
Sbjct  653  SISADRILLLDSYFSVVIFHGMTIAQWRNMGYQNQAEHQGFALLLRTPHEDAEAIIRERF  712

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARF+LAKLNPSATY S+A  +   D+IFTDDVS +VF+DHLQRLAV
Sbjct  713  PVPRLVVCDQHGSQARFVLAKLNPSATY-SNAQEM-ASDVIFTDDVSLQVFIDHLQRLAV  770

Query  191  Q  189
            Q
Sbjct  771  Q  771



>emb|CDY13800.1| BnaA09g43020D [Brassica napus]
Length=754

 Score =   284 bits (726),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 157/180 (87%), Gaps = 3/180 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENVSNS+VMIQPSL+S++F+S PEP+ LDV 
Sbjct  577  VFHLRRSQFVQVFNNSPDETAYFRMILNRENVSNSIVMIQPSLVSFTFNSQPEPIPLDVA  636

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YFT+V+FHG+TIAQWRKAGYH QPEHQA   LLQ+PR+ +++II +RF
Sbjct  637  SIAADRILLLDAYFTLVIFHGATIAQWRKAGYHHQPEHQALVHLLQSPRDYSDTIINERF  696

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P+PRLVICDQ+GSQARFLLAKLNPS+  N    P  GG  +FTDDVS  VFLDHL+RL V
Sbjct  697  PIPRLVICDQYGSQARFLLAKLNPSSDGNG---PFSGGSNVFTDDVSLSVFLDHLRRLIV  753



>ref|XP_010683601.1| PREDICTED: protein transport protein SEC23-like [Beta vulgaris 
subsp. vulgaris]
Length=791

 Score =   285 bits (728),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 156/181 (86%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNRENV+N+ VMIQPSLI+YSF++ P P LLDV 
Sbjct  610  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENVTNAAVMIQPSLIAYSFNAPPSPALLDVA  669

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++V+FHG T+AQWR  GY  QPEHQAF +LL+ P++D++ II DRF
Sbjct  670  SIAADRILLLDAYFSVVIFHGMTVAQWRNMGYQNQPEHQAFKELLEAPQQDSQMIIHDRF  729

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+        D+IFTDDVS +VF +HLQRLAV
Sbjct  730  PVPRLVVCDQHGSQARFLLAKLNPSATYNNVNELAAVSDVIFTDDVSLQVFFEHLQRLAV  789

Query  191  Q  189
            Q
Sbjct  790  Q  790



>ref|XP_004247906.1| PREDICTED: protein transport protein SEC23-like [Solanum lycopersicum]
Length=766

 Score =   283 bits (725),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 158/181 (87%), Gaps = 0/181 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETAY+RM+L RE++S++VVMIQP+L+++SF+++P P LLDV 
Sbjct  584  MFHLRRSQFLQVFNNSPDETAYFRMLLYRESISSAVVMIQPTLMAFSFNTLPSPALLDVA  643

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF++V+FHG TIAQWR  GY  QPEHQAFA LLQ P ++A+++I++RF
Sbjct  644  SIAADRILLLDSYFSVVIFHGMTIAQWRNLGYQNQPEHQAFAHLLQVPHDEAQALIQERF  703

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+      G D+IFTDDVS +VF  HLQRLAV
Sbjct  704  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANDMAAGSDVIFTDDVSLQVFFQHLQRLAV  763

Query  191  Q  189
            Q
Sbjct  764  Q  764



>ref|XP_009117382.1| PREDICTED: protein transport protein SEC23 [Brassica rapa]
Length=759

 Score =   283 bits (724),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 157/180 (87%), Gaps = 3/180 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENVSNS+VMIQPSL+S++F+S PEP+ LDV 
Sbjct  582  VFHLRRSQFVQVFNNSPDETAYFRMILNRENVSNSIVMIQPSLVSFTFNSQPEPIPLDVA  641

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YFT+V+FHG+TIAQWRKAGYH QPEHQA   LLQ+PR+ +++II +RF
Sbjct  642  SIAADRILLLDAYFTLVIFHGATIAQWRKAGYHHQPEHQALVHLLQSPRDYSDTIINERF  701

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P+PRLVICDQ+GSQARFLLAKLNPS+  N    P  GG  +FTDDVS  VFLDHL+RL V
Sbjct  702  PIPRLVICDQYGSQARFLLAKLNPSSDGNG---PFSGGSNVFTDDVSLSVFLDHLRRLIV  758



>ref|XP_001419416.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97709.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=770

 Score =   282 bits (722),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/180 (75%), Positives = 153/180 (85%), Gaps = 0/180 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RMIL RENV NS+VMIQP+L +YSF+  PEPVLLDV 
Sbjct  588  MFNLRRSQFVQVFNNSPDETAYFRMILMRENVFNSLVMIQPTLTAYSFNGPPEPVLLDVC  647

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAAD+IL+LD+YF++VVFHG TIAQWRKA Y +QPEH AF  LL  P+ +AE II  RF
Sbjct  648  SIAADKILVLDAYFSVVVFHGMTIAQWRKANYQDQPEHVAFKDLLAAPKAEAEQIIATRF  707

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV CDQHGSQARFLLAKLNPSATYNS A    G DIIFTDDVS +VF+DHL+RLAV
Sbjct  708  PVPRLVDCDQHGSQARFLLAKLNPSATYNSSATMGGGSDIIFTDDVSLQVFMDHLKRLAV  767



>ref|NP_179757.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
 gb|AAD23642.1| putative protein transport protein SEC23 [Arabidopsis thaliana]
 gb|AAM20606.1| putative protein transport protein SEC23 [Arabidopsis thaliana]
 gb|AAQ56788.1| At2g21630 [Arabidopsis thaliana]
 gb|AEC07205.1| sec23/sec24-like transport protein [Arabidopsis thaliana]
Length=761

 Score =   281 bits (719),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 139/181 (77%), Positives = 155/181 (86%), Gaps = 4/181 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMIL RENVSNSVVMIQPSLIS+SFHS PEP+LLDV 
Sbjct  585  VFHLRRSQFVQVFNNSPDETAYFRMILYRENVSNSVVMIQPSLISFSFHSPPEPILLDVA  644

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYFT+V+FHGSTIAQWRKAGYH QPEHQAF  LLQ+PR+ A++I+ +RF
Sbjct  645  SIAADRILLLDSYFTLVIFHGSTIAQWRKAGYHNQPEHQAFGHLLQSPRDYADTIMSERF  704

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P PRLVICDQ+GSQARFLLAKLNP    + DA    G   +FTDDVS  VFLDHL+RL V
Sbjct  705  PTPRLVICDQYGSQARFLLAKLNPC---DGDA-HFSGQSNVFTDDVSLSVFLDHLRRLIV  760

Query  191  Q  189
             
Sbjct  761  H  761



>ref|XP_002508348.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69606.1| predicted protein [Micromonas sp. RCC299]
Length=808

 Score =   281 bits (720),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 154/180 (86%), Gaps = 0/180 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAYYRMIL RENV NS+VMIQP+L++YSF+  PEPVLLDV 
Sbjct  627  MFNLRRSQFVQVFNNSPDETAYYRMILWRENVLNSLVMIQPTLMAYSFNGPPEPVLLDVC  686

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIA DRIL+LD+YF++V+FHG TIAQWRKA Y EQPEH+AF QLL+ P+ DA+ I+  RF
Sbjct  687  SIAPDRILVLDAYFSVVIFHGQTIAQWRKANYQEQPEHEAFKQLLEAPKADAQEILGRRF  746

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV CDQHGSQARFLLAKLNPSATYNS        DIIFTDDVS +VF++HL+RLAV
Sbjct  747  PVPRLVDCDQHGSQARFLLAKLNPSATYNSAGMGGGSSDIIFTDDVSLQVFMEHLKRLAV  806



>ref|XP_006404618.1| hypothetical protein EUTSA_v10000056mg [Eutrema salsugineum]
 gb|ESQ46071.1| hypothetical protein EUTSA_v10000056mg [Eutrema salsugineum]
Length=764

 Score =   281 bits (718),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 155/181 (86%), Gaps = 4/181 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENVSNS+VMIQPSL+S+SFHS PEP+LLDV 
Sbjct  588  VFHLRRSQFVQVFNNSPDETAYFRMILNRENVSNSIVMIQPSLVSFSFHSPPEPILLDVS  647

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHG TIAQWRKAGY  QPEHQAF  LLQ+PR+ A++II +RF
Sbjct  648  AIAADRILLLDSYFTLVIFHGVTIAQWRKAGYQNQPEHQAFVHLLQSPRDCADTIINERF  707

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P PR VICDQ+GSQARFLLAKLNP    + +A P  G   +FTDDVS  VFLDHL+RL V
Sbjct  708  PTPRTVICDQYGSQARFLLAKLNPC---DGNA-PFSGESNVFTDDVSLSVFLDHLRRLIV  763

Query  191  Q  189
            Q
Sbjct  764  Q  764



>ref|XP_010472160.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=765

 Score =   280 bits (716),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 135/181 (75%), Positives = 153/181 (85%), Gaps = 3/181 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RM+L RENVSNS+VMIQPSL+++S HS PEP+LLDV 
Sbjct  588  VFHLRRSQFVQVFNNSPDETAYFRMLLYRENVSNSIVMIQPSLVAFSLHSQPEPILLDVA  647

