BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2960

Length=1010
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_007051457.1|  Basic helix-loop-helix DNA-binding family pr...    265   1e-80   
ref|XP_009604694.1|  PREDICTED: transcription factor MYC3-like          262   2e-79   Nicotiana tomentosiformis
ref|XP_011094312.1|  PREDICTED: transcription factor MYC2               259   3e-78   Sesamum indicum [beniseed]
ref|XP_007219048.1|  hypothetical protein PRUPE_ppa004680mg             257   2e-77   Prunus persica
ref|XP_012083125.1|  PREDICTED: transcription factor MYC2               256   3e-77   Jatropha curcas
ref|XP_010100678.1|  hypothetical protein L484_023447                   255   3e-76   Morus notabilis
gb|KJB41602.1|  hypothetical protein B456_007G111800                    252   2e-75   Gossypium raimondii
ref|XP_006444764.1|  hypothetical protein CICLE_v10019749mg             253   2e-75   Citrus clementina [clementine]
ref|XP_010054972.1|  PREDICTED: transcription factor MYC2               252   2e-75   Eucalyptus grandis [rose gum]
ref|XP_009776117.1|  PREDICTED: transcription factor MYC2-like          250   1e-74   Nicotiana sylvestris
ref|XP_002301432.1|  basic helix-loop-helix family protein              250   1e-74   Populus trichocarpa [western balsam poplar]
gb|KDO86574.1|  hypothetical protein CISIN_1g046178mg                   250   1e-74   Citrus sinensis [apfelsine]
gb|ABK94979.1|  unknown                                                 249   2e-74   Populus trichocarpa [western balsam poplar]
ref|XP_004306627.1|  PREDICTED: transcription factor MYC2               249   2e-74   Fragaria vesca subsp. vesca
ref|XP_004248092.1|  PREDICTED: transcription factor MYC3-like          248   3e-74   Solanum lycopersicum
ref|XP_011039030.1|  PREDICTED: transcription factor MYC2 isoform X2    249   3e-74   Populus euphratica
ref|XP_011039024.1|  PREDICTED: transcription factor MYC2 isoform X1    249   7e-74   Populus euphratica
ref|XP_006362125.1|  PREDICTED: transcription factor MYC2-like          246   2e-73   Solanum tuberosum [potatoes]
ref|XP_007135301.1|  hypothetical protein PHAVU_010G117900g             242   5e-72   Phaseolus vulgaris [French bean]
gb|KHN15898.1|  Transcription factor bHLH14                             242   6e-72   Glycine soja [wild soybean]
ref|XP_003528771.1|  PREDICTED: transcription factor MYC2-like          242   8e-72   Glycine max [soybeans]
ref|XP_011023113.1|  PREDICTED: transcription factor MYC2-like          241   3e-71   Populus euphratica
ref|XP_003548195.1|  PREDICTED: transcription factor MYC2-like          239   5e-71   Glycine max [soybeans]
ref|XP_002529968.1|  transcription factor, putative                     234   5e-71   
ref|XP_009375455.1|  PREDICTED: transcription factor MYC2-like          239   1e-70   Pyrus x bretschneideri [bai li]
ref|XP_002266775.1|  PREDICTED: transcription factor MYC2-like          239   2e-70   Vitis vinifera
ref|XP_008370350.1|  PREDICTED: transcription factor MYC2               238   7e-70   
ref|XP_009592442.1|  PREDICTED: transcription factor MYC2-like          233   1e-68   Nicotiana tomentosiformis
gb|KJB09595.1|  hypothetical protein B456_001G151700                    234   1e-68   Gossypium raimondii
gb|KCW83845.1|  hypothetical protein EUGRSUZ_B00713                     232   1e-67   Eucalyptus grandis [rose gum]
ref|XP_010031905.1|  PREDICTED: transcription factor MYC2-like          231   1e-67   Eucalyptus grandis [rose gum]
gb|KJB49615.1|  hypothetical protein B456_008G128800                    230   5e-67   Gossypium raimondii
ref|XP_002529965.1|  DNA binding protein, putative                      229   6e-67   Ricinus communis
ref|XP_009766909.1|  PREDICTED: transcription factor MYC2               228   1e-66   Nicotiana sylvestris
ref|XP_009623539.1|  PREDICTED: transcription factor MYC3-like is...    225   1e-65   Nicotiana tomentosiformis
ref|XP_010909816.1|  PREDICTED: transcription factor MYC4-like          224   2e-65   Elaeis guineensis
gb|KJB24531.1|  hypothetical protein B456_004G149500                    225   3e-65   Gossypium raimondii
ref|XP_009623534.1|  PREDICTED: transcription factor MYC2-like is...    225   3e-65   
gb|KEH18600.1|  basic helix loop helix (bHLH) family transcriptio...    218   7e-63   Medicago truncatula
ref|XP_008345582.1|  PREDICTED: transcription factor bHLH14-like        216   7e-62   
ref|XP_004230022.1|  PREDICTED: transcription factor MYC2-like is...    215   8e-62   Solanum lycopersicum
ref|XP_004230021.1|  PREDICTED: transcription factor MYC2-like is...    215   1e-61   Solanum lycopersicum
ref|XP_004510627.1|  PREDICTED: transcription factor bHLH14-like        211   4e-60   Cicer arietinum [garbanzo]
ref|XP_007039384.1|  Basic helix-loop-helix DNA-binding family pr...    211   7e-60   
ref|XP_002320222.1|  basic helix-loop-helix family protein              209   1e-59   
ref|XP_008233076.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    210   1e-59   Prunus mume [ume]
ref|XP_006357552.1|  PREDICTED: transcription factor MYC2-like          209   2e-59   Solanum tuberosum [potatoes]
ref|XP_010267440.1|  PREDICTED: transcription factor MYC2               211   2e-59   Nelumbo nucifera [Indian lotus]
ref|XP_009412473.1|  PREDICTED: transcription factor MYC3-like          206   3e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004140617.1|  PREDICTED: transcription factor MYC2-like          204   6e-58   Cucumis sativus [cucumbers]
emb|CBI34590.3|  unnamed protein product                                201   8e-58   Vitis vinifera
gb|KJB52372.1|  hypothetical protein B456_008G259000                    204   3e-57   Gossypium raimondii
emb|CDP08631.1|  unnamed protein product                                202   4e-57   Coffea canephora [robusta coffee]
gb|ACF05947.1|  MYC1                                                    203   5e-57   Hevea brasiliensis [jebe]
gb|KDO76730.1|  hypothetical protein CISIN_1g010053mg                   204   7e-57   Citrus sinensis [apfelsine]
ref|XP_006439218.1|  hypothetical protein CICLE_v10019730mg             204   7e-57   
ref|XP_006476285.1|  PREDICTED: transcription factor MYC2-like          203   8e-57   Citrus sinensis [apfelsine]
ref|XP_002279973.1|  PREDICTED: transcription factor MYC4               202   1e-56   Vitis vinifera
gb|KEH18599.1|  basic helix loop helix (bHLH) family transcriptio...    201   2e-56   Medicago truncatula
gb|AEG74015.1|  lMYC5                                                   201   5e-56   Hevea brasiliensis [jebe]
ref|XP_009775258.1|  PREDICTED: transcription factor MYC2-like          198   2e-55   Nicotiana sylvestris
ref|XP_002518914.1|  DNA binding protein, putative                      198   5e-55   Ricinus communis
ref|XP_006362123.1|  PREDICTED: transcription factor MYC4-like          195   1e-54   Solanum tuberosum [potatoes]
gb|ACF19982.1|  MYC2                                                    197   1e-54   Hevea brasiliensis [jebe]
ref|XP_011026782.1|  PREDICTED: transcription factor MYC2-like          196   2e-54   Populus euphratica
ref|XP_006361006.1|  PREDICTED: transcription factor MYC4-like          194   2e-54   Solanum tuberosum [potatoes]
gb|KJB24138.1|  hypothetical protein B456_004G129600                    195   3e-54   Gossypium raimondii
gb|AGO03813.1|  JAMYC2                                                  191   4e-54   Taxus cuspidata [ichii]
ref|XP_006830285.1|  PREDICTED: transcription factor MYC2               195   5e-54   Amborella trichopoda
gb|AEG74013.1|  lMYC3                                                   193   2e-53   Hevea brasiliensis [jebe]
gb|KDP25207.1|  hypothetical protein JCGZ_20363                         193   2e-53   Jatropha curcas
ref|XP_012086610.1|  PREDICTED: transcription factor MYC2-like          193   3e-53   Jatropha curcas
ref|XP_006343781.1|  PREDICTED: transcription factor MYC2-like          191   4e-53   
gb|ADK91082.1|  LMYC2                                                   192   5e-53   Hevea brasiliensis [jebe]
gb|AEG74014.1|  lMYC4                                                   192   5e-53   Hevea brasiliensis [jebe]
ref|XP_002299425.1|  hypothetical protein POPTR_0001s11400g             192   1e-52   Populus trichocarpa [western balsam poplar]
ref|XP_011022409.1|  PREDICTED: transcription factor MYC2-like          191   2e-52   Populus euphratica
ref|XP_009418327.1|  PREDICTED: transcription factor MYC4-like          189   4e-52   
ref|XP_008780029.1|  PREDICTED: transcription factor MYC4-like          189   5e-52   
ref|XP_007209110.1|  hypothetical protein PRUPE_ppa005343mg             189   8e-52   
ref|XP_002303693.2|  hypothetical protein POPTR_0003s14710g             188   1e-51   Populus trichocarpa [western balsam poplar]
ref|XP_009151447.1|  PREDICTED: transcription factor MYC2               191   1e-51   Brassica rapa
ref|XP_010531704.1|  PREDICTED: transcription factor MYC2-like          191   2e-51   Tarenaya hassleriana [spider flower]
gb|ABS11038.1|  MYC                                                     191   2e-51   Brassica oleracea var. gemmifera
ref|XP_004246085.1|  PREDICTED: transcription factor bHLH14-like        186   2e-51   
ref|XP_008245836.1|  PREDICTED: transcription factor bHLH14-like ...    189   2e-51   
gb|ADK56287.1|  LMYC1                                                   188   2e-51   Hevea brasiliensis [jebe]
ref|XP_008374122.1|  PREDICTED: transcription factor MYC2-like          187   3e-51   
ref|XP_010556617.1|  PREDICTED: transcription factor bHLH14             186   5e-51   Tarenaya hassleriana [spider flower]
ref|XP_011082365.1|  PREDICTED: transcription factor MYC4-like          190   5e-51   Sesamum indicum [beniseed]
ref|XP_010100202.1|  hypothetical protein L484_015347                   187   6e-51   Morus notabilis
ref|XP_010691764.1|  PREDICTED: transcription factor MYC2-like          186   7e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008245834.1|  PREDICTED: transcription factor bHLH14-like ...    187   9e-51   Prunus mume [ume]
ref|XP_002893732.1|  ATMYC2                                             188   2e-50   Arabidopsis lyrata subsp. lyrata
gb|KJB21076.1|  hypothetical protein B456_003G182100                    187   2e-50   Gossypium raimondii
ref|NP_174541.1|  transcription factor MYC2                             188   2e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AAL55713.1|AF251691_1  putative transcription factor BHLH6           187   3e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006415166.1|  hypothetical protein EUTSA_v10007075mg             187   3e-50   Eutrema salsugineum [saltwater cress]
ref|XP_004248095.1|  PREDICTED: transcription factor MYC2-like          183   3e-50   Solanum lycopersicum
ref|XP_009360191.1|  PREDICTED: transcription factor MYC2-like          184   4e-50   Pyrus x bretschneideri [bai li]
dbj|BAA25078.1|  RD22BP1                                                187   5e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478689.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    186   9e-50   
ref|XP_009590627.1|  PREDICTED: transcription factor bHLH14-like        182   1e-49   Nicotiana tomentosiformis
emb|CDX84081.1|  BnaC08g07580D                                          184   1e-49   
ref|XP_010461111.1|  PREDICTED: transcription factor MYC2-like          186   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_008346662.1|  PREDICTED: transcription factor MYC2-like          183   1e-49   
ref|XP_010538366.1|  PREDICTED: transcription factor MYC2-like          185   2e-49   Tarenaya hassleriana [spider flower]
ref|XP_008374121.1|  PREDICTED: transcription factor MYC3-like          183   2e-49   
gb|KDO44754.1|  hypothetical protein CISIN_1g005651mg                   186   2e-49   Citrus sinensis [apfelsine]
ref|XP_006428423.1|  hypothetical protein CICLE_v10011214mg             186   3e-49   Citrus clementina [clementine]
ref|XP_009609942.1|  PREDICTED: transcription factor MYC2-like          185   4e-49   Nicotiana tomentosiformis
gb|AAC28907.1|  phaseolin G-box binding protein PG2                     184   4e-49   Phaseolus vulgaris [French bean]
ref|XP_007158304.1|  hypothetical protein PHAVU_002G141500g             185   5e-49   Phaseolus vulgaris [French bean]
ref|XP_006303928.1|  hypothetical protein CARUB_v10008586mg             184   5e-49   Capsella rubella
gb|ADH04268.1|  MYC1b transcription factor                              184   6e-49   Nicotiana tabacum [American tobacco]
gb|AFZ93650.1|  transcription factor MYC2                               176   7e-49   Euphorbia lathyris
gb|ADH04267.1|  MYC1a transcription factor                              184   7e-49   Nicotiana tabacum [American tobacco]
ref|XP_009780487.1|  PREDICTED: transcription factor MYC2-like          184   7e-49   Nicotiana sylvestris
ref|XP_009131125.1|  PREDICTED: transcription factor MYC4-like          175   8e-49   
gb|AGZ94899.1|  MYC transcription factor 2                              184   9e-49   Solanum lycopersicum
ref|XP_004245895.2|  PREDICTED: transcription factor MYC2               184   1e-48   
ref|XP_008659898.1|  PREDICTED: transcription factor MYC4-like          184   1e-48   Zea mays [maize]
gb|AIO09733.1|  transcription factor MYC2                               182   1e-48   Salvia miltiorrhiza [Chinese salvia]
gb|EYU44086.1|  hypothetical protein MIMGU_mgv1a002808mg                182   2e-48   Erythranthe guttata [common monkey flower]
ref|XP_006352856.1|  PREDICTED: transcription factor MYC2-like          182   3e-48   Solanum tuberosum [potatoes]
ref|XP_008373574.1|  PREDICTED: transcription factor MYC2               182   4e-48   
gb|AGL98101.1|  transcription factor MYC2-like protein                  182   4e-48   Nicotiana attenuata
ref|XP_010559309.1|  PREDICTED: transcription factor MYC4-like          182   4e-48   Tarenaya hassleriana [spider flower]
ref|XP_008658563.1|  PREDICTED: transcription factor MYC4               182   5e-48   
gb|KHM99167.1|  Transcription factor MYC4                               172   5e-48   Glycine soja [wild soybean]
gb|AAD15818.1|  transcription factor MYC7E                              182   5e-48   Zea mays [maize]
ref|XP_007210309.1|  hypothetical protein PRUPE_ppa002404mg             182   5e-48   
gb|ADL36595.1|  BHLH domain class transcription factor                  182   5e-48   Malus domestica [apple tree]
gb|AHN63211.1|  transcription factor MYC2                               181   5e-48   Salvia miltiorrhiza f. alba
gb|EEC67493.1|  hypothetical protein OsI_34761                          181   6e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_009359541.1|  PREDICTED: transcription factor MYC2-like          179   6e-48   Pyrus x bretschneideri [bai li]
gb|AAK00453.1|AC060755_23  putative MYC transcription factor            181   6e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002467448.1|  hypothetical protein SORBIDRAFT_01g028230          181   7e-48   Sorghum bicolor [broomcorn]
ref|XP_008238247.1|  PREDICTED: transcription factor MYC2               181   7e-48   Prunus mume [ume]
ref|XP_012090783.1|  PREDICTED: transcription factor bHLH14-like        179   7e-48   Jatropha curcas
ref|XP_003574381.1|  PREDICTED: transcription factor MYC4-like          181   8e-48   Brachypodium distachyon [annual false brome]
ref|NP_199488.1|  JAZ-interacting transcription factor MYC3             181   8e-48   Arabidopsis thaliana [mouse-ear cress]
gb|AAL55712.1|AF251690_1  putative transcription factor BHLH5           180   8e-48   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001288107.1|  uncharacterized protein LOC101261048               181   8e-48   Solanum lycopersicum
ref|NP_001065478.1|  Os10g0575000                                       181   9e-48   
emb|CDY58502.1|  BnaA06g40330D                                          178   9e-48   Brassica napus [oilseed rape]
ref|XP_009796881.1|  PREDICTED: transcription factor MYC2-like          177   1e-47   Nicotiana sylvestris
emb|CDY35179.1|  BnaA09g18160D                                          179   1e-47   Brassica napus [oilseed rape]
emb|CDX77688.1|  BnaC07g19420D                                          177   1e-47   
ref|XP_008370020.1|  PREDICTED: transcription factor MYC2-like          178   1e-47   
ref|XP_010540785.1|  PREDICTED: transcription factor MYC2-like is...    180   1e-47   Tarenaya hassleriana [spider flower]
ref|XP_009114329.1|  PREDICTED: transcription factor MYC3-like          179   1e-47   Brassica rapa
ref|XP_007210206.1|  hypothetical protein PRUPE_ppa016220mg             177   1e-47   
ref|XP_006414178.1|  hypothetical protein EUTSA_v10024688mg             180   1e-47   Eutrema salsugineum [saltwater cress]
gb|ABD65632.1|  basic helix-loop-helix (bHLH) family transcriptio...    179   2e-47   Brassica oleracea
ref|XP_009360190.1|  PREDICTED: transcription factor MYC2-like          177   2e-47   Pyrus x bretschneideri [bai li]
gb|KHN18804.1|  Transcription factor MYC4                               173   2e-47   Glycine soja [wild soybean]
ref|XP_011081344.1|  PREDICTED: transcription factor MYC2-like          177   2e-47   Sesamum indicum [beniseed]
emb|CDY03195.1|  BnaC09g19610D                                          179   2e-47   
ref|XP_009344509.1|  PREDICTED: transcription factor MYC2-like          177   2e-47   Pyrus x bretschneideri [bai li]
ref|XP_006366244.1|  PREDICTED: transcription factor MYC2-like          179   2e-47   Solanum tuberosum [potatoes]
emb|CAF74711.1|  MYC transcription factor                               179   2e-47   Solanum tuberosum [potatoes]
ref|XP_010523833.1|  PREDICTED: transcription factor MYC3-like          176   3e-47   Tarenaya hassleriana [spider flower]
ref|XP_010445298.1|  PREDICTED: transcription factor MYC4-like          179   3e-47   Camelina sativa [gold-of-pleasure]
gb|EPS57820.1|  hypothetical protein M569_16997                         178   4e-47   Genlisea aurea
gb|EYU32289.1|  hypothetical protein MIMGU_mgv1a007575mg                175   4e-47   Erythranthe guttata [common monkey flower]
ref|XP_006283348.1|  hypothetical protein CARUB_v10004392mg             179   4e-47   Capsella rubella
dbj|BAJ91022.1|  predicted protein                                      179   6e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ91674.1|  predicted protein                                      179   6e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB51639.1|  hypothetical protein B456_008G226300                    178   7e-47   Gossypium raimondii
ref|XP_008810069.1|  PREDICTED: transcription factor MYC4-like          175   7e-47   Phoenix dactylifera
ref|XP_002865164.1|  hypothetical protein ARALYDRAFT_916752             178   7e-47   Arabidopsis lyrata subsp. lyrata
gb|AGQ80897.1|  MYC1                                                    178   7e-47   Lithospermum erythrorhizon
gb|AIT39751.1|  transcription factor MYC2                               178   9e-47   Chrysanthemum boreale
ref|XP_003612909.1|  BHLH transcription factor                          178   1e-46   Medicago truncatula
ref|XP_009101493.1|  PREDICTED: transcription factor MYC3               177   1e-46   Brassica rapa
ref|XP_006279855.1|  hypothetical protein CARUB_v10028441mg             177   1e-46   Capsella rubella
gb|AAB00686.1|  phaseolin G-box binding protein PG1                     177   1e-46   Phaseolus vulgaris [French bean]
gb|AAL55711.1|AF251689_1  putative transcription factor BHLH4           177   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009347383.1|  PREDICTED: transcription factor MYC2               178   1e-46   
ref|XP_004512525.1|  PREDICTED: transcription factor MYC2-like          177   1e-46   Cicer arietinum [garbanzo]
ref|NP_193522.1|  transcription factor MYC4                             177   1e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010481417.1|  PREDICTED: transcription factor MYC3               177   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_011650295.1|  PREDICTED: transcription factor bHLH14-like ...    175   2e-46   Cucumis sativus [cucumbers]
ref|XP_010441550.1|  PREDICTED: transcription factor MYC3-like          177   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_008245390.1|  PREDICTED: transcription factor MYC2-like          175   2e-46   Prunus mume [ume]
ref|XP_004146202.2|  PREDICTED: transcription factor MYC3-like is...    174   2e-46   Cucumis sativus [cucumbers]
dbj|BAJ86015.1|  predicted protein                                      177   2e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010434608.1|  PREDICTED: transcription factor MYC4-like          177   2e-46   Camelina sativa [gold-of-pleasure]
ref|XP_002868032.1|  basic helix-loop-helix family protein              176   2e-46   
emb|CAF74710.1|  MYC transcription factor                               177   2e-46   Solanum tuberosum [potatoes]
emb|CDY44507.1|  BnaC01g10420D                                          176   2e-46   Brassica napus [oilseed rape]
ref|XP_010494857.1|  PREDICTED: transcription factor MYC3-like          176   2e-46   
gb|ADH04263.1|  bHLH2 transcription factor                              177   3e-46   Nicotiana benthamiana
gb|KHM99168.1|  Transcription factor MYC2                               173   3e-46   Glycine soja [wild soybean]
gb|KFK31432.1|  hypothetical protein AALP_AA6G111200                    176   3e-46   Arabis alpina [alpine rockcress]
ref|XP_009800420.1|  PREDICTED: transcription factor MYC2-like          176   3e-46   Nicotiana sylvestris
ref|XP_006398371.1|  hypothetical protein EUTSA_v10000808mg             176   3e-46   
ref|XP_009587276.1|  PREDICTED: transcription factor MYC2-like          176   4e-46   Nicotiana tomentosiformis
dbj|BAJ33793.1|  unnamed protein product                                176   4e-46   Eutrema halophilum
ref|XP_010530031.1|  PREDICTED: transcription factor MYC4               176   5e-46   Tarenaya hassleriana [spider flower]
ref|XP_008341963.1|  PREDICTED: transcription factor MYC2-like          176   5e-46   
ref|XP_009765330.1|  PREDICTED: transcription factor MYC2-like          172   5e-46   Nicotiana sylvestris
ref|XP_009420803.1|  PREDICTED: transcription factor MYC3-like          172   5e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002280253.1|  PREDICTED: transcription factor MYC2-like          176   6e-46   
gb|AGL98100.1|  transcription factor MYC2                               176   7e-46   Nicotiana attenuata
gb|KJB25303.1|  hypothetical protein B456_004G184800                    176   7e-46   Gossypium raimondii
gb|KJB37703.1|  hypothetical protein B456_006G216700                    176   7e-46   Gossypium raimondii
ref|XP_007156435.1|  hypothetical protein PHAVU_003G285700g             175   7e-46   Phaseolus vulgaris [French bean]
ref|XP_012076236.1|  PREDICTED: transcription factor MYC2               176   8e-46   Jatropha curcas
gb|ADH04269.1|  MYC2a transcription factor                              175   9e-46   Nicotiana tabacum [American tobacco]
gb|ACO53628.1|  bHLH domain protein                                     175   1e-45   Gossypium hirsutum [American cotton]
emb|CDX78808.1|  BnaA01g08750D                                          174   1e-45   
ref|XP_003516794.1|  PREDICTED: transcription factor MYC2-like          174   2e-45   Glycine max [soybeans]
ref|XP_008796257.1|  PREDICTED: transcription factor MYC4               174   2e-45   Phoenix dactylifera
gb|AET03296.2|  basic helix loop helix (bHLH) family transcriptio...    174   2e-45   Medicago truncatula
ref|XP_010940945.1|  PREDICTED: transcription factor MYC4-like          171   3e-45   Elaeis guineensis
ref|XP_008238755.1|  PREDICTED: transcription factor bHLH14-like ...    172   3e-45   Prunus mume [ume]
ref|XP_008238754.1|  PREDICTED: transcription factor MYC4-like is...    172   3e-45   Prunus mume [ume]
ref|XP_003531962.1|  PREDICTED: transcription factor MYC2               174   3e-45   Glycine max [soybeans]
gb|KGN60384.1|  Transcription factor AtMYC2                             174   4e-45   Cucumis sativus [cucumbers]
ref|XP_010058170.1|  PREDICTED: transcription factor MYC2               174   4e-45   
gb|KCW71784.1|  hypothetical protein EUGRSUZ_E00277                     173   4e-45   Eucalyptus grandis [rose gum]
ref|XP_011652651.1|  PREDICTED: transcription factor MYC2               173   5e-45   Cucumis sativus [cucumbers]
ref|XP_010919958.1|  PREDICTED: transcription factor MYC4-like          173   5e-45   Elaeis guineensis
ref|XP_009388411.1|  PREDICTED: transcription factor MYC2               173   5e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007210924.1|  hypothetical protein PRUPE_ppa027182mg             171   6e-45   
ref|XP_008465979.1|  PREDICTED: transcription factor MYC2-like          173   6e-45   Cucumis melo [Oriental melon]
ref|XP_004509726.1|  PREDICTED: transcription factor MYC2-like          173   6e-45   Cicer arietinum [garbanzo]
ref|XP_009617148.1|  PREDICTED: transcription factor MYC4-like          168   6e-45   
gb|KHN38923.1|  Transcription factor MYC2                               171   6e-45   Glycine soja [wild soybean]
gb|EPS71023.1|  hypothetical protein M569_03732                         172   7e-45   Genlisea aurea
ref|XP_007151965.1|  hypothetical protein PHAVU_004G090300g             169   7e-45   Phaseolus vulgaris [French bean]
ref|XP_010449546.1|  PREDICTED: transcription factor MYC4-like          172   7e-45   Camelina sativa [gold-of-pleasure]
ref|XP_008238769.1|  PREDICTED: transcription factor MYC2-like          171   8e-45   Prunus mume [ume]
emb|CDP13028.1|  unnamed protein product                                172   9e-45   Coffea canephora [robusta coffee]
ref|XP_007039493.1|  Basic helix-loop-helix DNA-binding family pr...    172   9e-45   
gb|ABD59338.1|  G-box element binding protein                           172   1e-44   Pisum sativum [garden pea]
ref|XP_008448683.1|  PREDICTED: transcription factor MYC2-like          172   1e-44   Cucumis melo [Oriental melon]
ref|XP_010441529.1|  PREDICTED: transcription factor bHLH28-like        170   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010104300.1|  hypothetical protein L484_023250                   172   1e-44   Morus notabilis
gb|ACM48567.1|  JAMYC                                                   172   1e-44   Taxus cuspidata [ichii]
gb|AAY90122.1|  basic helix-loop-helix transcription factor protein     172   1e-44   Rheum australe [Himalayan rhubarb]
ref|XP_004148739.1|  PREDICTED: transcription factor MYC2-like          172   2e-44   Cucumis sativus [cucumbers]
ref|XP_003628820.1|  Transcription factor MYC2                          171   2e-44   
ref|XP_009384126.1|  PREDICTED: transcription factor MYC4-like          171   2e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002519814.1|  Transcription factor AtMYC2, putative              171   3e-44   Ricinus communis
ref|XP_010910582.1|  PREDICTED: transcription factor MYC4-like          168   3e-44   Elaeis guineensis
ref|XP_003534274.2|  PREDICTED: transcription factor MYC2-like          171   4e-44   Glycine max [soybeans]
ref|XP_004300239.1|  PREDICTED: transcription factor MYC2-like          171   4e-44   Fragaria vesca subsp. vesca
ref|XP_007208833.1|  hypothetical protein PRUPE_ppa025417mg             168   5e-44   
ref|XP_010538501.1|  PREDICTED: transcription factor MYC4-like          170   5e-44   Tarenaya hassleriana [spider flower]
gb|KFK28472.1|  hypothetical protein AALP_AA7G000700                    169   6e-44   Arabis alpina [alpine rockcress]
ref|XP_008245386.1|  PREDICTED: transcription factor bHLH14-like        168   6e-44   Prunus mume [ume]
ref|XP_006352213.1|  PREDICTED: transcription factor ATR2-like          167   8e-44   Solanum tuberosum [potatoes]
ref|XP_009384727.1|  PREDICTED: transcription factor MYC3-like          169   9e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008245388.1|  PREDICTED: transcription factor MYC2-like          167   1e-43   
ref|XP_009408104.1|  PREDICTED: transcription factor MYC4-like          169   1e-43   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011028179.1|  PREDICTED: transcription factor MYC2-like          169   1e-43   Populus euphratica
ref|XP_006385657.1|  phaseolin G-box binding protein PG2                169   2e-43   
ref|XP_007210117.1|  hypothetical protein PRUPE_ppa022165mg             166   2e-43   
ref|XP_004244656.1|  PREDICTED: transcription factor bHLH14-like        166   2e-43   Solanum lycopersicum
gb|ACN21638.1|  putative basic helix-loop-helix protein BHLH22          168   2e-43   Lotus japonicus
ref|XP_010677236.1|  PREDICTED: transcription factor MYC2-like          168   2e-43   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010481407.1|  PREDICTED: transcription factor bHLH28-like        166   3e-43   Camelina sativa [gold-of-pleasure]
ref|XP_011018569.1|  PREDICTED: transcription factor MYC2-like          168   3e-43   Populus euphratica
ref|XP_009401251.1|  PREDICTED: transcription factor MYC4-like          168   4e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADH04262.1|  bHLH1 transcription factor                              167   4e-43   Nicotiana benthamiana
gb|AAQ14332.1|AF283507_1  MYC2                                          167   6e-43   Catharanthus roseus [chatas]
ref|XP_008799392.1|  PREDICTED: transcription factor MYC2-like          167   6e-43   Phoenix dactylifera
ref|XP_009396848.1|  PREDICTED: transcription factor MYC4-like          167   8e-43   
ref|XP_006368399.1|  phaseolin G-box binding protein PG2                166   1e-42   
ref|XP_009413229.1|  PREDICTED: transcription factor MYC2-like          166   1e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006287856.1|  hypothetical protein CARUB_v10001082mg             163   1e-42   Capsella rubella
ref|XP_008786336.1|  PREDICTED: transcription factor MYC2-like          166   1e-42   Phoenix dactylifera
emb|CDY26910.1|  BnaA05g18020D                                          163   2e-42   Brassica napus [oilseed rape]
ref|XP_010933462.1|  PREDICTED: transcription factor MYC4-like          165   3e-42   Elaeis guineensis
gb|AEB35606.1|  MYC2                                                    155   4e-42   Helianthus annuus
ref|XP_010275210.1|  PREDICTED: transcription factor MYC2-like          165   4e-42   Nelumbo nucifera [Indian lotus]
gb|AEB35656.1|  MYC2                                                    155   4e-42   
gb|AEB35640.1|  MYC2                                                    154   4e-42   
emb|CDX73261.1|  BnaC05g28450D                                          162   5e-42   
gb|AEB35567.1|  MYC2                                                    154   5e-42   
gb|AEB35671.1|  MYC2                                                    154   5e-42   
gb|AEB35595.1|  MYC2                                                    154   6e-42   
gb|AEB35604.1|  MYC2                                                    154   6e-42   
gb|AEB35703.1|  MYC2                                                    154   6e-42   
gb|AEB35597.1|  MYC2                                                    154   6e-42   
gb|AEB35692.1|  MYC2                                                    154   6e-42   
gb|AEB35674.1|  MYC2                                                    154   6e-42   
gb|AEB35565.1|  MYC2                                                    154   6e-42   
gb|KFK45000.1|  hypothetical protein AALP_AA1G331100                    164   7e-42   
gb|AEB35676.1|  MYC2                                                    154   7e-42   
gb|AEB35658.1|  MYC2                                                    154   7e-42   
gb|AEB35596.1|  MYC2                                                    154   9e-42   
gb|AEB35587.1|  MYC2                                                    153   1e-41   
ref|XP_008448555.1|  PREDICTED: transcription factor MYC3-like          161   1e-41   
gb|AEB35592.1|  MYC2                                                    153   1e-41   
gb|AEB35649.1|  MYC2                                                    153   1e-41   
gb|AEB35694.1|  MYC2                                                    153   1e-41   
gb|AEB35660.1|  MYC2                                                    153   2e-41   
ref|XP_006398377.1|  hypothetical protein EUTSA_v10000853mg             162   2e-41   
gb|AEB35568.1|  MYC2                                                    153   2e-41   
ref|XP_010941241.1|  PREDICTED: transcription factor MYC2-like          162   2e-41   
ref|XP_010273162.1|  PREDICTED: transcription factor MYC2-like          162   2e-41   
ref|XP_003520013.2|  PREDICTED: transcription factor MYC2-like          159   2e-41   
ref|XP_008245385.1|  PREDICTED: transcription factor bHLH14-like ...    160   3e-41   
ref|XP_008245384.1|  PREDICTED: transcription factor bHLH14-like ...    160   3e-41   
gb|KHN04880.1|  Transcription factor MYC2                               160   3e-41   
gb|AEB35580.1|  MYC2                                                    152   3e-41   
gb|AEB35601.1|  MYC2                                                    152   3e-41   
gb|KFK31426.1|  hypothetical protein AALP_AA6G110400                    160   4e-41   
ref|XP_009385748.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    161   4e-41   
gb|AEB35706.1|  MYC2                                                    152   4e-41   
ref|XP_007210118.1|  hypothetical protein PRUPE_ppa022201mg             160   5e-41   
gb|AEB35575.1|  MYC2                                                    152   6e-41   
gb|AEB35657.1|  MYC2                                                    151   7e-41   
gb|AEB35570.1|  MYC2                                                    151   7e-41   
gb|AEB35571.1|  MYC2                                                    151   9e-41   
gb|AEB35678.1|  MYC2                                                    151   1e-40   
ref|XP_009370919.1|  PREDICTED: transcription factor MYC2-like          159   1e-40   
gb|AEB35577.1|  MYC2                                                    150   1e-40   
gb|AEB35578.1|  MYC2                                                    150   2e-40   
gb|AGO03814.1|  JAMYC4                                                  155   3e-40   
ref|XP_010053608.1|  PREDICTED: transcription factor MYC2-like          159   3e-40   
gb|KFK30669.1|  hypothetical protein AALP_AA6G012400                    156   4e-40   
ref|XP_010056012.1|  PREDICTED: transcription factor MYC2-like          157   4e-40   
ref|XP_008342536.1|  PREDICTED: transcription factor MYC2-like          157   9e-40   
ref|XP_009391048.1|  PREDICTED: transcription factor MYC2-like          157   1e-39   
ref|XP_009393178.1|  PREDICTED: transcription factor MYC3-like          156   1e-39   
ref|XP_009359542.1|  PREDICTED: transcription factor MYC2-like          157   1e-39   
ref|XP_008356558.1|  PREDICTED: transcription factor MYC2-like          157   1e-39   
ref|XP_009114324.1|  PREDICTED: transcription factor bHLH28-like        156   2e-39   
emb|CDY35183.1|  BnaA09g18200D                                          156   2e-39   
emb|CDY03185.1|  BnaC09g19710D                                          155   2e-39   
gb|AEB35573.1|  MYC2                                                    147   3e-39   
ref|XP_006279851.1|  hypothetical protein CARUB_v10028430mg             155   3e-39   
gb|KGN61317.1|  hypothetical protein Csa_2G080170                       152   4e-39   
ref|XP_006838603.1|  PREDICTED: transcription factor MYC2               156   4e-39   
gb|ABR16623.1|  unknown                                                 155   5e-39   
ref|XP_002865159.1|  predicted protein                                  154   6e-39   
ref|XP_009101672.1|  PREDICTED: transcription factor bHLH28-like        150   6e-39   
gb|EPS60924.1|  hypothetical protein M569_13876                         155   7e-39   
ref|XP_010494874.1|  PREDICTED: transcription factor bHLH28-like        154   8e-39   
ref|XP_009358714.1|  PREDICTED: transcription factor MYC4-like          154   1e-38   
ref|XP_008342518.1|  PREDICTED: transcription factor MYC3-like is...    154   1e-38   
ref|XP_010456176.1|  PREDICTED: transcription factor bHLH14-like ...    151   1e-38   
ref|XP_008342523.1|  PREDICTED: transcription factor MYC3-like is...    154   1e-38   
emb|CDX77699.1|  BnaC07g19530D                                          149   1e-38   
ref|XP_010935028.1|  PREDICTED: transcription factor MYC4-like          154   2e-38   
ref|XP_010456175.1|  PREDICTED: transcription factor bHLH14-like ...    152   2e-38   
emb|CDY33482.1|  BnaA06g35910D                                          148   2e-38   
ref|XP_002872924.1|  predicted protein                                  152   3e-38   
ref|XP_010058363.1|  PREDICTED: transcription factor MYC2-like          151   4e-38   
emb|CDP12229.1|  unnamed protein product                                151   4e-38   
ref|XP_008441948.1|  PREDICTED: transcription factor MYC4-like          148   8e-38   
gb|KCW72574.1|  hypothetical protein EUGRSUZ_E01043                     151   1e-37   
ref|XP_010422737.1|  PREDICTED: transcription factor bHLH14-like        149   2e-37   
gb|EMS55891.1|  Transcription factor MYC4                               147   4e-37   
ref|XP_008350027.1|  PREDICTED: transcription factor MYC2-like          150   4e-37   
ref|XP_008803328.1|  PREDICTED: transcription factor MYC3-like          149   4e-37   
ref|XP_008386326.1|  PREDICTED: transcription factor MYC3-like          148   1e-36   
ref|NP_199495.1|  calcium-binding transcription factor NIG1             147   3e-36   
ref|NP_567195.1|  transcription factor bHLH14                           145   9e-36   
emb|CDY59973.1|  BnaA09g53560D                                          145   1e-35   
ref|XP_010058361.1|  PREDICTED: transcription factor MYC2-like          144   2e-35   
gb|AEB35693.1|  MYC2                                                    135   5e-35   
ref|XP_009114323.1|  PREDICTED: transcription factor bHLH28-like        144   5e-35   
emb|CDY03183.1|  BnaC09g19730D                                          143   6e-35   
ref|XP_006361007.1|  PREDICTED: transcription factor bHLH14-like        135   7e-35   
ref|XP_008385225.1|  PREDICTED: transcription factor MYC2-like          143   8e-35   
ref|XP_010428091.1|  PREDICTED: transcription factor bHLH14-like        141   1e-34   
ref|XP_008358724.1|  PREDICTED: transcription factor MYC3-like          142   1e-34   
ref|XP_010058362.1|  PREDICTED: transcription factor MYC2-like          141   2e-34   
gb|KCW72573.1|  hypothetical protein EUGRSUZ_E01042                     140   3e-34   
gb|AAF04917.1|AF011557_1  jasmonic acid 3                               139   3e-34   
ref|XP_002320871.2|  hypothetical protein POPTR_0014s09520g             141   5e-34   
ref|XP_008385247.1|  PREDICTED: transcription factor MYC3-like          139   1e-33   
gb|AEB35702.1|  MYC2                                                    132   1e-33   
gb|AEB35681.1|  MYC2                                                    132   1e-33   
gb|AEB35699.1|  MYC2                                                    132   1e-33   
gb|AEB35566.1|  MYC2                                                    131   2e-33   
ref|XP_011038317.1|  PREDICTED: transcription factor bHLH13-like        139   2e-33   
ref|XP_006852614.1|  PREDICTED: transcription factor bHLH13             139   3e-33   
gb|AEB35704.1|  MYC2                                                    130   3e-33   
ref|XP_010058370.1|  PREDICTED: transcription factor MYC2-like          137   8e-33   
ref|XP_009354516.1|  PREDICTED: transcription factor MYC3-like          137   9e-33   
gb|KHN16427.1|  Transcription factor bHLH13                             137   1e-32   
ref|XP_010242395.1|  PREDICTED: transcription factor bHLH13-like        137   1e-32   
ref|XP_003520875.1|  PREDICTED: transcription factor bHLH13-like        137   1e-32   
emb|CBI38690.3|  unnamed protein product                                134   1e-32   
ref|XP_007147321.1|  hypothetical protein PHAVU_006G114000g             137   2e-32   
ref|XP_006294316.1|  hypothetical protein CARUB_v10023324mg             135   2e-32   
ref|XP_010507550.1|  PREDICTED: transcription factor MYC2-like          135   2e-32   
ref|XP_007210224.1|  hypothetical protein PRUPE_ppa015634mg             135   3e-32   
gb|EMS62462.1|  Transcription factor MYC2                               132   3e-32   
ref|XP_010058366.1|  PREDICTED: transcription factor MYC4-like          135   3e-32   
ref|XP_010513049.1|  PREDICTED: transcription factor MYC2-like          134   5e-32   
ref|XP_010412880.1|  PREDICTED: transcription factor MYC2-like          133   9e-32   
gb|AFB33094.1|  hypothetical protein 0_9408_01                          127   1e-31   
gb|AFB33098.1|  hypothetical protein 0_9408_01                          127   1e-31   
gb|AEW07707.1|  hypothetical protein 0_9408_01                          126   3e-31   
ref|XP_010508006.1|  PREDICTED: transcription factor ABA-INDUCIBL...    133   3e-31   
ref|XP_010506659.1|  PREDICTED: transcription factor ABA-INDUCIBL...    133   3e-31   
gb|AFB33089.1|  hypothetical protein 0_9408_01                          125   3e-31   
gb|AEW07706.1|  hypothetical protein 0_9408_01                          125   4e-31   
ref|XP_010055004.1|  PREDICTED: transcription factor bHLH13             133   4e-31   
ref|XP_002892077.1|  basic helix-loop-helix family protein              132   4e-31   
ref|XP_010554450.1|  PREDICTED: transcription factor bHLH3              132   5e-31   
dbj|BAJ85584.1|  predicted protein                                      132   5e-31   
ref|XP_010518324.1|  PREDICTED: transcription factor ABA-INDUCIBL...    132   5e-31   
ref|XP_008670327.1|  PREDICTED: transcription factor MYC2-like          129   5e-31   
ref|XP_006397843.1|  hypothetical protein EUTSA_v10001374mg             132   7e-31   
ref|XP_001765254.1|  predicted protein                                  134   7e-31   
ref|XP_010696336.1|  PREDICTED: transcription factor bHLH13-like        132   1e-30   
ref|XP_001754025.1|  predicted protein                                  131   1e-30   
ref|XP_010677037.1|  PREDICTED: transcription factor bHLH14-like        129   1e-30   
ref|XP_002882073.1|  basic helix-loop-helix family protein              131   1e-30   
ref|NP_566078.1|  transcription factor ABA-INDUCIBLE bHLH-TYPE          130   2e-30   
gb|EMT07783.1|  Transcription factor MYC2                               127   2e-30   
gb|KFK37416.1|  hypothetical protein AALP_AA4G254100                    130   2e-30   
ref|XP_004306657.1|  PREDICTED: transcription factor bHLH13-like        131   2e-30   
ref|XP_004229991.1|  PREDICTED: transcription factor bHLH13-like        130   4e-30   
ref|XP_003553791.1|  PREDICTED: transcription factor bHLH13-like        130   5e-30   
ref|XP_009401987.1|  PREDICTED: transcription factor bHLH13-like        130   5e-30   
gb|AHG95274.1|  mys transcription factor                                121   5e-30   
ref|XP_002462680.1|  hypothetical protein SORBIDRAFT_02g030120          126   6e-30   
gb|AAM19778.1|  At2g46510/F13A10.4                                      129   7e-30   
gb|EMT04182.1|  Transcription factor bHLH13                             129   8e-30   
ref|XP_006307052.1|  hypothetical protein CARUB_v10008640mg             129   9e-30   
gb|ABR16436.1|  unknown                                                 129   1e-29   
ref|XP_004974089.1|  PREDICTED: transcription factor MYC2-like          124   1e-29   
ref|XP_010058368.1|  PREDICTED: transcription factor MYC2-like          127   1e-29   
gb|AHG95269.1|  mys transcription factor                                120   1e-29   
ref|XP_008233131.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...    128   2e-29   
gb|AHG95271.1|  mys transcription factor                                120   2e-29   
gb|AHG95270.1|  mys transcription factor                                120   2e-29   
ref|XP_009781532.1|  PREDICTED: transcription factor bHLH13-like        128   2e-29   
gb|EEE51454.1|  hypothetical protein OsJ_32566                          129   2e-29   
emb|CDY70013.1|  BnaCnng66320D                                          124   2e-29   
ref|XP_009627739.1|  PREDICTED: transcription factor bHLH13-like        128   2e-29   
dbj|BAH20404.1|  AT1G01260                                              127   2e-29   
ref|XP_004974086.1|  PREDICTED: transcription factor MYC2-like          124   3e-29   
ref|XP_004974088.1|  PREDICTED: transcription factor bHLH14-like        123   3e-29   
ref|XP_009608279.1|  PREDICTED: transcription factor bHLH13-like        127   4e-29   
ref|XP_011093944.1|  PREDICTED: transcription factor bHLH13-like        127   5e-29   
ref|XP_001765161.1|  predicted protein                                  128   6e-29   
emb|CDX90021.1|  BnaA10g00610D                                          126   6e-29   
gb|AAM10932.1|AF488559_1  putative bHLH transcription factor            126   7e-29   
ref|NP_171634.1|  transcription factor bHLH13                           126   7e-29   
ref|XP_010480459.1|  PREDICTED: transcription factor bHLH13-like        126   7e-29   
ref|XP_010474717.1|  PREDICTED: transcription factor bHLH13-like        126   8e-29   
emb|CDP08667.1|  unnamed protein product                                126   9e-29   
ref|XP_009119682.1|  PREDICTED: transcription factor bHLH13             126   1e-28   
ref|XP_010457144.1|  PREDICTED: transcription factor bHLH13             126   1e-28   
ref|XP_002302637.2|  basic helix-loop-helix family protein              125   1e-28   
ref|XP_010559123.1|  PREDICTED: transcription factor ABA-INDUCIBL...    125   2e-28   
ref|XP_002444643.1|  hypothetical protein SORBIDRAFT_07g025310          122   2e-28   
ref|XP_010058369.1|  PREDICTED: transcription factor MYC2-like          124   2e-28   
ref|XP_010451453.1|  PREDICTED: transcription factor bHLH3-like         122   2e-28   
ref|XP_001752627.1|  predicted protein                                  127   2e-28   
ref|XP_010544844.1|  PREDICTED: transcription factor ABA-INDUCIBL...    124   3e-28   
ref|XP_011093027.1|  PREDICTED: transcription factor bHLH13-like ...    124   4e-28   
ref|XP_011093025.1|  PREDICTED: transcription factor bHLH13-like ...    124   4e-28   
ref|XP_008372794.1|  PREDICTED: transcription factor bHLH14-like        118   5e-28   
ref|XP_010522910.1|  PREDICTED: transcription factor bHLH13-like        124   5e-28   
ref|XP_011023168.1|  PREDICTED: transcription factor bHLH13-like        124   5e-28   
ref|XP_009770264.1|  PREDICTED: transcription factor bHLH13-like        124   6e-28   
emb|CDX90525.1|  BnaA03g42560D                                          122   6e-28   
ref|XP_006339721.1|  PREDICTED: transcription factor bHLH13-like        124   6e-28   
ref|NP_001063693.1|  Os09g0519100                                       120   6e-28   
ref|XP_006418406.1|  hypothetical protein EUTSA_v10007139mg             124   6e-28   
gb|KGN56417.1|  hypothetical protein Csa_3G119500                       124   7e-28   
emb|CDY34468.1|  BnaC01g21650D                                          122   7e-28   
ref|XP_004957382.1|  PREDICTED: transcription factor MYC2-like          120   7e-28   
gb|KCW72571.1|  hypothetical protein EUGRSUZ_E01039                     122   9e-28   
ref|XP_004133809.1|  PREDICTED: transcription factor bHLH13             124   1e-27   
ref|XP_004957381.1|  PREDICTED: transcription factor MYC2-like          119   1e-27   
ref|XP_009146001.1|  PREDICTED: transcription factor bHLH3              121   1e-27   
emb|CDY32242.1|  BnaA01g17420D                                          121   1e-27   
ref|XP_010440158.1|  PREDICTED: transcription factor bHLH3-like i...    121   1e-27   
gb|EYU32259.1|  hypothetical protein MIMGU_mgv1a021930mg                122   2e-27   
ref|XP_006282965.1|  hypothetical protein CARUB_v10007725mg             121   2e-27   
ref|XP_010434826.1|  PREDICTED: transcription factor bHLH3              121   2e-27   
ref|XP_006414350.1|  hypothetical protein EUTSA_v10025122mg             121   2e-27   
ref|XP_010440156.1|  PREDICTED: transcription factor bHLH3-like i...    121   2e-27   
emb|CDY27319.1|  BnaC04g50860D                                          121   2e-27   
ref|NP_193376.1|  transcription factor bHLH3                            120   3e-27   
ref|XP_009136765.1|  PREDICTED: transcription factor bHLH3-like         120   3e-27   
ref|XP_002870159.1|  basic helix-loop-helix family protein              120   3e-27   
ref|XP_006443887.1|  hypothetical protein CICLE_v10019816mg             121   3e-27   
gb|KDO68498.1|  hypothetical protein CISIN_1g010728mg                   121   3e-27   
ref|XP_010556598.1|  PREDICTED: transcription factor bHLH13-like        122   3e-27   
gb|AEB35549.1|  MYC2                                                    119   3e-27   
gb|AEB35467.1|  MYC2                                                    119   4e-27   
gb|AEB35556.1|  MYC2                                                    119   4e-27   
gb|KFK26541.1|  hypothetical protein AALP_AA8G262400                    120   4e-27   
gb|AEB35522.1|  MYC2                                                    119   4e-27   
ref|XP_004493757.1|  PREDICTED: transcription factor bHLH3-like         120   4e-27   
gb|AEB35563.1|  MYC2                                                    119   4e-27   