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYFT+V+FHGS IAQWRKAGYH QPEHQAF  LLQ+PR+  ++II +RF
Sbjct  648  SIAADRILLLDSYFTLVIFHGSAIAQWRKAGYHNQPEHQAFKHLLQSPRDYTDTIISERF  707

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P PRLVICDQ+GSQARFLLAKLNPS   +    P  G   IFTDDVS  VFLDHL+RL V
Sbjct  708  PSPRLVICDQYGSQARFLLAKLNPS---DGGDAPFSGESNIFTDDVSLSVFLDHLRRLIV  764

Query  191  Q  189
            Q
Sbjct  765  Q  765



>ref|XP_002878562.1| hypothetical protein ARALYDRAFT_481031 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54821.1| hypothetical protein ARALYDRAFT_481031 [Arabidopsis lyrata subsp. 
lyrata]
Length=761

 Score =   280 bits (716),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 136/181 (75%), Positives = 153/181 (85%), Gaps = 4/181 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDET Y+RMIL RENVSNS+VMIQPSLIS+SFHS PEP+LLDV 
Sbjct  585  VFHLRRSQFVQVFNNSPDETVYFRMILYRENVSNSIVMIQPSLISFSFHSPPEPILLDVA  644

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYFT+V+FHGSTIAQW+KAGYH QPEHQ F  LLQ+PR+ A++II +RF
Sbjct  645  SIAADRILLLDSYFTLVIFHGSTIAQWQKAGYHNQPEHQVFEHLLQSPRDYADTIINERF  704

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P PRLVICDQ+GSQARFLLAKLNPS        P+ G   +FTDDVS  VFLDHL+RL V
Sbjct  705  PTPRLVICDQYGSQARFLLAKLNPS----DGEAPLSGESNVFTDDVSLSVFLDHLRRLIV  760

Query  191  Q  189
             
Sbjct  761  H  761



>emb|CDY59754.1| BnaC08g49290D [Brassica napus]
Length=947

 Score =   282 bits (722),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 134/180 (74%), Positives = 156/180 (87%), Gaps = 3/180 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENVSNSVVMIQP L+S++F+S PEP+ LDV 
Sbjct  770  VFHLRRSQFVQVFNNSPDETAYFRMILNRENVSNSVVMIQPWLVSFTFNSQPEPIPLDVA  829

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YFT+V+FHG+TIAQWRKAGYH QPEHQA   LLQ+PR+ +++II +RF
Sbjct  830  SIAADRILLLDAYFTLVIFHGATIAQWRKAGYHHQPEHQALVHLLQSPRDYSDTIINERF  889

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P+PRLVICDQ+GSQARFLLAKLNPS+  N    P  GG  +FTDDVS  VFLDHL+RL V
Sbjct  890  PIPRLVICDQYGSQARFLLAKLNPSSDGNG---PFSGGSNVFTDDVSLSVFLDHLRRLIV  946



>gb|AAF79733.1|AC005106_14 T25N20.17 [Arabidopsis thaliana]
Length=811

 Score =   280 bits (716),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 156/208 (75%), Gaps = 28/208 (13%)
 Frame = -2

Query  728  FHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVGS  549
            F+LRRSQFVQVF NSPDETAY RM+LNREN+SN+ VMIQPSL +YSF+S+P+P LLDV S
Sbjct  603  FNLRRSQFVQVFNNSPDETAYNRMLLNRENISNAAVMIQPSLTTYSFNSLPQPALLDVAS  662

Query  548  IAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQ----------------------  435
            I ADRILLLDSY ++VVFHG TIAQWR  GY  QPEHQ                      
Sbjct  663  IGADRILLLDSYISVVVFHGMTIAQWRNLGYQNQPEHQVMNMQVALALDFLEYEPYMSRL  722

Query  434  ------AFAQLLQTPREDAESIIRDRFPVPRLVICDQHGSQARFLLAKLNPSATYNSDAP  273
                  AFAQLL+ P+EDA+ IIRDRFPVPRLV+CDQHGSQARFLLAKLNPSATYN+ + 
Sbjct  723  TSLFVKAFAQLLEAPQEDAQMIIRDRFPVPRLVVCDQHGSQARFLLAKLNPSATYNNASE  782

Query  272  PVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
               G DIIFTDDVS +VF  HLQ+LAVQ
Sbjct  783  MNAGSDIIFTDDVSLQVFFQHLQKLAVQ  810



>ref|XP_006296197.1| hypothetical protein CARUB_v10025362mg [Capsella rubella]
 gb|EOA29095.1| hypothetical protein CARUB_v10025362mg [Capsella rubella]
Length=761

 Score =   278 bits (711),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 156/178 (88%), Gaps = 4/178 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMIL+RENVSNS+VMIQPSL+S+SFHS PEP+LLDV 
Sbjct  585  VFHLRRSQFVQVFNNSPDETAYFRMILSRENVSNSIVMIQPSLVSFSFHSPPEPILLDVT  644

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRIL+LDSYFT+V+FHGSTIAQWRKAGYH QPE+QAF QLLQ+P + A++I+ +RF
Sbjct  645  SIAADRILVLDSYFTLVIFHGSTIAQWRKAGYHNQPEYQAFEQLLQSPHDYADTIVSERF  704

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRL  198
            P PRLVICDQ+GSQARFLLAKLNPS   + D  P  G   +FTDDVS  VFLDHL+RL
Sbjct  705  PSPRLVICDQYGSQARFLLAKLNPS---DGDG-PFAGESNVFTDDVSLSVFLDHLRRL  758



>gb|EYU38948.1| hypothetical protein MIMGU_mgv1a001629mg [Erythranthe guttata]
Length=782

 Score =   278 bits (712),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/182 (72%), Positives = 160/182 (88%), Gaps = 1/182 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+R++LNRE++SN++VMIQPSL+SY+F++ P PVLLDV 
Sbjct  599  MFNLRRSQFVQVFNNSPDETAYFRILLNRESISNAIVMIQPSLVSYAFNAHPVPVLLDVQ  658

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYF++V+FHG TIAQWR  GY  Q  H+ FAQLLQ+P ++A+ IIR+RF
Sbjct  659  SIAADRILLLDSYFSVVIFHGMTIAQWRNMGYQNQQGHEPFAQLLQSPHDEAQLIIRERF  718

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPV-PGGDIIFTDDVSFEVFLDHLQRLA  195
            PVPRLV+CDQHGSQARFLLAKLNPSATYN+    +  G D+IFTDDVS +VF++HLQRLA
Sbjct  719  PVPRLVVCDQHGSQARFLLAKLNPSATYNNANEMMNSGSDVIFTDDVSLQVFIEHLQRLA  778

Query  194  VQ  189
            VQ
Sbjct  779  VQ  780



>ref|XP_010429086.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=763

 Score =   278 bits (711),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 134/181 (74%), Positives = 153/181 (85%), Gaps = 3/181 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RM+L RENVSNS+VMIQPSL+++S HS PEP+LLDV 
Sbjct  586  VFHLRRSQFVQVFNNSPDETAYFRMLLYRENVSNSIVMIQPSLVAFSLHSQPEPILLDVA  645

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYFTIV+FHGS IAQWRKAGYH QPEH+AF  LLQ+PR+  ++II +RF
Sbjct  646  SIAADRILLLDSYFTIVIFHGSNIAQWRKAGYHNQPEHKAFQHLLQSPRDYTDTIISERF  705

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P PRLVICDQ+GSQARFLLAKLNPS   N+   P  G   +FTDDVS  VFLDHL+RL V
Sbjct  706  PSPRLVICDQYGSQARFLLAKLNPSDDGNA---PFSGESNVFTDDVSLSVFLDHLRRLIV  762

Query  191  Q  189
             
Sbjct  763  H  763



>ref|XP_010416920.1| PREDICTED: protein transport protein SEC23-like [Camelina sativa]
Length=766

 Score =   277 bits (709),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 153/181 (85%), Gaps = 3/181 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RM+L RENVSNS+VMIQPSL+++S HS PEP+LLDV 
Sbjct  589  VFHLRRSQFVQVFNNSPDETAYFRMLLYRENVSNSIVMIQPSLVAFSLHSQPEPILLDVA  648

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSYFT+V+FHGS IAQWRKAGYH QPEHQAF  LLQ+PR+  ++II +RF
Sbjct  649  SIAADRILLLDSYFTLVIFHGSAIAQWRKAGYHNQPEHQAFKHLLQSPRDFTDTIISERF  708

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P PRLVICDQ+GSQARFLLAKLNPS   +    P  G   +FTDDVS  VFLDHL+RL V
Sbjct  709  PSPRLVICDQYGSQARFLLAKLNPS---DGGDAPFSGESNVFTDDVSLSVFLDHLRRLIV  765

Query  191  Q  189
            +
Sbjct  766  R  766



>gb|EMT27989.1| Protein transport protein sec-23 [Aegilops tauschii]
Length=932

 Score =   278 bits (710),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 137/211 (65%), Positives = 161/211 (76%), Gaps = 31/211 (15%)
 Frame = -2

Query  731  LFHLRRSQFVQV------------------------------FGNSPDETAYYRMILNRE  642
            +F+LRRSQFVQV                              F NSPDETAY+RM+L RE
Sbjct  723  MFNLRRSQFVQVEGSGLSSLNNATKMEISMFIHTELLTLMQVFNNSPDETAYFRMMLERE  782

Query  641  NVSNSVVMIQPSLISYSFHSVPEPVLLDVGSIAADRILLLDSYFTIVVFHGSTIAQWRKA  462
            NV N+V MIQPSLISYSF S P PVLLD  +IA D+ILLLDSYF++V+FHG TIAQWRKA
Sbjct  783  NVGNAVAMIQPSLISYSFQSGPMPVLLDATAIAPDKILLLDSYFSVVIFHGITIAQWRKA  842

Query  461  GYHEQPEHQAFAQLLQTPREDAESIIRDRFPVPRLVICDQHGSQARFLLAKLNPSATYNS  282
            GY +Q  H+AFAQLL+ P +++++II++RFPVPRLV+CDQ+GSQARFLLAKLNPS TYNS
Sbjct  843  GYQDQEGHEAFAQLLKAPHDESDAIIKERFPVPRLVVCDQYGSQARFLLAKLNPSVTYNS  902

Query  281  DAPPVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
            D  P PGGD+IFTDDVSFEVF+DHLQRLAVQ
Sbjct  903  DN-PAPGGDVIFTDDVSFEVFMDHLQRLAVQ  932



>ref|XP_007515183.1| predicted protein [Bathycoccus prasinos]
 emb|CCO14062.1| predicted protein [Bathycoccus prasinos]
Length=816

 Score =   273 bits (697),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 130/183 (71%), Positives = 156/183 (85%), Gaps = 3/183 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+R++L RENV NS+VMIQP+L +YSF+  PEPVLLDV 
Sbjct  632  MFNLRRSQFVQVFNNSPDETAYFRVVLWRENVLNSLVMIQPTLTAYSFNGPPEPVLLDVC  691

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            S+A DRILLLD+YF++VVFHGSTIAQWRKA Y EQ EH+AFA+LL+ P+EDA  I+  RF
Sbjct  692  SVAPDRILLLDAYFSVVVFHGSTIAQWRKAKYQEQEEHKAFAELLKMPQEDANYILNQRF  751

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPP---VPGGDIIFTDDVSFEVFLDHLQR  201
            PVPRLV CDQ+GSQARFLLAKLNPSAT+NS   P     G D+IFTDDVS +VF++HL+R
Sbjct  752  PVPRLVDCDQNGSQARFLLAKLNPSATHNSQGSPYGHAGGSDVIFTDDVSLQVFMEHLKR  811

Query  200  LAV  192
            L+V
Sbjct  812  LSV  814



>ref|XP_006297005.1| hypothetical protein CARUB_v10012995mg [Capsella rubella]
 gb|EOA29903.1| hypothetical protein CARUB_v10012995mg [Capsella rubella]
Length=812

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 156/211 (74%), Gaps = 30/211 (14%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+ M+LNREN+SN+ VMIQPSL  YSF S P+P LLDV 
Sbjct  601  IFNLRRSQFVQVFNNSPDETAYFCMLLNRENISNATVMIQPSLTMYSFTSPPQPALLDVA  660

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLD+YF++VVFHG TIAQWR   YH QPEHQAFA+LLQ P+ED++ I+R+RF
Sbjct  661  SIAADRILLLDAYFSVVVFHGMTIAQWRNMRYHHQPEHQAFAELLQAPQEDSQMIVRERF  720

Query  371  PVPRLVICDQHGSQ------------------------------ARFLLAKLNPSATYNS  282
            PVPRLV+CDQHGSQ                              ARFLLAKLNPSATYN+
Sbjct  721  PVPRLVVCDQHGSQVIHLLYICVQVIVSFNFCMCISLDLNGKMQARFLLAKLNPSATYNN  780

Query  281  DAPPVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
                  G D+IFTDDVS +VF +HLQ+LAVQ
Sbjct  781  ANEMSTGSDVIFTDDVSLQVFFEHLQKLAVQ  811



>ref|XP_002982254.1| hypothetical protein SELMODRAFT_155031 [Selaginella moellendorffii]
 gb|EFJ16499.1| hypothetical protein SELMODRAFT_155031 [Selaginella moellendorffii]
Length=756

 Score =   270 bits (689),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 155/180 (86%), Gaps = 3/180 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETA++R++L+RE V+NS++MIQPSL+SYS  + P P LLDV 
Sbjct  576  MFNLRRSQFVQVFNNSPDETAHFRILLDRETVTNSLLMIQPSLVSYSMSAPPSPALLDVA  635

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLD+YF++V+FHG TIAQWR  GY  QPE++ FA LLQ P  DAE+I ++RF
Sbjct  636  AIAADRILLLDAYFSVVIFHGMTIAQWRNLGYQNQPEYKDFADLLQAPHTDAEAISKERF  695

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLA+LNPSATYNS AP   G ++IFTDDVS +VFL+HLQRLAV
Sbjct  696  PVPRLVVCDQHGSQARFLLARLNPSATYNS-AP--AGAELIFTDDVSLQVFLEHLQRLAV  752



>ref|XP_002966180.1| hypothetical protein SELMODRAFT_168140 [Selaginella moellendorffii]
 gb|EFJ32207.1| hypothetical protein SELMODRAFT_168140 [Selaginella moellendorffii]
Length=756

 Score =   270 bits (689),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 127/180 (71%), Positives = 155/180 (86%), Gaps = 3/180 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETA++R++L+RE V+NS++MIQPSL+SYS  + P P LLDV 
Sbjct  576  MFNLRRSQFVQVFNNSPDETAHFRILLDRETVTNSLLMIQPSLVSYSMSAPPSPALLDVA  635

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLD+YF++V+FHG TIAQWR  GY  QPE++ FA LLQ P  DAE+I ++RF
Sbjct  636  AIAADRILLLDAYFSVVIFHGMTIAQWRNLGYQNQPEYKDFADLLQAPHADAEAISKERF  695

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV+CDQHGSQARFLLA+LNPSATYNS AP   G ++IFTDDVS +VFL+HLQRLAV
Sbjct  696  PVPRLVVCDQHGSQARFLLARLNPSATYNS-AP--AGAELIFTDDVSLQVFLEHLQRLAV  752



>gb|KHG04907.1| Protein transport SEC23 [Gossypium arboreum]
Length=842

 Score =   270 bits (691),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/172 (74%), Positives = 146/172 (85%), Gaps = 0/172 (0%)
 Frame = -2

Query  704  VQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVGSIAADRILL  525
             +VF NSPDETAY+R++LN+EN++N+ VM QPSLISYSF+S P+P LLDV SI+AD ILL
Sbjct  670  TEVFNNSPDETAYFRVLLNKENITNAAVMAQPSLISYSFNSPPQPALLDVASISADHILL  729

Query  524  LDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRFPVPRLVICD  345
            LDSYF+IVVFHG TIAQWR  GY  QPEHQAFA LL+ P+ DA+ IIRDRFPVPRLV+CD
Sbjct  730  LDSYFSIVVFHGMTIAQWRNMGYQNQPEHQAFALLLEAPQVDAQIIIRDRFPVPRLVVCD  789

Query  344  QHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAVQ  189
            QHGSQARFLLAKLNPSATYN+      G DIIFTDDVS +VF +HLQRLAVQ
Sbjct  790  QHGSQARFLLAKLNPSATYNNATDIAQGSDIIFTDDVSLQVFCEHLQRLAVQ  841



>ref|XP_003059046.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH57501.1| predicted protein [Micromonas pusilla CCMP1545]
Length=809

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 133/181 (73%), Positives = 153/181 (85%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAYYRMIL RENV NS+VMIQP+L++YSF+  PEPVLLDV 
Sbjct  626  MFNLRRSQFVQVFNNSPDETAYYRMILWRENVLNSLVMIQPTLMAYSFNGPPEPVLLDVC  685

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  DRIL+LD++F+IVVFHG TIAQWRKA Y +Q EH AF QLL+ P+ DA  +++ RF
Sbjct  686  SITPDRILVLDAFFSIVVFHGQTIAQWRKANYQDQEEHVAFKQLLEAPKADANDVLKQRF  745

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNS-DAPPVPGGDIIFTDDVSFEVFLDHLQRLA  195
            P PRLV CDQHGSQARFLLAKLNPSATYNS  A    GGDIIFTDDVS +VF+DHL+RLA
Sbjct  746  PTPRLVDCDQHGSQARFLLAKLNPSATYNSGGAGGGGGGDIIFTDDVSLQVFMDHLKRLA  805

Query  194  V  192
            V
Sbjct  806  V  806



>ref|XP_002880424.1| hypothetical protein ARALYDRAFT_481081 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56683.1| hypothetical protein ARALYDRAFT_481081, partial [Arabidopsis 
lyrata subsp. lyrata]
Length=685

 Score =   259 bits (662),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 126/168 (75%), Positives = 142/168 (85%), Gaps = 4/168 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMIL RENVSNS+VMIQPSLIS+SFHS  EP+LLDV 
Sbjct  521  VFHLRRSQFVQVFNNSPDETAYFRMILYRENVSNSIVMIQPSLISFSFHSPAEPILLDVA  580

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIAADRILLLDSY T+V+FHGSTIAQWRKAGYH QPEHQAF  LLQ+PR+ A++I+ +RF
Sbjct  581  SIAADRILLLDSYLTLVIFHGSTIAQWRKAGYHNQPEHQAFEHLLQSPRDYADTIVSERF  640

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSF  228
            P PRLVIC Q+GSQARFLLAKLNPS        P+ G   +FTDDVS 
Sbjct  641  PTPRLVICYQYGSQARFLLAKLNPS----DGEAPLSGESNVFTDDVSL  684



>gb|KJB72956.1| hypothetical protein B456_011G205900 [Gossypium raimondii]
Length=735