>ref|XP_007051457.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
 gb|EOX95614.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
Length=497

 Score =   265 bits (678),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 155/267 (58%), Positives = 186/267 (70%), Gaps = 29/267 (11%)
 Frame = -1

Query  992  ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPE  813
            +R ISFADIG+++G     Q   A  D+    ++          Q    +    ++SY +
Sbjct  235  DRNISFADIGIIAG----VQEEDASPDNRTKQENH-------NNQTKKDSTKPGQSSYVD  283

Query  812  SEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  633
            SEHSDSDC  L    I  R    PKKRGRKPG GR TP+NHVEAERQRREKLNHRFYALR
Sbjct  284  SEHSDSDCPLLAMNNIEKR---TPKKRGRKPGLGRETPLNHVEAERQRREKLNHRFYALR  340

Query  632  SVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssa  459
            +VVPNVSRMDKASLLSDAVSYINELK K+EELE QLQ RE KKVKVE V   DNQST+++
Sbjct  341  AVVPNVSRMDKASLLSDAVSYINELKAKIEELESQLQ-RECKKVKVEMVDAMDNQSTTTS  399

Query  458  assvaSP------------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  315
                A P            ++ ++KI+G DAMIRVQSEN NYPSA+LM  LR+LE  VHH
Sbjct  400  VDQAARPSNSSSGTAGSGGLEFDIKIMGNDAMIRVQSENVNYPSARLMIALRDLEFQVHH  459

Query  314  ASISSVNDIMLQDIVVKVPEGLRSEDG  234
            AS+S VN++MLQDIVV+VP+GLR+E+G
Sbjct  460  ASMSCVNELMLQDIVVRVPDGLRTEEG  486



>ref|XP_009604694.1| PREDICTED: transcription factor MYC3-like [Nicotiana tomentosiformis]
Length=489

 Score =   262 bits (670),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 154/276 (56%), Positives = 188/276 (68%), Gaps = 36/276 (13%)
 Frame = -1

Query  992  ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPE  813
            E+TISFADIGLVS   L + G+  G +     +    G+    A             + +
Sbjct  216  EKTISFADIGLVSC--LQEDGQILGNNKNNTSKKPKTGEIFSAAGTTL---------FQD  264

Query  812  SEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  633
            S+HSDSDCQ L + PIV+++   PKKRGRKPGA R TP NHVEAERQRREKLNHRFYALR
Sbjct  265  SDHSDSDCQVLVDKPIVEKK--TPKKRGRKPGATRETPSNHVEAERQRREKLNHRFYALR  322

Query  632  SVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLR--ESKKVKVEAVG----DNQs  471
            SVVP+V++MDKASLLSDAV YINELK KV++LE QL  +    KK+KVE++     DNQS
Sbjct  323  SVVPHVTKMDKASLLSDAVEYINELKAKVDDLELQLNNKSESKKKLKVESMDSTTLDNQS  382

Query  470  -----------------tssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGL  342
                             ++S+       V+VEVKI+GPDAMIRVQSEN NYPSA+LM  L
Sbjct  383  TTTTTTTSVDQIRPNSNSTSSFGPNNLTVEVEVKILGPDAMIRVQSENVNYPSARLMRAL  442

Query  341  RELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  234
            ++LEL VHHASISSVND+MLQDIVVKVP+ L +E+G
Sbjct  443  QDLELHVHHASISSVNDLMLQDIVVKVPQCLGTENG  478



>ref|XP_011094312.1| PREDICTED: transcription factor MYC2 [Sesamum indicum]
Length=473

 Score =   259 bits (661),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 162/201 (81%), Gaps = 9/201 (4%)
 Frame = -1

Query  824  SYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            SY +SEHSDSDCQF   P  V+ ++  PKKRGRKP  GR  P+NHVEAERQRREKLNHRF
Sbjct  262  SYLDSEHSDSDCQFFL-PETVETKR-TPKKRGRKPNLGRDAPLNHVEAERQRREKLNHRF  319

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG---DNQ  474
            YALRSVVPNVSRMDKASLLSDAVSYI ELK KVEELE QLQ RESKKVK E      DNQ
Sbjct  320  YALRSVVPNVSRMDKASLLSDAVSYIKELKSKVEELETQLQ-RESKKVKTETTAETLDNQ  378

Query  473  stssaassv---aSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
            ST+++   V    S ++VEVKIVG D MIRVQS+N NYP+A+LM+ +RELEL VHHAS+S
Sbjct  379  STTTSVDQVGPITSLLEVEVKIVGVDGMIRVQSDNGNYPAARLMDAIRELELQVHHASMS  438

Query  302  SVNDIMLQDIVVKVPEGLRSE  240
             VND+MLQD+V++VP+GLR E
Sbjct  439  CVNDLMLQDVVIRVPDGLRCE  459



>ref|XP_007219048.1| hypothetical protein PRUPE_ppa004680mg [Prunus persica]
 gb|EMJ20247.1| hypothetical protein PRUPE_ppa004680mg [Prunus persica]
Length=496

 Score =   257 bits (656),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 153/263 (58%), Positives = 186/263 (71%), Gaps = 33/263 (13%)
 Frame = -1

Query  989  RTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPES  810
            R  SFADIG+++G E  +  +   A DL +++ R  G+        S       N+ P+ 
Sbjct  242  RNFSFADIGIIAGVEEEEDDKKEVALDLTMMK-RKGGNPGTGLYPDS-------NANPKP  293

Query  809  EHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRS  630
            ++SDSD             +  PKKRGRKPG GR TP+NHVEAERQRREKLNHRFYALR+
Sbjct  294  DYSDSDGP-----------KRTPKKRGRKPGLGRDTPLNHVEAERQRREKLNHRFYALRA  342

Query  629  VVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN---Qstssa  459
            VVPNVSRMDKASLLSDAVSYINELK KV+ELE Q+Q RESKKVKVE  GDN   QST+++
Sbjct  343  VVPNVSRMDKASLLSDAVSYINELKTKVDELESQVQ-RESKKVKVE-TGDNLDIQSTTTS  400

Query  458  assvaSP---------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  306
               +A P         ++VEVKIVG DAMIRVQSEN NYPSA+LM  LR+LEL +HHAS+
Sbjct  401  VEQIAKPPSSSANGSGLEVEVKIVGTDAMIRVQSENVNYPSARLMAALRDLELQIHHASL  460

Query  305  SSVNDIMLQDIVVKVPEGLRSED  237
            S +N++MLQDIV+KVPE +RSED
Sbjct  461  SCINELMLQDIVLKVPENMRSED  483



>ref|XP_012083125.1| PREDICTED: transcription factor MYC2 [Jatropha curcas]
 gb|KDP28433.1| hypothetical protein JCGZ_14204 [Jatropha curcas]
Length=482

 Score =   256 bits (655),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 144/258 (56%), Positives = 181/258 (70%), Gaps = 26/258 (10%)
 Frame = -1

Query  983  ISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEH  804
            ISFADIGL++G +          D    L+ +A    ++   EA          Y +SEH
Sbjct  232  ISFADIGLIAGAQ----------DQEASLEQKA----QQTNYEAKKDIDKPGQCYIDSEH  277

Query  803  SDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVV  624
            SDSDC  +   P V+++   PKKRGRKP  GR TP+NHVEAERQRREKLNHRFYALR+VV
Sbjct  278  SDSDCPLV--APTVEKR--TPKKRGRKPSLGRETPLNHVEAERQRREKLNHRFYALRAVV  333

Query  623  PNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAV--GDNQstssaass  450
            PNVSRMDKASLLSDAV YINELK K++EL+ QLQ  +SK+VK+E     DNQST ++   
Sbjct  334  PNVSRMDKASLLSDAVCYINELKAKIDELDSQLQRDQSKRVKLEVTDNTDNQSTITSVDQ  393

Query  449  va------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDI  288
                      +D+EVKI+G DAMIRVQSEN NYP+AKL+  LR+LE  VHHAS+S+VN++
Sbjct  394  ARPSPISGFTLDIEVKILGDDAMIRVQSENVNYPAAKLLTALRDLEFQVHHASMSTVNEL  453

Query  287  MLQDIVVKVPEGLRSEDG  234
            MLQD+VV+VP+G R+E+G
Sbjct  454  MLQDVVVRVPDGFRTEEG  471



>ref|XP_010100678.1| hypothetical protein L484_023447 [Morus notabilis]
 gb|EXB83840.1| hypothetical protein L484_023447 [Morus notabilis]
Length=525

 Score =   255 bits (651),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 147/284 (52%), Positives = 186/284 (65%), Gaps = 43/284 (15%)
 Frame = -1

Query  983  ISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEH  804
            ISFADIG+++G   +Q+      D++K        +                ++Y +SEH
Sbjct  240  ISFADIGIIAG---VQEEDKYSPDEIK------KKETLDLMMMKKRKKKEGNSAYVDSEH  290

Query  803  SDSDCQFLK-----EPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYA  639
            SDSDC  +         I   ++ APKKRGRKPG GR TP+NHVEAERQRREKLNHRFYA
Sbjct  291  SDSDCPLITVNNNNNNNISTGEKRAPKKRGRKPGLGRDTPLNHVEAERQRREKLNHRFYA  350

Query  638  LRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRES-KKVKVEAVG----DNQ  474
            LR+VVPNVSRMDKASLLSDAVSYINELK K+++LE QLQ  +S KKVK+EA      DNQ
Sbjct  351  LRAVVPNVSRMDKASLLSDAVSYINELKAKIDDLESQLQRDQSNKKVKLEAADTMSLDNQ  410

Query  473  stssaassvaSP---------------------VDVEVKIVGPDAMIRVQSENANYPSAK  357
            ST+++      P                     +++EVKI+G DAMIRVQSEN NYPSA+
Sbjct  411  STTTSVDQTKPPNSNSSSNKSNNINSVTGNINGLEIEVKIIGTDAMIRVQSENVNYPSAR  470

Query  356  LMNGLRELELAVHHASISSVNDIMLQDIVVKVPEG---LRSEDG  234
            LM  LR+LE  VHHAS+SS+ND+MLQD+VVK+PEG   +R+++G
Sbjct  471  LMGALRDLEFQVHHASVSSINDLMLQDVVVKIPEGIVLMRTQEG  514



>gb|KJB41602.1| hypothetical protein B456_007G111800 [Gossypium raimondii]
Length=495

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 150/270 (56%), Positives = 187/270 (69%), Gaps = 31/270 (11%)
 Frame = -1

Query  992  ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPE  813
            +R ISFADIG+++G     Q     + D+K  Q  +    +K + +          SY +
Sbjct  228  DRNISFADIGIIAG----VQEEDDASQDIKTKQEHSNNQTKKDSSKLGQP------SYVD  277

Query  812  SEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  633
            SEHSDSD   L    + + ++  PKKRGRKPG GR TP+NHVEAERQRREKLNHRFYALR
Sbjct  278  SEHSDSDFPLL---AMNNVEKRTPKKRGRKPGLGRETPLNHVEAERQRREKLNHRFYALR  334

Query  632  SVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssa  459
            +VVPNVSRMDKASLLSDAVSYI +LK K++ELE QLQ RE KKVKVE V   DNQST++ 
Sbjct  335  AVVPNVSRMDKASLLSDAVSYITDLKAKIDELESQLQ-RERKKVKVEMVDTMDNQSTTTT  393

Query  458  ass---------------vaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  324
             +S                 S +++EVKI+  DAMIRV SEN NYP+A+LM  LR+LE  
Sbjct  394  TTSEEEQQATRPSYSSPGTGSGIELEVKIMVNDAMIRVHSENVNYPAARLMGALRDLEFQ  453

Query  323  VHHASISSVNDIMLQDIVVKVPEGLRSEDG  234
            VHHAS+SSVND+MLQDIVV++P+GLR+E+G
Sbjct  454  VHHASMSSVNDLMLQDIVVRLPDGLRTEEG  483



>ref|XP_006444764.1| hypothetical protein CICLE_v10019749mg [Citrus clementina]
 gb|ESR58004.1| hypothetical protein CICLE_v10019749mg [Citrus clementina]
Length=515

 Score =   253 bits (645),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 149/271 (55%), Positives = 191/271 (70%), Gaps = 26/271 (10%)
 Frame = -1

Query  992  ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqea-----saaaaaaK  828
            +R ISFADIG+++G   +QQ      ++ + L      D  K  +       +  ++  +
Sbjct  240  DRNISFADIGIIAG---VQQEEEEEEEEEEELSRPEEEDQNKVKKPRKDQGCTVKSSTGQ  296

Query  827  NSYP-ESEHSDSDCQFLKEPPIVDR----QQNAPKKRGRKPGAGRVTPVNHVEAERQRRE  663
            +SY  +SEHSDSDC     PP V+     ++  PKKRGRKPG GR TP+NHVEAERQRRE
Sbjct  297  SSYTVDSEHSDSDCPL---PPPVNNISAVEKRTPKKRGRKPGLGRETPLNHVEAERQRRE  353

Query  662  KLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG  483
            KLNHRFYALR+VVPNVSRMDKASLLSDAVSYI ELK K+++LE QL  RESKKVK+E + 
Sbjct  354  KLNHRFYALRAVVPNVSRMDKASLLSDAVSYIRELKVKIDDLESQLLQRESKKVKLE-IS  412

Query  482  DNQstssaassvaSP---------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELE  330
            DN ST+++                ++VE KI+G DAMIRVQSEN N+P+AKLM+ LR+L+
Sbjct  413  DNHSTTTSVDQARPSSAGSGGGFNLEVETKIMGSDAMIRVQSENVNHPAAKLMSSLRDLD  472

Query  329  LAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            L +HHAS+S VND+MLQDIVV+VP+GLR+ED
Sbjct  473  LQLHHASMSCVNDLMLQDIVVRVPDGLRTED  503



>ref|XP_010054972.1| PREDICTED: transcription factor MYC2 [Eucalyptus grandis]
 gb|KCW71457.1| hypothetical protein EUGRSUZ_E00019 [Eucalyptus grandis]
Length=495

 Score =   252 bits (643),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 151/262 (58%), Positives = 184/262 (70%), Gaps = 26/262 (10%)
 Frame = -1

Query  983  ISFADIGLVSGHELLQQGRSAGADD----LKVLQSRAAGDaekqaqeasaaaaaaKNSY-  819
            ISFADIG+++G   +Q+   A  DD    +K  Q    G            A    +SY 
Sbjct  235  ISFADIGIIAG---VQENDFAPHDDHEKKVKKKQPLVEG------AGGKPEAPFGCSSYL  285

Query  818  PESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYA  639
             ESEHSDSD  F+     V  ++  PKKRGRKPG GR TP+NHVEAERQRREKLNHRFYA
Sbjct  286  VESEHSDSDSPFMA---AVMTEKRTPKKRGRKPGLGRDTPLNHVEAERQRREKLNHRFYA  342

Query  638  LRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAV-GDNQstss  462
            LR+VVPNVSRMDKASLLSDAVSYINELK K+ +LE QLQ RESK+VK E     +  +++
Sbjct  343  LRAVVPNVSRMDKASLLSDAVSYINELKSKIGDLESQLQ-RESKRVKQEVTDATDNLSTT  401

Query  461  aassvaSP-------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
             +   +SP       ++VEVKIVG DAMIRVQSENANYPSA+LM  +R+LEL +HHAS+S
Sbjct  402  TSVDHSSPSGCGGSLLEVEVKIVGCDAMIRVQSENANYPSARLMAAMRDLELHIHHASLS  461

Query  302  SVNDIMLQDIVVKVPEGLRSED  237
            +VND+MLQD+VV VPEGL+ E+
Sbjct  462  TVNDLMLQDVVVSVPEGLKGEE  483



>ref|XP_009776117.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=496

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 148/275 (54%), Positives = 188/275 (68%), Gaps = 28/275 (10%)
 Frame = -1

Query  992  ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPE  813
            E+T+SFA+IGLVS   L + G+    ++    ++  +   + +    +A AA     + +
Sbjct  217  EKTVSFANIGLVSC--LQENGQILAINNNNHNKNNTSKKPKTEEISTTATAATTL--FQD  272

Query  812  SEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  633
            S+HSDSDCQ L + PIV+++   PKKRGRKPGA R TP+NHVEAERQRREKLNHRFYALR
Sbjct  273  SDHSDSDCQVLVDKPIVEKK--TPKKRGRKPGATRETPLNHVEAERQRREKLNHRFYALR  330

Query  632  SVVPNVSRMDKASLLSDAVSYINELKGKVEELECQL----------------------QL  519
            SVVP+V++MDKASLLSDAV YINELK KV+ELE QL                      Q 
Sbjct  331  SVVPHVTKMDKASLLSDAVEYINELKTKVDELELQLNKKSESKKKLKVESMDSTTLDNQT  390

Query  518  RESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLR  339
              +    V+ +  N ++SS+       V+VEVKI+GPDAMIRVQSEN NYPSA+LM  L+
Sbjct  391  TTTTTTSVDQIRPNSNSSSSYGPNNLTVEVEVKILGPDAMIRVQSENVNYPSARLMRALQ  450

Query  338  ELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  234
            +LEL VHHASISSVND+MLQDIVVKVP+ L +E+G
Sbjct  451  DLELHVHHASISSVNDLMLQDIVVKVPKCLGTENG  485



>ref|XP_002301432.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE80705.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=491

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 145/265 (55%), Positives = 181/265 (68%), Gaps = 29/265 (11%)
 Frame = -1

Query  992  ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPE  813
            +R+ISFAD+G+++G   LQ+  +   +     ++  A                   SY  
Sbjct  234  DRSISFADMGIIAG---LQEDCAVDREQKNARETEEANKRNANKPGL---------SYLN  281

Query  812  SEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  633
            SEHSDSD   L     +  ++  PKKRGRKPG GR  P+NHVEAERQRREKLNHRFYALR
Sbjct  282  SEHSDSDFPLLA----MHMEKRIPKKRGRKPGLGRDAPLNHVEAERQRREKLNHRFYALR  337

Query  632  SVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssa  459
            +VVPNVSRMDKASLLSDAVSYINELK KV+ELE QL+ RESKKVK+E     DNQST+++
Sbjct  338  AVVPNVSRMDKASLLSDAVSYINELKAKVDELESQLE-RESKKVKLEVADNLDNQSTTTS  396

Query  458  assva----------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  309
                A            ++VE+K VG DAMIRVQSEN NYP+++LM  LRELE  VHHAS
Sbjct  397  VDQSACRPNSAGGAGLALEVEIKFVGNDAMIRVQSENVNYPASRLMCALRELEFQVHHAS  456

Query  308  ISSVNDIMLQDIVVKVPEGLRSEDG  234
            +S VN++MLQD+VV+VP+GLR+E+ 
Sbjct  457  MSCVNELMLQDVVVRVPDGLRTEEA  481



>gb|KDO86574.1| hypothetical protein CISIN_1g046178mg [Citrus sinensis]
Length=515

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 151/275 (55%), Positives = 191/275 (69%), Gaps = 34/275 (12%)
 Frame = -1

Query  992  ERTISFADIGLVSG---------HELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaa  840
            +R ISFADIG+++G          E  +  R    D  KV + R       + Q  +  +
Sbjct  240  DRNISFADIGIIAGVQQEQEEEEEEEEELSRPEEEDQNKVKKPR-------KDQGCTVKS  292

Query  839  aaaKNSYP-ESEHSDSDCQFLKEPPIVDR----QQNAPKKRGRKPGAGRVTPVNHVEAER  675
            +  ++SY  +SEHSDSDC     PP V+     ++  PKKRGRKPG GR TP+NHVEAER
Sbjct  293  STGQSSYTVDSEHSDSDCPL---PPPVNNISAVEKRTPKKRGRKPGLGRETPLNHVEAER  349

Query  674  QRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKV  495
            QRREKLNHRFYALR+VVPNVSRMDKASLLSDAVSYI ELK K+++LE QL  RESKKVK+
Sbjct  350  QRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYIRELKVKIDDLESQLLQRESKKVKL  409

Query  494  EAVGDNQstssaassvaSP---------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGL  342
            E + DN ST+++                ++VE KI+G DAMIRVQSEN N+P+AKLM+ L
Sbjct  410  E-ISDNHSTTTSVDQARPSSAGSGGGFNLEVETKIMGSDAMIRVQSENVNHPAAKLMSSL  468

Query  341  RELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            R+L+L +HHAS+S VND+MLQDIVV+VP+GLR+ED
Sbjct  469  RDLDLQLHHASMSCVNDLMLQDIVVRVPDGLRTED  503



>gb|ABK94979.1| unknown [Populus trichocarpa]
Length=491

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 145/265 (55%), Positives = 181/265 (68%), Gaps = 29/265 (11%)
 Frame = -1

Query  992  ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPE  813
            +R+ISFAD+G+++G   LQ+  +   +     ++  A                   SY  
Sbjct  234  DRSISFADMGIIAG---LQEDCAVDREQKNARETEEANKRNANKPGL---------SYLN  281

Query  812  SEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  633
            SEHSDSD   L     +  ++  PKKRGRKPG GR  P+NHVEAERQRREKLNHRFYALR
Sbjct  282  SEHSDSDFPLLA----MHMEKRIPKKRGRKPGLGRDAPLNHVEAERQRREKLNHRFYALR  337

Query  632  SVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssa  459
            +VVPNVSRMDKASLLSDAVSYINELK KV+ELE QL+ RESKKVK+E     DNQST+++
Sbjct  338  AVVPNVSRMDKASLLSDAVSYINELKAKVDELESQLE-RESKKVKLEVADNLDNQSTTTS  396

Query  458  assva----------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  309
                A            ++VE+K VG DAMIRVQSEN NYP+++LM  LRELE  VHHAS
Sbjct  397  VDQSACRPNSAGGAGLALEVEIKFVGNDAMIRVQSENVNYPASRLMCALRELEFQVHHAS  456