 Score =   254 bits (649),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSLISYSF S PEP LLDV 
Sbjct  582  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVANSVVMIQPSLISYSFQSAPEPALLDVA  641

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFTIV+FHGSTIAQWRKAGYH QPEHQAFAQLLQ PR+DA++II +RF
Sbjct  642  AIAADRILLLDSYFTIVIFHGSTIAQWRKAGYHNQPEHQAFAQLLQAPRDDADAIINERF  701

Query  371  PVPRLVICDQHGSQARFLLAK  309
            PVPRLVICDQHGSQ +  ++K
Sbjct  702  PVPRLVICDQHGSQLQLEMSK  722



>ref|XP_001765516.1| predicted protein [Physcomitrella patens]
 gb|EDQ69566.1| predicted protein [Physcomitrella patens]
Length=752

 Score =   254 bits (650),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/181 (66%), Positives = 148/181 (82%), Gaps = 3/181 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF N+PDE+A+YR+++NRE V  S+VMIQP+L SYSF   P PVLLDV 
Sbjct  574  MFHLRRSQFLQVFNNTPDESAFYRLMINREGVVGSLVMIQPTLFSYSFDGPPVPVLLDVS  633

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  DRILL DSYF +VV  GSTIAQWRK GYH+ P+H+ F +LL+ P EDAE+++ +R 
Sbjct  634  SIGPDRILLFDSYFFVVVHFGSTIAQWRKLGYHKDPQHENFRKLLEAPIEDAEALLSERN  693

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P+PRLV+CDQHGSQARFLLAKLNPS T+NS+     G ++IFTDDVS +VF +HLQRLAV
Sbjct  694  PLPRLVVCDQHGSQARFLLAKLNPSITHNSNQ---QGSEVIFTDDVSLQVFTEHLQRLAV  750

Query  191  Q  189
            Q
Sbjct  751  Q  751



>gb|KJB78639.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=716

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSL+SYSF SVPEP LLDV 
Sbjct  578  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVANSVVMIQPSLVSYSFQSVPEPALLDVT  637

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHGSTIAQWRKAGYH+QPEHQAFAQLLQ PR+DA++II +RF
Sbjct  638  AIAADRILLLDSYFTVVIFHGSTIAQWRKAGYHDQPEHQAFAQLLQAPRDDADAIINERF  697

Query  371  PVPRLVICDQHGSQ  330
            PVPRLVICDQHGSQ
Sbjct  698  PVPRLVICDQHGSQ  711



>ref|XP_006386863.1| hypothetical protein POPTR_0002s23950g [Populus trichocarpa]
 gb|ERP64660.1| hypothetical protein POPTR_0002s23950g [Populus trichocarpa]
Length=652

 Score =   251 bits (640),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 131/150 (87%), Gaps = 5/150 (3%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+R+ILNRENV+NSVVMIQPSLISYSFHS PEP LLDV 
Sbjct  465  MFHLRRSQFVQVFNNSPDETAYFRVILNRENVANSVVMIQPSLISYSFHSGPEPALLDVA  524

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFTIV+F G+TIAQWRKAGYH QPEHQAFAQLLQ PR+D + II++RF
Sbjct  525  AIAADRILLLDSYFTIVIFDGATIAQWRKAGYHNQPEHQAFAQLLQAPRDDTDEIIKERF  584

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNS  282
            PVPRLVICDQHGSQ +F      P  TY S
Sbjct  585  PVPRLVICDQHGSQFKF-----APQFTYCS  609



>gb|KJB78636.1| hypothetical protein B456_013G010400 [Gossypium raimondii]
Length=726

 Score =   252 bits (644),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSL+SYSF SVPEP LLDV 
Sbjct  578  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVANSVVMIQPSLVSYSFQSVPEPALLDVT  637

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHGSTIAQWRKAGYH+QPEHQAFAQLLQ PR+DA++II +RF
Sbjct  638  AIAADRILLLDSYFTVVIFHGSTIAQWRKAGYHDQPEHQAFAQLLQAPRDDADAIINERF  697

Query  371  PVPRLVICDQHGSQ  330
            PVPRLVICDQHGSQ
Sbjct  698  PVPRLVICDQHGSQ  711



>gb|KDD74127.1| hypothetical protein H632_c1547p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=441

 Score =   244 bits (622),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 142/180 (79%), Gaps = 2/180 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+ RRSQF QVFG SPDETA+ RM+LNRE VS +V M+QP L +Y+    PEPVLLDV 
Sbjct  262  MFNFRRSQFCQVFGASPDETAFARMLLNRETVSEAVTMLQPLLYAYAMGVQPEPVLLDVS  321

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+ DR+LLLD+YF +VVFHG+T+AQWRKA Y EQPE+ AF QLL++P  +A+ I+  RF
Sbjct  322  SISPDRVLLLDAYFYVVVFHGATVAQWRKANYQEQPEYAAFKQLLESPLAEAKGIVDRRF  381

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRL +CDQ+GSQARFLLAKLNPS+TY S A      ++I TDDVS  VF DHL++LAV
Sbjct  382  PVPRLTVCDQNGSQARFLLAKLNPSSTYQSTA--ALSSEVIMTDDVSLSVFTDHLKKLAV  439



>emb|CEG81644.1| Putative Protein transporter sec23 [Rhizopus microsporus]
Length=403

 Score =   241 bits (616),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 143/181 (79%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETA+YR  LNRENV NS++MIQP+L SYSF   P+PVLLD  
Sbjct  219  MFHLRRSQFLQVFNNSPDETAFYRHTLNRENVDNSLIMIQPTLTSYSFDVPPQPVLLDSI  278

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            S+  D ILLLD++F I++FHG TIAQWR AGY +Q  ++ F QLL+ P  DA+ ++ DRF
Sbjct  279  SVKPDVILLLDTFFHILIFHGDTIAQWRNAGYQDQEGYENFKQLLEAPVLDAQDLLMDRF  338

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAP-PVPGGDIIFTDDVSFEVFLDHLQRLA  195
            PV R ++CDQ GSQARFLL+KLNPS T+ S +P   PGG ++ TDDVS +VF++HL++LA
Sbjct  339  PVSRYIVCDQGGSQARFLLSKLNPSTTHTSGSPYSAPGGAVVLTDDVSLQVFMEHLKKLA  398

Query  194  V  192
            V
Sbjct  399  V  399



>emb|CDY12241.1| BnaC04g12710D [Brassica napus]
Length=608

 Score =   245 bits (626),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 141/181 (78%), Gaps = 8/181 (4%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY RM+LNREN+SN+ VMIQPSL +YSF+S+P+P LLDV 
Sbjct  435  MFNLRRSQFVQVFNNSPDETAYSRMLLNRENISNAAVMIQPSLTTYSFNSIPQPALLDVS  494

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SIA+DRILLLDSYF+IVVFHG TIAQ R  GY   PEHQAF QLLQ P+EDA+ I   RF
Sbjct  495  SIASDRILLLDSYFSIVVFHGLTIAQCRTLGYQNHPEHQAFTQLLQEPQEDAQMIAHGRF  554

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P+PRLV        ARFLLA+LNPSA+YN+ +    G   IF DD S EVF  HLQ+LAV
Sbjct  555  PMPRLV--------ARFLLARLNPSASYNNASEMNTGSAAIFRDDASLEVFYQHLQKLAV  606

Query  191  Q  189
            Q
Sbjct  607  Q  607



>gb|ABS72191.1| transport protein, partial [Corchorus olitorius]
Length=264

 Score =   234 bits (598),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/133 (79%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVF NSPDETAY+RM+LNREN++N+ VMIQPSLISYSF+S+P+P LLDV 
Sbjct  132  MFNLRRSQFVQVFNNSPDETAYFRMLLNRENITNAAVMIQPSLISYSFNSLPQPALLDVA  191

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+ADRILLLDSYF++VVFHG TIAQWR AGY  QPEHQAFAQLLQ P++DA+ IIR+RF
Sbjct  192  SISADRILLLDSYFSVVVFHGMTIAQWRNAGYQNQPEHQAFAQLLQAPQDDAQMIIRERF  251

Query  371  PVPRLVICDQHGS  333
            PVPRLV+CDQHGS
Sbjct  252  PVPRLVVCDQHGS  264



>ref|XP_002977937.1| hypothetical protein SELMODRAFT_107900 [Selaginella moellendorffii]
 gb|EFJ21275.1| hypothetical protein SELMODRAFT_107900 [Selaginella moellendorffii]
Length=763

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 144/181 (80%), Gaps = 2/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            ++HLRRSQF+ VF NSPDETA++R++LNRE V  S++MIQP+L SYSF   P PVLLDV 
Sbjct  584  MYHLRRSQFLSVFNNSPDETAFFRLMLNREGVVGSLIMIQPTLFSYSFEGPPVPVLLDVS  643

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  +RILL DSYF +VV +GSTIAQWRK GYH  P +++F  LL+ P  DA +++ DR 
Sbjct  644  SITPERILLFDSYFYVVVHYGSTIAQWRKLGYHNDPAYESFKALLEAPVNDARAVMEDRV  703

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV CDQHGSQARFLLAKLNPS T+NS+A      ++IFTDDVS +VF++HLQRLAV
Sbjct  704  PVPRLVECDQHGSQARFLLAKLNPSVTHNSNA--YGNVEVIFTDDVSLQVFIEHLQRLAV  761

Query  191  Q  189
            Q
Sbjct  762  Q  762



>ref|XP_002986965.1| hypothetical protein SELMODRAFT_124893 [Selaginella moellendorffii]
 gb|EFJ12047.1| hypothetical protein SELMODRAFT_124893 [Selaginella moellendorffii]
Length=763

 Score =   248 bits (632),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 144/181 (80%), Gaps = 2/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            ++HLRRSQF+ VF NSPDETA++R++LNRE V  S++MIQP+L SYSF   P PVLLDV 
Sbjct  584  MYHLRRSQFLSVFNNSPDETAFFRLMLNREGVVGSLIMIQPTLFSYSFEGPPVPVLLDVS  643

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  +RILL DSYF +VV +GSTIAQWRK GYH  P +++F  LL+ P  DA +++ DR 
Sbjct  644  SITPERILLFDSYFYVVVHYGSTIAQWRKLGYHNDPAYESFKALLEAPVNDARAVMEDRV  703

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPRLV CDQHGSQARFLLAKLNPS T+NS+A      ++IFTDDVS +VF++HLQRLAV
Sbjct  704  PVPRLVECDQHGSQARFLLAKLNPSVTHNSNA--YGNVEVIFTDDVSLQVFIEHLQRLAV  761

Query  191  Q  189
            Q
Sbjct  762  Q  762



>ref|XP_001743552.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ92266.1| predicted protein [Monosiga brevicollis MX1]
Length=772

 Score =   247 bits (631),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/180 (64%), Positives = 144/180 (80%), Gaps = 1/180 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETAYYR  L +E+  NS+ MIQP+L +Y+F+  PEPVLLD  
Sbjct  590  MFHLRRSQFLQVFNNSPDETAYYRNKLTKEDCINSLTMIQPTLTAYAFNQEPEPVLLDSS  649

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  +RILLLD++F IV+FHG TIA WRKAG+HEQPEH+AF QLL+ PREDA+ I+  RF
Sbjct  650  SITEERILLLDAFFQIVIFHGDTIANWRKAGFHEQPEHEAFRQLLKAPREDAQEILLTRF  709

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            P+PR V CDQ  SQARFLL+K+NPS T+N +     GG  +FTDDVS +VF++HL++LAV
Sbjct  710  PMPRYVDCDQGSSQARFLLSKVNPSHTHN-NMYSQDGGAAVFTDDVSLQVFMEHLKKLAV  768



>ref|XP_003081259.1| Vesicle coat complex COPII, subunit SEC23 (ISS), partial [Ostreococcus 
tauri]
Length=337

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 141/184 (77%), Gaps = 4/184 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+Q   NSPDETA+YR++L RE V+ S+VMIQP+L+SYSF+  P+PVLLDV 
Sbjct  152  MFHLRRSQFLQTANNSPDETAFYRIMLTRETVTTSLVMIQPTLLSYSFNGAPQPVLLDVS  211

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +I  D ILLLDSYF IVV  GSTIA W + GY +QPEH+AF  LL +P  DA+++  +R 
Sbjct  212  AITPDTILLLDSYFLIVVHRGSTIAGWHREGYQDQPEHEAFRALLASPVRDAQALAAERC  271

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDA----PPVPGGDIIFTDDVSFEVFLDHLQ  204
            P PRLV C+Q GSQARFLLAKLNPSAT+N+ A        GG+ IFTDD+S  VFL+HL 
Sbjct  272  PTPRLVECNQGGSQARFLLAKLNPSATHNTSANGYGAQQGGGEYIFTDDISLSVFLEHLS  331

Query  203  RLAV  192
            +LAV
Sbjct  332  KLAV  335



>gb|KDO85349.1| hypothetical protein CISIN_1g004199mg [Citrus sinensis]
Length=762

 Score =   246 bits (629),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQFVQVF NSPDETAY+RMILNRENV+NSVVMIQPSLISYSFHS PEP LLDV 
Sbjct  590  MFHLRRSQFVQVFNNSPDETAYFRMILNRENVTNSVVMIQPSLISYSFHSGPEPALLDVA  649

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +IAADRILLLDSYFT+V+FHG+TIAQWRKAGYH QPEHQAFAQLLQ P +DA  I+++RF
Sbjct  650  AIAADRILLLDSYFTVVIFHGATIAQWRKAGYHNQPEHQAFAQLLQAPHDDAGVIMKERF  709

Query  371  PVPRLVICDQHGSQ  330
            PVPRLVICDQHGSQ
Sbjct  710  PVPRLVICDQHGSQ  723



>gb|KIJ05426.1| hypothetical protein PAXINDRAFT_103792 [Paxillus involutus ATCC 
200175]
Length=245

 Score =   233 bits (593),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 109/185 (59%), Positives = 144/185 (78%), Gaps = 5/185 (3%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETA+YR IL+ E+V+NS++MIQP+L+SY+F   P+PVLLD  
Sbjct  56   MFHLRRSQFLQVFNNSPDETAFYRHILDEEDVNNSLIMIQPTLMSYTFDVPPQPVLLDSV  115

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  D ILLLD++F I++FHG T+AQWRKAGY +Q  ++ F +LL+ P  DA+ ++ DRF
Sbjct  116  SIKPDVILLLDTFFHILIFHGETVAQWRKAGYQDQEGYENFKELLEAPVADAQDLLGDRF  175

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNS-----DAPPVPGGDIIFTDDVSFEVFLDHL  207
            P+PR ++CDQ GSQARFLL+KLNPS T+ S      +     G  IFTDDVS +VF++HL
Sbjct  176  PIPRYIVCDQGGSQARFLLSKLNPSTTHMSTSMYGSSQAAGAGQAIFTDDVSLQVFMEHL  235

Query  206  QRLAV  192
            +RLAV
Sbjct  236  KRLAV  240



>emb|CDO71073.1| hypothetical protein BN946_scf184844.g77 [Trametes cinnabarina]
Length=597

 Score =   242 bits (618),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETA+YR +LN E+V+NS++MIQP+L+SY+F S P+PVLLD  
Sbjct  409  MFHLRRSQFLQVFNNSPDETAFYRHVLNEEDVNNSLIMIQPTLMSYTFDSPPQPVLLDSV  468

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  D ILLLD++F I++FHG TIAQWRKAGY +Q  ++ F +LL+ P  DA+ ++ DRF
Sbjct  469  SIKPDVILLLDTFFHILIFHGETIAQWRKAGYQDQEGYENFKELLEAPVRDAQDLLADRF  528

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDA----PPVPGGDIIFTDDVSFEVFLDHLQ  204
            P+PR ++CDQ GSQARFLL+KLNPS T+ S++     P   G  IFTDDVS +VF++HL+
Sbjct  529  PIPRYIVCDQGGSQARFLLSKLNPSTTHVSNSMYGTAPANAGQAIFTDDVSLQVFMEHLK  588

Query  203  RLAV  192
            RLAV
Sbjct  589  RLAV  592



>ref|XP_001419581.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97874.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=771

 Score =   245 bits (626),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 143/181 (79%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+Q   NSPDETA+YR++L+RE V+NS+VMIQP+L+SYSF+  P+PVLLDV 
Sbjct  589  IFHLRRSQFLQTANNSPDETAFYRIMLSRETVTNSLVMIQPTLLSYSFNGPPQPVLLDVS  648

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +I  D ILLLDSYF IV   GSTIA W KAGY +QPEH+AF  LL  P  DA+++  DR 
Sbjct  649  AITPDTILLLDSYFLIVAHRGSTIAAWHKAGYQDQPEHEAFRALLAAPVRDAKALAADRC  708

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSD-APPVPGGDIIFTDDVSFEVFLDHLQRLA  195
            P PRLV C+Q GSQARFLLAKLNPSAT+N+D      GG+IIFTDD+S  VF+DHL +LA
Sbjct  709  PTPRLVECNQGGSQARFLLAKLNPSATHNTDLGYGQSGGEIIFTDDISMNVFVDHLAKLA  768

Query  194  V  192
            V
Sbjct  769  V  769



>ref|XP_002946892.1| hypothetical protein VOLCADRAFT_103128 [Volvox carteri f. nagariensis]
 gb|EFJ52118.1| hypothetical protein VOLCADRAFT_103128 [Volvox carteri f. nagariensis]
Length=764

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 117/181 (65%), Positives = 144/181 (80%), Gaps = 2/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRS FVQVFGNSPDETAYYRM L R +V +++VMIQP L++Y F+  PEPVLLDV 
Sbjct  585  MFHLRRSPFVQVFGNSPDETAYYRMALFRVSVPDAMVMIQPQLMAYHFNGPPEPVLLDVS  644

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  +R+LLLD+YF +VVFHG+TIAQWRKA YH QPEH AFAQ+L  P+ +A+ I++ RF
Sbjct  645  SILPERLLLLDAYFYVVVFHGTTIAQWRKAEYHRQPEHVAFAQVLSAPQAEAKEIVKRRF  704

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVP++V CD +GSQARFLL KLNPS+TY S  P     ++I TDDVS   F +HL+RLAV
Sbjct  705  PVPKIVECDNNGSQARFLLVKLNPSSTYTSATP--MSAEVINTDDVSLATFTEHLKRLAV  762

Query  191  Q  189
            Q
Sbjct  763  Q  763



>emb|CEP06830.1| hypothetical protein [Parasitella parasitica]
Length=765

 Score =   245 bits (625),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 146/181 (81%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETA+YR  LNRENV +S++MIQP+L SY F + P+PVLLD  
Sbjct  581  MFHLRRSQFLQVFNNSPDETAFYRHTLNRENVDSSLIMIQPTLTSYCFDADPQPVLLDSI  640