Query  308  ISSVNDIMLQDIVVKVPEGLRSEDG  234
            +S VN++MLQD+VV+VP+GLR+E+ 
Sbjct  457  MSCVNELMLQDVVVRVPDGLRTEEA  481



>ref|XP_004306627.1| PREDICTED: transcription factor MYC2 [Fragaria vesca subsp. vesca]
Length=491

 Score =   249 bits (637),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 148/269 (55%), Positives = 181/269 (67%), Gaps = 41/269 (15%)
 Frame = -1

Query  989  RTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPES  810
            R  SFADIG+V+G  + ++  S+  DD K +                      +N  P +
Sbjct  234  RNFSFADIGIVAG--VQEEDNSSYNDDKKHV----------LGYNKKKNNNGLQNPTP-A  280

Query  809  EHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRS  630
            + +DSD Q           +  PKKRGRKPG GR TP+NHVEAERQRREKLNHRFYALR+
Sbjct  281  DFADSDFQL----------KRTPKKRGRKPGMGRDTPLNHVEAERQRREKLNHRFYALRA  330

Query  629  VVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssaa  456
            VVPNVSRMDKASLLSDAVSYINELK KV+ELE QLQ RESKKVKVE     DNQST++ A
Sbjct  331  VVPNVSRMDKASLLSDAVSYINELKAKVDELESQLQ-RESKKVKVEMADNLDNQSTTTTA  389

Query  455  ssvaSP---------------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  321
            S   +                +++EVKIVG DAMIRVQSEN NYPSA+LM  +R+LE  +
Sbjct  390  SVEQTQTVTPDNNNNNNNGSGLEIEVKIVGTDAMIRVQSENVNYPSARLMTAMRDLEFQI  449

Query  320  HHASISSVNDIMLQDIVVKVPEGLRSEDG  234
            HHAS+SS+ND+MLQDIVVKVP+ +++E+G
Sbjct  450  HHASLSSINDLMLQDIVVKVPDNMKNEEG  478



>ref|XP_004248092.1| PREDICTED: transcription factor MYC3-like [Solanum lycopersicum]
Length=451

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 136/210 (65%), Positives = 155/210 (74%), Gaps = 25/210 (12%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            E   SDSDCQ L E       +  PKKRGRKPGA R TP+NHVEAERQRREKLNHRFYAL
Sbjct  237  ECNDSDSDCQLLVE-------KKTPKKRGRKPGATRETPLNHVEAERQRREKLNHRFYAL  289

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG----DNQst  468
            RSVVP+V++MDKASLLSDAVSYINELK KV ELE QL  R+SKK+K+E       DN ST
Sbjct  290  RSVVPHVTKMDKASLLSDAVSYINELKSKVAELETQLT-RKSKKLKIECTDSFSIDNNST  348

Query  467  ssaass-------------vaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  327
            ++  ++                 V+VEVKI+GPDAM+RVQSEN NYPS +LM  L++LEL
Sbjct  349  ATTITNSVDQIRHNSFGVHSNLKVEVEVKILGPDAMVRVQSENVNYPSTRLMRALQDLEL  408

Query  326  AVHHASISSVNDIMLQDIVVKVPEGLRSED  237
             VHHASISSVNDIMLQDIVVKVP GL +ED
Sbjct  409  HVHHASISSVNDIMLQDIVVKVPIGLSTED  438



>ref|XP_011039030.1| PREDICTED: transcription factor MYC2 isoform X2 [Populus euphratica]
Length=500

 Score =   249 bits (635),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 164/209 (78%), Gaps = 18/209 (9%)
 Frame = -1

Query  824  SYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            SY +SEHSDSD  F+     V+ ++  PKKRGRKPG GR  P+NHVEAERQRREKLNHRF
Sbjct  278  SYVDSEHSDSDFHFVA----VNIEKRIPKKRGRKPGLGRGAPLNHVEAERQRREKLNHRF  333

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQs  471
            YALR+VVPNVSRMDKASLLSDAVSYINE+K KV++LE QLQ RESKKVK+E     DNQS
Sbjct  334  YALRAVVPNVSRMDKASLLSDAVSYINEMKAKVDKLESQLQ-RESKKVKMEVADTMDNQS  392

Query  470  tssaassva-----------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  324
            T+++    A             ++VEVK VG DAMIRVQS+N NYP+++LM+ LR+LE  
Sbjct  393  TTTSVDQAACRPNSNSGGAGLALEVEVKFVGNDAMIRVQSDNVNYPASRLMSALRDLEFQ  452

Query  323  VHHASISSVNDIMLQDIVVKVPEGLRSED  237
            VHHAS+SSVN++MLQD+VV+VP+GLR+E+
Sbjct  453  VHHASMSSVNELMLQDVVVRVPDGLRTEE  481



>ref|XP_011039024.1| PREDICTED: transcription factor MYC2 isoform X1 [Populus euphratica]
Length=525

 Score =   249 bits (635),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 164/209 (78%), Gaps = 18/209 (9%)
 Frame = -1

Query  824  SYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            SY +SEHSDSD  F+     V+ ++  PKKRGRKPG GR  P+NHVEAERQRREKLNHRF
Sbjct  278  SYVDSEHSDSDFHFVA----VNIEKRIPKKRGRKPGLGRGAPLNHVEAERQRREKLNHRF  333

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQs  471
            YALR+VVPNVSRMDKASLLSDAVSYINE+K KV++LE QLQ RESKKVK+E     DNQS
Sbjct  334  YALRAVVPNVSRMDKASLLSDAVSYINEMKAKVDKLESQLQ-RESKKVKMEVADTMDNQS  392

Query  470  tssaassva-----------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  324
            T+++    A             ++VEVK VG DAMIRVQS+N NYP+++LM+ LR+LE  
Sbjct  393  TTTSVDQAACRPNSNSGGAGLALEVEVKFVGNDAMIRVQSDNVNYPASRLMSALRDLEFQ  452

Query  323  VHHASISSVNDIMLQDIVVKVPEGLRSED  237
            VHHAS+SSVN++MLQD+VV+VP+GLR+E+
Sbjct  453  VHHASMSSVNELMLQDVVVRVPDGLRTEE  481



>ref|XP_006362125.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=457

 Score =   246 bits (627),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 136/212 (64%), Positives = 154/212 (73%), Gaps = 27/212 (13%)
 Frame = -1

Query  803  SDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVV  624
            SDSDCQ L E P+   ++  PKKRGRKPGA R TP+NHVEAERQRREKLNHRFYALRSVV
Sbjct  237  SDSDCQVLVEKPV---EKKTPKKRGRKPGATRETPLNHVEAERQRREKLNHRFYALRSVV  293

Query  623  PNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG----DNQ------  474
            P+V++MDKASLLSDAVSYINELK KV ELE QL  R+SKK+K+E       DN       
Sbjct  294  PHVTKMDKASLLSDAVSYINELKSKVTELEGQL-TRKSKKLKIECTDSITIDNHSTATTT  352

Query  473  -------------stssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLREL  333
                         S +S        V+VEVKI+GPDAM+RVQSEN NYPSA+LM  L++L
Sbjct  353  TTNSVDQIRHNSSSAASFGVQNNLKVEVEVKILGPDAMVRVQSENVNYPSARLMRALQDL  412

Query  332  ELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            EL VHHASISSVNDIMLQDIVVKVP  L +ED
Sbjct  413  ELHVHHASISSVNDIMLQDIVVKVPIELSTED  444



>ref|XP_007135301.1| hypothetical protein PHAVU_010G117900g [Phaseolus vulgaris]
 gb|ESW07295.1| hypothetical protein PHAVU_010G117900g [Phaseolus vulgaris]
Length=464

 Score =   242 bits (618),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 140/268 (52%), Positives = 175/268 (65%), Gaps = 40/268 (15%)
 Frame = -1

Query  992  ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPE  813
            + TISFADIG+V+G +  ++ + A                              K+ Y +
Sbjct  211  DNTISFADIGIVAGIQETKKRKQA-----------------------QTPPNNKKDIYVD  247

Query  812  SEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  633
            SEHSDSDC  L          + PKKRGRKP  GR TP+NHVEAERQRREKLNHRFYALR
Sbjct  248  SEHSDSDCPMLPT--TTTPTASEPKKRGRKPVIGRETPMNHVEAERQRREKLNHRFYALR  305

Query  632  SVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssa  459
            +VVPNVSRMDKASLLSDAV+YINELK K+E LE Q Q   +K+VK E +   DNQST++ 
Sbjct  306  AVVPNVSRMDKASLLSDAVTYINELKAKIEYLESQQQREGNKRVKTEMMDTMDNQSTTTT  365

Query  458  assvaSP-------------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  318
             +S                 ++++VKI+GPDAM+RVQSENAN+P A+LM  LR+LE  VH
Sbjct  366  TTSTIVDQSRPGAGGPCPFGLEIDVKIMGPDAMVRVQSENANHPGARLMGALRDLEFQVH  425

Query  317  HASISSVNDIMLQDIVVKVPEGLRSEDG  234
            HAS+S VND+MLQD+V+ VP G+RSE+G
Sbjct  426  HASMSCVNDLMLQDVVINVPNGMRSEEG  453



>gb|KHN15898.1| Transcription factor bHLH14 [Glycine soja]
Length=465

 Score =   242 bits (618),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 137/267 (51%), Positives = 179/267 (67%), Gaps = 39/267 (15%)
 Frame = -1

Query  995  EERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYP  816
            ++ TISFADIG+V+G +  ++ +       ++ Q+  + +                ++Y 
Sbjct  212  DDHTISFADIGIVAGIQETKKRK-------QITQTAPSKN----------------DNYV  248

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +SEHSDSDC  L         +  PKKRGRKP  GR TP+NHVEAERQRREKLNHRFYAL
Sbjct  249  DSEHSDSDCPTLPTATTPTASE--PKKRGRKPVLGRETPINHVEAERQRREKLNHRFYAL  306

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstss  462
            R+VVPNVSRMDKASLLSDAV+YINELK K+E+LE Q     +KK+K E     DNQS ++
Sbjct  307  RAVVPNVSRMDKASLLSDAVAYINELKAKIEDLESQQPRDSNKKMKTEMTDTLDNQSATT  366

Query  461  aassvaSP------------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  318
             ++ V               ++V+V+IVGPDAM+RVQSEN N+P A+LM  LR+LE  VH
Sbjct  367  TSTVVDQSGSGSRLGLGPLGLEVDVRIVGPDAMVRVQSENVNHPGARLMGALRDLEFQVH  426

Query  317  HASISSVNDIMLQDIVVKVPEGLRSED  237
            HAS+S VND+MLQD+VVK+P G+RSE+
Sbjct  427  HASMSCVNDLMLQDVVVKLPNGMRSEE  453



>ref|XP_003528771.1| PREDICTED: transcription factor MYC2-like [Glycine max]
 gb|KHN06348.1| Transcription factor bHLH14 [Glycine soja]
Length=464

 Score =   242 bits (617),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 142/268 (53%), Positives = 175/268 (65%), Gaps = 36/268 (13%)
 Frame = -1

Query  995  EERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYP  816
            ++ TISFADIG+V+G   +Q+ +    +  +  +     D                 +Y 
Sbjct  208  DDHTISFADIGIVAG---VQETKKRRINQTQTQKPPRKND-----------------NYV  247

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
             SEHSDSDC  L          + PKKRGRKP  GR TPVNHVEAERQRREKLNHRFYAL
Sbjct  248  NSEHSDSDCPTLPT--ATTPTTSEPKKRGRKPILGRETPVNHVEAERQRREKLNHRFYAL  305

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstss  462
            R+VVPNVSRMDKASLLSDAV+YI+ELK K+E LE Q     SKKVK E     DN ST++
Sbjct  306  RAVVPNVSRMDKASLLSDAVAYISELKAKIEYLESQQPRDSSKKVKTEMTDTLDNHSTTT  365

Query  461  aassvaSP------------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  318
             ++ V               ++V+VKIVGPDAM+RVQSEN N+P A+LM  LR+LE  VH
Sbjct  366  ISTVVDQSGPEPRLGPSPLGLEVDVKIVGPDAMVRVQSENVNHPGARLMGALRDLEFQVH  425

Query  317  HASISSVNDIMLQDIVVKVPEGLRSEDG  234
            HAS+S VND+MLQD+VVK+P G+RSE+G
Sbjct  426  HASMSCVNDLMLQDVVVKLPNGMRSEEG  453



>ref|XP_011023113.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=491

 Score =   241 bits (615),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 143/265 (54%), Positives = 178/265 (67%), Gaps = 29/265 (11%)
 Frame = -1

Query  992  ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPE  813
            +R+ISFAD+G+++G   LQ+  +   +     ++  A                    Y  
Sbjct  234  DRSISFADMGIIAG---LQEDCAVDREQKNAHETEEANKRNANKPGL---------PYLN  281

Query  812  SEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  633
            SE SDSD   L     +  ++  PKKRGRKPG GR  P+NHVEAERQRREKLNHRFYALR
Sbjct  282  SEPSDSDFPLLA----MHMEKRIPKKRGRKPGLGRDAPLNHVEAERQRREKLNHRFYALR  337

Query  632  SVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssa  459
            +VVPNVSRMDKASLLSDAVSYINELK KV+ELE QL+ RE KKVK+E     DNQST+++
Sbjct  338  AVVPNVSRMDKASLLSDAVSYINELKAKVDELESQLE-REFKKVKLEVADNLDNQSTTTS  396

Query  458  assva----------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  309
                A            ++VEVK VG DAMIRVQSEN NYP+++LM  LRELE  VHHAS
Sbjct  397  VDQSACRPNSAGGAGHALEVEVKFVGNDAMIRVQSENVNYPASRLMCALRELEFQVHHAS  456

Query  308  ISSVNDIMLQDIVVKVPEGLRSEDG  234
            +S VN++MLQD+VV+VP+GLR+E+ 
Sbjct  457  MSCVNELMLQDVVVRVPDGLRTEEA  481



>ref|XP_003548195.1| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=466

 Score =   239 bits (611),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 136/267 (51%), Positives = 178/267 (67%), Gaps = 39/267 (15%)
 Frame = -1

Query  995  EERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYP  816
            ++  ISFADIG+V+G +  ++ +       ++ Q+  + +                ++Y 
Sbjct  213  DDHIISFADIGIVAGIQETKKRK-------QITQTAPSKN----------------DNYV  249

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +SEHSDSDC  L         +  PKKRGRKP  GR TP+NHVEAERQRREKLNHRFYAL
Sbjct  250  DSEHSDSDCPTLPTATTPTASE--PKKRGRKPVLGRETPINHVEAERQRREKLNHRFYAL  307

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstss  462
            R+VVPNVSRMDKASLLSDAV+YINELK K+E+LE Q     +KK+K E     DNQS ++
Sbjct  308  RAVVPNVSRMDKASLLSDAVAYINELKAKIEDLESQQPRDSNKKMKTEMTDTLDNQSATT  367

Query  461  aassvaSP------------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  318
             ++ V               ++V+V+IVGPDAM+RVQSEN N+P A+LM  LR+LE  VH
Sbjct  368  TSTVVDQSGSGSRLGLGPLGLEVDVRIVGPDAMVRVQSENVNHPGARLMGALRDLEFQVH  427

Query  317  HASISSVNDIMLQDIVVKVPEGLRSED  237
            HAS+S VND+MLQD+VVK+P G+RSE+
Sbjct  428  HASMSCVNDLMLQDVVVKLPNGMRSEE  454



>ref|XP_002529968.1| transcription factor, putative [Ricinus communis]
 gb|EEF32411.1| transcription factor, putative [Ricinus communis]
Length=288

 Score =   234 bits (597),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 131/264 (50%), Positives = 175/264 (66%), Gaps = 38/264 (14%)
 Frame = -1

Query  983  ISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEH  804
            ISFAD+G++SG   +Q+G +  A++                 +        +++  +SEH
Sbjct  36   ISFADMGIISG---IQEGDTTHANE-----------------KPQENDEKKESNNVDSEH  75

Query  803  SDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVV  624
            SDSD        +   ++ +PKKRGRKP  G    + HVEAERQRREKLNHRFYALR+VV
Sbjct  76   SDSDFSLFAAASL---EKKSPKKRGRKPALGGDKALKHVEAERQRREKLNHRFYALRAVV  132

Query  623  PNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEA--VGDNQstssa---  459
            PNVSRMDKASLLSDAVSYIN+LK K++ELE QL +  SK VK+E     DNQST++    
Sbjct  133  PNVSRMDKASLLSDAVSYINDLKAKIDELESQLHIDSSKTVKLEVADTKDNQSTTTTSDD  192

Query  458  ----------assvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  309
                      +++   P++VEVK +G DAMIRVQSEN NYP+A+LM  LRELE  VH  +
Sbjct  193  QAASRPISSVSTTNGFPLEVEVKSLGNDAMIRVQSENVNYPAARLMTALRELEFQVHRVT  252

Query  308  ISSVNDIMLQDIVVKVPEGLRSED  237
            +S+VN++MLQD+VV+VP+GLR+E+
Sbjct  253  MSTVNELMLQDVVVRVPDGLRTEE  276



>ref|XP_009375455.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=496

 Score =   239 bits (611),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 143/262 (55%), Positives = 177/262 (68%), Gaps = 31/262 (12%)
 Frame = -1

Query  989  RTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPES  810
            R  SFADIG+++G E  +  +   A D+  ++ +         +        +  +    
Sbjct  242  RNFSFADIGIIAGVEE-EDDKKEVALDITAMKKKCG-------RACPGLLQLSNLNSLNP  293

Query  809  EHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRS  630
            EHSDS  +F K           PKKRGRKPG GR TP+NHVEAERQRREKLNHRFYALR+
Sbjct  294  EHSDS--EFPKR---------TPKKRGRKPGLGRDTPLNHVEAERQRREKLNHRFYALRA  342

Query  629  VVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssaa  456
            VVPNVSRMDKASLLSDAVSYINELK KV+ELE Q+Q RESKKVKVE     DNQST+++ 
Sbjct  343  VVPNVSRMDKASLLSDAVSYINELKSKVDELESQVQ-RESKKVKVETGDNLDNQSTTTSV  401

Query  455  ssvaSP---------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
                 P         +++EVKIVG DAMIRVQS N NYPSA+LM  LR+LE  +HHAS+S
Sbjct  402  EQTRPPNSSASGSTGLEMEVKIVGSDAMIRVQSANVNYPSARLMAALRDLEFEIHHASLS  461

Query  302  SVNDIMLQDIVVKVPEGLRSED  237
             +N++MLQD+VVKVP+ +RSE+
Sbjct  462  CMNELMLQDVVVKVPDNMRSEE  483



>ref|XP_002266775.1| PREDICTED: transcription factor MYC2-like [Vitis vinifera]
Length=497

 Score =   239 bits (610),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 141/268 (53%), Positives = 179/268 (67%), Gaps = 38/268 (14%)
 Frame = -1

Query  983  ISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPESEH  804
             SFADIG++SG   +Q+      D   +  ++  G                ++   ESEH
Sbjct  237  FSFADIGIISG---IQEEEGTRQDKKPMGNAKKEG-----------IVNGCQSLCLESEH  282

Query  803  SDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVV  624
            SDSDC  +     V  ++  PKKRGRKP  GR  P+NHVEAERQRREKLNHRFYALR+VV
Sbjct  283  SDSDCPLVA----VTVEKRVPKKRGRKPRLGRDAPLNHVEAERQRREKLNHRFYALRAVV  338

Query  623  PNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEA--VGDNQstss----  462
            PNVSRMDKASLL+DAVSYINELK KV+ELE Q+  +ESKKVK+E     DNQST++    
Sbjct  339  PNVSRMDKASLLADAVSYINELKAKVDELESQVH-KESKKVKLEMADTTDNQSTTTSVDQ  397

Query  461  -------------aassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  321
                         +A+     ++VE+KIVGPDAMIRVQS+N N+PSA+LM  LR+LE  V
Sbjct  398  TGPTPPPPPPPPSSATGGGVALEVEIKIVGPDAMIRVQSDNHNHPSARLMGALRDLEFQV  457

Query  320  HHASISSVNDIMLQDIVVKVPEGLRSED  237
            HHAS+SS+ND+MLQD+VV++P+  R+ED
Sbjct  458  HHASMSSINDLMLQDVVVRLPDRFRNED  485



>ref|XP_008370350.1| PREDICTED: transcription factor MYC2 [Malus domestica]
Length=496

 Score =   238 bits (606),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 147/264 (56%), Positives = 173/264 (66%), Gaps = 35/264 (13%)
 Frame = -1

Query  989  RTISFADIGLVSGHELLQQGRSAGADDLK--VLQSRAAGDaekqaqeasaaaaaaKNSYP  816
            R  SFADIG+++G          G +D K  V     A   +           +  NS  
Sbjct  242  RNFSFADIGIIAG---------VGEEDDKKEVALDITAMKKKCGXACPDLVQLSNLNSL-  291

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
              EHSDS  +F K           PKKRGRKPG GR TP+NHVEAERQRREKLNHRFYAL
Sbjct  292  NPEHSDS--EFPKR---------TPKKRGRKPGLGRDTPLNHVEAERQRREKLNHRFYAL  340

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstss  462
            R+VVPNVSRMDKASLLSDAVSYINELK KV+ELE Q+Q RESKKVKVE     DNQST++
Sbjct  341  RAVVPNVSRMDKASLLSDAVSYINELKXKVDELESQVQ-RESKKVKVETGDNLDNQSTTT  399

Query  461  aassvaSP---------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  309
            +      P          + EVKIVG DAMIRVQS N NYPSA+LM  LR+LE  +HHAS
Sbjct  400  SVEQTRPPNSSASGSTGFETEVKIVGSDAMIRVQSANVNYPSARLMAALRDLEFEIHHAS  459

Query  308  ISSVNDIMLQDIVVKVPEGLRSED  237
            +S +N++MLQD+VVKVP+ +RSE+
Sbjct  460  LSCMNELMLQDVVVKVPBNMRSEE  483



>ref|XP_009592442.1| PREDICTED: transcription factor MYC2-like [Nicotiana tomentosiformis]
Length=439

 Score =   233 bits (594),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 139/261 (53%), Positives = 181/261 (69%), Gaps = 20/261 (8%)
 Frame = -1

Query  995  EERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYP  816
            ++ TI FA+I LV+G  L + G+ +  +  K  +S+     E               S+P
Sbjct  177  DQNTIYFANIDLVTG--LQEDGQESENNSNKNQESKLKKFEEVATTSHV--------SFP  226

Query  815  ESEHSDSDCQFLKEP---PIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +SE S SDCQ L+ P     V  ++   KKRGRKPG      +NHVE ERQRREKLNHRF
Sbjct  227  DSELSASDCQLLEHPVQKSRVGSKKRTYKKRGRKPGEDCDKQMNHVEVERQRREKLNHRF  286

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQ--LRESKKVKVEA--VGDN  477
            YALRSVVP V+RMDKASLLSDAV+YINELK KV++LE +L   L   KK+++E+    DN
Sbjct  287  YALRSVVPQVTRMDKASLLSDAVAYINELKAKVDKLESKLHRNLELKKKLQMESNDAVDN  346

Query  476  QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  297
            Q   S+ +SV   ++VEVK+VGP+AMIRVQSENANYPS +LM  L++LEL VHHASISSV
Sbjct  347  Q---SSTNSVDLTLEVEVKMVGPNAMIRVQSENANYPSTRLMCALQDLELHVHHASISSV  403

Query  296  NDIMLQDIVVKVPEGLRSEDG  234
            N+I+LQ+IV++VP+ L++EDG
Sbjct  404  NNILLQNIVIRVPKELKTEDG  424



>gb|KJB09595.1| hypothetical protein B456_001G151700 [Gossypium raimondii]
Length=502

 Score =   234 bits (597),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 145/270 (54%), Positives = 175/270 (65%), Gaps = 30/270 (11%)
 Frame = -1

Query  992  ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPE  813
            +R ISFADIG++SG  + ++    G D+                          ++S  +
Sbjct  235  DRNISFADIGIISG--VEEEEEDVGPDN-------ETKQEHHNHPTKKYFTKLGQSSSVD  285

Query  812  SEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  633
            SEHSDSD   L    +   +Q  P+KRGRKPG GR TP+NHVEAERQRREKLNHRFYALR
Sbjct  286  SEHSDSDRPSLA---MSHLEQKTPQKRGRKPGLGRETPLNHVEAERQRREKLNHRFYALR  342

Query  632  SVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEA--VGDNQstssa  459
            +VVPNVSRMDKASLLSDAVSYINELK K+EELE QLQ RE KK KVE   V DN ST+++
Sbjct  343  AVVPNVSRMDKASLLSDAVSYINELKAKIEELESQLQ-RECKKPKVEMVDVTDNHSTTTS  401

Query  458  assvaSPVD--------------VEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  321
                A+  D               ++KI+G DAMIRVQSENANYP  +LM  LR+LE  +
Sbjct  402  VEQEAAKPDNSPSPATAGCVGLEFDIKIMGNDAMIRVQSENANYPVTRLMVALRDLEFPI  461

Query  320  HHASISSVNDIMLQDIVVKVPE-GLRSEDG  234
            HHAS+S VN+ MLQDIVV VP+  LR+E G
Sbjct  462  HHASMSCVNETMLQDIVVNVPDLELRNEQG  491



>gb|KCW83845.1| hypothetical protein EUGRSUZ_B00713 [Eucalyptus grandis]
Length=490

 Score =   232 bits (591),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 140/257 (54%), Positives = 179/257 (70%), Gaps = 18/257 (7%)
 Frame = -1

Query  983  ISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSY-PESE  807
            ISF DIG+++G   LQ+   A  DD +  +     +   +       A     SY  ESE
Sbjct  230  ISFFDIGIIAG---LQESDFASHDDYE--KKVKKKEPLVEGAGGKPEAPFGSCSYLVESE  284

Query  806  HSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSV  627
            HSDS   F+    +V  ++  PKKRGRKPG G   P+NHVEAERQRREKLNHRFYALR+V
Sbjct  285  HSDSGSPFMA---VVMTEKRTPKKRGRKPGLGLDPPLNHVEAERQRREKLNHRFYALRAV  341

Query  626  VPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAV-GDNQstssaass  450
            VPNVS+MDK+SLLSDAVSYINELK K+ +LE Q+Q RESKK K E     +  +S+++  
Sbjct  342  VPNVSKMDKSSLLSDAVSYINELKSKISDLESQMQ-RESKKFKQEVTDATDNLSSTSSVD  400

Query  449  vaSP-------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVND  291
             +SP       ++VEVKIVG DAMIRVQS+NANY SA+LM  +R+LEL +HHAS+S+VND
Sbjct  401  HSSPSGCGGSLLEVEVKIVGCDAMIRVQSQNANYMSARLMAVMRDLELHIHHASLSAVND  460

Query  290  IMLQDIVVKVPEGLRSE  240
            ++LQD+VV+VPEGL+ E
Sbjct  461  LLLQDVVVRVPEGLKGE  477



>ref|XP_010031905.1| PREDICTED: transcription factor MYC2-like [Eucalyptus grandis]
Length=490

 Score =   231 bits (590),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 140/257 (54%), Positives = 179/257 (70%), Gaps = 18/257 (7%)
 Frame = -1

Query  983  ISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSY-PESE  807
            ISF DIG+++G   LQ+   A  DD +  +     +   +       A     SY  ESE
Sbjct  230  ISFFDIGIIAG---LQESDFASHDDYE--KKVKKKEPLVEGAGGKPEAPFGSCSYLVESE  284

Query  806  HSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSV  627
            HSDS   F+    +V  ++  PKKRGRKPG G   P+NHVEAERQRREKLNHRFYALR+V
Sbjct  285  HSDSGSPFMA---VVMTEKRTPKKRGRKPGLGLDPPLNHVEAERQRREKLNHRFYALRAV  341

Query  626  VPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAV-GDNQstssaass  450
            VPNVS+MDK+SLLSDAVSYINELK K+ +LE Q+Q RESKK K E     +  +S+++  
Sbjct  342  VPNVSKMDKSSLLSDAVSYINELKSKISDLESQMQ-RESKKFKQEVTDATDNLSSTSSVD  400

Query  449  vaSP-------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVND  291
             +SP       ++VEVKIVG DAMIRVQS+NANY SA+LM  +R+LEL +HHAS+S+VND
Sbjct  401  HSSPSGCGGSLLEVEVKIVGCDAMIRVQSQNANYMSARLMAVMRDLELHIHHASLSAVND  460

Query  290  IMLQDIVVKVPEGLRSE  240
            ++LQD+VV+VPEGL+ E
Sbjct  461  LLLQDVVVRVPEGLKGE  477



>gb|KJB49615.1| hypothetical protein B456_008G128800 [Gossypium raimondii]
Length=487

 Score =   230 bits (586),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 142/272 (52%), Positives = 177/272 (65%), Gaps = 43/272 (16%)
 Frame = -1

Query  992  ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPE  813
            ERTISF DIGL++G E        G  D K ++    G                ++SY +
Sbjct  229  ERTISFPDIGLLAGIE-----EENGGPDNKTIRDLKPG---------------QQSSYVD  268

Query  812  SEHSDSDCQFLKEPPIVDRQQN--APKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYA  639
            SE+SD DC  L     V+  +N   PKKRGRKP   R TPVNHVEAERQRREKLNHRFYA
Sbjct  269  SENSDFDCPLLA----VNNTENIRTPKKRGRKPCLRRDTPVNHVEAERQRREKLNHRFYA  324

Query  638  LRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQsts  465
            LR+ VPNVSRMDKASLLSDAV+YI ELK K+++LE QL+   ++KVKVE +   DNQST+
Sbjct  325  LRAAVPNVSRMDKASLLSDAVTYITELKSKIKDLESQLRKVCNEKVKVETIDAMDNQSTT  384

Query  464  saassva--------------SPVDVEVKIVG-PDAMIRVQSENANYPSAKLMNGLRELE  330
            ++    A              S + ++VK+ G  DA+IRVQSEN NYPSA+LM+ LR+LE
Sbjct  385  TSEEQAAARPSNSSSAATGRFSDLQLDVKVKGNDDAIIRVQSENVNYPSARLMSALRDLE  444

Query  329  LAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  234
              VHHAS+S VN++MLQDIV K+P GL SE+ 
Sbjct  445  FQVHHASMSCVNELMLQDIVAKIPYGLTSEEA  476



>ref|XP_002529965.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF32408.1| DNA binding protein, putative [Ricinus communis]
Length=486

 Score =   229 bits (585),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 117/186 (63%), Positives = 144/186 (77%), Gaps = 14/186 (8%)
 Frame = -1

Query  752  QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  573
            +  PKKRGRKP  GR TP+NHVEAER RREKLNHRFYALR+VVPNVSRMDKASLLSDAV 
Sbjct  289  KKTPKKRGRKPALGRDTPLNHVEAERLRREKLNHRFYALRAVVPNVSRMDKASLLSDAVC  348

Query  572  YINELKGKVEELECQLQLRESKKVKVEAV--GDNQstssaa------------ssvaSPV  435
            YINELK K+EELE QL  + SK+VK+E     DNQST+++             ++   P 
Sbjct  349  YINELKAKIEELESQLHRKSSKRVKLEVADNTDNQSTTTSEDQAASKPISTVCTTTGFPP  408

Query  434  DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPE  255
            ++EVKI+  DAMIRVQSEN NYP+A+LM  LR+LE  VHH S+S+VN++MLQD+VV+VP+
Sbjct  409  EIEVKILANDAMIRVQSENVNYPAARLMTALRDLEFQVHHVSMSTVNELMLQDVVVRVPD  468

Query  254  GLRSED  237
            GLR+E+
Sbjct  469  GLRTEE  474



>ref|XP_009766909.1| PREDICTED: transcription factor MYC2 [Nicotiana sylvestris]
 ref|XP_009766910.1| PREDICTED: transcription factor MYC2 [Nicotiana sylvestris]
Length=444

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 124/178 (70%), Positives = 140/178 (79%), Gaps = 9/178 (5%)
 Frame = -1

Query  740  KKRGRKPGAG----RVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  573
            KKRGRKP  G     +  +NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS
Sbjct  254  KKRGRKPKGGDSNINMVALNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  313

Query  572  YINELKGKVEELECQL--QLRESKKVKVEAVGDNQstssaassvaSP---VDVEVKIVGP  408
            YIN+LK KV+ELE QL      +KK K    G+NQST+++      P    +VEVKIVGP
Sbjct  314  YINQLKTKVDELESQLIDHSNSNKKQKSNESGENQSTNTSVDQELRPNSSSEVEVKIVGP  373

Query  407  DAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  234
            DAMIRVQSEN N+PSAKLM+ LR L+L VHHASISSVN++ML D+VVKVP GLRSEDG
Sbjct  374  DAMIRVQSENVNHPSAKLMSALRHLQLQVHHASISSVNNLMLHDVVVKVPLGLRSEDG  431



>ref|XP_009623539.1| PREDICTED: transcription factor MYC3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=448

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 142/263 (54%), Positives = 166/263 (63%), Gaps = 58/263 (22%)
 Frame = -1

Query  992  ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPE  813
            E++I FADIGLV+G   LQQ      D L                              E
Sbjct  221  EKSICFADIGLVTG---LQQDNE---DKL------------------------------E  244

Query  812  SEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAG----RVTPVNHVEAERQRREKLNHRF  645
             +  DSD            ++   KKRGRKP  G     +  +NHVEAERQRREKLNHRF
Sbjct  245  KQQLDSD------------KKAVAKKRGRKPKGGDNNINMAALNHVEAERQRREKLNHRF  292

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQL---QLRESKKVKVEAVGDNQ  474
            YALRS VPNVSRMDKASLLSDAVSYIN+LK KV+ELE QL       +KK K    G+NQ
Sbjct  293  YALRSAVPNVSRMDKASLLSDAVSYINQLKAKVDELELQLIDHSSSSNKKQKSNESGENQ  352

Query  473  stssaassvaSP---VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
            ST+++      P   ++VEVKIVGPDAMIRVQSEN NYPSAKLM+ LR L+L VHHASIS
Sbjct  353  STNTSVDQELRPNSSLEVEVKIVGPDAMIRVQSENVNYPSAKLMSALRHLQLQVHHASIS  412

Query  302  SVNDIMLQDIVVKVPEGLRSEDG  234
            SVN++ML D+VVKVP+GLR+EDG
Sbjct  413  SVNNLMLHDVVVKVPQGLRTEDG  435



>ref|XP_010909816.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=437

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 151/204 (74%), Gaps = 19/204 (9%)
 Frame = -1

Query  827  NSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHR  648
            +S  +SEHSDS+   + E       Q  PKKRGRKPG GR TPVNHVEAERQRREKLNHR
Sbjct  233  SSSVDSEHSDSEGALMME-------QRRPKKRGRKPGTGRETPVNHVEAERQRREKLNHR  285

Query  647  FYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQst  468
            FYALRSVVPNVSRMDKASLL+DAVSYI  L+ KVEELE      E+K++K E +GD    
Sbjct  286  FYALRSVVPNVSRMDKASLLADAVSYIKVLRAKVEELEA-----EAKRIKKEVIGDQGVG  340

Query  467  ssaassvaS-------PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  309
             +A +S  +        +++EVK++GPDA+IRV S+N N+P+AKLM  LR+LE+ VHHAS
Sbjct  341  GAATTSTTTTVSSGPLTMELEVKMLGPDALIRVHSDNLNHPTAKLMGALRDLEVNVHHAS  400

Query  308  ISSVNDIMLQDIVVKVPEGLRSED  237
            +S+V ++MLQD+VV+VP  L+ +D
Sbjct  401  VSTVKEVMLQDVVVRVPYALQGDD  424



>gb|KJB24531.1| hypothetical protein B456_004G149500 [Gossypium raimondii]
Length=476

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 154/208 (74%), Gaps = 19/208 (9%)
 Frame = -1