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  D ILLLD++F I++FHGSTIA+WR AGY +QP ++ F QLL+ P  DA+ ++ +RF
Sbjct  641  SIKPDAILLLDTFFHILIFHGSTIAEWRNAGYQDQPGYENFKQLLEAPVLDAQELLTERF  700

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAP-PVPGGDIIFTDDVSFEVFLDHLQRLA  195
            PVPR ++CDQ GSQARFLL+KLNPS T+ S +P   PGG ++ TDDVS +VF++HL++LA
Sbjct  701  PVPRYIVCDQGGSQARFLLSKLNPSTTHTSGSPYSAPGGAVVLTDDVSLQVFMEHLKKLA  760

Query  194  V  192
            V
Sbjct  761  V  761



>emb|CCO26912.1| Protein transport protein SEC23 [Rhizoctonia solani AG-1 IB]
Length=190

 Score =   229 bits (584),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 111/185 (60%), Positives = 144/185 (78%), Gaps = 5/185 (3%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETA+YR ILN E+V+NS++M+QP+L+SY+F + P+PVLLD  
Sbjct  1    MFHLRRSQFLQVFNNSPDETAFYRHILNEEDVNNSLIMMQPTLMSYTFDTPPQPVLLDSV  60

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  D ILLLD++F I++FHG T+AQWRKAGY EQ  +  F +LL+ P  DA+ ++ DRF
Sbjct  61   SIKPDVILLLDTFFHILIFHGETVAQWRKAGYQEQDGYDNFRELLEAPVGDAQDLLVDRF  120

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSD-----APPVPGGDIIFTDDVSFEVFLDHL  207
            P+PR V+CDQ GSQARFLL+KLNPS T+ S      +     G  IFTDDVS +VF++HL
Sbjct  121  PIPRYVVCDQGGSQARFLLSKLNPSTTHMSQGMYGTSGGGGAGAAIFTDDVSLQVFMEHL  180

Query  206  QRLAV  192
            +RLAV
Sbjct  181  KRLAV  185



>gb|KDQ13407.1| hypothetical protein BOTBODRAFT_33712 [Botryobasidium botryosum 
FD-172 SS1]
Length=764

 Score =   244 bits (624),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 148/185 (80%), Gaps = 5/185 (3%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETA+YR ILN E+V+NS++MIQP+L+SY+F + P+PVLLD  
Sbjct  575  MFHLRRSQFLQVFNNSPDETAFYRHILNEEDVNNSLIMIQPTLMSYTFDTPPQPVLLDSV  634

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  D +LLLD++F I++FHG T+AQWRKAGY EQ  ++ F +LL+TP+ DA+ ++ DRF
Sbjct  635  SIKPDVVLLLDTFFHILIFHGETVAQWRKAGYQEQEGYENFKELLETPQSDAQDLLVDRF  694

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNS-----DAPPVPGGDIIFTDDVSFEVFLDHL  207
            P+PR ++CDQ GSQARFLL+KLNPS T+ S      AP    G  IFTDDVS +VF++HL
Sbjct  695  PIPRYIVCDQGGSQARFLLSKLNPSTTHMSTSMYGSAPAGGAGQAIFTDDVSLQVFMEHL  754

Query  206  QRLAV  192
            +RLAV
Sbjct  755  KRLAV  759



>gb|AFW67664.1| hypothetical protein ZEAMMB73_006275 [Zea mays]
Length=277

 Score =   232 bits (592),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 109/181 (60%), Positives = 140/181 (77%), Gaps = 2/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +++LRRSQF+ VF +SPDETA++R++LNRE V  S++MIQP+L  YSF   P PVLLDV 
Sbjct  98   MYYLRRSQFIDVFNSSPDETAFFRLMLNREGVVGSLIMIQPTLFQYSFDGPPIPVLLDVS  157

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI+ D ILL DSYF IV+ +GS IAQWRK GYH+ P H+   +LL+ P  DAE+++ DRF
Sbjct  158  SISPDVILLFDSYFYIVIHYGSKIAQWRKLGYHKDPNHENLRKLLEAPEVDAEALLVDRF  217

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVP+L+ CDQHGSQARFLLA+LNPS T  +      G ++IFTDDVS +VF++HLQ LAV
Sbjct  218  PVPKLIKCDQHGSQARFLLARLNPSVTQKTQLS--EGSEVIFTDDVSLQVFIEHLQELAV  275

Query  191  Q  189
            Q
Sbjct  276  Q  276



>ref|XP_001702936.1| COP-II coat subunit [Chlamydomonas reinhardtii]
 gb|EDO96789.1| COP-II coat subunit [Chlamydomonas reinhardtii]
Length=762

 Score =   244 bits (623),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 118/181 (65%), Positives = 143/181 (79%), Gaps = 2/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQFVQVFGNSPDETAYYRM L R  V +++VMIQP L +Y F+  PEPVLLDV 
Sbjct  583  MFNLRRSQFVQVFGNSPDETAYYRMALFRVAVPDAMVMIQPQLTAYHFNGPPEPVLLDVS  642

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  +R+LLLD+YF +VVFHG+TIAQWRKA YH QPEH AFAQ+L  P+ +A+ I+R RF
Sbjct  643  SILPERVLLLDAYFYVVVFHGTTIAQWRKAEYHLQPEHVAFAQVLAAPQAEAKEIVRRRF  702

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVP++V CD +GSQARFLL KLNPS+TY S  P     ++I TDDVS   F +HL+RLAV
Sbjct  703  PVPKIVDCDHNGSQARFLLVKLNPSSTYTSATP--MSAEVINTDDVSLATFTEHLKRLAV  760

Query  191  Q  189
            Q
Sbjct  761  Q  761



>emb|CDH50391.1| protein transporter sec23 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=763

 Score =   244 bits (623),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 147/181 (81%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETA+YR ++NRENV NS++MIQP+L SY F S P+PVLLD  
Sbjct  579  MFHLRRSQFLQVFNNSPDETAFYRHVINRENVDNSLIMIQPTLTSYGFDSPPQPVLLDSI  638

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  D ILLLD++F +++FHG TIAQWR+AGY +Q  ++ F QLL+TP  DA+ ++ DRF
Sbjct  639  SIKPDVILLLDTFFHLLIFHGETIAQWREAGYQDQEGYENFKQLLETPVLDAQDLLMDRF  698

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAP-PVPGGDIIFTDDVSFEVFLDHLQRLA  195
            PVPR ++CDQ GSQARFLL+KLNPS T+ S++P   P G  IFTDDVS +VF++HL++L+
Sbjct  699  PVPRYIVCDQGGSQARFLLSKLNPSTTHASNSPYGAPQGAAIFTDDVSLQVFMEHLKKLS  758

Query  194  V  192
            V
Sbjct  759  V  759



>emb|CDS13505.1| Putative Protein transporter SEC23 [Absidia idahoensis var. thermophila]
Length=763

 Score =   244 bits (623),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/181 (62%), Positives = 147/181 (81%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETA+YR ++NRENV NS++MIQP+L SY F S P+PVLLD  
Sbjct  579  MFHLRRSQFLQVFNNSPDETAFYRHVINRENVDNSLIMIQPTLTSYGFDSPPQPVLLDSI  638

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  D ILLLD++F +++FHG TIAQWR+AGY +Q  ++ F QLL+TP  DA+ ++ DRF
Sbjct  639  SIKPDVILLLDTFFHLLIFHGETIAQWREAGYQDQEGYENFKQLLETPVLDAQDLLMDRF  698

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAP-PVPGGDIIFTDDVSFEVFLDHLQRLA  195
            PVPR ++CDQ GSQARFLL+KLNPS T+ S++P   P G  IFTDDVS +VF++HL++L+
Sbjct  699  PVPRYIVCDQGGSQARFLLSKLNPSTTHASNSPYGAPQGAAIFTDDVSLQVFMEHLKKLS  758

Query  194  V  192
            V
Sbjct  759  V  759



>emb|CDS13951.1| Putative Protein transporter SEC23 [Absidia idahoensis var. thermophila]
Length=763

 Score =   244 bits (622),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 147/181 (81%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETA+YR +L+RENV NS++MIQP+L SYSF S P+PVLLD  
Sbjct  579  MFHLRRSQFLQVFNNSPDETAFYRHVLDRENVDNSLIMIQPTLTSYSFDSPPQPVLLDSI  638

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  D ILLLD++F +++FHG TIAQWR+AGY EQ  ++ F QLL+ P  DA+ ++ DRF
Sbjct  639  SIKPDVILLLDTFFHLLIFHGETIAQWREAGYQEQEGYENFKQLLEAPVLDAQDLLMDRF  698

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAP-PVPGGDIIFTDDVSFEVFLDHLQRLA  195
            PVPR ++CDQ GSQARFLL+KLNPS T+ S++P   P G  IFTDDVS +VF++HL++L+
Sbjct  699  PVPRYIVCDQGGSQARFLLSKLNPSTTHASNSPYGAPQGAAIFTDDVSLQVFMEHLKKLS  758

Query  194  V  192
            V
Sbjct  759  V  759



>ref|XP_002408825.1| vesicle coat complex COPII, subunit SEC23, putative [Ixodes scapularis]
 gb|EEC04049.1| vesicle coat complex COPII, subunit SEC23, putative [Ixodes scapularis]
Length=445

 Score =   236 bits (603),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 142/183 (78%), Gaps = 3/183 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDET+YYR +LNR++++ S++MIQP L +YSF   PEPV LD  
Sbjct  259  MFHLRRSQFLQVFNNSPDETSYYRHMLNRKDLTQSLIMIQPILYAYSFSGPPEPVPLDTS  318

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            S   DRILL+D++F IV+FHG TIAQWRKAGY   PEH+ F QLLQ P +DA+ I++ RF
Sbjct  319  STQPDRILLMDTFFHIVIFHGETIAQWRKAGYQNNPEHENFRQLLQDPEDDAQEILQTRF  378

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSD---APPVPGGDIIFTDDVSFEVFLDHLQR  201
            P+PR ++CDQ GSQARFLL+K+NPS T+N+         GG  + TDDVS +VF++HL++
Sbjct  379  PMPRYIVCDQGGSQARFLLSKVNPSVTHNNAYNWGQQDTGGFPVLTDDVSLQVFMEHLKK  438

Query  200  LAV  192
            LAV
Sbjct  439  LAV  441



>emb|CEF99093.1| von Willebrand factor, type A [Ostreococcus tauri]
Length=550

 Score =   238 bits (607),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/184 (62%), Positives = 141/184 (77%), Gaps = 4/184 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+Q   NSPDETA+YR++L RE V+ S+VMIQP+L+SYSF+  P+PVLLDV 
Sbjct  365  MFHLRRSQFLQTANNSPDETAFYRIMLTRETVTTSLVMIQPTLLSYSFNGAPQPVLLDVS  424

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            +I  D ILLLDSYF IVV  GSTIA W + GY +QPEH+AF  LL +P  DA+++  +R 
Sbjct  425  AITPDTILLLDSYFLIVVHRGSTIAGWHREGYQDQPEHEAFRALLASPVRDAQALAAERC  484

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDA----PPVPGGDIIFTDDVSFEVFLDHLQ  204
            P PRLV C+Q GSQARFLLAKLNPSAT+N+ A        GG+ IFTDD+S  VFL+HL 
Sbjct  485  PTPRLVECNQGGSQARFLLAKLNPSATHNTSANGYGAQQGGGEYIFTDDISLSVFLEHLS  544

Query  203  RLAV  192
            +LAV
Sbjct  545  KLAV  548



>gb|EXX77374.1| Sec23p [Rhizophagus irregularis DAOM 197198w]
Length=760

 Score =   242 bits (618),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/181 (61%), Positives = 146/181 (81%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETA+YR +LN E+V+NS++MIQP+L+SY F   P+PVLLD  
Sbjct  576  MFHLRRSQFLQVFNNSPDETAFYRHVLNHEDVNNSLIMIQPTLMSYGFVQPPQPVLLDSI  635

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  D ILLLD++F I++FHG TIAQWRKAGY +Q  ++ F +LL+ P+ D+E ++ DRF
Sbjct  636  SIKPDVILLLDTFFHILIFHGETIAQWRKAGYQDQEGYENFKELLEAPKADSEELLADRF  695

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAP-PVPGGDIIFTDDVSFEVFLDHLQRLA  195
            P+PR ++CDQHGSQARFLL+KLNPS T+ S +    P G  IFTDDVS +VF++HL++LA
Sbjct  696  PIPRYIVCDQHGSQARFLLSKLNPSTTHVSGSMYGTPQGQAIFTDDVSLQVFMEHLKKLA  755

Query  194  V  192
            V
Sbjct  756  V  756



>gb|EIE91302.1| protein transporter SEC23 [Rhizopus delemar RA 99-880]
Length=759

 Score =   241 bits (616),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 144/181 (80%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETA+YR  LNRENV +S++MIQP+L SYSF + P+PVLLD  
Sbjct  575  MFHLRRSQFLQVFNNSPDETAFYRHTLNRENVDSSLIMIQPTLTSYSFDAPPQPVLLDSV  634

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            S+  D ILLLD++F I++FHG TIAQWR AGY +Q  ++ F QLL+ P  DA+ ++ DRF
Sbjct  635  SVKPDVILLLDTFFHILIFHGETIAQWRNAGYQDQEGYENFKQLLEVPVLDAQDLLTDRF  694

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAP-PVPGGDIIFTDDVSFEVFLDHLQRLA  195
            PV R V+CDQ GSQARFLL+KLNPS T+ S +P   PGG ++ TDDVS +VF++HL++LA
Sbjct  695  PVSRYVVCDQGGSQARFLLSKLNPSTTHTSGSPYSAPGGAVVLTDDVSLQVFMEHLKKLA  754

Query  194  V  192
            V
Sbjct  755  V  755



>gb|KKA73276.1| sec-23, partial [Pristionchus pacificus]
Length=255

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 137/180 (76%), Gaps = 1/180 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETAYYR IL  ENV  S  MIQP L SYSF+  PEPVLLD  
Sbjct  71   MFHLRRSQFLQVFNNSPDETAYYRHILFSENVLESTTMIQPVLFSYSFNGPPEPVLLDTS  130

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  DRILL+D YF ++++HG TIAQWRK  YHE P++ +F QLL+ P  DA SI+++RF
Sbjct  131  SILPDRILLMDDYFHVLIYHGQTIAQWRKLNYHEDPQYASFKQLLEAPVGDATSILQERF  190

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSD-APPVPGGDIIFTDDVSFEVFLDHLQRLA  195
            P+PR ++ +  GSQARFLL+K+NPS T+N+  A     G  +FTDDVS +VF++HL++LA
Sbjct  191  PMPRYIVTEYEGSQARFLLSKVNPSLTHNNPYATGAESGAAVFTDDVSLQVFMEHLKKLA  250



>emb|CEG75338.1| Putative Podospora anserina S mat genomic DNA chromosome 2, supercontig 
2 [Rhizopus microsporus]
 emb|CEG74164.1| Putative Podospora anserina S mat genomic DNA chromosome 2, supercontig 
2 [Rhizopus microsporus]
 emb|CEI92194.1| Putative Podospora anserina S mat genomic DNA chromosome 2, supercontig 
2 [Rhizopus microsporus]
Length=759

 Score =   241 bits (614),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 143/181 (79%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETA+YR  LNRENV NS++MIQP+L SYSF   P+PVLLD  
Sbjct  575  MFHLRRSQFLQVFNNSPDETAFYRHTLNRENVDNSLIMIQPTLTSYSFDVPPQPVLLDSI  634

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            S+  D ILLLD++F I++FHG TIAQWR AGY +Q  ++ F QLL+ P  DA+ ++ DRF
Sbjct  635  SVKPDVILLLDTFFHILIFHGDTIAQWRNAGYQDQEGYENFKQLLEAPVLDAQDLLMDRF  694

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAP-PVPGGDIIFTDDVSFEVFLDHLQRLA  195
            PV R ++CDQ GSQARFLL+KLNPS T+ S +P   PGG ++ TDDVS +VF++HL++LA
Sbjct  695  PVSRYIVCDQGGSQARFLLSKLNPSTTHTSGSPYSAPGGAVVLTDDVSLQVFMEHLKKLA  754

Query  194  V  192
            V
Sbjct  755  V  755



>emb|CDH54361.1| protein transporter sec23 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=763

 Score =   241 bits (614),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 146/181 (81%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETA+YR +L+RENV NS++MIQP+L SY F S P+PVLLD  
Sbjct  579  MFHLRRSQFLQVFNNSPDETAFYRHVLDRENVDNSLIMIQPTLTSYGFDSPPQPVLLDSI  638

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  D ILLLD++F +++FHG TIAQWR+AGY +Q  ++ F QLL+ P  DA+ ++ DRF
Sbjct  639  SIKPDVILLLDTFFHLLIFHGETIAQWREAGYQDQEGYENFKQLLEAPILDAQDLLMDRF  698

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAP-PVPGGDIIFTDDVSFEVFLDHLQRLA  195
            PVPR ++CDQ GSQARFLL+KLNPS T+ S++P   P G  IFTDDVS +VF++HL++L+
Sbjct  699  PVPRYIVCDQGGSQARFLLSKLNPSTTHASNSPYGAPQGAAIFTDDVSLQVFMEHLKKLS  758

Query  194  V  192
            V
Sbjct  759  V  759



>gb|KIY93781.1| hypothetical protein MNEG_14181 [Monoraphidium neglectum]
Length=198

 Score =   226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 115/186 (62%), Positives = 142/186 (76%), Gaps = 9/186 (5%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHS-----VPEPV  567
            +F+LRRS FV  FG  PDETAY RMIL R  V +++VMIQP L +Y F +       +P 
Sbjct  16   MFNLRRSPFV--FGFGPDETAYVRMILYRVPVQDAMVMIQPQLTAYCFGTQEPGITADPA  73

Query  566  LLDVGSIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESI  387
            LLDV SI  +R+LLLD+YF +VVFHG+T+AQWRKA YH  PEH+AFA+LL  P+ +A++I
Sbjct  74   LLDVMSITPERVLLLDAYFYVVVFHGATVAQWRKAEYHLLPEHKAFAELLAAPQAEAKAI  133

Query  386  IRDRFPVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHL  207
             + RFPVPR+V CDQ+GSQARFLLAKLNPSATYNS A     G++I TDDVS +VF DHL
Sbjct  134  AQRRFPVPRVVDCDQNGSQARFLLAKLNPSATYNSAA--AVSGEVIMTDDVSLQVFTDHL  191