Query  824  SYPESEHSDSDCQF---LKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLN  654
            S+  S+HSDS+C+F    +     + ++  PKKRGRKPG+GR T +NHVEAERQRREKLN
Sbjct  250  SFVNSDHSDSECRFRAATESNSNSNTEKRIPKKRGRKPGSGRETLLNHVEAERQRREKLN  309

Query  653  HRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--D  480
            HRFYALR+VVPNVSRMDKASLLSDAV+YINELK K+E+L+ +L  R+ KKVK+E V   D
Sbjct  310  HRFYALRAVVPNVSRMDKASLLSDAVAYINELKSKIEDLQSELG-RDRKKVKIETVDGMD  368

Query  479  NQstssaassvaSP-------------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLR  339
            NQST+++    A P              ++++KI+G DAMIRVQSEN N+P+A+LM+ LR
Sbjct  369  NQSTTTSVEQAAKPSSNSSSGNAGSNGFELDIKIIGNDAMIRVQSENVNHPAARLMDALR  428

Query  338  ELELAVHHASISSVNDIMLQDIVVKVPE  255
             LE  VHHAS+S VND+M+QD+VV   E
Sbjct  429  NLEFRVHHASMSCVNDLMIQDVVVSFTE  456



>ref|XP_009623534.1| PREDICTED: transcription factor MYC2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=487

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 142/263 (54%), Positives = 166/263 (63%), Gaps = 58/263 (22%)
 Frame = -1

Query  992  ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPE  813
            E++I FADIGLV+G   LQQ      D L                              E
Sbjct  260  EKSICFADIGLVTG---LQQDNE---DKL------------------------------E  283

Query  812  SEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAG----RVTPVNHVEAERQRREKLNHRF  645
             +  DSD            ++   KKRGRKP  G     +  +NHVEAERQRREKLNHRF
Sbjct  284  KQQLDSD------------KKAVAKKRGRKPKGGDNNINMAALNHVEAERQRREKLNHRF  331

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQL---QLRESKKVKVEAVGDNQ  474
            YALRS VPNVSRMDKASLLSDAVSYIN+LK KV+ELE QL       +KK K    G+NQ
Sbjct  332  YALRSAVPNVSRMDKASLLSDAVSYINQLKAKVDELELQLIDHSSSSNKKQKSNESGENQ  391

Query  473  stssaassvaSP---VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
            ST+++      P   ++VEVKIVGPDAMIRVQSEN NYPSAKLM+ LR L+L VHHASIS
Sbjct  392  STNTSVDQELRPNSSLEVEVKIVGPDAMIRVQSENVNYPSAKLMSALRHLQLQVHHASIS  451

Query  302  SVNDIMLQDIVVKVPEGLRSEDG  234
            SVN++ML D+VVKVP+GLR+EDG
Sbjct  452  SVNNLMLHDVVVKVPQGLRTEDG  474



>gb|KEH18600.1| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=464

 Score =   218 bits (556),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 129/279 (46%), Positives = 181/279 (65%), Gaps = 43/279 (15%)
 Frame = -1

Query  1007  SSXPEERTI--SFADIGLVSGH----ELLQQGRSAGADDLKVLQSRAAGDaekqaqeasa  846
             S+ P ++++  +FADIG+VSG     +  Q+  +     +  + S  + D          
Sbjct  196   STNPLDKSMFQTFADIGIVSGSGEDTDETQKTMNQKLQQMNNIVSSCSID----------  245

Query  845   aaaaaKNSYPESEHSDSD-CQFLKEPPIVDRQQNA-----PKKRGRKPGAGRVTPVNHVE  684
                        SE+SDS+ C  L  P     ++++     PKKRGRKP +G  TP+NHVE
Sbjct  246   -----------SENSDSEYCPPLATPTKTRTEKDSFEKREPKKRGRKPLSGTQTPMNHVE  294

Query  683   AERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKK  504
             AERQRREKLNHRFYALRSVVPNVS+MDKASLLSDAV YINELK K+E+LE  +Q +ESKK
Sbjct  295   AERQRREKLNHRFYALRSVVPNVSKMDKASLLSDAVDYINELKSKIEDLES-VQQKESKK  353

Query  503   VKVEA--VGDNQstssaass-------vaSPVDVEVKIVGPDAMIRVQSENANYPSAKLM  351
             VK+E   + DN S ++ ++          +  +++VKI+G DAM+RVQSEN N+P A+LM
Sbjct  354   VKMETMEIVDNNSATTTSTVVDQKRPCNVNAFEIDVKIIGNDAMVRVQSENVNHPGARLM  413

Query  350   NGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  234
             + L++LE  VHHASIS+VN++M+QD+VV++P  +  E+ 
Sbjct  414   SVLKDLEFQVHHASISTVNEVMVQDVVVRIPNEMNKEES  452



>ref|XP_008345582.1| PREDICTED: transcription factor bHLH14-like [Malus domestica]
Length=492

 Score =   216 bits (551),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 118/192 (61%), Positives = 146/192 (76%), Gaps = 12/192 (6%)
 Frame = -1

Query  776  EPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKA  597
            EP   +  +  PKKRGRKPG G  T ++HVEAERQRREKLNHRF ALR+VVPNVSRMDKA
Sbjct  290  EPSDSEFPKRTPKKRGRKPGLGXDTTLDHVEAERQRREKLNHRFCALRAVVPNVSRMDKA  349

Query  596  SLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssaassvaSP-----  438
            SLLSDAVSYI ELK KV+E+E Q+Q RESKKVK E V   DNQS++++      P     
Sbjct  350  SLLSDAVSYIIELKSKVDEMESQVQ-RESKKVKAETVDNLDNQSSTTSVDQTRPPNSLVS  408

Query  437  ----VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIV  270
                ++VEVKIV  DAMIRV+SEN NYPSA+LM  LR+L+  ++HAS+S +N++MLQD+V
Sbjct  409  GSTGLEVEVKIVCSDAMIRVRSENVNYPSARLMAALRDLDFEMYHASLSCMNELMLQDVV  468

Query  269  VKVPEGLRSEDG  234
            VKVP+ +RSE+ 
Sbjct  469  VKVPDNMRSEES  480



>ref|XP_004230022.1| PREDICTED: transcription factor MYC2-like isoform X2 [Solanum 
lycopersicum]
Length=450

 Score =   215 bits (547),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 139/265 (52%), Positives = 166/265 (63%), Gaps = 61/265 (23%)
 Frame = -1

Query  992  ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPE  813
            E+TISFADIGLV+G   LQQ      DD                           N Y  
Sbjct  222  EKTISFADIGLVTG---LQQ------DD---------------------------NDYKL  245

Query  812  SEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAG----RVTPVNHVEAERQRREKLNHRF  645
             E+S       K  P+V       KKRGRKP  G     +  +NHVEAERQRREKLNHRF
Sbjct  246  RENSR------KPHPVV------AKKRGRKPKGGEEDAHMAALNHVEAERQRREKLNHRF  293

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQL--QLRESKKVKVEAVGDNQs  471
            YALRSVVPNVSRMDKASLLSDAVSYIN+LK KV+ELE QL    ++ K V   +  DNQS
Sbjct  294  YALRSVVPNVSRMDKASLLSDAVSYINQLKAKVDELELQLIDHTKKPKIVTESSSADNQS  353

Query  470  tssaa----ssvaSPV---DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  312
             ++++       A+P    +VEVKIVG DAMIRVQSEN +YPSAKLM  L+ L++ VHHA
Sbjct  354  ATTSSDDQVIKAANPTAAPEVEVKIVGTDAMIRVQSENVDYPSAKLMIALQNLQMQVHHA  413

Query  311  SISSVNDIMLQDIVVKVPEGLRSED  237
            SISSVN ++L D+VV+VP+GL +ED
Sbjct  414  SISSVNHLVLHDVVVRVPQGLSTED  438



>ref|XP_004230021.1| PREDICTED: transcription factor MYC2-like isoform X1 [Solanum 
lycopersicum]
Length=451

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 139/265 (52%), Positives = 166/265 (63%), Gaps = 61/265 (23%)
 Frame = -1

Query  992  ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPE  813
            E+TISFADIGLV+G   LQQ      DD                           N Y  
Sbjct  222  EKTISFADIGLVTG---LQQ------DD---------------------------NDYKL  245

Query  812  SEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAG----RVTPVNHVEAERQRREKLNHRF  645
             E+S       K  P+V       KKRGRKP  G     +  +NHVEAERQRREKLNHRF
Sbjct  246  RENSR------KPHPVV------AKKRGRKPKGGEEDAHMAALNHVEAERQRREKLNHRF  293

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQL--QLRESKKVKVEAVGDNQs  471
            YALRSVVPNVSRMDKASLLSDAVSYIN+LK KV+ELE QL    ++ K V   +  DNQS
Sbjct  294  YALRSVVPNVSRMDKASLLSDAVSYINQLKAKVDELELQLIDHTKKPKIVTESSSADNQS  353

Query  470  tssaa----ssvaSPV---DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  312
             ++++       A+P    +VEVKIVG DAMIRVQSEN +YPSAKLM  L+ L++ VHHA
Sbjct  354  ATTSSDDQVIKAANPTAAPEVEVKIVGTDAMIRVQSENVDYPSAKLMIALQNLQMQVHHA  413

Query  311  SISSVNDIMLQDIVVKVPEGLRSED  237
            SISSVN ++L D+VV+VP+GL +ED
Sbjct  414  SISSVNHLVLHDVVVRVPQGLSTED  438



>ref|XP_004510627.1| PREDICTED: transcription factor bHLH14-like [Cicer arietinum]
Length=472

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 123/261 (47%), Positives = 172/261 (66%), Gaps = 28/261 (11%)
 Frame = -1

Query  992  ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPE  813
            ++ I F D+G++SG            D+++ + +R                    + Y +
Sbjct  218  DQNILFTDVGIISG-------TGEETDEMQKMMNRTW----------LQKPKTVSSCYVD  260

Query  812  SEHSDSDCQFLKEPPIVDR-QQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            SE+SDS+     E    D  ++  PKKRGRKP  G  TP++HVEAERQRREK+NHRFYAL
Sbjct  261  SEYSDSEYYPQLETKKNDSFEKREPKKRGRKPLLGNPTPMSHVEAERQRREKINHRFYAL  320

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaa  456
            R+VVPNVSRMDKASLLSDAV +INELK K+ ELE + Q +E KK+K+E + DNQST++ +
Sbjct  321  RAVVPNVSRMDKASLLSDAVDFINELKSKIVELELE-QQKELKKLKIENM-DNQSTATTS  378

Query  455  ss--------vaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISS  300
            +             ++++VKI+G DAM+RVQ EN N+P A+LM+ L++LE  VHHASIS 
Sbjct  379  TVVDQKRISCNNISLEIDVKIIGGDAMVRVQCENVNHPGARLMSVLKDLEFQVHHASISC  438

Query  299  VNDIMLQDIVVKVPEGLRSED  237
            VN+IM+QD+VV+VP  +R+E+
Sbjct  439  VNEIMVQDVVVQVPINMRNEE  459



>ref|XP_007039384.1| Basic helix-loop-helix DNA-binding family protein, putative [Theobroma 
cacao]
 gb|EOY23885.1| Basic helix-loop-helix DNA-binding family protein, putative [Theobroma 
cacao]
Length=473

 Score =   211 bits (536),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 145/184 (79%), Gaps = 10/184 (5%)
 Frame = -1

Query  761  DRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSD  582
            D++ N   KRGRKPG+G+ +P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLLSD
Sbjct  278  DKEFNVRSKRGRKPGSGKDSPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLSD  337

Query  581  AVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssaassva-------SPVDV  429
            AV+YI EL+ KVEELE +L++ +S+K K+ A+   DNQ T+S   +           ++V
Sbjct  338  AVAYIKELRSKVEELEAKLRV-QSQKSKLNAINVFDNQITTSTFENTRPSPSYGPKTIEV  396

Query  428  EVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGL  249
            +VKIVG +AMIRVQ  + NYP+A+LM+ LR+LEL VHHASIS+V +++LQD+VV+VP G 
Sbjct  397  DVKIVGSEAMIRVQCPDVNYPAARLMDALRDLELHVHHASISNVKELVLQDVVVRVPTGF  456

Query  248  RSED  237
             S++
Sbjct  457  ISDE  460



>ref|XP_002320222.1| basic helix-loop-helix family protein [Populus trichocarpa]
 gb|EEE98537.1| basic helix-loop-helix family protein [Populus trichocarpa]
Length=430

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 111/168 (66%), Positives = 136/168 (81%), Gaps = 14/168 (8%)
 Frame = -1

Query  701  PVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQ  522
            P+NHVEAERQRREKLNHRFYALR+VVPNVSRMDKASLLSDAVSYINE+K KV++LE +LQ
Sbjct  252  PLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLSDAVSYINEMKAKVDKLESKLQ  311

Query  521  LRESKKVKVEAVG--DNQstssaassva-----------SPVDVEVKIVGPDAMIRVQSE  381
             RESKKVK+E     DNQST+++    A             ++VEVK VG DAMIRVQS+
Sbjct  312  -RESKKVKLEVADTMDNQSTTTSVDQAACRPNSNSGGAGLALEVEVKFVGNDAMIRVQSD  370

Query  380  NANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            N NYP ++LM+ LR+LE  VHHAS+SSVN++MLQD+VV+VP+GLR+E+
Sbjct  371  NVNYPGSRLMSALRDLEFQVHHASMSSVNELMLQDVVVRVPDGLRTEE  418



>ref|XP_008233076.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC2 [Prunus 
mume]
Length=483

 Score =   210 bits (535),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 136/263 (52%), Positives = 169/263 (64%), Gaps = 44/263 (17%)
 Frame = -1

Query  989  RTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPES  810
            R  SFADIG+++G E  +  +   A DL +++ R  G+        S       N+ P+ 
Sbjct  240  RNFSFADIGIIAGVEEEEDDKKEVALDLTMMK-RKGGNPGTGLYPDS-------NANPKP  291

Query  809  EHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRS  630
            ++SDSD             +  PKKRGRKPG GR TP+NHVEAERQRR K+ H       
Sbjct  292  DYSDSDGP-----------KRTPKKRGRKPGLGRDTPLNHVEAERQRRGKIKHPVSG---  337

Query  629  VVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN---Qstssa  459
                    DKASLLSDAVSYINELK KV+ELE Q+Q RESKKVKVE  GDN   QST+++
Sbjct  338  --------DKASLLSDAVSYINELKTKVDELESQVQ-RESKKVKVE-TGDNLDIQSTTTS  387

Query  458  assvaSP---------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  306
               +A P         ++VEVKIVG DAMIRVQSEN NYPSA+LM  LR+LEL +HHAS+
Sbjct  388  VEQIAKPPSSSANGSGLEVEVKIVGTDAMIRVQSENVNYPSARLMAALRDLELQIHHASL  447

Query  305  SSVNDIMLQDIVVKVPEGLRSED  237
            S +N++MLQDIV+KVPE +RSED
Sbjct  448  SCINELMLQDIVLKVPENMRSED  470



>ref|XP_006357552.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=452

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 135/262 (52%), Positives = 167/262 (64%), Gaps = 57/262 (22%)
 Frame = -1

Query  992  ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPE  813
            E++I FADIGLV+G   LQQ      DD                           N    
Sbjct  225  EKSICFADIGLVTG---LQQ------DD---------------------------NDDKL  248

Query  812  SEHSDSDCQFLKEP-PIVDRQQNAPKKRGRKPGA-GRVTPVNHVEAERQRREKLNHRFYA  639
             E+S       K+P P+V     A KKRGRKP     +  +NHVEAERQRREKLNHRFYA
Sbjct  249  RENSK------KQPQPVV-----AKKKRGRKPKEDANMAALNHVEAERQRREKLNHRFYA  297

Query  638  LRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQL--QLRESKKVKVEAVGDNQsts  465
            LRSVVPNVSRMDKASLLSDAVSYIN+LK KV+ELE QL    ++ K V   +  DNQST+
Sbjct  298  LRSVVPNVSRMDKASLLSDAVSYINQLKAKVDELELQLIDHTKKPKNVTESSSADNQSTT  357

Query  464  saa------ssvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
            +++      ++  +  +VEVKI+G DAMIRVQSEN +YPSAKLM  L+ L++ VHHASIS
Sbjct  358  TSSDDQVIKANSTAAPEVEVKIIGTDAMIRVQSENVDYPSAKLMIALQNLQMQVHHASIS  417

Query  302  SVNDIMLQDIVVKVPEGLRSED  237
            SVN ++L D+VV+VP+GL +ED
Sbjct  418  SVNHLVLHDVVVRVPQGLSTED  439



>ref|XP_010267440.1| PREDICTED: transcription factor MYC2 [Nelumbo nucifera]
Length=522

 Score =   211 bits (536),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 132/216 (61%), Positives = 165/216 (76%), Gaps = 22/216 (10%)
 Frame = -1

Query  827  NSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHR  648
            +S  ESEH DSD   +      D ++  PKKRGRKPG GR  P+NHVEAERQRREKLNHR
Sbjct  299  SSSVESEHFDSDALLITS---ADMEKRRPKKRGRKPGKGRDMPLNHVEAERQRREKLNHR  355

Query  647  FYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQL-RESKKVKVEAVGDNQs  471
            FYALRSVVPNVSRMDKASLL+DAVSYINELKGK+E+LE +L L R SKKVK+E + D+QS
Sbjct  356  FYALRSVVPNVSRMDKASLLADAVSYINELKGKIEDLEGRLGLGRHSKKVKME-MDDHQS  414

Query  470  tssaassva-----------------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGL  342
            T + A++V                  + +DVEVKI+G DA+IRVQSEN NYPSA+LM+ L
Sbjct  415  TITTATTVFDYGQTRSSSIYGSGGLITSMDVEVKILGTDALIRVQSENVNYPSARLMDAL  474

Query  341  RELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  234
            R L+L VHHAS+SSV ++MLQD+V+++P+G++SE+G
Sbjct  475  RGLKLQVHHASVSSVKELMLQDVVIRLPDGVKSEEG  510



>ref|XP_009412473.1| PREDICTED: transcription factor MYC3-like [Musa acuminata subsp. 
malaccensis]
Length=467

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 111/180 (62%), Positives = 139/180 (77%), Gaps = 13/180 (7%)
 Frame = -1

Query  740  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  561
            KKRGRKPG+ R TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLL+DAVSYI E
Sbjct  276  KKRGRKPGSRRETPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLADAVSYIKE  335

Query  560  LKGKVEELECQLQLRESKKVKVEAVGDN------------QstssaassvaSPVDVEVKI  417
            LK K+E+LE   + R  K++ V    +              ++SS  ++  + ++VEVK 
Sbjct  336  LKSKLEDLEADSK-RAKKEINVVDASNRPCGAMASSTGTATTSSSVVTAGPATMEVEVKS  394

Query  416  VGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            +GPDAMIRVQ+EN ++P+AKLM  LRELEL VHHAS+SSV ++ML D+VV+VP+GL++ED
Sbjct  395  LGPDAMIRVQTENVSHPTAKLMEVLRELELQVHHASVSSVKEVMLHDVVVRVPDGLQAED  454



>ref|XP_004140617.1| PREDICTED: transcription factor MYC2-like [Cucumis sativus]
 gb|KGN46541.1| hypothetical protein Csa_6G107910 [Cucumis sativus]
Length=431

 Score =   204 bits (520),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 116/214 (54%), Positives = 143/214 (67%), Gaps = 27/214 (13%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            E E SDSD   LK        +   +KRGRKP   +   +NHVEAERQRREKLN+RFYAL
Sbjct  215  EWELSDSDSPVLK----TGVMKKTGQKRGRKPNMSKENAMNHVEAERQRREKLNNRFYAL  270

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaa  456
            RSVVPNVSRMDKASLLSDAVSYIN LK KVEE+E  LQLRESKK + E  GDNQST++ +
Sbjct  271  RSVVPNVSRMDKASLLSDAVSYINALKAKVEEME--LQLRESKKSRDEG-GDNQSTTTTS  327

Query  455  ssvaSP--------------------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  336
              +                        DVEVKI+G DAM+RVQS N N+PSA +M   R+
Sbjct  328  EELMKGNSGGGVTTPTITTTTTTMTRFDVEVKIIGRDAMVRVQSHNLNFPSAIVMGVFRD  387

Query  335  LELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  234
            +E  + HASI++VNDIMLQD+++K+P G  +++ 
Sbjct  388  MEFEIQHASITNVNDIMLQDVLIKLPHGFSTDEA  421



>emb|CBI34590.3| unnamed protein product [Vitis vinifera]
Length=306

 Score =   201 bits (510),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 132/169 (78%), Gaps = 15/169 (9%)
 Frame = -1

Query  743  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  564
            PKKRGRKP  GR  P+NHVEAERQRREKLNHRFYALR+VVPNVSRMDKASLL+DAVSYI+
Sbjct  142  PKKRGRKPATGREMPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLADAVSYIH  201

Query  563  ELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQS  384
            ELK K+++LE +L+  E +K K  A G            A  ++V+VKI+G +AMIRVQ 
Sbjct  202  ELKTKIDDLETKLR-EEVRKPK--AYG------------AIRMEVDVKIIGSEAMIRVQC  246

Query  383  ENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
             + NYPSA LM+ LR+L+L V HAS+SSV ++MLQD+VV++PEGL SE+
Sbjct  247  PDLNYPSAILMDALRDLDLRVLHASVSSVKELMLQDVVVRIPEGLTSEE  295



>gb|KJB52372.1| hypothetical protein B456_008G259000 [Gossypium raimondii]
Length=475

 Score =   204 bits (518),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 150/202 (74%), Gaps = 18/202 (9%)
 Frame = -1

Query  803  SDSDCQFLKEPPIVDRQQNA---PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  633
            S+SD  F       D + NA    KKRGRKPG G+ +P+NHVEAERQRRE+LNHRFYALR
Sbjct  265  SESDGDFAS----ADTEFNAGGRSKKRGRKPGNGKESPINHVEAERQRRERLNHRFYALR  320

Query  632  SVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQstssa  459
            SVVPNVS+MDKASLLSDAV+YI EL+ K+++LE QL L +S+K K+  +   +NQ+T SA
Sbjct  321  SVVPNVSKMDKASLLSDAVAYIKELRSKIDKLEAQL-LVQSEKSKLNPINVFENQTTKSA  379

Query  458  assva--------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
              +            V+V+VKIVG +AMIRV+S + ++P+A+LM+ LR+LEL VHHAS+S
Sbjct  380  FDNTMKQSSTYWPKTVEVDVKIVGSEAMIRVRSPDIDHPAARLMDALRDLELPVHHASVS  439

Query  302  SVNDIMLQDIVVKVPEGLRSED  237
            +VND+MLQD+VV+VP G+   D
Sbjct  440  NVNDLMLQDVVVRVPTGIFITD  461



>emb|CDP08631.1| unnamed protein product [Coffea canephora]
Length=419

 Score =   202 bits (514),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 120/204 (59%), Positives = 145/204 (71%), Gaps = 20/204 (10%)
 Frame = -1

Query  809  EHSDSDCQFLKEPPIVDRQ-----QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            E SDSDC  + E      Q         KKRGRK G GR TP+NHVEAERQRREKLNHRF
Sbjct  191  ESSDSDCVVVVETTTRSHQVERKGGVGGKKRGRKAGTGRETPLNHVEAERQRREKLNHRF  250

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKK--VKVEAVGDNQs  471
            YALRSVVPNVSRMDKASLLSDAV+YI ELKGKV+ELE QL+  E  K  VK+E    N +
Sbjct  251  YALRSVVPNVSRMDKASLLSDAVAYIKELKGKVDELESQLKRIEGNKKSVKIEVADSNGN  310

Query  470  ts-------------saassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELE  330
            T+             S    ++S V VEVK+VG DAM+RVQS+++ YP+A+LM+ +R+LE
Sbjct  311  TTDNHSTTTASSSSCSGGGGMSSNVQVEVKMVGTDAMVRVQSDSSGYPTARLMDAIRDLE  370

Query  329  LAVHHASISSVNDIMLQDIVVKVP  258
            L VHHAS+S VND+MLQD+V++VP
Sbjct  371  LRVHHASMSHVNDLMLQDVVIRVP  394



>gb|ACF05947.1| MYC1 [Hevea brasiliensis]
Length=476

 Score =   203 bits (517),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 138/175 (79%), Gaps = 8/175 (5%)
 Frame = -1

Query  740  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  561
            KKRGRK   G + P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  291  KKRGRKQLNGELLPINHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVTYIKE  350

Query  560  LKGKVEELECQLQLRESKKVKVEAVGDNQst-------ssaassvaSPVDVEVKIVGPDA  402
            LK KV+ELE +LQ   SKK K+ +V DNQST        S+++  A  +++EVKIVG +A
Sbjct  351  LKAKVDELESKLQAV-SKKSKITSVTDNQSTDSMIDHIRSSSAYKAKAMELEVKIVGSEA  409

Query  401  MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            MIR  S + NYP+A+LM+ LRE+E  VHHAS+SS+ +++LQD+V +VP+GL +E+
Sbjct  410  MIRFLSPDVNYPAARLMDALREVEFKVHHASMSSIKEMVLQDVVARVPDGLTNEE  464



>gb|KDO76730.1| hypothetical protein CISIN_1g010053mg [Citrus sinensis]
Length=519

 Score =   204 bits (518),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 136/181 (75%), Gaps = 13/181 (7%)
 Frame = -1

Query  740  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  561
            KKRGRKP +GR +P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  327  KKRGRKPTSGRESPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVAYIKE  386

Query  560  LKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP-------------VDVEVK  420
            L+ KV+ELE +L+ +  K   V  V DN  ++ +   + +              +DV+VK
Sbjct  387  LRAKVDELEAKLREQARKSKVVYNVYDNNQSTGSTIMMPTSSSTTHHLGININIMDVDVK  446

Query  419  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSE  240
            IVG +AMIRVQ  + NYP+AKLM+ LR+LE  VHHAS+SSV + MLQD+VV++PEGL SE
Sbjct  447  IVGSEAMIRVQCPDINYPAAKLMDVLRDLEFHVHHASVSSVRETMLQDVVVRIPEGLISE  506

Query  239  D  237
            +
Sbjct  507  E  507



>ref|XP_006439218.1| hypothetical protein CICLE_v10019730mg [Citrus clementina]
 gb|ESR52458.1| hypothetical protein CICLE_v10019730mg [Citrus clementina]
Length=519

 Score =   204 bits (518),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 136/181 (75%), Gaps = 13/181 (7%)
 Frame = -1

Query  740  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  561
            KKRGRKP +GR +P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  327  KKRGRKPTSGRESPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVAYIKE  386

Query  560  LKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP-------------VDVEVK  420
            L+ KV+ELE +L+ +  K   V  V DN  ++ +   + +              +DV+VK
Sbjct  387  LRAKVDELEAKLREQARKSKVVYNVYDNNQSTGSTIMMPTSSSTTHHLGININIMDVDVK  446

Query  419  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSE  240
            IVG +AMIRVQ  + NYP+AKLM+ LR+LE  VHHAS+SSV + MLQD+VV++PEGL SE
Sbjct  447  IVGSEAMIRVQCPDINYPAAKLMDVLRDLEFHVHHASVSSVRETMLQDVVVRIPEGLISE  506

Query  239  D  237
            +
Sbjct  507  E  507



>ref|XP_006476285.1| PREDICTED: transcription factor MYC2-like [Citrus sinensis]
Length=519

 Score =   203 bits (517),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 106/181 (59%), Positives = 136/181 (75%), Gaps = 13/181 (7%)
 Frame = -1

Query  740  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  561
            KKRGRKP +GR +P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  327  KKRGRKPTSGRESPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVAYIKE  386

Query  560  LKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP-------------VDVEVK  420
            L+ KV+ELE +L+ +  K   V  V DN  ++ +   + +              +DV+VK
Sbjct  387  LRAKVDELEAKLREQARKSKVVYNVYDNNQSTGSTIMMPTSSSTTHHLGININIMDVDVK  446

Query  419  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSE  240
            IVG +AMIRVQ  + NYP+AKLM+ LR+LE  VHHAS+SSV + MLQD+VV++PEGL SE
Sbjct  447  IVGSEAMIRVQCPDINYPAAKLMDVLRDLEFHVHHASVSSVRETMLQDVVVRIPEGLISE  506

Query  239  D  237
            +
Sbjct  507  E  507



>ref|XP_002279973.1| PREDICTED: transcription factor MYC4 [Vitis vinifera]
Length=468

 Score =   202 bits (513),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 140/180 (78%), Gaps = 12/180 (7%)
 Frame = -1

Query  743  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  564
            PKKRGRKP  GR  P+NHVEAERQRREKLNHRFYALR+VVPNVSRMDKASLL+DAVSYI+
Sbjct  279  PKKRGRKPATGREMPLNHVEAERQRREKLNHRFYALRAVVPNVSRMDKASLLADAVSYIH  338

Query  563  ELKGKVEELECQL--QLRESKKVKVEAVGDNQstssa---------assvaSPVDVEVKI  417
            ELK K+++LE +L  ++R+ K    E   DNQST++          +S  A  ++V+VKI
Sbjct  339  ELKTKIDDLETKLREEVRKPKACLAEMY-DNQSTTTTSIVDHGRSSSSYGAIRMEVDVKI  397

Query  416  VGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            +G +AMIRVQ  + NYPSA LM+ LR+L+L V HAS+SSV ++MLQD+VV++PEGL SE+
Sbjct  398  IGSEAMIRVQCPDLNYPSAILMDALRDLDLRVLHASVSSVKELMLQDVVVRIPEGLTSEE  457



>gb|KEH18599.1| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=454

 Score =   201 bits (511),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 149/212 (70%), Gaps = 19/212 (9%)
 Frame = -1

Query  815  ESEHSDSD-CQFLKEPPIVDR----QQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNH  651
            +SE SDS+ C  L       +    ++  PKKRGRKP  G  TP+NHVEAERQRREKLNH
Sbjct  234  DSEDSDSEYCPLLATKTTTAKNDSFEKREPKKRGRKPLTGTQTPMNHVEAERQRREKLNH  293

Query  650  RFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKK--VKVEAVGDN  477
            RFYALRSVVPNVS+MDKASLLSDAV YINELK K+E+L+   Q +ESKK  +K   + DN
Sbjct  294  RFYALRSVVPNVSKMDKASLLSDAVDYINELKAKIEDLKLG-QQKESKKAMMKTMKIVDN  352

Query  476  Qstssaa----------ssvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  327
             S ++ +          S     ++++VKI+G DAM+RVQS N N+PSA+LM+ L++LE 
Sbjct  353  NSATTTSIVVDQNKPSCSKNLIALEIDVKIIGHDAMVRVQSLNVNHPSARLMSVLKDLEY  412

Query  326  AVHHASISSVND-IMLQDIVVKVPEGLRSEDG  234
             VH ASIS+VN  +M+QD++VKVP  +R+E+ 
Sbjct  413  QVHQASISTVNKVVMVQDVIVKVPNEMRNEES  444



>gb|AEG74015.1| lMYC5 [Hevea brasiliensis]
Length=475

 Score =   201 bits (510),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 137/176 (78%), Gaps = 9/176 (5%)
 Frame = -1

Query  740  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  561
            KKRGRKP  G+  P+NHVEAERQRR++LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  289  KKRGRKPN-GKELPLNHVEAERQRRKRLNHRFYALRSVVPNVSKMDKASLLADAVTYIEE  347

Query  560  LKGKVEELECQLQ-LRESKKVKVEAVGDNQstss-------aassvaSPVDVEVKIVGPD  405
            LK KV+ELE +LQ + +  K+    + DNQST+        ++S     ++V+VKIVG +
Sbjct  348  LKAKVDELEAKLQAVSKQSKITSTIIYDNQSTNYMVNHLRPSSSYRDKAMEVDVKIVGSE  407

Query  404  AMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            AM+RV S + NYP+ +LM+ LRELE  VHHAS+SS+N+++LQD+VV VPEGL SE+
Sbjct  408  AMVRVHSPDVNYPAVRLMDALRELEFQVHHASVSSINEMVLQDVVVNVPEGLTSEE  463



>ref|XP_009775258.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=425

 Score =   198 bits (503),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 117/208 (56%), Positives = 151/208 (73%), Gaps = 18/208 (9%)
 Frame = -1

Query  824  SYPESEHSDSDCQFLKEPP----IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKL  657
            S+ +SE S+SDCQ L+ P     +  + +   +KRGRK G      +NHVEAERQRREKL
Sbjct  210  SFLDSELSNSDCQLLEYPVQKSRVGSKIRRTYRKRGRKHGVDCDKQMNHVEAERQRREKL  269

Query  656  NHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQ--LRESKKVKVEAVG  483
            NHRFY LRSVVP V+ +DKASLLSDAV+YINELK KV++LE +L   L   KK ++E   
Sbjct  270  NHRFYMLRSVVPQVTGIDKASLLSDAVAYINELKAKVDKLESKLHTNLELKKKPEMEHND  329

Query  482  --DNQstssaassvaSPVD-VEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  312
              DNQ       S  + VD VEVK++GPDAMIRVQSE+ NYPS +LM  L++LEL V+HA
Sbjct  330  DVDNQ-------SSTNSVDHVEVKMIGPDAMIRVQSEDVNYPSTRLMCALQDLELHVYHA  382

Query  311  SISSVNDIMLQDIVVK-VP-EGLRSEDG  234
            +ISSVN+I++QDIV++ VP +GL++EDG
Sbjct  383  NISSVNNIVVQDIVIRDVPNKGLKTEDG  410



>ref|XP_002518914.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF43447.1| DNA binding protein, putative [Ricinus communis]
Length=479

 Score =   198 bits (503),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 127/262 (48%), Positives = 166/262 (63%), Gaps = 34/262 (13%)
 Frame = -1

Query  992  ERTISFADIGLVSGHELLQQGRSAGADDLKVLQSRAAGDaekqaqeasaaaaaaKNSYPE  813
            +R+ S  DIG+ SG +      +    D+K   +   G                  S  +
Sbjct  229  DRSASVLDIGMFSGCQKQASPETHNEGDIKKDATNDLG-----------------RSSSD  271

Query  812  SEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  633
            S   DSD  F  E    DR     KKRGRKP  G+  P+NHVEAERQRRE+LN+RFYALR
Sbjct  272  SGPFDSDGNFAVES--TDR----IKKRGRKPVKGKELPLNHVEAERQRRERLNNRFYALR  325

Query  632  SVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEA--VGDNQsts--  465
            SVVPNVS+MDKASLL+DAV+YI ELK KV+EL+ Q+QL  SKK K+    V DN STS  
Sbjct  326  SVVPNVSKMDKASLLADAVTYIQELKAKVDELKTQVQL-VSKKSKISGNNVFDNNSTSSM  384

Query  464  ------saassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
                  +++   A  ++V+V+IVG +AMIRV+S + +YP+A+LMN +RELE  VHHASIS
Sbjct  385  IDRHLMTSSIYRAKEMEVDVRIVGSEAMIRVRSPDIDYPAARLMNAIRELEFQVHHASIS  444

Query  302  SVNDIMLQDIVVKVPEGLRSED  237
            S+ D++LQDIVV + +GL SE+
Sbjct  445  SIKDVVLQDIVVSIRDGLTSEE  466



>ref|XP_006362123.1| PREDICTED: transcription factor MYC4-like [Solanum tuberosum]
Length=402

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 135/183 (74%), Gaps = 10/183 (5%)
 Frame = -1

Query  764  VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLS  585
            V  +    KKRGRK      T  NHVEAERQRREKLN RFYALR VVPNV++MDKA+LLS
Sbjct  208  VGFKSKTSKKRGRKGREICETQGNHVEAERQRREKLNSRFYALREVVPNVTKMDKATLLS  267

Query  584  DAVSYINELKGKVEELECQL-------QLRESKKVKVEAVGDNQstssaassvaSPVDVE  426
            DAV+YI +LK KV+ELE +L       + ++  K++ + V DNQ   S+ +S    +++E
Sbjct  268  DAVTYITQLKAKVDELESKLHNNYYYSEHKKKHKMENDNVVDNQ---SSTTSWDHTMEIE  324