Query  206  QRLAVQ  189
            +RLAVQ
Sbjct  192  KRLAVQ  197



>ref|XP_010522501.1| PREDICTED: protein transport protein sec23-1 [Tarenaya hassleriana]
Length=791

 Score =   240 bits (613),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 137/181 (76%), Gaps = 2/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +F+LRRSQF+ VF NSPDET Y+R+ILNRE V NS++MIQP+L+ YSF   P PVLLD+ 
Sbjct  612  MFYLRRSQFLDVFNNSPDETGYFRLILNREGVVNSIIMIQPTLLRYSFDGPPVPVLLDIR  671

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            S+ +D ILL DSYF +VV HGS IAQWRK GYH+ P H+ F +LL+ P  DAE ++ DR 
Sbjct  672  SVTSDAILLFDSYFYVVVHHGSKIAQWRKLGYHKDPNHETFRKLLEAPEIDAEQLVADRI  731

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPGGDIIFTDDVSFEVFLDHLQRLAV  192
            PVPR V CDQHGSQARFLLAKLNPS T  SD     G DI+ TDD+S + FLD LQ LAV
Sbjct  732  PVPRFVRCDQHGSQARFLLAKLNPSVTQKSDY--TGGSDIVLTDDLSLQDFLDDLQSLAV  789

Query  191  Q  189
            +
Sbjct  790  K  790



>dbj|GAN07318.1| copii coat protein [Mucor ambiguus]
Length=765

 Score =   240 bits (612),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/181 (62%), Positives = 144/181 (80%), Gaps = 1/181 (1%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETA+YR  LNRENV +S++MIQP+L SYSF + P+PVLLD  
Sbjct  581  MFHLRRSQFLQVFNNSPDETAFYRHTLNRENVDSSLIMIQPTLTSYSFDTDPQPVLLDSI  640

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  D ILLLD++F I++FHG TIAQWRKAGY +Q  ++ F QLL+ P  DA+ ++ +RF
Sbjct  641  SIKPDAILLLDTFFHILIFHGETIAQWRKAGYQDQEGYENFKQLLEAPVLDAQDLLMERF  700

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAP-PVPGGDIIFTDDVSFEVFLDHLQRLA  195
            PVPR + CDQ GSQARFLL+KLNPS T+ S +P    GG ++ TDDVS +VF++HL++LA
Sbjct  701  PVPRYIDCDQGGSQARFLLSKLNPSTTHTSGSPYSATGGAVVLTDDVSLQVFMEHLKKLA  760

Query  194  V  192
            V
Sbjct  761  V  761



>gb|EPQ62665.1| hypothetical protein BGT96224_4934B [Blumeria graminis f. sp. 
tritici 96224]
Length=410

 Score =   232 bits (591),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/184 (60%), Positives = 140/184 (76%), Gaps = 4/184 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSF-HSVPEPVLLDV  555
            +FHLRRSQF+QVF NSPDETA+YR +LNRE+VSNS++MIQP+L SY+F     +PVLLD 
Sbjct  223  MFHLRRSQFLQVFNNSPDETAFYRHVLNREDVSNSLIMIQPTLDSYTFDQEGSQPVLLDS  282

Query  554  GSIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDR  375
             SI    ILLLD++F I++FHG TIA+WRKAGY +Q  ++ FA LL+ P+EDA  +I DR
Sbjct  283  TSIQQTHILLLDTFFHILIFHGETIAEWRKAGYQDQEGYENFAYLLEQPKEDARDLITDR  342

Query  374  FPVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPVPG---GDIIFTDDVSFEVFLDHLQ  204
            FP+PR ++CD  GSQARFLL+KLNPS T+ + A    G      IFTDDVS + F+DHL 
Sbjct  343  FPLPRFIVCDAGGSQARFLLSKLNPSTTHTTGAYGGVGAQTAQTIFTDDVSLQTFMDHLM  402

Query  203  RLAV  192
            +LAV
Sbjct  403  KLAV  406



>ref|XP_003321108.2| protein transporter SEC23 [Puccinia graminis f. sp. tritici CRL 
75-36-700-3]
 gb|EFP76689.2| protein transporter SEC23 [Puccinia graminis f. sp. tritici CRL 
75-36-700-3]
Length=762

 Score =   239 bits (611),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/183 (61%), Positives = 145/183 (79%), Gaps = 3/183 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETA+YR ILN E+V+NS+V IQP+L+SY   S P PVLLD  
Sbjct  576  MFHLRRSQFLQVFNNSPDETAFYRHILNAEDVNNSLVAIQPTLMSYGLDSEPSPVLLDSV  635

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  + ILLLD++F I++FHG+TIAQWRKAGYHEQ ++    +LLQ P++DA  ++ DRF
Sbjct  636  SIQDNTILLLDTFFHILIFHGATIAQWRKAGYHEQEDYANLKELLQRPKDDAADLLSDRF  695

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDAPPV---PGGDIIFTDDVSFEVFLDHLQR  201
            PVPR ++CDQ+GSQARFLL+KLNPS T+ S         GG +IFTDDVS ++F++HL++
Sbjct  696  PVPRYIVCDQNGSQARFLLSKLNPSTTHASGGGMYGQQSGGSMIFTDDVSLQIFMEHLKK  755

Query  200  LAV  192
            LAV
Sbjct  756  LAV  758



>gb|EGO04011.1| hypothetical protein SERLA73DRAFT_69806 [Serpula lacrymans var. 
lacrymans S7.3]
Length=756

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 145/185 (78%), Gaps = 5/185 (3%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETA+YR ILN E+V+NS++MIQP+L+SY+F   P+PVLLD  
Sbjct  567  MFHLRRSQFLQVFNNSPDETAFYRHILNEEDVNNSLIMIQPTLMSYTFDVPPQPVLLDSV  626

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  D ILLLD++F I++FHG T+AQWRKAGY EQ  ++ F +LL+TP  DA+ ++ DRF
Sbjct  627  SIKPDVILLLDTFFHILIFHGETVAQWRKAGYQEQEGYENFKELLETPVADAQDLLVDRF  686

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNS-----DAPPVPGGDIIFTDDVSFEVFLDHL  207
            P+PR ++CDQ GSQARFLL+KLNPS T+ S      A     G  IFTDDVS +VF++HL
Sbjct  687  PIPRYIVCDQGGSQARFLLSKLNPSTTHMSATMYGSAQGAGAGQAIFTDDVSLQVFMEHL  746

Query  206  QRLAV  192
            +RLAV
Sbjct  747  KRLAV  751



>ref|XP_007314172.1| hypothetical protein SERLADRAFT_413215 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO29930.1| hypothetical protein SERLADRAFT_413215 [Serpula lacrymans var. 
lacrymans S7.9]
Length=764

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 145/185 (78%), Gaps = 5/185 (3%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETA+YR ILN E+V+NS++MIQP+L+SY+F   P+PVLLD  
Sbjct  575  MFHLRRSQFLQVFNNSPDETAFYRHILNEEDVNNSLIMIQPTLMSYTFDVPPQPVLLDSV  634

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  D ILLLD++F I++FHG T+AQWRKAGY EQ  ++ F +LL+TP  DA+ ++ DRF
Sbjct  635  SIKPDVILLLDTFFHILIFHGETVAQWRKAGYQEQEGYENFKELLETPVADAQDLLVDRF  694

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNS-----DAPPVPGGDIIFTDDVSFEVFLDHL  207
            P+PR ++CDQ GSQARFLL+KLNPS T+ S      A     G  IFTDDVS +VF++HL
Sbjct  695  PIPRYIVCDQGGSQARFLLSKLNPSTTHMSATMYGSAQGAGAGQAIFTDDVSLQVFMEHL  754

Query  206  QRLAV  192
            +RLAV
Sbjct  755  KRLAV  759



>gb|KDQ58302.1| hypothetical protein JAAARDRAFT_34105 [Jaapia argillacea MUCL 
33604]
Length=763

 Score =   239 bits (610),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 145/184 (79%), Gaps = 4/184 (2%)
 Frame = -2

Query  731  LFHLRRSQFVQVFGNSPDETAYYRMILNRENVSNSVVMIQPSLISYSFHSVPEPVLLDVG  552
            +FHLRRSQF+QVF NSPDETA+YR ILN E+V+NS++MIQP+L+SY+F   P+PVLLD  
Sbjct  575  MFHLRRSQFLQVFNNSPDETAFYRHILNEEDVNNSLIMIQPTLMSYTFDVPPQPVLLDSV  634

Query  551  SIAADRILLLDSYFTIVVFHGSTIAQWRKAGYHEQPEHQAFAQLLQTPREDAESIIRDRF  372
            SI  D ILLLD++F I++FHG T+AQWRKAGY EQ  ++ F +LL+ P  DA+ ++ DRF
Sbjct  635  SIKPDFILLLDTFFHILIFHGETVAQWRKAGYQEQEGYENFKELLEAPVTDAQDLLVDRF  694

Query  371  PVPRLVICDQHGSQARFLLAKLNPSATYNSDA----PPVPGGDIIFTDDVSFEVFLDHLQ  204
            P+PR ++CDQ GSQARFLL+KLNPS T+ S +     P   G  IFTDDVS +VF++HL+
Sbjct  695  PIPRYIVCDQGGSQARFLLSKLNPSTTHMSTSMYGTNPAGAGQAIFTDDVSLQVFMEHLK  754

Query  203  RLAV  192
            RLAV
Sbjct  755  RLAV  758



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1628027073272