Query  425  VKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLR  246
            VK+VG DAMIRVQSEN NYPS +LM  L+E+EL V+HA+ISSVND+ML DI+VKVP+GL 
Sbjct  325  VKMVGQDAMIRVQSENVNYPSTRLMCALQEVELHVYHANISSVNDLMLHDILVKVPQGLE  384

Query  245  SED  237
            +ED
Sbjct  385  TED  387



>gb|ACF19982.1| MYC2 [Hevea brasiliensis]
Length=476

 Score =   197 bits (500),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 136/175 (78%), Gaps = 8/175 (5%)
 Frame = -1

Query  740  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  561
            KKRGR    G+   +NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  291  KKRGRTQLNGKELTLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVTYIKE  350

Query  560  LKGKVEELECQLQLRESKKVKVEAVGDNQst-------ssaassvaSPVDVEVKIVGPDA  402
            LK KV+ELE +LQ   SKK K+ +V DNQST        S+++  A  +++EVKIVG +A
Sbjct  351  LKAKVDELESKLQA-VSKKSKITSVTDNQSTDSMIDHIRSSSAYKAKAMELEVKIVGSEA  409

Query  401  MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            MIR  S + NYP+A+LM+ LRE+E  VHHAS+SS+ +++LQD+V +VP+GL +E+
Sbjct  410  MIRFLSPDVNYPAARLMDALREVEFKVHHASMSSIKEMVLQDVVARVPDGLTNEE  464



>ref|XP_011026782.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=471

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 139/181 (77%), Gaps = 15/181 (8%)
 Frame = -1

Query  740  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  561
            KKRGRKPG G+  P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DA +YI E
Sbjct  281  KKRGRKPG-GKELPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAATYIKE  339

Query  560  LKGKVEELECQLQLRESKKVKVEA---VGDNQstssaass----------vaSPVDVEVK  420
            LK KV ELE +L+   SKK K+     + DNQSTS++  +            + ++V+VK
Sbjct  340  LKSKVNELEGKLRA-VSKKSKISGNANIYDNQSTSTSTMTNHIRPTPNYMSNNAMEVDVK  398

Query  419  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSE  240
            I+G +A+IRVQS + NYP+A+LM+ LRELE +VHHAS+S V D++LQD+V+ +P+GL +E
Sbjct  399  ILGSEALIRVQSPDVNYPAARLMDALRELEFSVHHASVSKVKDLVLQDVVIIIPDGLVTE  458

Query  239  D  237
            +
Sbjct  459  E  459



>ref|XP_006361006.1| PREDICTED: transcription factor MYC4-like [Solanum tuberosum]
Length=407

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 134/183 (73%), Gaps = 10/183 (5%)
 Frame = -1

Query  764  VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLS  585
            V  +    KKRGRK      T  NHVEAERQRREKLN RFYALR VVPNV++MDKA+LLS
Sbjct  213  VGFKSKTSKKRGRKGREICETQGNHVEAERQRREKLNSRFYALREVVPNVTKMDKATLLS  272

Query  584  DAVSYINELKGKVEELECQLQ-------LRESKKVKVEAVGDNQstssaassvaSPVDVE  426
            DAV+YI +LK KV+ELE +L        + +  K++ + V DNQ   S+ +S    +++E
Sbjct  273  DAVTYITQLKAKVDELESKLHNNYYYSVMEKKHKMENDNVVDNQ---SSTTSWDHTMEIE  329

Query  425  VKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLR  246
            VK+VG DAM+RVQSEN NYPS +LM  L+E+EL V+HA+ISSVND+ML DI+VKVP+GL 
Sbjct  330  VKMVGQDAMLRVQSENMNYPSTRLMCALQEVELHVYHANISSVNDLMLHDILVKVPQGLE  389

Query  245  SED  237
            +ED
Sbjct  390  TED  392



>gb|KJB24138.1| hypothetical protein B456_004G129600 [Gossypium raimondii]
Length=463

 Score =   195 bits (496),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 135/177 (76%), Gaps = 10/177 (6%)
 Frame = -1

Query  740  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  561
            KKRGRK G G+ TP NHVEAER RREKLNHRFYALRSVVP VS+MDKASLLSDAV+YI E
Sbjct  277  KKRGRKSGTGKTTPSNHVEAERLRREKLNHRFYALRSVVPTVSKMDKASLLSDAVAYIKE  336

Query  560  LKGKVEELECQLQLRESKKVKVEA--VGDNQstssaassvaSPVD-------VEVKIVGP  408
            L+ ++++L+ +L++ +S+K K+ A  V +NQ  +S   S     D       V+VKI+G 
Sbjct  337  LRSQIDKLDVKLKV-QSQKAKLNAINVSNNQRNASTFDSTRPTYDYGPNTMEVDVKIIGS  395

Query  407  DAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            +AMIRVQ  + NYP+A+LM+ LR+LEL VHHAS+S+VN+++LQD+VV +P G  SE+
Sbjct  396  EAMIRVQCPDVNYPAARLMDALRDLELHVHHASVSTVNELVLQDVVVILPAGFISEE  452



>gb|AGO03813.1| JAMYC2 [Taxus cuspidata]
Length=304

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 106/220 (48%), Positives = 147/220 (67%), Gaps = 27/220 (12%)
 Frame = -1

Query  824  SYPESEHSDSDCQFLKE--PPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNH  651
            S  ESEHSD +    KE    +V+++   P+KRGRKP  GR  P+NHVEAERQRREKLN 
Sbjct  72   SGAESEHSDVEAASFKEMEEAVVEKK---PRKRGRKPANGREEPLNHVEAERQRREKLNQ  128

Query  650  RFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRES--KKVKVEAVGDN  477
            RFYALR+VVPNVS+MDKASLL DAVSYINEL+ KV+ELE + +  ES  +  K E +  +
Sbjct  129  RFYALRAVVPNVSKMDKASLLGDAVSYINELRSKVQELETERKELESHVEATKKELLSSH  188

Query  476  QstssaassvaSP--------------------VDVEVKIVGPDAMIRVQSENANYPSAK  357
               S A    A                      +D++V+++G +AM+R+QS   N+P+A+
Sbjct  189  SGFSGANFGFAKDLSSSSRVPDSKGFGTKQCPGLDLDVRVLGAEAMVRIQSGKKNHPAAR  248

Query  356  LMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            LM   +ELEL VHHAS+S+VN++MLQ+++V++P+ L +E+
Sbjct  249  LMTAFQELELEVHHASVSTVNELMLQNVIVRLPKSLYTEE  288



>ref|XP_006830285.1| PREDICTED: transcription factor MYC2 [Amborella trichopoda]
 gb|ERM97701.1| hypothetical protein AMTR_s00121p00026620 [Amborella trichopoda]
Length=459

 Score =   195 bits (495),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 126/168 (75%), Gaps = 4/168 (2%)
 Frame = -1

Query  743  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  564
            PKKRGRKPG GRV P+NHVEAERQRREKLN RFYALR+VVP+VS+MDKASLL+DAVSYIN
Sbjct  267  PKKRGRKPGNGRVVPLNHVEAERQRREKLNRRFYALRAVVPHVSKMDKASLLADAVSYIN  326

Query  563  ELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP----VDVEVKIVGPDAMI  396
            +LK KV+ LE  LQ   S +   +   D +     + S  +      ++EVKI+G DA+I
Sbjct  327  QLKAKVQHLESALQKLGSDEKTTQKDSDGKLMPDTSGSEGAEWNGIAELEVKIMGQDAII  386

Query  395  RVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEG  252
            RVQSE+  +P+AKLM  L EL L VHHAS+S+V  +M+QD+VV+VPEG
Sbjct  387  RVQSESTGHPAAKLMRALEELGLPVHHASVSNVKGLMVQDVVVRVPEG  434



>gb|AEG74013.1| lMYC3 [Hevea brasiliensis]
Length=475

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/175 (59%), Positives = 133/175 (76%), Gaps = 8/175 (5%)
 Frame = -1

Query  740  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  561
            KKR +K   G+  P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  285  KKRAKKLQNGKELPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVTYIKE  344

Query  560  LKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP-------VDVEVKIVGPDA  402
            LK KV+ELE +LQ   +KK K   V DNQST S    +  P       +++EVKIVG +A
Sbjct  345  LKAKVDELESKLQ-AVTKKSKNTNVTDNQSTDSLIDQIRDPSIYKTKAMELEVKIVGSEA  403

Query  401  MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            MIR  S + NYP+A+LM+ LRE+E  VHHAS+SS+ +++LQD+V +VP+GL +E+
Sbjct  404  MIRFLSPDINYPAARLMDVLREIEFKVHHASMSSIKEMVLQDVVARVPDGLTNEE  458



>gb|KDP25207.1| hypothetical protein JCGZ_20363 [Jatropha curcas]
Length=482

 Score =   193 bits (491),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 137/194 (71%), Gaps = 11/194 (6%)
 Frame = -1

Query  800  DSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVP  621
            DSD +F      VDR     KKRGRKP  G+  P+NHVEAERQRRE+LNHRFYALRSVVP
Sbjct  284  DSDGKF-APGSTVDRF----KKRGRKPINGKELPLNHVEAERQRRERLNHRFYALRSVVP  338

Query  620  NVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQst------ssa  459
            NVS+MDKASLL DAV+YI +LK KV ELE +LQ    K   V  +  N +          
Sbjct  339  NVSKMDKASLLEDAVTYIKDLKAKVNELETKLQAVRKKSKNVTNINANTNNYVVIGPEVM  398

Query  458  assvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  279
            + +    ++V+VKIVG +AMIRVQS + NYP+A+LM+ LRELE+ VHHAS+S + +++L 
Sbjct  399  SHNKVMTMEVDVKIVGSEAMIRVQSLDVNYPAARLMDALRELEIKVHHASVSRIKEMVLL  458

Query  278  DIVVKVPEGLRSED  237
            D+V+++P+GL +E+
Sbjct  459  DVVIRLPDGLTNEE  472



>ref|XP_012086610.1| PREDICTED: transcription factor MYC2-like [Jatropha curcas]
Length=486

 Score =   193 bits (491),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 104/194 (54%), Positives = 137/194 (71%), Gaps = 11/194 (6%)
 Frame = -1

Query  800  DSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVP  621
            DSD +F      VDR     KKRGRKP  G+  P+NHVEAERQRRE+LNHRFYALRSVVP
Sbjct  288  DSDGKF-APGSTVDRF----KKRGRKPINGKELPLNHVEAERQRRERLNHRFYALRSVVP  342

Query  620  NVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQst------ssa  459
            NVS+MDKASLL DAV+YI +LK KV ELE +LQ    K   V  +  N +          
Sbjct  343  NVSKMDKASLLEDAVTYIKDLKAKVNELETKLQAVRKKSKNVTNINANTNNYVVIGPEVM  402

Query  458  assvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQ  279
            + +    ++V+VKIVG +AMIRVQS + NYP+A+LM+ LRELE+ VHHAS+S + +++L 
Sbjct  403  SHNKVMTMEVDVKIVGSEAMIRVQSLDVNYPAARLMDALRELEIKVHHASVSRIKEMVLL  462

Query  278  DIVVKVPEGLRSED  237
            D+V+++P+GL +E+
Sbjct  463  DVVIRLPDGLTNEE  476



>ref|XP_006343781.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=388

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 132/201 (66%), Gaps = 36/201 (18%)
 Frame = -1

Query  827  NSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAG---RVTPVNHVEAERQRREKL  657
            N   +S +SD D     E   +++  N+PKKRGRK  +    R T  NHVEAERQRREKL
Sbjct  207  NKSSDSGNSDYD----NESSAINKDANSPKKRGRKSSSSTIERATAKNHVEAERQRREKL  262

Query  656  NHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN  477
            NHRFYALRSVVPNVS+MDKASLL+DAV+YINELK KVEE               +A G  
Sbjct  263  NHRFYALRSVVPNVSKMDKASLLADAVTYINELKAKVEEF--------------KAYG--  306

Query  476  QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  297
                         ++VEVKI+G +AMIRV+S N NYP A+LMN LRELE  +HHAS+SSV
Sbjct  307  -------------MEVEVKIIGVEAMIRVRSPNVNYPCARLMNVLRELEFQIHHASVSSV  353

Query  296  NDIMLQDIVVKVPEGLRSEDG  234
             ++M QD+V+K+P  + +++ 
Sbjct  354  KEMMQQDVVIKIPHNVTNDEA  374



>gb|ADK91082.1| LMYC2 [Hevea brasiliensis]
Length=475

 Score =   192 bits (489),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 136/175 (78%), Gaps = 8/175 (5%)
 Frame = -1

Query  740  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  561
            KKRGR    G+   +N+VEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  290  KKRGRAQLNGKELTLNYVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVTYIKE  349

Query  560  LKGKVEELECQLQLRESKKVKVEAVGDNQst-------ssaassvaSPVDVEVKIVGPDA  402
            LK KV+ELE +LQ   SKK K+ +V DNQST        S+++  A  +++EVKIVG +A
Sbjct  350  LKAKVDELESKLQAV-SKKSKITSVTDNQSTDSMIDHIRSSSAYKAKAMELEVKIVGSEA  408

Query  401  MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            MI+  S + NYP+A+LM+ LRE+E  VHHAS+SS+ +++LQD+V +VP+GL +E+
Sbjct  409  MIQFLSPDVNYPAARLMDALREVEFKVHHASMSSIKEVVLQDVVARVPDGLTNEE  463



>gb|AEG74014.1| lMYC4 [Hevea brasiliensis]
Length=470

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 133/175 (76%), Gaps = 8/175 (5%)
 Frame = -1

Query  740  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  561
            KK+GRK   G+  P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DAV+YI E
Sbjct  285  KKKGRKQLNGKELPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAVTYIEE  344

Query  560  LKGKVEELECQLQLRESKKVKVEAVGDNQstss-------aassvaSPVDVEVKIVGPDA  402
            LK KV+ELE +LQ   SKK K   V DNQST S       ++S     ++++VKIVG +A
Sbjct  345  LKAKVDELESKLQAV-SKKCKSINVTDNQSTDSMIDHTRCSSSYKVKSMELDVKIVGSEA  403

Query  401  MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            MIR  S + NYP A+LM  L+E+E  VHHAS+SS+ +++LQD+V +VP+GL +ED
Sbjct  404  MIRFLSPDVNYPGARLMEVLKEVEFKVHHASMSSIKEMVLQDVVARVPDGLTNED  458



>ref|XP_002299425.1| hypothetical protein POPTR_0001s11400g [Populus trichocarpa]
 gb|EEE84230.1| hypothetical protein POPTR_0001s11400g [Populus trichocarpa]
Length=471

 Score =   192 bits (487),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 139/181 (77%), Gaps = 15/181 (8%)
 Frame = -1

Query  740  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  561
            KKRGRKP +G+  P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MDKASLL+DA +YI E
Sbjct  281  KKRGRKP-SGKELPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDKASLLADAATYIKE  339

Query  560  LKGKVEELECQLQLRESKKVKVEA---VGDNQstssaass----------vaSPVDVEVK  420
            LK KV ELE +L+   SKK K+     + DNQSTS++  +            + ++V+VK
Sbjct  340  LKSKVNELEGKLRA-VSKKSKISGNANIYDNQSTSTSTMTNHIRPTPNYMSNNAMEVDVK  398

Query  419  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSE  240
            I+G +A+IRVQS + NYP+A+LM+ LRELE +VHHAS+S V +++LQD+V+ +P+GL +E
Sbjct  399  ILGSEALIRVQSPDVNYPAARLMDALRELEFSVHHASVSKVKELVLQDVVIIIPDGLVTE  458

Query  239  D  237
            +
Sbjct  459  E  459



>ref|XP_011022409.1| PREDICTED: transcription factor MYC2-like [Populus euphratica]
Length=463

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 138/180 (77%), Gaps = 13/180 (7%)
 Frame = -1

Query  740  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  561
            KKRGRKPG G+ +P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MD+ASLL+DAV+YI E
Sbjct  275  KKRGRKPG-GKESPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDRASLLADAVTYIKE  333

Query  560  LKGKVEELECQLQLRESKKVKVEA---VGDNQstssaassvaSP--------VDVEVKIV  414
            LK +V ELE  LQ+  SKK K+ +   + DNQSTS+  + +  P        V+V+VKI+
Sbjct  334  LKRRVNELEANLQV-VSKKSKISSCANIYDNQSTSTMVNHIRPPPNYMSNNAVEVDVKIL  392

Query  413  GPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  234
            G D +IRVQS + NYP+A+LM+ LRELE  +HH S++ V +++LQD V+++ +GL +E+ 
Sbjct  393  GSDGLIRVQSPDINYPAARLMDTLRELEFPIHHLSVTRVKELVLQDAVIRIDDGLVTEEA  452



>ref|XP_009418327.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=417

 Score =   189 bits (479),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 144/208 (69%), Gaps = 18/208 (9%)
 Frame = -1

Query  827  NSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAG-RVTPVNHVEAERQRREKLNH  651
            +S  +S HSDSD     E          PKKRGRK  +G R  P +HVEAERQRREKLNH
Sbjct  206  SSSVDSGHSDSDGGLTVE-------HRRPKKRGRKTVSGTREAPASHVEAERQRREKLNH  258

Query  650  RFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQs  471
            RFYALRSVVPNVSRMDKASLL+DAV+YI ELK KV++LE + +    K++ VE    + +
Sbjct  259  RFYALRSVVPNVSRMDKASLLADAVAYIQELKAKVDKLEAEGK-PAMKEITVEQTAGHSA  317

Query  470  ---------tssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  318
                     T+SA +   + ++VEVK++G +A+IRVQSE+  +PSA+LM  LR+LEL VH
Sbjct  318  DAGAATSSTTTSATTLTKAAMEVEVKLLGAEALIRVQSEDRGHPSARLMAALRDLELRVH  377

Query  317  HASISSVNDIMLQDIVVKVPEGLRSEDG  234
            HAS+SS+  ++LQD+V KVP  L+ EDG
Sbjct  378  HASVSSLEQVVLQDVVAKVPTELQREDG  405



>ref|XP_008780029.1| PREDICTED: transcription factor MYC4-like [Phoenix dactylifera]
Length=440

 Score =   189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 119/204 (58%), Positives = 150/204 (74%), Gaps = 19/204 (9%)
 Frame = -1

Query  827  NSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHR  648
            +S  +SEHSD +   + E       +  PKKRGRKPG GR TPVNHVEAERQRREKLNHR
Sbjct  235  SSSVDSEHSDLEGALMVE-------RRRPKKRGRKPGTGRETPVNHVEAERQRREKLNHR  287

Query  647  FYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN---  477
            FYALRSVVPNVSRMDKASLL+DAVSYI EL+ KVEELE      E K+VK E V D+   
Sbjct  288  FYALRSVVPNVSRMDKASLLADAVSYIKELRAKVEELEA-----EGKRVKKETVVDHGVS  342

Query  476  ----QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  309
                 ST++   S    +++EVK +GPDA+IRV SEN N+P+AKLM  LR+LE+ V+HAS
Sbjct  343  GAAATSTTTTELSGRVTMELEVKKLGPDALIRVHSENLNHPAAKLMGVLRDLEVHVNHAS  402

Query  308  ISSVNDIMLQDIVVKVPEGLRSED  237
            +S++ ++MLQD+VV+VP  L+++D
Sbjct  403  VSTLKEVMLQDVVVRVPYALQTDD  426



>ref|XP_007209110.1| hypothetical protein PRUPE_ppa005343mg [Prunus persica]
 gb|EMJ10309.1| hypothetical protein PRUPE_ppa005343mg [Prunus persica]
Length=466

 Score =   189 bits (480),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 104/196 (53%), Positives = 128/196 (65%), Gaps = 27/196 (14%)
 Frame = -1

Query  740  KKRGRKP--GAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYI  567
            KKRGR    G  R +P+NHVEAERQRREKLNHRFYALRSVVPNVS+MDKASLLSDAV YI
Sbjct  260  KKRGRSSNHGTDRESPINHVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLSDAVVYI  319

Query  566  NELKGKVEELECQLQ-------------LRESKKVKVEAVGDNQstssaassvaSP----  438
            N+LK KVEELE ++Q             L         ++ D+        +   P    
Sbjct  320  NKLKAKVEELEAKIQQPPQKPKLGILSNLEHQSNQSASSIVDHHRHHHHHQARPRPASSY  379

Query  437  --------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIML  282
                    ++V+VKIVG +AMIRVQS + NYP A+LMN L++LEL V+HASISSV ++ML
Sbjct  380  TNSEVAGAIEVDVKIVGSEAMIRVQSPDQNYPYARLMNALKDLELQVYHASISSVKEMML  439

Query  281  QDIVVKVPEGLRSEDG  234
            QD+V +VP G  SE+ 
Sbjct  440  QDVVARVPHGFTSEEA  455



>ref|XP_002303693.2| hypothetical protein POPTR_0003s14710g [Populus trichocarpa]
 gb|EEE78672.2| hypothetical protein POPTR_0003s14710g [Populus trichocarpa]
Length=465

 Score =   188 bits (478),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/182 (56%), Positives = 137/182 (75%), Gaps = 15/182 (8%)
 Frame = -1

Query  740  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  561
            KKRGRKPG G+ +P+NHVEAERQRRE+LNHRFYALRSVVPNVS+MD+ASLL+DAV+YI E
Sbjct  275  KKRGRKPG-GKESPLNHVEAERQRRERLNHRFYALRSVVPNVSKMDRASLLADAVNYIKE  333

Query  560  LKGKVEELECQLQLRESKKVKVEA---VGDNQstssaas----------svaSPVDVEVK  420
            LK KV ELE  LQ+  SKK K+ +   + DNQSTS++               + V+V+VK
Sbjct  334  LKRKVNELEANLQV-VSKKSKISSCANIYDNQSTSTSTMVNHIRPPPNYMSNNAVEVDVK  392

Query  419  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSE  240
            I+G + +IRVQS + NYP+A+LM+ LRELE  VHH S++ V +++LQD+V++  +GL +E
Sbjct  393  ILGSEGLIRVQSPDINYPAARLMDALRELEFPVHHLSVTRVKELVLQDVVIRFDDGLVTE  452

Query  239  DG  234
            + 
Sbjct  453  EA  454



>ref|XP_009151447.1| PREDICTED: transcription factor MYC2 [Brassica rapa]
Length=605

 Score =   191 bits (485),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 137/199 (69%), Gaps = 16/199 (8%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            ES+HSD +   +KE P     +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  398  ESDHSDLEASVVKEIP-----EKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  452

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESK----KVKVEAVG  483
            R+VVPNVS+MDKASLL DA++YINELK KV     E+ + + QL E K      K  A G
Sbjct  453  RAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEKTQIKTQLEEVKMELAGRKASAGG  512

Query  482  DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
            D  S+ S  +     +++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS+S
Sbjct  513  DLSSSCSMTAIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHASMS  572

Query  302  SVNDIMLQDIVVKVPEGLR  246
             VND+M+Q   VK+  G R
Sbjct  573  VVNDLMIQQATVKM--GFR  589



>ref|XP_010531704.1| PREDICTED: transcription factor MYC2-like [Tarenaya hassleriana]
Length=615

 Score =   191 bits (485),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 141/198 (71%), Gaps = 15/198 (8%)
 Frame = -1

Query  812  SEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  633
            S+HSD +   +KE     R    P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR
Sbjct  409  SDHSDLEASVVKEAAPEKR----PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALR  464

Query  632  SVVPNVSRMDKASLLSDAVSYINELKGKVE-------ELECQLQLRESKKVKVEAVGDNQ  474
            +VVPNVS+MDKASLL DA+SYINELK K++       ++ECQL+  +S+     A   N+
Sbjct  465  AVVPNVSKMDKASLLGDAISYINELKSKLQRTESEKTQIECQLENLKSELAGRNANAGNR  524

Query  473  stssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISS  300
                ++S+V+ P+  ++EVKI+G DAMIR++S   N+P+A+LM+ L++LEL V+HAS+S 
Sbjct  525  DCGDSSSAVSKPIGMEIEVKIIGWDAMIRIESSKRNHPAARLMSALKDLELEVNHASMSV  584

Query  299  VNDIMLQDIVVKVPEGLR  246
            VND+M+Q   VK+  G R
Sbjct  585  VNDLMIQQATVKM--GFR  600



>gb|ABS11038.1| MYC [Brassica oleracea var. gemmifera]
Length=610

 Score =   191 bits (484),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 137/199 (69%), Gaps = 16/199 (8%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            ES+HSD +   +KE P     +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  403  ESDHSDLEASVVKEIP-----EKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  457

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESK----KVKVEAVG  483
            R+VVPNVS+MDKASLL DA++YINELK KV     E+ + + QL E K      K  A G
Sbjct  458  RAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEKTQIKTQLEEVKMELAGRKASAGG  517

Query  482  DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
            D  S+ S  +     +++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS+S
Sbjct  518  DLSSSCSLTAIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHASMS  577

Query  302  SVNDIMLQDIVVKVPEGLR  246
             VND+M+Q   VK+  G R
Sbjct  578  VVNDLMIQQATVKM--GFR  594



>ref|XP_004246085.1| PREDICTED: transcription factor bHLH14-like [Solanum lycopersicum]
Length=387

 Score =   186 bits (472),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 98/180 (54%), Positives = 131/180 (73%), Gaps = 11/180 (6%)
 Frame = -1

Query  752  QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  573
            +++PKKR RK    +    NHVEAERQRREKLNHRFYALRSVVPNVS+MDKASLL+DAV+
Sbjct  200  KDSPKKRARKSTTAK----NHVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLADAVT  255

Query  572  YINELKGKVEELECQLQLRESKKVK------VEAVGD-NQstssaassvaSPVDVEVKIV  414
            YINELK KVEEL+ ++++   K ++        AV D      +  SS    ++VEVKI+
Sbjct  256  YINELKAKVEELKAKIEVSTKKLIQKRNCVSSSAVVDGTNINININSSFVDGMEVEVKII  315

Query  413  GPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  234
            G +AMIRV+S N NYP A+LMN LRELE  +HHA++SS+ ++M QD+V++VP  + +E+ 
Sbjct  316  GVEAMIRVRSPNVNYPCARLMNVLRELEFQIHHATVSSMKEMMQQDVVIRVPHNVTNEEA  375



>ref|XP_008245836.1| PREDICTED: transcription factor bHLH14-like isoform X2 [Prunus 
mume]
Length=492

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/196 (53%), Positives = 131/196 (67%), Gaps = 27/196 (14%)
 Frame = -1

Query  740  KKRGRKP--GAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYI  567
            KKRGR    G  R +P+NHVEAERQRREKLNHRFYALRSVVPNVS+MDKASLLSDAV YI
Sbjct  286  KKRGRSSNHGTDRESPINHVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLSDAVVYI  345

Query  566  NELKGKVEELECQLQLRESKKVKV-------------EAVGDNQstssaassvaSP----  438
            N+LK +VEELE ++Q  +  K+ +              ++ D+        +   P    
Sbjct  346  NKLKARVEELEAKIQQPQKPKLGILSNLEHHQSNQSASSIVDHHRHHHHHQARPRPASSY  405

Query  437  --------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIML  282
                    ++V+VKIVG +AMIRVQS + NYP A+LMN L++LEL V+HASISSV ++ML
Sbjct  406  TNCEVAGAIEVDVKIVGSEAMIRVQSPDQNYPYARLMNALKDLELQVYHASISSVKEMML  465

Query  281  QDIVVKVPEGLRSEDG  234
            QD+V +VP G  SE+ 
Sbjct  466  QDVVARVPHGFTSEEA  481



>gb|ADK56287.1| LMYC1 [Hevea brasiliensis]
Length=476

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 102/175 (58%), Positives = 132/175 (75%), Gaps = 8/175 (5%)
 Frame = -1

Query  740  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  561
            KKRGRK   G   P+NHVEAERQRRE+LNHRFYALRS VPNVS+MDKASLL+DAV+YI E
Sbjct  291  KKRGRKQLNGEELPINHVEAERQRRERLNHRFYALRSAVPNVSKMDKASLLADAVTYIKE  350

Query  560  LKGKVEELECQLQLRESKKVKVEAVGDNQst-------ssaassvaSPVDVEVKIVGPDA  402
            LK  V+EL+ +L+   SKK K   V DNQST        S++S  A  ++++V IVG +A
Sbjct  351  LKATVDELQSKLEAV-SKKSKSTNVTDNQSTDSMIDHMRSSSSYKAKGMELDVTIVGSEA  409

Query  401  MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            MIR  S + NYP+A+LM+ LRE+E  VHHAS+SS+ +++LQD+VV+VP+GL  E+
Sbjct  410  MIRFLSPDVNYPAARLMDVLREVEFKVHHASMSSIKEMVLQDVVVRVPDGLTDEE  464



>ref|XP_008374122.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=467

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/183 (57%), Positives = 133/183 (73%), Gaps = 16/183 (9%)
 Frame = -1

Query  740  KKRGRKPGA--GRV-TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  570
            KKRGR   +  GR  TP+NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAV+Y
Sbjct  274  KKRGRSSNSETGRSETPINHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVAY  333

Query  569  INELKGKVEELECQLQLRESKKVKVEAVGDN------------QstssaassvaSPVDVE  426
            INELK +V +LE ++Q +  K V V+  G              + +SS  +  A  + ++
Sbjct  334  INELKARVVQLEAKIQAQPGKPV-VDIGGQTTCSIVDHHQTRPRQSSSYNNRAAGAMKID  392

Query  425  VKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLR  246
            VKIVG +AMIRVQ  + +YP+A+LMN L+ LEL V+HASISSV ++MLQD+V +VP+G  
Sbjct  393  VKIVGSEAMIRVQCPDCDYPNARLMNALKSLELQVYHASISSVKELMLQDVVARVPQGFT  452

Query  245  SED  237
            SE+
Sbjct  453  SEE  455



>ref|XP_010556617.1| PREDICTED: transcription factor bHLH14 [Tarenaya hassleriana]
Length=439

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 111/195 (57%), Positives = 135/195 (69%), Gaps = 14/195 (7%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +SE+SD D  F         Q N   KR +K G     PVNHVEAERQRR KLNHRFYAL
Sbjct  245  DSEYSDFDGIF---------QGN---KRRKKLGTPAAVPVNHVEAERQRRVKLNHRFYAL  292

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaa  456
            R+VVPNVSRMDKASLLSDAVSYINELK ++EELE QLQ +           +NQS ++++
Sbjct  293  RAVVPNVSRMDKASLLSDAVSYINELKARIEELETQLQTQTQSPSCSNNNNNNQSNTTSS  352

Query  455  ssvaS--PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIML  282
             +       +V+VK+VG +A++RVQSEN N+P+A LM  LRE+E  V HAS S VND+M+
Sbjct  353  EAGGVIPGAEVQVKMVGDEAVVRVQSENVNHPTAALMGALREMECRVIHASASRVNDLMV  412

Query  281  QDIVVKVPEGLRSED  237
            QD VV VP GLRSED
Sbjct  413  QDAVVWVPIGLRSED  427



>ref|XP_011082365.1| PREDICTED: transcription factor MYC4-like [Sesamum indicum]
Length=670

 Score =   190 bits (483),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 109/205 (53%), Positives = 140/205 (68%), Gaps = 13/205 (6%)
 Frame = -1

Query  815  ESEHSDSDCQFLKE---PPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            ES+HSD +   +KE     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  453  ESDHSDLEASVVKEVESSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  511

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQL--RESKKVKVE  492
            YALR+VVPNVS+MDKASLL DA++YINELK KV       EEL  QL+L  +E     + 
Sbjct  512  YALRAVVPNVSKMDKASLLGDAIAYINELKSKVQSVESDKEELRSQLELVKKELGTKDMR  571

Query  491  AVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  312
            +        + +S+V   +D++VKI+G DAMIRVQ    N+P+AKLM  LREL+L VHHA
Sbjct  572  SAPPPAHDLNMSSNVKVDMDIDVKIIGWDAMIRVQCSKKNHPAAKLMLALRELDLDVHHA  631

Query  311  SISSVNDIMLQDIVVKVPEGLRSED  237
            S+S VND+M+Q   VK+     S+D
Sbjct  632  SVSVVNDLMIQQATVKMEGRFYSQD  656



>ref|XP_010100202.1| hypothetical protein L484_015347 [Morus notabilis]
 gb|EXB81873.1| hypothetical protein L484_015347 [Morus notabilis]
Length=506

 Score =   187 bits (476),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 103/188 (55%), Positives = 129/188 (69%), Gaps = 16/188 (9%)
 Frame = -1

Query  749  NAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  570
            N  KKRGRKP  G   PVNHVEAERQRREKLNHRFYALRSVVPNVS+MDKASLL+DAV Y
Sbjct  308  NRIKKRGRKPVIGNSLPVNHVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLADAVVY  367

Query  569  INELKGKVEELECQLQLRESKK-VKVEAVGDNQstssaassvaSPV--------------  435
            INELK K+ ELE Q+ L +S + +K+     N +    + S  + V              
Sbjct  368  INELKSKINELETQVHLSQSNRPLKMGITMCNSTPKFESQSTYNIVEHKRKYSSYGSVGA  427

Query  434  -DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVP  258
             +V+VKIVG +AMIRVQ  + NYP A+LMN LR+LE  + H S+SSV +++LQD+VV+VP
Sbjct  428  MEVDVKIVGTEAMIRVQCPDVNYPPARLMNALRDLEFQILHVSVSSVKELVLQDVVVRVP  487

Query  257  EGLRSEDG  234
            +   SE+ 
Sbjct  488  DRFPSEEA  495



>ref|XP_010691764.1| PREDICTED: transcription factor MYC2-like [Beta vulgaris subsp. 
vulgaris]
Length=457

 Score =   186 bits (473),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 130/178 (73%), Gaps = 7/178 (4%)
 Frame = -1

Query  755  QQNAPKKRGRKPGA---GRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLS  585
            +Q   +KRGR+P     G+V  +NHVEAERQRREK+N RFYALRSVVP V+RMDKASLL+
Sbjct  266  RQRVVRKRGRRPITSREGQVVTMNHVEAERQRREKMNSRFYALRSVVPTVTRMDKASLLA  325

Query  584  DAVSYINELKGKVEELECQLQLRESKKVKVEAVG---DNQstssaassvaSPVDVEVKIV  414
            DAV+YIN+LK K+  LE Q Q+  + +  + +      N +  +   +   P+DVEV+++
Sbjct  326  DAVAYINDLKNKISSLELQFQVTNNDRNTLMSSSSGISNTNIHNNVVNSRIPLDVEVRVL  385

Query  413  GPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVV-KVPEGLRS  243
            G +AMIRVQSEN N+PSA+LMN  ++L L VHHAS+S+V  +MLQD+V+ KVP+ LRS
Sbjct  386  GNEAMIRVQSENVNHPSARLMNVFKQLNLQVHHASVSTVEQMMLQDVVIAKVPQELRS  443



>ref|XP_008245834.1| PREDICTED: transcription factor bHLH14-like isoform X1 [Prunus 
mume]
Length=493

 Score =   187 bits (474),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 103/197 (52%), Positives = 129/197 (65%), Gaps = 28/197 (14%)
 Frame = -1

Query  740  KKRGRKP--GAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYI  567
            KKRGR    G  R +P+NHVEAERQRREKLNHRFYALRSVVPNVS+MDKASLLSDAV YI
Sbjct  286  KKRGRSSNHGTDRESPINHVEAERQRREKLNHRFYALRSVVPNVSKMDKASLLSDAVVYI  345

Query  566  NELKGKVEELECQLQLRESK--------------KVKVEAVGDNQstssaassvaSP---  438
            N+LK +VEELE ++Q +  K                   ++ D+        +   P   
Sbjct  346  NKLKARVEELEAKIQQQPQKPKLGILSNLEHHQSNQSASSIVDHHRHHHHHQARPRPASS  405

Query  437  ---------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIM  285
                     ++V+VKIVG +AMIRVQS + NYP A+LMN L++LEL V+HASISSV ++M
Sbjct  406  YTNCEVAGAIEVDVKIVGSEAMIRVQSPDQNYPYARLMNALKDLELQVYHASISSVKEMM  465

Query  284  LQDIVVKVPEGLRSEDG  234
            LQD+V +VP G  SE+ 
Sbjct  466  LQDVVARVPHGFTSEEA  482



>ref|XP_002893732.1| ATMYC2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69991.1| ATMYC2 [Arabidopsis lyrata subsp. lyrata]
Length=625

 Score =   188 bits (478),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 139/201 (69%), Gaps = 20/201 (10%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            ES+HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  418  ESDHSDLEASVVKEVAVEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  473

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVGDNQs  471
            R+VVPNVS+MDKASLL DA+SYINELK KV     E+++ + QL E   VK+E  G   S
Sbjct  474  RAVVPNVSKMDKASLLGDAISYINELKSKVVKTESEKIQIKNQLEE---VKLELAGRKAS  530

Query  470  tssaassva----SPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  309
             S    S +     PV  ++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS
Sbjct  531  ASGGDMSSSCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHAS  590

Query  308  ISSVNDIMLQDIVVKVPEGLR  246
            +S VND+M+Q   VK+  G R
Sbjct  591  MSVVNDLMIQQATVKM--GFR  609



>gb|KJB21076.1| hypothetical protein B456_003G182100 [Gossypium raimondii]
Length=549

 Score =   187 bits (474),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 101/195 (52%), Positives = 130/195 (67%), Gaps = 17/195 (9%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEP-----PIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNH  651
            +S+HSD +   +KE       I    +  P+KRGRKP  GR  P+NHVEAERQRREKLN 
Sbjct  340  DSDHSDLEVSVIKEADSARVTITAEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQ  399

Query  650  RFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEEL-----ECQLQLRESKKVKVEAV  486
            RFYALR+VVPNVS+MDKASLL DA+SYINELK K++       E   QL E+KK      
Sbjct  400  RFYALRAVVPNVSKMDKASLLGDAISYINELKIKLQNADSKKEELHKQLEETKK------  453

Query  485  GDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  306
             + Q      S     +D++VK +G DAMIR+QS   N+P+A+LM  L+EL+L VHHAS+
Sbjct  454  -EGQRGGLTTSHKLLELDIDVKTIGLDAMIRIQSNKKNHPAARLMAALQELDLDVHHASV  512

Query  305  SSVNDIMLQDIVVKV  261
            S VND+M+Q + VK+
Sbjct  513  SVVNDLMIQQVNVKM  527



>ref|NP_174541.1| transcription factor MYC2 [Arabidopsis thaliana]
 sp|Q39204.2|MYC2_ARATH RecName: Full=Transcription factor MYC2; Short=AtMYC2; AltName: 
Full=Basic helix-loop-helix protein 6; Short=AtbHLH6; Short=bHLH 
6; AltName: Full=Protein JASMONATE INSENSITIVE 1; AltName: 
Full=R-homologous Arabidopsis protein 1; Short=RAP-1; 
AltName: Full=Transcription factor EN 38; AltName: Full=Z-box 
binding factor 1 protein; AltName: Full=bHLH transcription 
factor bHLH006; AltName: Full=rd22BP1 [Arabidopsis thaliana]
 gb|AAF25980.1|AC017118_17 F6N18.4 [Arabidopsis thaliana]
 gb|AAK59788.1| At1g32640/F6N18_4 [Arabidopsis thaliana]
 gb|AAO23607.1| At1g32640/F6N18_4 [Arabidopsis thaliana]
 emb|CAH58735.1| Z-box binding factor 1 protein [Arabidopsis thaliana]
 emb|CAA67885.2| bHLH protein [Arabidopsis thaliana]
 gb|AEE31513.1| transcription factor MYC2 [Arabidopsis thaliana]
Length=623

 Score =   188 bits (477),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 139/201 (69%), Gaps = 20/201 (10%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            ES+HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  416  ESDHSDLEASVVKEVAVEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  471

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVGDNQs  471
            R+VVPNVS+MDKASLL DA++YINELK KV     E+L+ + QL E   VK+E  G   S
Sbjct  472  RAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEE---VKLELAGRKAS  528

Query  470  tssaassva----SPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  309
             S    S +     PV  ++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS
Sbjct  529  ASGGDMSSSCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHAS  588

Query  308  ISSVNDIMLQDIVVKVPEGLR  246
            +S VND+M+Q   VK+  G R
Sbjct  589  MSVVNDLMIQQATVKM--GFR  607



>gb|AAL55713.1|AF251691_1 putative transcription factor BHLH6 [Arabidopsis thaliana]
Length=623

 Score =   187 bits (476),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 139/201 (69%), Gaps = 20/201 (10%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            ES+HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  416  ESDHSDLEASVVKEVAVEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  471

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVGDNQs  471
            R+VVPNVS+MDKASLL DA++YINELK KV     E+L+ + QL E   VK+E  G   S
Sbjct  472  RAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEE---VKLELAGRRAS  528

Query  470  tssaassva----SPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  309
             S    S +     PV  ++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS
Sbjct  529  ASGGDMSSSCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHAS  588

Query  308  ISSVNDIMLQDIVVKVPEGLR  246
            +S VND+M+Q   VK+  G R
Sbjct  589  MSVVNDLMIQQATVKM--GFR  607



>ref|XP_006415166.1| hypothetical protein EUTSA_v10007075mg [Eutrema salsugineum]
 gb|ESQ33519.1| hypothetical protein EUTSA_v10007075mg [Eutrema salsugineum]
Length=624

 Score =   187 bits (476),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 136/203 (67%), Gaps = 23/203 (11%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            ES+HSD +   +KE P     +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  416  ESDHSDLEASVVKEVP-----EKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  470

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVGDNQs  471
            R+VVPNVS+MDKASLL DA++YINELK KV     E+ + + QL E   VK E  G   S
Sbjct  471  RAVVPNVSKMDKASLLGDAIAYINELKSKVTKTESEKTQIKTQLEE---VKHELAGRKAS  527

Query  470  tssaassvaSP--------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  315
                  + +SP        +++EVKI+G DAMIRV+S   N+P+A+LM  L +LEL V+H
Sbjct  528  AGGGDLASSSPMMGIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMTALMDLELEVNH  587

Query  314  ASISSVNDIMLQDIVVKVPEGLR  246
            AS+S VND+M+Q   VK+  G R
Sbjct  588  ASMSVVNDLMIQQATVKM--GFR  608



>ref|XP_004248095.1| PREDICTED: transcription factor MYC2-like [Solanum lycopersicum]
Length=393

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/182 (58%), Positives = 128/182 (70%), Gaps = 17/182 (9%)
 Frame = -1

Query  746  APKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYI  567
              KKR R+      T  NHVEAERQRREKLN RFYALR VVPNV++MDKA+LLSDAV+YI
Sbjct  201  TSKKRRREICE---TQGNHVEAERQRREKLNSRFYALREVVPNVTKMDKATLLSDAVTYI  257

Query  566  NELKGKVEELECQLQLRESK--------KVKVEA----VGDNQstssaassvaSPVDVEV  423
             +LK KV+ELE +L              K K+E     V DNQS+ + +      +++EV
Sbjct  258  TQLKAKVDELESKLHSNNYHYYYPEMKIKHKMENHDINVVDNQSSITTSRDH--TMEIEV  315

Query  422  KIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRS  243
            K+VG DAMIRVQSEN NYPS +LM  L+E+EL V+HA+ISSVND ML DIVVKVP+GL +
Sbjct  316  KMVGQDAMIRVQSENVNYPSTRLMCALQEVELHVYHANISSVNDFMLHDIVVKVPQGLET  375

Query  242  ED  237
            ED
Sbjct  376  ED  377



>ref|XP_009360191.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=476

 Score =   184 bits (468),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 102/185 (55%), Positives = 129/185 (70%), Gaps = 18/185 (10%)
 Frame = -1

Query  740  KKRGRKPG--AGRV-TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  570
            KKRGR      GR  TP+NHVEAERQRREKLN RFYALR+VVPNVSRMDKASLLSDAV Y
Sbjct  283  KKRGRSSNRETGRSETPINHVEAERQRREKLNRRFYALRAVVPNVSRMDKASLLSDAVVY  342

Query  569  INELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP-------------VDV  429
            INELK +VE+LE ++Q +  K V    +G   ++S        P             +++
Sbjct  343  INELKARVEQLEAKIQAQHLKPVV--DIGGQTTSSIIDHHQTRPRLSSSYDNKAAGVMEI  400

Query  428  EVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGL  249
            +VKIVG +AMIRVQ  + +YP+A+LMN L++LEL V+HASISSV  +MLQD+V +VP+G 
Sbjct  401  DVKIVGSEAMIRVQCPDCDYPNARLMNALKDLELQVYHASISSVKGLMLQDVVARVPQGF  460

Query  248  RSEDG  234
             SE+ 
Sbjct  461  TSEEA  465



>dbj|BAA25078.1| RD22BP1 [Arabidopsis thaliana]
Length=623

 Score =   187 bits (474),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 111/201 (55%), Positives = 139/201 (69%), Gaps = 20/201 (10%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            ES+HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  416  ESDHSDLEASVVKEVAVEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  471

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVGDNQs  471
            R+VVPNVS+MDKASLL DA++YINELK KV     E+L+ + QL E   VK+E  G   S
Sbjct  472  RAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEE---VKLELAGRKAS  528

Query  470  tssaassva----SPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  309
             S    S +     PV  ++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS
Sbjct  529  PSGGDMSSSCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHAS  588

Query  308  ISSVNDIMLQDIVVKVPEGLR  246
            +S VND+M+Q   VK+  G R
Sbjct  589  MSVVNDLMIQQATVKM--GFR  607



>ref|XP_010478689.1| PREDICTED: LOW QUALITY PROTEIN: transcription factor MYC2-like 
[Camelina sativa]
Length=626

 Score =   186 bits (473),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 139/202 (69%), Gaps = 21/202 (10%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            ES+HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  418  ESDHSDLEASVVKEVAVEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  473

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVGDNQs  471
            R+VVPNVS+MDKASLL DA++YINELK KV     E+L+ + QL E   VK+E  G   S
Sbjct  474  RAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEE---VKLELAGRKAS  530

Query  470  t-----ssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  312
                  SS+  S   PV  ++EVKI+G DAMIRV+S   N+P+A+LM  L +LEL V+HA
Sbjct  531  AGCGDMSSSTCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMAALMDLELEVNHA  590

Query  311  SISSVNDIMLQDIVVKVPEGLR  246
            S+S VND+M+Q   VK+  G R
Sbjct  591  SMSVVNDLMIQQATVKM--GFR  610



>ref|XP_009590627.1| PREDICTED: transcription factor bHLH14-like [Nicotiana tomentosiformis]
Length=425

 Score =   182 bits (463),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 102/186 (55%), Positives = 133/186 (72%), Gaps = 6/186 (3%)
 Frame = -1

Query  776  EPPIVDRQQNAPKKRGRKPGAGRVTPV----NHVEAERQRREKLNHRFYALRSVVPNVSR  609
            E   ++   N P KR RK G+ R T      NHVEAERQRREKLN+RFYALRSVVPNVS+
Sbjct  226  ESSTINNIINRPIKRERKAGSSRTTGTEMAKNHVEAERQRREKLNNRFYALRSVVPNVSK  285

Query  608  MDKASLLSDAVSYINELKGKVEELECQLQLRESKK--VKVEAVGDNQstssaassvaSPV  435
            MD+ASLL+DAV+YINELK KVEELE    L +  K      +V    ST    ++ +  +
Sbjct  286  MDRASLLADAVTYINELKAKVEELESYKILSQKPKGQCATTSVQSVPSTVVNRANNSFEM  345

Query  434  DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPE  255
            +VEVKI+G +AM+RV+S + NYP A+LMN LRELEL V+HAS+SSV ++MLQD+V++VP 
Sbjct  346  EVEVKIIGLEAMVRVRSPDMNYPCARLMNVLRELELQVNHASVSSVKNLMLQDVVLRVPN  405

Query  254  GLRSED  237
             + +E+
Sbjct  406  EVANEE  411



>emb|CDX84081.1| BnaC08g07580D [Brassica napus]
Length=529

 Score =   184 bits (468),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 143/204 (70%), Gaps = 16/204 (8%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            ES+HSD +   +KE P     +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  320  ESDHSDLEAFIVKEIP-----EKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  374

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESK----KVKVEAVG  483
            R+VVPNVS+MDKASLL DA++YINELK KV     E++  + QL E K      K    G
Sbjct  375  RAVVPNVSKMDKASLLGDAIAYINELKLKVNKTESEKIHIKNQLEEVKIELAGRKSSTCG  434

Query  482  DNQstssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  309
            D  S+SS+A+++  PV  ++EVK++G DAMIRV+S   N+P+A+LM+ L +LEL V HAS
Sbjct  435  DLSSSSSSATAMIKPVGMEIEVKVIGWDAMIRVESSKRNHPAARLMSALMDLELEVSHAS  494

Query  308  ISSVNDIMLQDIVVKVPEGLRSED  237
            +S VND+M+Q   VK+   + ++D
Sbjct  495  MSVVNDLMIQQATVKMGFRIYTQD  518



>ref|XP_010461111.1| PREDICTED: transcription factor MYC2-like [Camelina sativa]
Length=623

 Score =   186 bits (471),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 112/202 (55%), Positives = 139/202 (69%), Gaps = 21/202 (10%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            ES+HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  415  ESDHSDLEASVVKEVAMEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  470

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVGDNQs  471
            R+VVPNVS+MDKASLL DA++YINELK KV     E+L+ + QL E   VK+E  G   S
Sbjct  471  RAVVPNVSKMDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEE---VKLELAGRKAS  527

Query  470  t-----ssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  312
                  SS+  S   PV  ++EVKI+G DAMIRV+S   N+P+A+LM  L +LEL V+HA
Sbjct  528  AGCGDVSSSTCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMAALMDLELEVNHA  587

Query  311  SISSVNDIMLQDIVVKVPEGLR  246
            S+S VND+M+Q   VK+  G R
Sbjct  588  SMSVVNDLMIQQATVKM--GFR  607



>ref|XP_008346662.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=475

 Score =   183 bits (465),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/184 (57%), Positives = 131/184 (71%), Gaps = 16/184 (9%)
 Frame = -1

Query  740  KKRGRKPG--AGRV-TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  570
            KKRGR      GR  TP+NHVEAERQRREKLN RFYALR+VVPNVSRMDKASLLSDAV Y
Sbjct  282  KKRGRSSNREXGRSETPINHVEAERQRREKLNRRFYALRAVVPNVSRMDKASLLSDAVVY  341

Query  569  INELKGKVEELECQLQLRESKKVKVEAVGDN------------QstssaassvaSPVDVE  426
            INELK +VE+LE ++Q +  K V V+  G              + +SS  +  A  +++E
Sbjct  342  INELKARVEQLEAKIQAQHLKPV-VDIGGQTTSSIIDPHQTRPRLSSSYNNRAAGAMEIE  400

Query  425  VKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLR  246
             KIVG +AMIRVQ  + +YP+A+LMN L++LEL V+HASISSV  +MLQD+V +VP+G  
Sbjct  401  XKIVGSEAMIRVQCPDCDYPNARLMNALKDLELQVYHASISSVKGLMLQDVVARVPQGFT  460

Query  245  SEDG  234
            SE+ 
Sbjct  461  SEEA  464



>ref|XP_010538366.1| PREDICTED: transcription factor MYC2-like [Tarenaya hassleriana]
Length=613

 Score =   185 bits (470),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 142/208 (68%), Gaps = 24/208 (12%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +   +KE     R    P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  404  DSDHSDLEASVVKEAVPEKR----PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  459

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVE-------ELECQLQLRESKKVKVEAVGDN  477
            R+VVPNVS+MDKASLL DA++YINELK K++       ++ECQ++      +K E  G N
Sbjct  460  RAVVPNVSKMDKASLLGDAIAYINELKSKLQKVESEKTQVECQVE-----SLKGELAGQN  514

Query  476  Qst--------ssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  321
             +         S ++ S  + V++EVKI+G DAMIR++S   NYP+A+LM+ LR+LEL V
Sbjct  515  ANAGVVGDVGDSYSSVSKRTGVEIEVKIIGWDAMIRIESSKRNYPAARLMSALRDLELEV  574

Query  320  HHASISSVNDIMLQDIVVKVPEGLRSED  237
            +HAS+S VND+M+Q   VK+   + ++D
Sbjct  575  NHASMSVVNDLMVQQATVKMGFRIYTQD  602



>ref|XP_008374121.1| PREDICTED: transcription factor MYC3-like [Malus domestica]
Length=500

 Score =   183 bits (465),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 133/183 (73%), Gaps = 15/183 (8%)
 Frame = -1

Query  740  KKRGRKPG--AGRV-TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  570
            KKRGR      GR  +P+NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAV Y
Sbjct  308  KKRGRSSNRETGRTESPINHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVVY  367

Query  569  INELKGKVEELECQLQLRESKKVKVEAVGDN-----------QstssaassvaSPVDVEV  423
            IN+LK ++ +LE ++   + +K  V+  G             + +SS  +S A  V+++V
Sbjct  368  INDLKARIGQLEAKIHA-QPQKPGVDIGGQTSSXVDHHQTRPRLSSSYNNSAAGAVEIDV  426

Query  422  KIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRS  243
            KIVG +AMIRVQ  + NYP+A+LMN L++LEL V+HASISSV ++MLQD+V +VP+G  S
Sbjct  427  KIVGSEAMIRVQCPDCNYPNARLMNALKDLELQVYHASISSVKELMLQDVVARVPKGFTS  486

Query  242  EDG  234
            ++ 
Sbjct  487  DEA  489



>gb|KDO44754.1| hypothetical protein CISIN_1g005651mg [Citrus sinensis]
Length=685

 Score =   186 bits (471),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 134/201 (67%), Gaps = 17/201 (8%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQ-QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYA  639
            +S+HSD +   +K+P     + +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYA
Sbjct  464  DSDHSDLEASVVKDPDSSRVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYA  523

Query  638  LRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC---QLQLRESKKVKVEAVG-----  483
            LR+VVPNVS+MDKASLL DA+SYINEL+ K++  E     LQ +E   VK E  G     
Sbjct  524  LRAVVPNVSKMDKASLLGDAISYINELRTKLQSAESDKEDLQ-KELASVKKELAGGGKDS  582

Query  482  -------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  324
                   D     S  +S    +D+EVKI+G DAMIR+QS   N+P+AKLM  L+EL+L 
Sbjct  583  HSGPSTSDQDLKMSNHASKLIDLDIEVKIIGWDAMIRIQSSKKNHPAAKLMQALKELDLE  642

Query  323  VHHASISSVNDIMLQDIVVKV  261
            V+HAS+S VND+M+Q   VK+
Sbjct  643  VNHASMSVVNDLMIQQATVKM  663



>ref|XP_006428423.1| hypothetical protein CICLE_v10011214mg [Citrus clementina]
 ref|XP_006491734.1| PREDICTED: transcription factor MYC2-like [Citrus sinensis]
 gb|ESR41663.1| hypothetical protein CICLE_v10011214mg [Citrus clementina]
Length=685

 Score =   186 bits (471),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 104/201 (52%), Positives = 134/201 (67%), Gaps = 17/201 (8%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQ-QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYA  639
            +S+HSD +   +K+P     + +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYA
Sbjct  464  DSDHSDLEASVVKDPDSSRVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYA  523

Query  638  LRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC---QLQLRESKKVKVEAVG-----  483
            LR+VVPNVS+MDKASLL DA+SYINEL+ K++  E     LQ +E   VK E  G     
Sbjct  524  LRAVVPNVSKMDKASLLGDAISYINELRTKLQSAESDKEDLQ-KELASVKKELAGGGKDS  582

Query  482  -------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  324
                   D     S  +S    +D+EVKI+G DAMIR+QS   N+P+AKLM  L+EL+L 
Sbjct  583  HSGPSTSDQDLKMSNHASKLIDLDIEVKIIGWDAMIRIQSSKKNHPAAKLMEALKELDLE  642

Query  323  VHHASISSVNDIMLQDIVVKV  261
            V+HAS+S VND+M+Q   VK+
Sbjct  643  VNHASMSVVNDLMIQQATVKM  663



>ref|XP_009609942.1| PREDICTED: transcription factor MYC2-like [Nicotiana tomentosiformis]
Length=679

 Score =   185 bits (469),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 137/209 (66%), Gaps = 16/209 (8%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S+HSD +   +KE     V   +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  457  DSDHSDLEASVVKEAESSRVVEPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFY  516

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGK--------------VEELECQLQLRESKK  504
            ALR+VVPNVS+MDKASLL DA+SYINELK K              +E+L+ +L  ++S++
Sbjct  517  ALRAVVPNVSKMDKASLLGDAISYINELKLKLQNTETDREELKSQIEDLKKELASKDSRR  576

Query  503  VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  324
                    +   SS   S    VD++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L 
Sbjct  577  PGPPPSNHDHKMSSHTGSKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMVALKELDLD  636

Query  323  VHHASISSVNDIMLQDIVVKVPEGLRSED  237
            VHHAS+S VND+M+Q   VK+   L +E+
Sbjct  637  VHHASVSVVNDLMIQQATVKMGSRLYTEE  665



>gb|AAC28907.1| phaseolin G-box binding protein PG2, partial [Phaseolus vulgaris]
Length=614

 Score =   184 bits (468),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 134/200 (67%), Gaps = 18/200 (9%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +   +K+P  V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  396  DSDHSDLEASVVKDP--VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  453

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDN--  477
            R+VVPNVS+MDKASLL DA+SYI ELK K++ LE      Q QL   KK ++E   DN  
Sbjct  454  RAVVPNVSKMDKASLLGDAISYITELKSKLQNLESDKDGLQKQLEGVKK-ELEKSSDNVS  512

Query  476  --------QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  321
                     S   +++     +D++VKI+G DAMIR+Q    N+P+A+LM  L EL+L V
Sbjct  513  SNHTKHGGNSNIKSSNQALIDLDIDVKIIGWDAMIRIQCSKKNHPAARLMAALMELDLDV  572

Query  320  HHASISSVNDIMLQDIVVKV  261
            HHAS+S VND+M+Q   VK+
Sbjct  573  HHASVSVVNDLMIQQATVKM  592



>ref|XP_007158304.1| hypothetical protein PHAVU_002G141500g [Phaseolus vulgaris]
 gb|ESW30298.1| hypothetical protein PHAVU_002G141500g [Phaseolus vulgaris]
Length=728

 Score =   185 bits (469),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 134/200 (67%), Gaps = 18/200 (9%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +   +K+P  V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  510  DSDHSDLEASVVKDP--VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  567

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDN--  477
            R+VVPNVS+MDKASLL DA+SYI ELK K++ LE      Q QL   KK ++E   DN  
Sbjct  568  RAVVPNVSKMDKASLLGDAISYITELKSKLQNLESDKDGLQKQLEGVKK-ELEKSSDNVS  626

Query  476  --------QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  321
                     S   +++     +D++VKI+G DAMIR+Q    N+P+A+LM  L EL+L V
Sbjct  627  SNHTKHGGNSNIKSSNQALIDLDIDVKIIGWDAMIRIQCSKKNHPAARLMAALMELDLDV  686

Query  320  HHASISSVNDIMLQDIVVKV  261
            HHAS+S VND+M+Q   VK+
Sbjct  687  HHASVSVVNDLMIQQATVKM  706



>ref|XP_006303928.1| hypothetical protein CARUB_v10008586mg [Capsella rubella]
 gb|EOA36826.1| hypothetical protein CARUB_v10008586mg [Capsella rubella]
Length=624

 Score =   184 bits (467),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 108/199 (54%), Positives = 141/199 (71%), Gaps = 15/199 (8%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            ES+HSD +   +KE  +  R    PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  416  ESDHSDVEASVVKEVAVEKR----PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  471

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESK--KVKVEAVGDNQst--  468
            R+VVPNVS+MDKASLL DA++YINELK KV + E +  + +++  +VK+E  G   S   
Sbjct  472  RAVVPNVSKMDKASLLGDAIAYINELKAKVVKTESEKVMIKNQLEEVKMELAGRKASAGC  531

Query  467  ---ssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
               SS++ S   PV  ++EVKI+G DAMIRV+S   N+P+A+LM+ L +LEL V+HAS+S
Sbjct  532  GDMSSSSCSSIKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHASMS  591

Query  302  SVNDIMLQDIVVKVPEGLR  246
             VND+M+Q   VK+  G R
Sbjct  592  VVNDLMIQQATVKM--GFR  608



>gb|ADH04268.1| MYC1b transcription factor [Nicotiana tabacum]
 gb|ADU60100.1| MYC2a transcription factor [Nicotiana tabacum]
Length=679

 Score =   184 bits (468),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 104/209 (50%), Positives = 137/209 (66%), Gaps = 16/209 (8%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S+HSD +   +KE     V   +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  457  DSDHSDLEASVVKEAESSRVVEPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFY  516

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGK--------------VEELECQLQLRESKK  504
            ALR+VVPNVS+MDKASLL DA+SYINELK K              +E+L+ +L  ++S++
Sbjct  517  ALRAVVPNVSKMDKASLLGDAISYINELKLKLQNTETDREELKSQIEDLKKELVSKDSRR  576

Query  503  VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  324
                    +   SS   S    VD++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L 
Sbjct  577  PGPPPSNHDHKMSSHTGSKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMVALKELDLD  636

Query  323  VHHASISSVNDIMLQDIVVKVPEGLRSED  237
            VHHAS+S VND+M+Q   VK+   L +E+
Sbjct  637  VHHASVSVVNDLMIQQATVKMGSRLYTEE  665



>gb|AFZ93650.1| transcription factor MYC2, partial [Euphorbia lathyris]
Length=272

 Score =   176 bits (446),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 99/197 (50%), Positives = 133/197 (68%), Gaps = 13/197 (7%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S+HSD +   ++E     IV+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  56   DSDHSDLEASVVRETESSRIVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  114

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQ--LRESKKVKVE  492
            YALR+VVPNVS+MDKASLL DA+SYI ELK K+       EELE Q++   +E  K    
Sbjct  115  YALRAVVPNVSKMDKASLLGDAISYIKELKSKLQNTESDKEELEKQVESMKKEFSKKDTR  174

Query  491  AVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  312
            +           S+ +  +D++VKI+G D MIR+Q    N+P+A+LM  L+EL+L VHHA
Sbjct  175  SGTPPPDQELKMSNKSIEMDIDVKIIGWDVMIRIQCSKKNHPAARLMAALKELDLDVHHA  234

Query  311  SISSVNDIMLQDIVVKV  261
            S+S VND+M+Q   VK+
Sbjct  235  SVSVVNDLMIQQATVKM  251



>gb|ADH04267.1| MYC1a transcription factor [Nicotiana tabacum]
 gb|ADU60101.1| MYC2b transcription factor [Nicotiana tabacum]
 gb|ADU60102.1| MYC2c transcription factor [Nicotiana tabacum]
Length=681

 Score =   184 bits (467),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 136/208 (65%), Gaps = 16/208 (8%)
 Frame = -1

Query  812  SEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYA  639
            S+HSD +   +KE     V   +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYA
Sbjct  460  SDHSDLEASVVKEAESSRVVEPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYA  519

Query  638  LRSVVPNVSRMDKASLLSDAVSYINELKGK--------------VEELECQLQLRESKKV  501
            LR+VVPNVS+MDKASLL DA+SYINELK K              +E+L+ +L  ++S++ 
Sbjct  520  LRAVVPNVSKMDKASLLGDAISYINELKLKLQTTETDREDLKSQIEDLKKELDSKDSRRP  579

Query  500  KVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  321
                   +   SS   S    VD++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L V
Sbjct  580  GPPPPNQDHKMSSHTGSKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMVALKELDLDV  639

Query  320  HHASISSVNDIMLQDIVVKVPEGLRSED  237
            HHAS+S VND+M+Q   VK+   L +E+
Sbjct  640  HHASVSVVNDLMIQQATVKMGSRLYTEE  667



>ref|XP_009780487.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=681

 Score =   184 bits (467),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 136/208 (65%), Gaps = 16/208 (8%)
 Frame = -1

Query  812  SEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYA  639
            S+HSD +   +KE     V   +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYA
Sbjct  460  SDHSDLEASVVKEAESSRVVEPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYA  519

Query  638  LRSVVPNVSRMDKASLLSDAVSYINELKGK--------------VEELECQLQLRESKKV  501
            LR+VVPNVS+MDKASLL DA+SYINELK K              +E+L+ +L  ++S++ 
Sbjct  520  LRAVVPNVSKMDKASLLGDAISYINELKLKLQTTETDREDLKSQIEDLKKELDSKDSRRP  579

Query  500  KVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  321
                   +   SS   S    VD++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L V
Sbjct  580  GPPPPNQDHKMSSHTGSKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMVALKELDLDV  639

Query  320  HHASISSVNDIMLQDIVVKVPEGLRSED  237
            HHAS+S VND+M+Q   VK+   L +E+
Sbjct  640  HHASVSVVNDLMIQQATVKMGSRLYTEE  667



>ref|XP_009131125.1| PREDICTED: transcription factor MYC4-like [Brassica rapa]
Length=230

 Score =   175 bits (443),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 99/205 (48%), Positives = 133/205 (65%), Gaps = 12/205 (6%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S  SD +   +KE     I    +  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  16   DSNRSDLEASVVKEAESGRIAAEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  75

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-QLQLRESKKVKVEAVGD----  480
            Y+LR+VVPNVS+MDKASLL DA+SYINELK K+++ E  + +L++      + VGD    
Sbjct  76   YSLRAVVPNVSKMDKASLLGDAISYINELKAKLQKAEADKEELQKQIDGMSKEVGDGNVK  135

Query  479  ----NQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  312
                +Q      S V+  V+++VKI+G DAMIR+Q    N+P AK M  L+ELEL V+HA
Sbjct  136  SSVKDQKCLEQDSGVSIEVEIDVKIIGWDAMIRIQCGKKNHPGAKFMEALKELELEVNHA  195

Query  311  SISSVNDIMLQDIVVKVPEGLRSED  237
            S+S VN+ M+Q   VK+     ++D
Sbjct  196  SLSVVNEFMIQQATVKMGNQFFTQD  220



>gb|AGZ94899.1| MYC transcription factor 2 [Solanum lycopersicum]
Length=689

 Score =   184 bits (467),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 133/197 (68%), Gaps = 12/197 (6%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +SEHSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  471  DSEHSDLEASVVKEADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  530

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQ-LRESKKVKVEAV  486
            ALR+VVPNVS+MDKASLL DA+SYINELK K+       E+L+ Q++ L++  +      
Sbjct  531  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQNTESDKEDLKSQIEDLKKESRRPGPPP  590

Query  485  GDNQstssaassvaS--PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  312
              NQ    ++ +      VD++VKI+G DAMIR+Q    N+P+A+LM  L EL+L VHHA
Sbjct  591  PPNQDLKMSSHTGGKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMAALMELDLDVHHA  650

Query  311  SISSVNDIMLQDIVVKV  261
            S+S VND+M+Q   VK+
Sbjct  651  SVSVVNDLMIQQATVKM  667



>ref|XP_004245895.2| PREDICTED: transcription factor MYC2 [Solanum lycopersicum]
Length=689

 Score =   184 bits (466),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 133/197 (68%), Gaps = 12/197 (6%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +SEHSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  471  DSEHSDLEASVVKEADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  530

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQ-LRESKKVKVEAV  486
            ALR+VVPNVS+MDKASLL DA+SYINELK K+       E+L+ Q++ L++  +      
Sbjct  531  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQNTESDKEDLKSQIEDLKKESRRPGPPP  590

Query  485  GDNQstssaassvaS--PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  312
              NQ    ++ +      VD++VKI+G DAMIR+Q    N+P+A+LM  L EL+L VHHA
Sbjct  591  PPNQDLKMSSHTGGKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMAALMELDLDVHHA  650

Query  311  SISSVNDIMLQDIVVKV  261
            S+S VND+M+Q   VK+
Sbjct  651  SVSVVNDLMIQQATVKM  667



>ref|XP_008659898.1| PREDICTED: transcription factor MYC4-like [Zea mays]
 gb|AFW87749.1| putative HLH DNA-binding domain superfamily protein [Zea mays]
Length=703

 Score =   184 bits (466),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 137/213 (64%), Gaps = 26/213 (12%)
 Frame = -1

Query  815  ESEHSDSDC--------QFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  660
            ES+HSD D         + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  478  ESDHSDLDASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  534

Query  659  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGD  480
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     RE+ + +VEA+  
Sbjct  535  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTSLESD---RETLQAQVEALKK  591

Query  479  NQstssaassva------------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  336
             +         A              V+++ KI+G +AMIRVQ    N+PSA+LM  LRE
Sbjct  592  ERDARPHPHPAAGLGGHDAGGPRCHAVEIDAKILGLEAMIRVQCHKRNHPSARLMTALRE  651

Query  335  LELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            L+L V+HAS+S V D+M+Q + VK+   + S+D
Sbjct  652  LDLDVYHASVSVVKDLMIQQVAVKMASRMYSQD  684



>gb|AIO09733.1| transcription factor MYC2 [Salvia miltiorrhiza]
Length=602

 Score =   182 bits (463),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 100/191 (52%), Positives = 129/191 (68%), Gaps = 2/191 (1%)
 Frame = -1

Query  827  NSYPESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLN  654
            N+  ES+HSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN
Sbjct  390  NNTIESDHSDLEASVVKEADSSRVVNPEKRPRKRGRKPANGREEPLNHVEAERQRREKLN  449

Query  653  HRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQ  474
             RFYALR+VVPNVS+MDKASLL DA++YINELK KV+  E       S+   ++      
Sbjct  450  QRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVQNAESDKDELRSELESLKRATPAP  509

Query  473  stssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVN  294
            + + A +     +D++VKI+G DAMIRVQ    N+P+AKLM  LREL+L VHHAS+S V 
Sbjct  510  APAPAPAPAKIDMDMDVKIIGWDAMIRVQCSKKNHPAAKLMVALRELDLDVHHASVSVVK  569

Query  293  DIMLQDIVVKV  261
            D+M+Q   VK+
Sbjct  570  DLMIQQATVKM  580



>gb|EYU44086.1| hypothetical protein MIMGU_mgv1a002808mg [Erythranthe guttata]
Length=635

 Score =   182 bits (463),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/202 (52%), Positives = 140/202 (69%), Gaps = 10/202 (5%)
 Frame = -1

Query  815  ESEHSDSDCQFLKE---PPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S+ SD +   +KE     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  423  DSDQSDLEASVVKEVESSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  481

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-QLQLR---ESKKVKVEAVGDN  477
            YALR+VVPNVS+MDKASLL DA++YINELK K++ +E  + +LR   ES    ++   D 
Sbjct  482  YALRAVVPNVSKMDKASLLGDAIAYINELKSKLQNVELDKDELRRQLESSSSSMQKKKDK  541

Query  476  QstssaassvaSPVDVE--VKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
            + +S+   S    VD+E  VKI+G DAMIRVQ    N+P+AK+M  LREL+L VHHAS+S
Sbjct  542  EYSSAKEESSKGIVDMEIDVKIIGWDAMIRVQCSKKNHPAAKMMVALRELDLDVHHASVS  601

Query  302  SVNDIMLQDIVVKVPEGLRSED  237
             VND+M+Q   VK+     S+D
Sbjct  602  VVNDLMIQQATVKMEGRFFSQD  623



>ref|XP_006352856.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=702

 Score =   182 bits (463),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 102/196 (52%), Positives = 132/196 (67%), Gaps = 11/196 (6%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +SEHSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  481  DSEHSDLEASVVKEADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  540

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQ--LRESKKVKVEA  489
            ALR+VVPNVS+MDKASLL DA+SYINELK K+       E+L+ Q++   +ES++     
Sbjct  541  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQNTESDKEDLKSQIEDLKKESRRPGPPP  600

Query  488  VGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  309
               +   SS        VD++VKI+G DAMIR+Q    N+P+A+LM  L EL+L VHHAS
Sbjct  601  PNQDLKMSSHTGGKIVDVDIDVKIIGWDAMIRIQCNKKNHPAARLMAALMELDLDVHHAS  660

Query  308  ISSVNDIMLQDIVVKV  261
            +S VND+M+Q   VK+
Sbjct  661  VSVVNDLMIQQATVKM  676



>ref|XP_008373574.1| PREDICTED: transcription factor MYC2 [Malus domestica]
Length=689

 Score =   182 bits (462),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 138/207 (67%), Gaps = 15/207 (7%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S+HSD +   ++E     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  468  DSDHSDLEASVVREADSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  526

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRE----SKKVK  498
            YALR+VVPNVS+MDKASLL DA+SYINELK K+       EEL+ QL+       SK  +
Sbjct  527  YALRAVVPNVSKMDKASLLGDAISYINELKXKLQTVETDKEELQKQLESMNKDLPSKDSR  586

Query  497  VEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  318
                   +     +SS    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L VH
Sbjct  587  SSGSTVXEHEMKGSSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDLEVH  646

Query  317  HASISSVNDIMLQDIVVKVPEGLRSED  237
            HAS+S VND+M+Q   VK    + ++D
Sbjct  647  HASVSVVNDLMIQQATVKAGSRIYTQD  673



>gb|AGL98101.1| transcription factor MYC2-like protein [Nicotiana attenuata]
Length=666

 Score =   182 bits (462),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 134/210 (64%), Gaps = 21/210 (10%)
 Frame = -1

Query  812  SEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYA  639
            S+HSD +   +KE     V   +  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYA
Sbjct  446  SDHSDLEASVVKEAESSRVVEPEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYA  505

Query  638  LRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAV---------  486
            LR+VVPNVS+MDKASLL DA+SYINELK K++  E     RE  K ++E +         
Sbjct  506  LRAVVPNVSKMDKASLLGDAISYINELKLKLQNTETD---REDLKSQIEDLKKELASEDS  562

Query  485  -------GDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  327
                     +   SS   S    VD++VKI+G DAM+R+Q    N+P+A+LM  L+EL+L
Sbjct  563  WRPGPPPNQDHKMSSHTGSKIVDVDIDVKIIGWDAMVRIQCNKKNHPAARLMVALKELDL  622

Query  326  AVHHASISSVNDIMLQDIVVKVPEGLRSED  237
             VHHAS+S VND+M+Q   VK+   L +E+
Sbjct  623  EVHHASVSVVNDLMIQQATVKMGSRLYTEE  652



>ref|XP_010559309.1| PREDICTED: transcription factor MYC4-like [Tarenaya hassleriana]
Length=635

 Score =   182 bits (461),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 99/200 (50%), Positives = 131/200 (66%), Gaps = 10/200 (5%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S+HSD +    KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  428  DSDHSDVEASVYKEADSGRVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  487

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEEL-----ECQLQLRESKKVKVEAVGDN  477
            +LR++VPNVS+MDKASLL DA+SYINELK KV++      E Q QLRE +K      G +
Sbjct  488  SLRALVPNVSKMDKASLLGDAISYINELKSKVQKAEFDKGELQKQLRELRK---GVSGKD  544

Query  476  QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  297
            Q   +  S  +   +++VKI+G D MIR+Q    N+P AK M  L+EL+L V+HAS+S V
Sbjct  545  QKGLNQDSGPSVETEIDVKIIGWDVMIRIQCSKKNHPGAKFMEALKELDLEVNHASLSVV  604

Query  296  NDIMLQDIVVKVPEGLRSED  237
            ND M++   VK+     ++D
Sbjct  605  NDFMIEQATVKMGSRFFTQD  624



>ref|XP_008658563.1| PREDICTED: transcription factor MYC4 [Zea mays]
 tpg|DAA46409.1| TPA: putative HLH DNA-binding domain superfamily protein [Zea 
mays]
Length=705

 Score =   182 bits (462),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 138/211 (65%), Gaps = 24/211 (11%)
 Frame = -1

Query  815  ESEHSDSDC--------QFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  660
            ES+HSD D         + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  482  ESDHSDLDASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  538

Query  659  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGD  480
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     +E+ + +VEA+  
Sbjct  539  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTSLETD---KETLQTQVEALKK  595

Query  479  NQstssaassva----------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELE  330
             +     + S              V+++ KI+G +AMIRVQ    N+PSA+LM  LREL+
Sbjct  596  ERDARPPSHSAGLGGHDGGPRCHAVEIDAKILGLEAMIRVQCHKRNHPSARLMTALRELD  655

Query  329  LAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            L V+HAS+S V D+M+Q + VK+   + ++D
Sbjct  656  LDVYHASVSVVKDLMIQQVAVKMASRVYTQD  686



>gb|KHM99167.1| Transcription factor MYC4 [Glycine soja]
Length=218

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/180 (51%), Positives = 121/180 (67%), Gaps = 19/180 (11%)
 Frame = -1

Query  743  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  564
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DA+SYIN
Sbjct  16   PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAISYIN  75

Query  563  ELKGKV-----EELECQLQLRESKKVKVEAVGD--------------NQstssaassvaS  441
            ELK K+     E+ E + QL  +KK    A  +              N   +   ++  +
Sbjct  76   ELKLKLNGLDSEKGELEKQLDSAKKELELATKNPPPPPPPPPGLPPSNNEEAKKTTTKLA  135

Query  440  PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKV  261
             +++EVKI+G DAMIR+Q    N+P+A+LM  L++L+L VHHAS+S VND+M+Q   V +
Sbjct  136  DLEIEVKIIGWDAMIRIQCSKKNHPAARLMAALKDLDLEVHHASVSVVNDLMIQQATVNM  195



>gb|AAD15818.1| transcription factor MYC7E [Zea mays]
Length=702

 Score =   182 bits (462),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 138/211 (65%), Gaps = 24/211 (11%)
 Frame = -1

Query  815  ESEHSDSDC--------QFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  660
            ES+HSD D         + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  479  ESDHSDLDASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  535

Query  659  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGD  480
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     +E+ + +VEA+  
Sbjct  536  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTSLETD---KETLQTQVEALKK  592

Query  479  NQstssaassva----------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELE  330
             +     + S              V+++ KI+G +AMIRVQ    N+PSA+LM  LREL+
Sbjct  593  ERDARPPSHSAGLGGHDGGPRCHAVEIDAKILGLEAMIRVQCHKRNHPSARLMTALRELD  652

Query  329  LAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            L V+HAS+S V D+M+Q + VK+   + ++D
Sbjct  653  LDVYHASVSVVKDLMIQQVAVKMASRVYTQD  683



>ref|XP_007210309.1| hypothetical protein PRUPE_ppa002404mg [Prunus persica]
 gb|EMJ11508.1| hypothetical protein PRUPE_ppa002404mg [Prunus persica]
Length=676

 Score =   182 bits (461),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 102/209 (49%), Positives = 141/209 (67%), Gaps = 20/209 (10%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S+HSD +   ++E     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  458  DSDHSDLEASVVRETDSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  516

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG------  483
            YALR+VVPNVS+MDKASLL DA+SYINELK K++  E     +E  + ++E++       
Sbjct  517  YALRAVVPNVSKMDKASLLGDAISYINELKAKLQTTESD---KEDLQKQLESMNQDLGCK  573

Query  482  -------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  324
                   D + +   ASS    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L 
Sbjct  574  DSSSLSDDLKMSKHQASSKLIDLDIDVKIIGWDAMIRIQCCKKNHPAARLMASLKELDLD  633

Query  323  VHHASISSVNDIMLQDIVVKVPEGLRSED  237
            VHHASIS VND+M+Q   VK+   + ++D
Sbjct  634  VHHASISVVNDLMIQQATVKMGSRIYTQD  662



>gb|ADL36595.1| BHLH domain class transcription factor [Malus domestica]
Length=691

 Score =   182 bits (461),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 103/207 (50%), Positives = 139/207 (67%), Gaps = 15/207 (7%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S+HSD +   ++E     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  470  DSDHSDLEASVVREADSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  528

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRE----SKKVK  498
            YALR+VVPNVS+MDKASLL DA+SYINELK K+       EEL+ QL+       SK  +
Sbjct  529  YALRAVVPNVSKMDKASLLGDAISYINELKLKLQTVETDKEELQKQLESMNKDLPSKDSR  588

Query  497  VEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  318
                  ++     +SS    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L VH
Sbjct  589  SSGSTMSEHEMKGSSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDLEVH  648

Query  317  HASISSVNDIMLQDIVVKVPEGLRSED  237
            HAS+S VND+M+Q   VK    + ++D
Sbjct  649  HASVSVVNDLMIQQATVKAGSRIYTQD  675



>gb|AHN63211.1| transcription factor MYC2 [Salvia miltiorrhiza f. alba]
Length=592

 Score =   181 bits (459),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 100/192 (52%), Positives = 133/192 (69%), Gaps = 6/192 (3%)
 Frame = -1

Query  827  NSYPESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLN  654
            N+  ES+HSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN
Sbjct  382  NNTIESDHSDLEASVVKEADSSRVVNPEKRPRKRGRKPANGREEPLNHVEAERQRREKLN  441

Query  653  HRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG-DN  477
             RFYALR+VVPNVS+MDKASLL DA++YINELK KV+  E     ++  + ++E++    
Sbjct  442  QRFYALRAVVPNVSKMDKASLLGDAIAYINELKSKVQNAESD---KDELRSELESLKRAT  498

Query  476  QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  297
             + + A +     +D++VKI+G DAMIRVQ    N+P+AKLM  LREL+L VHHAS+S V
Sbjct  499  PAPAPAPAPAKIDMDMDVKIIGWDAMIRVQCSKKNHPAAKLMVALRELDLDVHHASVSVV  558

Query  296  NDIMLQDIVVKV  261
             D+M+Q   VK+
Sbjct  559  KDLMIQQATVKM  570



>gb|EEC67493.1| hypothetical protein OsI_34761 [Oryza sativa Indica Group]
Length=664

 Score =   181 bits (460),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 133/206 (65%), Gaps = 16/206 (8%)
 Frame = -1

Query  815  ESEHSDSDC--------QFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  660
            ES+HSD +         + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  444  ESDHSDLEASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  500

Query  659  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKV  495
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE      Q Q+   KK + 
Sbjct  501  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTALETDKETLQSQMESLKKERD  560

Query  494  EAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  315
                          +    V++E KI+G +AMIRVQ    N+P+A+LM  LREL+L V+H
Sbjct  561  ARPPAPSGGGGDGGARCHAVEIEAKILGLEAMIRVQCHKRNHPAARLMTALRELDLDVYH  620

Query  314  ASISSVNDIMLQDIVVKVPEGLRSED  237
            AS+S V D+M+Q + VK+   + S+D
Sbjct  621  ASVSVVKDLMIQQVAVKMASRVYSQD  646



>ref|XP_009359541.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=481

 Score =   179 bits (454),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 131/182 (72%), Gaps = 13/182 (7%)
 Frame = -1

Query  740  KKRGRKPG--AGR-VTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  570
            KKRGR      GR  +P+NHVEAERQRREKLN RFYALRSVVPNVSRMDKASLLSDAV Y
Sbjct  289  KKRGRSSNRETGRPESPINHVEAERQRREKLNCRFYALRSVVPNVSRMDKASLLSDAVVY  348

Query  569  INELKGKVEELECQLQLRESK-----KVKVEAVGDNQst-----ssaassvaSPVDVEVK  420
            INELK +V +LE ++Q +  K       +  ++ D+  T     SS  +     ++++VK
Sbjct  349  INELKARVGQLESKIQAQLQKPGVDIGGQTSSIVDHHQTRPRLSSSYNNRAVGDMEMDVK  408

Query  419  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSE  240
            IVG +AM+RVQ  + NYP+A+LMN L++LEL V+HASISSV ++M+QD+VV+VP G  SE
Sbjct  409  IVGSEAMLRVQCPDCNYPNARLMNALKDLELQVYHASISSVKELMIQDVVVRVPHGFTSE  468

Query  239  DG  234
            + 
Sbjct  469  EA  470



>gb|AAK00453.1|AC060755_23 putative MYC transcription factor [Oryza sativa Japonica Group]
Length=688

 Score =   181 bits (460),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 133/206 (65%), Gaps = 16/206 (8%)
 Frame = -1

Query  815  ESEHSDSDC--------QFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  660
            ES+HSD +         + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  468  ESDHSDLEASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  524

Query  659  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKV  495
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE      Q Q+   KK + 
Sbjct  525  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTALETDKETLQSQMESLKKERD  584

Query  494  EAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  315
                          +    V++E KI+G +AMIRVQ    N+P+A+LM  LREL+L V+H
Sbjct  585  ARPPAPSGGGGDGGARCHAVEIEAKILGLEAMIRVQCHKRNHPAARLMTALRELDLDVYH  644

Query  314  ASISSVNDIMLQDIVVKVPEGLRSED  237
            AS+S V D+M+Q + VK+   + S+D
Sbjct  645  ASVSVVKDLMIQQVAVKMASRVYSQD  670



>ref|XP_002467448.1| hypothetical protein SORBIDRAFT_01g028230 [Sorghum bicolor]
 gb|EER94446.1| hypothetical protein SORBIDRAFT_01g028230 [Sorghum bicolor]
Length=709

 Score =   181 bits (460),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 138/211 (65%), Gaps = 24/211 (11%)
 Frame = -1

Query  815  ESEHSDSDC--------QFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  660
            ES+HSD D         + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  486  ESDHSDLDASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  542

Query  659  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGD  480
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     +++ + ++EA+  
Sbjct  543  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTSLESD---KDTLQAQIEALKK  599

Query  479  NQstssaassva----------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELE  330
             +     A +              V+++ KI+G +AMIRVQ    N+PSA+LM  LREL+
Sbjct  600  ERDARPPAHAAGLGGHDGGPRCHAVEIDAKILGLEAMIRVQCHKRNHPSARLMTALRELD  659

Query  329  LAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            L V+HAS+S V D+M+Q + VK+   + S+D
Sbjct  660  LDVYHASVSVVKDLMIQQVAVKMASRIYSQD  690



>ref|XP_008238247.1| PREDICTED: transcription factor MYC2 [Prunus mume]
Length=685

 Score =   181 bits (460),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 102/210 (49%), Positives = 142/210 (68%), Gaps = 21/210 (10%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S+HSD +   ++E     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  466  DSDHSDLEASVVRETDSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  524

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG------  483
            YALR+VVPNVS+MDKASLL DA+SYINELK K++ +E     +E  + ++E++       
Sbjct  525  YALRAVVPNVSKMDKASLLGDAISYINELKAKLQTVESD---KEDLQKQLESMNQDLGCK  581

Query  482  --------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  327
                    D + +   ASS    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L
Sbjct  582  DSSSLSDQDLKMSKHQASSKLIDLDIDVKIIGWDAMIRIQCCKKNHPAARLMASLKELDL  641

Query  326  AVHHASISSVNDIMLQDIVVKVPEGLRSED  237
             VHHASIS VND+M+Q   VK+   + ++D
Sbjct  642  DVHHASISVVNDLMIQQATVKMGSRIYTQD  671



>ref|XP_012090783.1| PREDICTED: transcription factor bHLH14-like [Jatropha curcas]
 gb|KDP22548.1| hypothetical protein JCGZ_26379 [Jatropha curcas]
Length=469

 Score =   179 bits (453),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 128/172 (74%), Gaps = 4/172 (2%)
 Frame = -1

Query  740  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  561
            KKR RK  AG+ T +NHVEAERQRRE+LNHRFY+LRSVVP VS+MDKASLL+DAV+YI E
Sbjct  286  KKRSRKQSAGKETHLNHVEAERQRRERLNHRFYSLRSVVPTVSKMDKASLLADAVTYIKE  345

Query  560  LKGKVEELECQLQ---LRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVG-PDAMIR  393
            LK KV+ELE + Q   + ++     +    N    S +S  A  ++V+VKI+G  +AMIR
Sbjct  346  LKAKVDELETKQQAIIMSKNNNNHNKLNNGNDIFRSFSSHRAKVIEVDVKILGSSEAMIR  405

Query  392  VQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            V S N N+P+A+LM+ LRE E  VHH S+SS+ D++LQD++V+VP+GL+ E+
Sbjct  406  VLSPNVNHPAARLMDALREAECQVHHGSVSSIKDMLLQDVMVRVPDGLKDEE  457



>ref|XP_003574381.1| PREDICTED: transcription factor MYC4-like [Brachypodium distachyon]
Length=706

 Score =   181 bits (460),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 102/208 (49%), Positives = 135/208 (65%), Gaps = 22/208 (11%)
 Frame = -1

Query  815  ESEHSDSDCQF-------LKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKL  657
            ES+HSD +          +  PP    ++  P+KRGRKP  GR  P+NHVEAERQRREKL
Sbjct  486  ESDHSDLEASVREVESSRVVPPP----EEKRPRKRGRKPANGREEPLNHVEAERQRREKL  541

Query  656  NHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN  477
            N RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     +++   ++EA+   
Sbjct  542  NQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKMTALESD---KDTLHSQIEALKKE  598

Query  476  Qstssaassva--------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  321
            +     A              V++E KI+G +AMIRVQ    N+P+AKLM  LREL+L V
Sbjct  599  RDARPVAPLSGVHDSGPRCHAVEIEAKILGLEAMIRVQCHKRNHPAAKLMTALRELDLDV  658

Query  320  HHASISSVNDIMLQDIVVKVPEGLRSED  237
            +HAS+S V DIM+Q + VK+P  + S+D
Sbjct  659  YHASVSVVKDIMIQQVAVKMPNRVYSQD  686



>ref|NP_199488.1| JAZ-interacting transcription factor MYC3 [Arabidopsis thaliana]
 sp|Q9FIP9.1|MYC3_ARATH RecName: Full=Transcription factor MYC3; AltName: Full=Basic 
helix-loop-helix protein 5; Short=AtbHLH5; Short=bHLH 5; AltName: 
Full=Protein ALTERED TRYPTOPHAN REGULATION 2; AltName: 
Full=Transcription factor ATR2; AltName: Full=Transcription 
factor EN 36; AltName: Full=bHLH transcription factor bHLH005 
[Arabidopsis thaliana]
 dbj|BAB08920.1| bHLH protein-like [Arabidopsis thaliana]
 gb|AED95422.1| JAZ-interacting transcription factor MYC3 [Arabidopsis thaliana]
Length=592

 Score =   181 bits (458),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 137/204 (67%), Gaps = 11/204 (5%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +   +KE  +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  375  DSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  434

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN-------  477
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E   +  + K   +   G+N       
Sbjct  435  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAESDKEEIQKKLDGMSKEGNNGKGCGSR  494

Query  476  ----QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  309
                +S++  +++ +  ++++VKI+G D MIRVQ    ++P A+ M  L+EL+L V+HAS
Sbjct  495  AKERKSSNQDSTASSIEMEIDVKIIGWDVMIRVQCGKKDHPGARFMEALKELDLEVNHAS  554

Query  308  ISSVNDIMLQDIVVKVPEGLRSED  237
            +S VND+M+Q   VK+     + D
Sbjct  555  LSVVNDLMIQQATVKMGSQFFNHD  578



>gb|AAL55712.1|AF251690_1 putative transcription factor BHLH5 [Arabidopsis thaliana]
Length=592

 Score =   180 bits (457),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 94/204 (46%), Positives = 137/204 (67%), Gaps = 11/204 (5%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +   +KE  +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  375  DSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  434

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN-------  477
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E   +  + K   +   G+N       
Sbjct  435  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAESDKEEIQKKLDGMSKEGNNGKGCGSR  494

Query  476  ----QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  309
                +S++  +++ +  ++++VKI+G D MIRVQ    ++P A+ M  L+EL+L V+HAS
Sbjct  495  AKERKSSNQDSTASSIEMEIDVKIIGWDVMIRVQCGKKDHPGARFMEALKELDLEVNHAS  554

Query  308  ISSVNDIMLQDIVVKVPEGLRSED  237
            +S VND+M+Q   VK+     + D
Sbjct  555  LSVVNDLMIQQATVKMGSQFFNHD  578



>ref|NP_001288107.1| uncharacterized protein LOC101261048 [Solanum lycopersicum]
 gb|AIC63945.1| MYC1 [Solanum lycopersicum]
Length=630

 Score =   181 bits (458),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 132/200 (66%), Gaps = 9/200 (5%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +   +KE   V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  419  DSDHSDLEASVVKEA--VVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  476

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVGDN  477
            R+VVPNVS+MDKASLL DA++YINELK KV       EEL  Q++    +     +   +
Sbjct  477  RAVVPNVSKMDKASLLGDAIAYINELKSKVQNSDLDKEELRSQIECLRKELTNKGSSNYS  536

Query  476  QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  297
             S           +D++VK++G DAMIR+Q    N+P+A+LM  L++L+L VHHAS+S V
Sbjct  537  ASPPLNQDVKIVDMDIDVKVIGWDAMIRIQCSKKNHPAARLMAALKDLDLDVHHASVSVV  596

Query  296  NDIMLQDIVVKVPEGLRSED  237
            ND+M+Q   VK+   L +++
Sbjct  597  NDLMIQQATVKMGSRLYAQE  616



>ref|NP_001065478.1| Os10g0575000 [Oryza sativa Japonica Group]
 gb|AAS66204.1| MYC protein [Oryza sativa]
 gb|ABB48017.1| transcription factor MYC7E, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF27315.1| Os10g0575000 [Oryza sativa Japonica Group]
Length=699

 Score =   181 bits (460),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 100/206 (49%), Positives = 133/206 (65%), Gaps = 16/206 (8%)
 Frame = -1

Query  815  ESEHSDSDC--------QFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREK  660
            ES+HSD +         + +  PP  +++   P+KRGRKP  GR  P+NHVEAERQRREK
Sbjct  479  ESDHSDLEASVREVESSRVVAPPPEAEKR---PRKRGRKPANGREEPLNHVEAERQRREK  535

Query  659  LNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKV  495
            LN RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE      Q Q+   KK + 
Sbjct  536  LNQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKLTALETDKETLQSQMESLKKERD  595

Query  494  EAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  315
                          +    V++E KI+G +AMIRVQ    N+P+A+LM  LREL+L V+H
Sbjct  596  ARPPAPSGGGGDGGARCHAVEIEAKILGLEAMIRVQCHKRNHPAARLMTALRELDLDVYH  655

Query  314  ASISSVNDIMLQDIVVKVPEGLRSED  237
            AS+S V D+M+Q + VK+   + S+D
Sbjct  656  ASVSVVKDLMIQQVAVKMASRVYSQD  681



>emb|CDY58502.1| BnaA06g40330D [Brassica napus]
Length=449

 Score =   178 bits (451),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 139/203 (68%), Gaps = 11/203 (5%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            ES+HSD +   +KE  +V+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  234  ESDHSDLEASVVKEAIVVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  292

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaa  456
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E + +  + +   +   G+ +S +S A
Sbjct  293  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAESEKEEIQKQLDGMSKEGNGKSGASRA  352

Query  455  ----------ssvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  306
                      S+ +  ++++VKI+G D MIRVQ    N+P ++ M+ L+EL+L V+HAS+
Sbjct  353  VKERRSSYQDSASSVEMEIDVKIIGWDVMIRVQCSKKNHPGSRFMDALKELDLEVNHASL  412

Query  305  SSVNDIMLQDIVVKVPEGLRSED  237
            S VND+M+Q   VK+     + D
Sbjct  413  SVVNDLMIQQATVKMGSQFFNHD  435



>ref|XP_009796881.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=424

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 128/177 (72%), Gaps = 6/177 (3%)
 Frame = -1

Query  749  NAPKKRGRKPGAGRVTPV----NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSD  582
            N P KRGRK  +   T       HVEAERQRREKLN+RFYALRSVVPNVS+MD+ASLL+D
Sbjct  234  NRPIKRGRKSSSSNATGTEMAKKHVEAERQRREKLNNRFYALRSVVPNVSKMDRASLLAD  293

Query  581  AVSYINELKGKVEELECQ--LQLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGP  408
            AV+YINELK KVEELE    L  +  ++    +V    ST    ++ +  ++VEVKI+G 
Sbjct  294  AVTYINELKAKVEELESYKILSQKPKRQCATNSVQTVPSTVLNRANNSFGMEVEVKIIGL  353

Query  407  DAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            +AM+RV+S + NYP A+LMN LRELEL V+HAS+SSV ++MLQD+V+KV   + +E+
Sbjct  354  EAMVRVRSPDVNYPCARLMNVLRELELQVNHASVSSVKNLMLQDVVIKVTNEVANEE  410



>emb|CDY35179.1| BnaA09g18160D [Brassica napus]
Length=562

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 132/190 (69%), Gaps = 6/190 (3%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +   +KE  IV+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  352  DSDHSDIEASVVKEAIIVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  410

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDNQs  471
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E      Q QL    K    +    + 
Sbjct  411  RAVVPNVSKMDKASLLGDAISYINELKTKLQQAETDKEEVQKQLDRMSKEGGGSRRAKER  470

Query  470  tssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVND  291
             S+  S+ +  ++++VKI+G D MIRVQ    N+P A+ M  L+EL+L V+HAS+S VND
Sbjct  471  KSNLDSASSVEMEIDVKIIGWDVMIRVQCGKKNHPGARFMEALKELDLEVNHASLSMVND  530

Query  290  IMLQDIVVKV  261
            +M+Q   VK+
Sbjct  531  LMIQQATVKM  540



>emb|CDX77688.1| BnaC07g19420D [Brassica napus]
Length=452

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 137/203 (67%), Gaps = 11/203 (5%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            ES+HSD +   +KE  +V+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  237  ESDHSDLEASVVKEAIVVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  295

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDNQs  471
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E      Q QL    K      G +++
Sbjct  296  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAESDKEEIQKQLDGMSKEGNGKSGASRA  355

Query  470  -----tssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  306
                 +S   S+ +  ++++VKI+G D MIRVQ    N+P ++ M+ L+EL+L V+HAS+
Sbjct  356  VRERKSSYQDSASSVEMEIDVKIIGWDVMIRVQCSKKNHPGSRFMDALKELDLEVNHASL  415

Query  305  SSVNDIMLQDIVVKVPEGLRSED  237
            S VND+M+Q   VK+     + D
Sbjct  416  SVVNDLMIQQATVKMGSQFFNHD  438



>ref|XP_008370020.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=481

 Score =   178 bits (452),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 131/182 (72%), Gaps = 13/182 (7%)
 Frame = -1

Query  740  KKRGRKPG--AGR-VTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  570
            KKRGR      GR  +P+NHVEAERQRREKLN RFYALRSVVPNVSRMDKASLLSDAV Y
Sbjct  289  KKRGRSSNRETGRPESPINHVEAERQRREKLNCRFYALRSVVPNVSRMDKASLLSDAVVY  348

Query  569  INELKGKVEELECQLQLRESK-----KVKVEAVGDNQst-----ssaassvaSPVDVEVK  420
            INELK +V +LE ++Q +  K       +  ++ D+  T     SS  +     ++++VK
Sbjct  349  INELKARVGQLESKIQAQLQKPGVDIGGQTSSIVDHHQTRPRLSSSYNNRAGGALEMDVK  408

Query  419  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSE  240
            IVG +AM+RVQ  + +YP+A+LMN L++LEL V+HASISSV ++MLQD+VV+VP G  SE
Sbjct  409  IVGSEAMLRVQCPDCDYPNARLMNALKDLELQVYHASISSVKELMLQDVVVRVPHGFTSE  468

Query  239  DG  234
            + 
Sbjct  469  EA  470



>ref|XP_010540785.1| PREDICTED: transcription factor MYC2-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010540787.1| PREDICTED: transcription factor MYC2-like isoform X2 [Tarenaya 
hassleriana]
Length=603

 Score =   180 bits (457),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 104/203 (51%), Positives = 138/203 (68%), Gaps = 17/203 (8%)
 Frame = -1

Query  821  YPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            + +S+HSD +   +KE     R    P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  391  FGDSDHSDLEASVVKEAAPEKR----PRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  446

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVE-------ELECQLQ--LRESKKVKVEA  489
            ALR+VVPNVS+MDKASLL DA+SYINELK K++       + +CQL+   RE       A
Sbjct  447  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQRAESDKTQFQCQLENLKRELAGRHANA  506

Query  488  VGDNQstssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  315
                   S ++S+V+ P+  ++EVKI+  DAMIR++S   N+P+A+LM  L+ELEL V+H
Sbjct  507  NAGILDASDSSSAVSKPIGMEIEVKIIEWDAMIRIESSKRNHPAARLMTALKELELEVNH  566

Query  314  ASISSVNDIMLQDIVVKVPEGLR  246
            AS+S VND+M+Q   VK+  G R
Sbjct  567  ASVSVVNDLMIQQATVKL--GFR  587



>ref|XP_009114329.1| PREDICTED: transcription factor MYC3-like [Brassica rapa]
Length=563

 Score =   179 bits (455),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 132/190 (69%), Gaps = 6/190 (3%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +   +KE  IV+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  353  DSDHSDIEASVVKEAIIVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  411

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDNQs  471
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E      Q QL    K    +    + 
Sbjct  412  RAVVPNVSKMDKASLLGDAISYINELKTKLQQAETDKEEVQKQLDRMSKEGGGSRRAKER  471

Query  470  tssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVND  291
             S+  S+ +  ++++VKI+G D MIRVQ    N+P A+ M  L+EL+L V+HAS+S VND
Sbjct  472  KSNLDSASSVEMEIDVKIIGWDVMIRVQCGKKNHPGARFMEALKELDLEVNHASLSMVND  531

Query  290  IMLQDIVVKV  261
            +M+Q   VK+
Sbjct  532  LMIQQATVKM  541



>ref|XP_007210206.1| hypothetical protein PRUPE_ppa016220mg [Prunus persica]
 gb|EMJ11405.1| hypothetical protein PRUPE_ppa016220mg [Prunus persica]
Length=459

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 131/182 (72%), Gaps = 14/182 (8%)
 Frame = -1

Query  740  KKRGRKPGAGRVTPV-NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  564
            ++R    GA R + + NHVEAERQRREKLNHRFY LRSVVPNVS+MD++SLL+DAV+YIN
Sbjct  268  RRRSSNNGASRESSLLNHVEAERQRREKLNHRFYLLRSVVPNVSKMDRSSLLADAVAYIN  327

Query  563  ELKGKVEELE--CQLQLRESKKVKVEAVGDNQstssaas----------svaSPVDVEVK  420
            +LK KVEELE   Q Q +  KKV V  + DNQ + S +S          +   PV+V+VK
Sbjct  328  QLKAKVEELELKTQAQPQNPKKVSVNNL-DNQCSQSTSSIVDHHSSYNNTKVVPVEVDVK  386

Query  419  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSE  240
            I+G +A+IRVQ ++ +YP A+LMN L+ L L V+HASISSV ++M+QD+V +VP G  SE
Sbjct  387  IMGSEAIIRVQCQDQDYPYARLMNALKGLGLQVYHASISSVKELMIQDVVARVPYGFTSE  446

Query  239  DG  234
            + 
Sbjct  447  EA  448



>ref|XP_006414178.1| hypothetical protein EUTSA_v10024688mg [Eutrema salsugineum]
 gb|ESQ55631.1| hypothetical protein EUTSA_v10024688mg [Eutrema salsugineum]
Length=621

 Score =   180 bits (457),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 134/203 (66%), Gaps = 12/203 (6%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S HSD D   +KE      V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  407  DSNHSDLDASVVKEAESNRTVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  466

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAV  486
            Y+LR+VVPNVS+MDKASLL DA+SYINELK K+       EEL+ Q+ +  ++  K    
Sbjct  467  YSLRAVVPNVSKMDKASLLGDAISYINELKSKLQKVESDKEELQKQIDVMSNENGKCS--  524

Query  485  GDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  306
            G ++   +  S V+  ++++VKI+G DAMIR+Q    N+P AK M  L++L+L V+HAS+
Sbjct  525  GGDRKYLNQDSGVSIEMEIDVKIIGWDAMIRIQCSKRNHPGAKFMEALKDLDLEVNHASL  584

Query  305  SSVNDIMLQDIVVKVPEGLRSED  237
            S VND M+Q   VK+     ++D
Sbjct  585  SVVNDFMIQQATVKMGNQFFTQD  607



>gb|ABD65632.1| basic helix-loop-helix (bHLH) family transcription factor [Brassica 
oleracea]
Length=586

 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 134/205 (65%), Gaps = 12/205 (6%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S  SD +   +KE     IV   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  372  DSNRSDLEASVVKEAESGRIVAETEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  431

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQL--QLRESKKVKVE  492
            Y+LR+VVPNVS+MDKASLL DA+SYINELK K+       EEL+ Q+    +E     V+
Sbjct  432  YSLRAVVPNVSKMDKASLLGDAISYINELKAKLQKAEADKEELQKQIDGMSKEVGDGNVK  491

Query  491  AVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  312
            ++  +Q      S V+  V+++VKI+G DAMIR+Q    N+P AK M  L+ELEL V+HA
Sbjct  492  SLVKDQKCLDQDSGVSIEVEIDVKIIGWDAMIRIQCAKKNHPGAKFMEALKELELEVNHA  551

Query  311  SISSVNDIMLQDIVVKVPEGLRSED  237
            S+S VN+ M+Q   VK+     ++D
Sbjct  552  SLSVVNEFMIQQATVKMGNQFFTQD  576



>ref|XP_009360190.1| PREDICTED: transcription factor MYC2-like [Pyrus x bretschneideri]
Length=468

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/182 (54%), Positives = 132/182 (73%), Gaps = 14/182 (8%)
 Frame = -1

Query  740  KKRGRKPGA--GRV-TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  570
            KKRGR   +  GR  TP+NHVEAERQRR+KLN RFYALR+VVPNVSRMDKASLLSDAV Y
Sbjct  275  KKRGRSSNSETGRSETPINHVEAERQRRDKLNRRFYALRAVVPNVSRMDKASLLSDAVIY  334

Query  569  INELKGKVEELECQLQLRESKKV------KVEAVGDN-----QstssaassvaSPVDVEV  423
            INELK +V +LE ++Q +  K V         ++ D+     Q +S+  +  A  + ++V
Sbjct  335  INELKARVVQLEAKIQAQPGKPVVDIGGQTTTSIVDHHQTRPQQSSNYNNKAAGAMKIDV  394

Query  422  KIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRS  243
            KI+G +AMIRVQ  + +YP+A+LMN L++LEL V+HAS+SSV + MLQD+V +VP+G  S
Sbjct  395  KILGSEAMIRVQCPDCDYPNARLMNVLKDLELQVYHASLSSVKEWMLQDVVGRVPQGFTS  454

Query  242  ED  237
            E+
Sbjct  455  EE  456



>gb|KHN18804.1| Transcription factor MYC4 [Glycine soja]
Length=280

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/206 (47%), Positives = 128/206 (62%), Gaps = 24/206 (12%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +    K+   V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  55   DSDHSDLEASVAKQ---VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  111

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKK-----------  504
            R+VVPNVS+MDKASLL DA+ YINELK K+     E+ E + QL  +KK           
Sbjct  112  RAVVPNVSKMDKASLLGDAILYINELKSKLNVLDSEKTELEKQLDSTKKELELATKNPPP  171

Query  503  -----VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLR  339
                         N       +S  + +++EVKI+G DAM+R+Q    N+P+A+LM  L+
Sbjct  172  PPPPPPPPGPPPSNSVEPKKTTSKLADLELEVKIIGWDAMVRIQCSKKNHPAARLMAALK  231

Query  338  ELELAVHHASISSVNDIMLQDIVVKV  261
            +L+L VHHAS+S VND+M+Q   V +
Sbjct  232  DLDLEVHHASVSVVNDLMIQQATVNM  257



>ref|XP_011081344.1| PREDICTED: transcription factor MYC2-like [Sesamum indicum]
Length=469

 Score =   177 bits (450),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 129/181 (71%), Gaps = 12/181 (7%)
 Frame = -1

Query  740  KKRGRKP-GAGR---VTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  573
            +KR R     GR   +TP NHVEAERQRREKLN RFYALRS+VPNVSRMDKASLL+DAV+
Sbjct  278  RKRARNSENVGRNQLMTPANHVEAERQRREKLNQRFYALRSIVPNVSRMDKASLLADAVT  337

Query  572  YINELKGKVEELE--CQLQ-LRESKKVKVEAVGDNQstssaassvaSP-----VDVEVKI  417
            YI ELK K+  LE  C+++ L++  +  +  + D +ST S      S      +DVEVKI
Sbjct  338  YIKELKAKISGLEAKCRVESLKQEPRTGLLEMYDTKSTFSTVDFTRSASGCVIMDVEVKI  397

Query  416  VGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            +G +AMIRVQS + NYP A+LMN L +LE  + HAS+SSV D+M QD++++VP+GL SE+
Sbjct  398  LGSEAMIRVQSPDVNYPCARLMNVLGDLEFQISHASVSSVRDVMFQDVIIRVPDGLPSEE  457

Query  236  G  234
             
Sbjct  458  A  458



>emb|CDY03195.1| BnaC09g19610D [Brassica napus]
Length=545

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 130/193 (67%), Gaps = 11/193 (6%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +   +KE  IV+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  350  DSDHSDIEASVVKEAIIVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  408

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaa  456
            R+VVPNVS+MDKASLL DA+SYINELK K       LQ  E+ K +V+   D  S     
Sbjct  409  RAVVPNVSKMDKASLLGDAISYINELKTK-------LQQAETDKEEVQKQLDGMSKEGGG  461

Query  455  ssvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQD  276
            S     ++++VKI+G D MIRVQ    N+P A+ M  L+EL+L V+HAS+S VND+M+Q 
Sbjct  462  SVE---MEIDVKIIGWDVMIRVQCGKKNHPGARFMEALKELDLEVNHASLSVVNDLMIQQ  518

Query  275  IVVKVPEGLRSED  237
              VK+     + D
Sbjct  519  ATVKMGSQFFNHD  531



>ref|XP_009344509.1| PREDICTED: transcription factor MYC2-like, partial [Pyrus x bretschneideri]
Length=461

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 139/207 (67%), Gaps = 15/207 (7%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S+HSD +   ++E     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  240  DSDHSDLEASVVREADSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  298

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRES----KKVK  498
            YALR+VVPNVS+MDKASLL DA+SYINELK K+       EEL+ QL+   +    K  +
Sbjct  299  YALRAVVPNVSKMDKASLLGDAISYINELKLKLQTVETDKEELQKQLESMNNHLPCKDSR  358

Query  497  VEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  318
                  ++      SS    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL++ VH
Sbjct  359  SSGSIMSEEELKGCSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDMDVH  418

Query  317  HASISSVNDIMLQDIVVKVPEGLRSED  237
            HAS+S VND+M+Q   VK+   + ++D
Sbjct  419  HASVSVVNDLMIQQATVKMGSRIYTQD  445



>ref|XP_006366244.1| PREDICTED: transcription factor MYC2-like [Solanum tuberosum]
Length=650

 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 133/197 (68%), Gaps = 9/197 (5%)
 Frame = -1

Query  806  HSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSV  627
            HSD +   +KE  IV+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+V
Sbjct  442  HSDLEASVVKEA-IVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV  499

Query  626  VPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVGDNQst  468
            VPNVS+MDKASLL DA++YINELK KV       EEL  Q++    +     +   + S 
Sbjct  500  VPNVSKMDKASLLGDAIAYINELKSKVQNSDLDKEELRSQIESLRKELANKGSSNYSSSP  559

Query  467  ssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDI  288
             S        +D++VK++G DAMIR+Q    N+P+A+LM  L++L+L VHHAS+S VND+
Sbjct  560  PSNQDLKIVDMDIDVKVIGWDAMIRIQCSKKNHPAARLMAALKDLDLDVHHASVSVVNDL  619

Query  287  MLQDIVVKVPEGLRSED  237
            M+Q   VK+   L +++
Sbjct  620  MIQQATVKMGSRLYAQE  636



>emb|CAF74711.1| MYC transcription factor [Solanum tuberosum]
Length=646

 Score =   179 bits (455),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 134/198 (68%), Gaps = 9/198 (5%)
 Frame = -1

Query  809  EHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRS  630
            +HSD +   +KE  IV+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+
Sbjct  437  DHSDLEASVVKEA-IVEPERK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRA  494

Query  629  VVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVGDNQs  471
            VVPNVS+MDKASLL DA++YINELK KV       EEL  Q++    +     +   + S
Sbjct  495  VVPNVSKMDKASLLGDAIAYINELKSKVQNSDLDKEELRSQIESLRKELANKGSSNYSSS  554

Query  470  tssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVND  291
              S        +D++VK++G DAMIR+Q    N+P+A+LM  L++L+L VHHAS+S VND
Sbjct  555  PPSNQDLKIVDMDIDVKVIGWDAMIRIQCSKKNHPAARLMAALKDLDLDVHHASVSVVND  614

Query  290  IMLQDIVVKVPEGLRSED  237
            +M+Q   VK+   L +++
Sbjct  615  LMIQQATVKMGSRLYAQE  632



>ref|XP_010523833.1| PREDICTED: transcription factor MYC3-like [Tarenaya hassleriana]
Length=418

 Score =   176 bits (445),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 127/176 (72%), Gaps = 11/176 (6%)
 Frame = -1

Query  743  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  564
            P++R RK  +    P+NH+EAERQRREKLNHRFYALRSVVP VSRMDKASLLSDAVSYIN
Sbjct  229  PERRRRKANSTGEQPLNHIEAERQRREKLNHRFYALRSVVPRVSRMDKASLLSDAVSYIN  288

Query  563  ELKGKVEELECQLQLRESKKVKVEAVGD----------NQstssaassvaSPVDVEVKIV  414
            ELK K++ELE +L+  ++K+VK+E +            N S +  +    S V+V+VKIV
Sbjct  289  ELKRKIDELESKLK-PDNKRVKLEEMTTGLSNDQSGIKNASEALVSKRGYSKVEVDVKIV  347

Query  413  GPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLR  246
            G +A+IRVQ+EN +YP A L   LREL+L + H S+SSV ++M+Q +VV VP G R
Sbjct  348  GDEAVIRVQTENLSYPVAALTAALRELKLKIRHGSMSSVEELMVQQMVVTVPRGTR  403



>ref|XP_010445298.1| PREDICTED: transcription factor MYC4-like [Camelina sativa]
Length=612

 Score =   179 bits (453),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 130/196 (66%), Gaps = 11/196 (6%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S HSD +   +KE      V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  411  DSNHSDLEASVVKEAESNRTVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  470

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQsts  465
            Y+LR+VVPNVS+MDKASLL DA+SYINELK K+ + E     +E  + +++ +  NQ   
Sbjct  471  YSLRAVVPNVSKMDKASLLGDAISYINELKSKLLKAESD---KEELQKQIDGMKRNQEPG  527

Query  464  saassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIM  285
             +       ++V+VKI+G DAMIRVQ    N+P AK M  L+EL+L V+HAS+S VND+M
Sbjct  528  VSVE-----MEVDVKIIGWDAMIRVQCSKRNHPGAKFMEALKELDLEVNHASLSVVNDLM  582

Query  284  LQDIVVKVPEGLRSED  237
            +Q   VK+     ++D
Sbjct  583  IQQATVKMGNEFFTQD  598



>gb|EPS57820.1| hypothetical protein M569_16997, partial [Genlisea aurea]
Length=562

 Score =   178 bits (452),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 102/200 (51%), Positives = 133/200 (67%), Gaps = 12/200 (6%)
 Frame = -1

Query  809  EHSDSDCQFLK--EPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +HSD +   +K  +   V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  355  DHSDLEASIVKGADSSRVFDPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  414

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGK-------VEELECQLQLRESKKVKVEAVGDN  477
            R+VVPNVS+MDKASLL DA+SYINELK K       V+EL  QL   ES K +       
Sbjct  415  RAVVPNVSKMDKASLLGDAISYINELKSKLQNSEMDVDELRSQL---ESLKKEHNDSDPP  471

Query  476  QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  297
               ++A+++    VD+EVKI+G DAMI+VQ    N+P+A+LM   REL+L VHHAS+S V
Sbjct  472  TGYTTASATNNVSVDIEVKIIGRDAMIQVQCGKRNHPAAQLMTAFRELDLDVHHASVSVV  531

Query  296  NDIMLQDIVVKVPEGLRSED  237
            N++M+Q   VK+     ++D
Sbjct  532  NELMIQQATVKMGSKYFTQD  551



>gb|EYU32289.1| hypothetical protein MIMGU_mgv1a007575mg [Erythranthe guttata]
Length=403

 Score =   175 bits (444),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 100/169 (59%), Positives = 124/169 (73%), Gaps = 14/169 (8%)
 Frame = -1

Query  740  KKRGRKPGAGR----VTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  573
            KKRGRKP   R    +  +NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS
Sbjct  222  KKRGRKPAGPRGPDALPTMNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVS  281

Query  572  YINELKGKVEELECQ----LQLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPD  405
            YI ELK ++++L+      L    S  VK E   D++   S++S       VEVK+VG D
Sbjct  282  YIKELKSRLDDLQTNNVNKLLSSSSSVVKTETDDDDEPIISSSSL------VEVKMVGVD  335

Query  404  AMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVP  258
             MIRVQSE +NYPSA+LM+ +R+L+L + HAS+S VN+IM+QD+VV +P
Sbjct  336  GMIRVQSEKSNYPSARLMDAIRDLKLEIQHASMSCVNNIMIQDVVVTLP  384



>ref|XP_006283348.1| hypothetical protein CARUB_v10004392mg [Capsella rubella]
 gb|EOA16246.1| hypothetical protein CARUB_v10004392mg [Capsella rubella]
Length=614

 Score =   179 bits (453),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 134/203 (66%), Gaps = 10/203 (5%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S HSD +   +KE      V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  398  DSNHSDLEASVVKEAESNRTVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  457

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAV  486
            Y+LR+VVPN+S+MDKASLL DA+SYINELK K+       EEL+ Q++    +    ++ 
Sbjct  458  YSLRAVVPNISKMDKASLLGDAISYINELKSKLQKVESDKEELQKQIEGMSKEAANEKSY  517

Query  485  GDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  306
               +  ++  S V   ++V+VKI+G DAMIRVQ    N+P AK M  L+EL+L V+HAS+
Sbjct  518  VKERKCANQESGVTIEMEVDVKIIGWDAMIRVQCSKRNHPGAKFMEALKELDLEVNHASL  577

Query  305  SSVNDIMLQDIVVKVPEGLRSED  237
            S VND+M+Q   VK+ +   ++D
Sbjct  578  SVVNDLMIQQATVKMGKEFFTQD  600



>dbj|BAJ91022.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=684

 Score =   179 bits (453),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 133/201 (66%), Gaps = 23/201 (11%)
 Frame = -1

Query  815  ESEHSDSDCQF-------LKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKL  657
            ES+HSD +          +  PP    ++  P+KRGRKP  GR  P+NHVEAERQRREKL
Sbjct  463  ESDHSDLEASVREVESSRVVPPP----EEKRPRKRGRKPANGREEPLNHVEAERQRREKL  518

Query  656  NHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN  477
            N RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     +E+   ++EA+   
Sbjct  519  NQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKMTALESD---KETLHSQIEALKKE  575

Query  476  Qstssaassva---------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  324
            +    AA S +           V++E KI+G +AMIRVQ    N+P+AKLM  LREL+L 
Sbjct  576  RDARPAAPSSSGMHDNGARCHAVEIEAKILGLEAMIRVQCHKRNHPAAKLMTALRELDLD  635

Query  323  VHHASISSVNDIMLQDIVVKV  261
            V+HAS+S V DIM+Q + VK+
Sbjct  636  VYHASVSVVKDIMIQQVAVKM  656



>dbj|BAJ91674.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89030.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=684

 Score =   179 bits (453),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 102/201 (51%), Positives = 133/201 (66%), Gaps = 23/201 (11%)
 Frame = -1

Query  815  ESEHSDSDCQF-------LKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKL  657
            ES+HSD +          +  PP    ++  P+KRGRKP  GR  P+NHVEAERQRREKL
Sbjct  463  ESDHSDLEASVREVESSRVVPPP----EEKRPRKRGRKPANGREEPLNHVEAERQRREKL  518

Query  656  NHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN  477
            N RFYALR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     +E+   ++EA+   
Sbjct  519  NQRFYALRAVVPNVSKMDKASLLGDAISYINELRGKMTALESD---KETLHSQIEALKKE  575

Query  476  Qstssaassva---------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  324
            +    AA S +           V++E KI+G +AMIRVQ    N+P+AKLM  LREL+L 
Sbjct  576  RDARPAAPSSSGMHDNGARCHAVEIEAKILGLEAMIRVQCHKRNHPAAKLMTALRELDLD  635

Query  323  VHHASISSVNDIMLQDIVVKV  261
            V+HAS+S V DIM+Q + VK+
Sbjct  636  VYHASVSVVKDIMIQQVAVKM  656



>gb|KJB51639.1| hypothetical protein B456_008G226300 [Gossypium raimondii]
Length=646

 Score =   178 bits (452),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 132/194 (68%), Gaps = 9/194 (5%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVD--RQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S++SD +   +KE   V     +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  431  DSDNSDIEASVVKEAECVKPLEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  490

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVG  483
            ALR+VVPNVS+MDKASLL DA+SYINEL  KV       +EL+ QL+  + +  K ++  
Sbjct  491  ALRAVVPNVSKMDKASLLGDAISYINELSTKVQDAESEKQELQKQLEAMKKELAKKDSSP  550

Query  482  DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
             N  TS+   +    ++ EVK++G DAMIR+Q +  N+P+A+LM  L+EL L V HAS++
Sbjct  551  QNPKTSNHLGNRLIELETEVKVIGWDAMIRIQCKRKNHPAARLMAALKELNLDVQHASVT  610

Query  302  SVNDIMLQDIVVKV  261
             VND+M+Q   VK+
Sbjct  611  VVNDLMIQQATVKM  624



>ref|XP_008810069.1| PREDICTED: transcription factor MYC4-like [Phoenix dactylifera]
Length=434

 Score =   175 bits (444),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 110/211 (52%), Positives = 143/211 (68%), Gaps = 25/211 (12%)
 Frame = -1

Query  827  NSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHR  648
            +S  +SEHSDS+   + E     ++   P         GR TPVNHVEAERQRREKLNHR
Sbjct  224  SSSVDSEHSDSEGLLMVERRRPKKRGRKPGT-------GRETPVNHVEAERQRREKLNHR  276

Query  647  FYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQst  468
            FYALRSVVPNVSRMDKASLL+DAVSYI EL+ KVEELE      E+K+VK E + D    
Sbjct  277  FYALRSVVPNVSRMDKASLLADAVSYIKELRTKVEELEA-----EAKRVKKEIIVDQGVG  331

Query  467  ssaassva-------------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  327
             +A ++               + +++EVK++GPDA+IRV SEN ++P+AKLM  LRELE+
Sbjct  332  GAATTTSTTVSSVVSCGGGGLATMELEVKMLGPDALIRVHSENLSHPTAKLMGALRELEV  391

Query  326  AVHHASISSVNDIMLQDIVVKVPEGLRSEDG  234
             VHHAS+S+V ++ +QD+VV+VP  L+  DG
Sbjct  392  HVHHASVSTVKEVTVQDVVVRVPYALQVNDG  422



>ref|XP_002865164.1| hypothetical protein ARALYDRAFT_916752 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41423.1| hypothetical protein ARALYDRAFT_916752 [Arabidopsis lyrata subsp. 
lyrata]
Length=610

 Score =   178 bits (451),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 93/207 (45%), Positives = 138/207 (67%), Gaps = 17/207 (8%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +   +KE  +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  393  DSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  452

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG---------  483
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E     +E  + K++ +          
Sbjct  453  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAESD---KEEIQKKLDGMSKEGNNGKGG  509

Query  482  -----DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  318
                 + +S++  +++ +  ++++VKI+G D MIRVQ    ++P A+ M  L+EL+L V+
Sbjct  510  GSRAKERKSSNQDSTASSIEMEIDVKIIGWDVMIRVQCSKKDHPGARFMEALKELDLEVN  569

Query  317  HASISSVNDIMLQDIVVKVPEGLRSED  237
            HAS+S VND+M+Q   VK+     + D
Sbjct  570  HASLSVVNDLMIQQATVKMGSQFFNHD  596



>gb|AGQ80897.1| MYC1 [Lithospermum erythrorhizon]
Length=636

 Score =   178 bits (452),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 95/175 (54%), Positives = 125/175 (71%), Gaps = 17/175 (10%)
 Frame = -1

Query  743  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  564
            P+KRGRKP  GR+ P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL+DA+SYI 
Sbjct  443  PRKRGRKPANGRLEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLADAISYIT  502

Query  563  ELKGKVEELECQLQLRESKKVKVEAV-GDNQstssaassvaSP-------------VDVE  426
            ELK K+++ E     RE  K +VE +  D  S++  +   ++P             +D++
Sbjct  503  ELKSKLQKSES---AREDLKSQVEFLKKDLSSSTKESRKGSAPPTSRGTKNTKIVDIDID  559

Query  425  VKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKV  261
            VKI+G DAMIR+QS   N+P+AKLM  L+E +L VHHAS+S VND+M+Q   VK+
Sbjct  560  VKIIGWDAMIRIQSSKRNHPAAKLMAALQEHDLEVHHASVSVVNDLMIQQATVKM  614



>gb|AIT39751.1| transcription factor MYC2, partial [Chrysanthemum boreale]
Length=648

 Score =   178 bits (451),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 135/214 (63%), Gaps = 24/214 (11%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVD--RQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S+HSD D   +KE   +     +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  424  DSDHSDLDASMIKEVESIRVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  483

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG-------  483
            ALR+VVPNVS+MDKASLL DA+ YINELK KV+  +C    +E  + ++EA+        
Sbjct  484  ALRAVVPNVSKMDKASLLGDAILYINELKSKVDNTQCD---KEELRNQLEALKKELLTKD  540

Query  482  ------------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLR  339
                        D+    +   S  + +D++VK++G DAMIR+Q    N+P+A+LM   +
Sbjct  541  SRQSSSSAISLPDDMKMPTGVHSAIADLDIDVKVMGWDAMIRIQCNKKNHPAARLMAVFK  600

Query  338  ELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            EL+  V+HAS+S VND+M+Q   VK+   L S+D
Sbjct  601  ELDFEVNHASVSIVNDLMIQQATVKMGSRLYSQD  634



>ref|XP_003612909.1| BHLH transcription factor [Medicago truncatula]
 gb|AES95867.1| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=677

 Score =   178 bits (451),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/208 (49%), Positives = 135/208 (65%), Gaps = 26/208 (13%)
 Frame = -1

Query  815  ESEHSDSDCQFLKE--PPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S+HSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  451  DSDHSDLEASVVKEVDSSRVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  510

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEE-------LECQLQLRESKKVKVEAVG  483
            ALR+VVPNVS+MDKASLL DA+SYI ELK K+++       LE QL   +  K +++ + 
Sbjct  511  ALRAVVPNVSKMDKASLLGDAISYITELKTKLQKTESDKDGLEKQL---DGMKNEIQKIN  567

Query  482  DNQstss--------------aassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNG  345
            +NQS                 +++     +D++VKI+G DAMIRVQ    N+P+A+LM  
Sbjct  568  ENQSHQPPQQQQQQQPIPNKPSSNQALIDLDIDVKIIGWDAMIRVQCSKKNHPAARLMAA  627

Query  344  LRELELAVHHASISSVNDIMLQDIVVKV  261
            L EL+L VHHAS+S VND+M+Q   VK+
Sbjct  628  LMELDLEVHHASVSVVNDLMIQQATVKM  655



>ref|XP_009101493.1| PREDICTED: transcription factor MYC3 [Brassica rapa]
Length=580

 Score =   177 bits (449),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/195 (49%), Positives = 137/195 (70%), Gaps = 11/195 (6%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            ES+HSD +   +KE  +V+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  365  ESDHSDLEASVVKEAIVVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  423

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaa  456
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E + +  + +   +   G+ +S +S A
Sbjct  424  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAESEKEEIQKQLDGMSKEGNGKSGASRA  483

Query  455  ----------ssvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  306
                      S+ +  ++++VKI+G D MIRVQ    N+P ++ M+ L+EL+L V+HAS+
Sbjct  484  VKERRSSYQDSASSVEMEIDVKIIGWDVMIRVQCSKKNHPGSRFMDALKELDLEVNHASL  543

Query  305  SSVNDIMLQDIVVKV  261
            S VND+M+Q   VK+
Sbjct  544  SVVNDLMIQQATVKM  558



>ref|XP_006279855.1| hypothetical protein CARUB_v10028441mg [Capsella rubella]
 gb|EOA12753.1| hypothetical protein CARUB_v10028441mg [Capsella rubella]
Length=602

 Score =   177 bits (449),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 133/202 (66%), Gaps = 9/202 (4%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +   +KE  +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  387  DSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  446

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaa  456
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E   +  + +   V   G+ +  S A 
Sbjct  447  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAEIDKEEIQKRLDGVNKEGNGKGGSRAK  506

Query  455  ssvaS---------PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
               +S          ++++VKI+G D MIRVQ    ++P A+ M  L+EL+L V+HAS+S
Sbjct  507  ERKSSNQDSSGSSIEMEIDVKIIGWDVMIRVQCSKKDHPGARFMEALKELDLEVNHASLS  566

Query  302  SVNDIMLQDIVVKVPEGLRSED  237
             VND+M+Q   VK+     + D
Sbjct  567  VVNDLMIQQATVKMGSQFFNHD  588



>gb|AAB00686.1| phaseolin G-box binding protein PG1 [Phaseolus vulgaris]
Length=642

 Score =   177 bits (450),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 97/199 (49%), Positives = 130/199 (65%), Gaps = 17/199 (9%)
 Frame = -1

Query  809  EHSDSDCQFLKEPP--IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            E+SD +   +KE    +V+ ++  P+KRGRKPG GR  P+NHVEAERQRREKLN RFYAL
Sbjct  423  ENSDLEASVVKEADSRVVEPEKR-PRKRGRKPGNGREEPLNHVEAERQRREKLNQRFYAL  481

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC--------------QLQLRESKKVK  498
            R+VVPNVS+MDKASLL DA+SYINELK K+ ELE               +L+L       
Sbjct  482  RAVVPNVSKMDKASLLGDAISYINELKSKLSELESEKGELEKQLELVKKELELATKSPSP  541

Query  497  VEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  318
                  +   +   +S    +++EVKI+G DAMIR+Q    N+P+A+LM  L+EL+L V+
Sbjct  542  PPGPPPSNKEAKETTSKLIDLELEVKIIGWDAMIRIQCSKKNHPAARLMAALKELDLDVN  601

Query  317  HASISSVNDIMLQDIVVKV  261
            HAS+S VND+M+Q   V +
Sbjct  602  HASVSVVNDLMIQQATVNM  620



>gb|AAL55711.1|AF251689_1 putative transcription factor BHLH4 [Arabidopsis thaliana]
Length=589

 Score =   177 bits (449),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 134/203 (66%), Gaps = 10/203 (5%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S HSD +    KE     +V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  373  DSNHSDLEASVAKEAESNRVVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  432

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAV  486
            Y+LR+VVPNVS+MDKASLL DA+SYI+ELK K+       EEL+ Q+ +   +    ++ 
Sbjct  433  YSLRAVVPNVSKMDKASLLGDAISYISELKSKLQKAESDKEELQKQIDVMNKEAGNAKSS  492

Query  485  GDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  306
              ++   +  SSV   ++V+VKI+G DAMIR+Q    N+P AK M  L+EL+L V+HAS+
Sbjct  493  VKDRKCLNQESSVLIEMEVDVKIIGWDAMIRIQCSKRNHPGAKFMEALKELDLEVNHASL  552

Query  305  SSVNDIMLQDIVVKVPEGLRSED  237
            S VND+M+Q   VK+     ++D
Sbjct  553  SVVNDLMIQQATVKMGNQFFTQD  575



>ref|XP_009347383.1| PREDICTED: transcription factor MYC2 [Pyrus x bretschneideri]
Length=687

 Score =   178 bits (451),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/207 (49%), Positives = 139/207 (67%), Gaps = 15/207 (7%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S+HSD +   ++E     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  466  DSDHSDLEASVVREADSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  524

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRES----KKVK  498
            YALR+VVPNVS+MDKASLL DA+SYINELK K+       EEL+ QL+   +    K  +
Sbjct  525  YALRAVVPNVSKMDKASLLGDAISYINELKLKLQTVETDKEELQKQLESMNNHLPCKDSR  584

Query  497  VEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  318
                  ++      SS    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL++ VH
Sbjct  585  SSGSIMSEEELKGCSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDMDVH  644

Query  317  HASISSVNDIMLQDIVVKVPEGLRSED  237
            HAS+S VND+M+Q   VK+   + ++D
Sbjct  645  HASVSVVNDLMIQQATVKMGSRIYTQD  671



>ref|XP_004512525.1| PREDICTED: transcription factor MYC2-like [Cicer arietinum]
Length=664

 Score =   177 bits (450),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 135/203 (67%), Gaps = 21/203 (10%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQ-----QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNH  651
            +S+HSD +   +KE   VD       +  P+KRGRKP  GR  P+NHVEAERQRREKLN 
Sbjct  443  DSDHSDLEASVVKE---VDSSRMVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQ  499

Query  650  RFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESK----KVKVEAVG  483
            RFYALR+VVPNVS+MDKASLL DA+SYI ELK K+++ E    + E +    K +++ + 
Sbjct  500  RFYALRAVVPNVSKMDKASLLGDAISYITELKTKLQKTESDKDVLEKEIDEVKKELQKIN  559

Query  482  DNQstss---------aassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELE  330
            +N S  S         +++     +D++VKI+G DAMIR+Q    N+P+A+LM  L EL+
Sbjct  560  ENSSNPSQPQPLHNKPSSNKALINLDIDVKIIGWDAMIRIQCSKKNHPAARLMAALMELD  619

Query  329  LAVHHASISSVNDIMLQDIVVKV  261
            L VHHAS+S VND+M+Q   VK+
Sbjct  620  LEVHHASVSVVNDLMIQQATVKM  642



>ref|NP_193522.1| transcription factor MYC4 [Arabidopsis thaliana]
 sp|O49687.1|MYC4_ARATH RecName: Full=Transcription factor MYC4; Short=AtMYC4; AltName: 
Full=Basic helix-loop-helix protein 4; Short=AtbHLH4; Short=bHLH 
4; AltName: Full=Transcription factor EN 37; AltName: 
Full=bHLH transcription factor bHLH004 [Arabidopsis thaliana]
 emb|CAA17131.1| bHLH protein-like [Arabidopsis thaliana]
 emb|CAB78790.1| bHLH protein-like [Arabidopsis thaliana]
 dbj|BAD94748.1| putative transcription factor BHLH4 [Arabidopsis thaliana]
 gb|AEE83960.1| transcription factor MYC4 [Arabidopsis thaliana]
Length=589

 Score =   177 bits (448),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 134/203 (66%), Gaps = 10/203 (5%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S HSD +    KE     +V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  373  DSNHSDLEASVAKEAESNRVVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  432

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAV  486
            Y+LR+VVPNVS+MDKASLL DA+SYI+ELK K+       EEL+ Q+ +   +    ++ 
Sbjct  433  YSLRAVVPNVSKMDKASLLGDAISYISELKSKLQKAESDKEELQKQIDVMNKEAGNAKSS  492

Query  485  GDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  306
              ++   +  SSV   ++V+VKI+G DAMIR+Q    N+P AK M  L+EL+L V+HAS+
Sbjct  493  VKDRKCLNQESSVLIEMEVDVKIIGWDAMIRIQCSKRNHPGAKFMEALKELDLEVNHASL  552

Query  305  SSVNDIMLQDIVVKVPEGLRSED  237
            S VND+M+Q   VK+     ++D
Sbjct  553  SVVNDLMIQQATVKMGNQFFTQD  575



>ref|XP_010481417.1| PREDICTED: transcription factor MYC3 [Camelina sativa]
Length=610

 Score =   177 bits (449),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 132/203 (65%), Gaps = 13/203 (6%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +   +KE  +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  397  DSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  456

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstss--  462
            R+VVPNVS+MDKASLL+DA+SYINELK K+++ E     +E  + +++ V          
Sbjct  457  RAVVPNVSKMDKASLLADAISYINELKSKLQQAEID---KEEIQKRLDGVNKEGKGGGGG  513

Query  461  --------aassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  306
                    +    +  ++++VKI+G D MIRVQ    ++P A+ M  L+EL+L V+HAS+
Sbjct  514  SRGRERNCSNQDASIEMEIDVKIIGWDVMIRVQCSKKDHPGARFMEALKELDLEVNHASL  573

Query  305  SSVNDIMLQDIVVKVPEGLRSED  237
            S VND+M+Q   VK+     + D
Sbjct  574  SVVNDLMIQQATVKMGSQFFNHD  596



>ref|XP_011650295.1| PREDICTED: transcription factor bHLH14-like isoform X1 [Cucumis 
sativus]
Length=466

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/193 (52%), Positives = 129/193 (67%), Gaps = 14/193 (7%)
 Frame = -1

Query  785  FLKEPPIVDRQQNAPKKRGRKPGAGRVT-----PVNHVEAERQRREKLNHRFYALRSVVP  621
            FL+   I   Q    KKRG++      T     PVNHVEAERQRR+KLN RFYALRSVVP
Sbjct  265  FLRTLSI---QNTVGKKRGKRSAKNIKTELSSLPVNHVEAERQRRQKLNQRFYALRSVVP  321

Query  620  NVSRMDKASLLSDAVSYINELKGKVEELECQL-----QLRESKKVKVEAVGDNQstssaa  456
            NVS+MDKASLL+DA  YI ELK KV++LE +L     Q   S    VE    +  TS   
Sbjct  322  NVSKMDKASLLADAAEYIKELKSKVQKLESKLKQSQHQTSSSTISTVEQT-ISSITSFTN  380

Query  455  ssvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQD  276
            ++  +  +VEV+++G +AM+RVQ  + NYPSA+L+N L+EL L VHHAS+SSVN++MLQD
Sbjct  381  NNNNNNNNVEVQLIGSEAMVRVQCRDENYPSARLLNVLKELGLQVHHASLSSVNEMMLQD  440

Query  275  IVVKVPEGLRSED  237
            +VV+VP  +   D
Sbjct  441  VVVRVPHAVAWRD  453



>ref|XP_010441550.1| PREDICTED: transcription factor MYC3-like [Camelina sativa]
Length=607

 Score =   177 bits (448),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/200 (46%), Positives = 129/200 (65%), Gaps = 7/200 (4%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +   +KE  +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  394  DSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  453

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVGDN  477
            R+VVPNVS+MDKASLL DA+SYINELK K+       EE++ +L     +          
Sbjct  454  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAEVDKEEIQKRLDGVNKEGKGGGGGSRA  513

Query  476  QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSV  297
            +    +    +  ++++VKI+G D MIRVQ    ++P A+ M  L+EL+L V+HAS+S V
Sbjct  514  RERKCSNQDTSIEMEIDVKIIGWDVMIRVQCSKKDHPGARFMEALKELDLEVNHASLSVV  573

Query  296  NDIMLQDIVVKVPEGLRSED  237
            ND+M+Q   VK+     + D
Sbjct  574  NDLMIQQATVKMGSQFFNHD  593



>ref|XP_008245390.1| PREDICTED: transcription factor MYC2-like [Prunus mume]
Length=483

 Score =   175 bits (443),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/175 (55%), Positives = 129/175 (74%), Gaps = 13/175 (7%)
 Frame = -1

Query  719  GAGRVTPV-NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVE  543
            GA R + + NHVEAERQRREKLNHRFY LRSVVPNVS+MD++SLL+DAVSYIN+LK KVE
Sbjct  298  GASRASQLLNHVEAERQRREKLNHRFYVLRSVVPNVSKMDRSSLLADAVSYINQLKAKVE  357

Query  542  ELECQLQLR-ESKKVKVEAVGDNQstssaassva-----------SPVDVEVKIVGPDAM  399
            ELE ++Q + ++ KV   +  D+QS+ S +S              +P++V+VKI+G DAM
Sbjct  358  ELEAKVQEQPKNPKVSNASSLDHQSSQSTSSIANHPHSSYSNRSVAPLEVDVKILGSDAM  417

Query  398  IRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  234
            IRVQ  + +YP A+LMN L+ L L V+HASISSV ++M+QD+V +VP G  SE+ 
Sbjct  418  IRVQCPDQDYPYARLMNALKGLGLQVYHASISSVKELMIQDVVARVPYGFTSEEA  472



>ref|XP_004146202.2| PREDICTED: transcription factor MYC3-like isoform X2 [Cucumis 
sativus]
 gb|KGN55667.1| hypothetical protein Csa_3G002860 [Cucumis sativus]
Length=447

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 97/181 (54%), Positives = 125/181 (69%), Gaps = 11/181 (6%)
 Frame = -1

Query  749  NAPKKRGRKPGAGRVT-----PVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLS  585
            N  KKRG++      T     PVNHVEAERQRR+KLN RFYALRSVVPNVS+MDKASLL+
Sbjct  255  NVGKKRGKRSAKNIKTELSSLPVNHVEAERQRRQKLNQRFYALRSVVPNVSKMDKASLLA  314

Query  584  DAVSYINELKGKVEELECQL-----QLRESKKVKVEAVGDNQstssaassvaSPVDVEVK  420
            DA  YI ELK KV++LE +L     Q   S    VE    +  TS   ++  +  +VEV+
Sbjct  315  DAAEYIKELKSKVQKLESKLKQSQHQTSSSTISTVEQT-ISSITSFTNNNNNNNNNVEVQ  373

Query  419  IVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSE  240
            ++G +AM+RVQ  + NYPSA+L+N L+EL L VHHAS+SSVN++MLQD+VV+VP  +   
Sbjct  374  LIGSEAMVRVQCRDENYPSARLLNVLKELGLQVHHASLSSVNEMMLQDVVVRVPHAVAWR  433

Query  239  D  237
            D
Sbjct  434  D  434



>dbj|BAJ86015.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=684

 Score =   177 bits (449),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/201 (50%), Positives = 132/201 (66%), Gaps = 23/201 (11%)
 Frame = -1

Query  815  ESEHSDSDCQF-------LKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKL  657
            ES+HSD +          +  PP    ++  P+KRGRKP  GR  P+NHVEAERQRREKL
Sbjct  463  ESDHSDLEASVREVESSRVVPPP----EEKRPRKRGRKPANGREEPLNHVEAERQRREKL  518

Query  656  NHRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDN  477
            N RFY LR+VVPNVS+MDKASLL DA+SYINEL+GK+  LE     +E+   ++EA+   
Sbjct  519  NQRFYTLRAVVPNVSKMDKASLLGDAISYINELRGKMTALESD---KETLHSQIEALKKE  575

Query  476  Qstssaassva---------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  324
            +    AA S +           V++E KI+G +AMIRVQ    N+P+AKLM  LREL+L 
Sbjct  576  RDARPAAPSSSGMHDNGARCHAVEIEAKILGLEAMIRVQCHKRNHPAAKLMTALRELDLD  635

Query  323  VHHASISSVNDIMLQDIVVKV  261
            V+HAS+S V DIM+Q + VK+
Sbjct  636  VYHASVSVVKDIMIQQVAVKM  656



>ref|XP_010434608.1| PREDICTED: transcription factor MYC4-like [Camelina sativa]
Length=623

 Score =   177 bits (448),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/205 (49%), Positives = 131/205 (64%), Gaps = 17/205 (8%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S HSD +   +KE      V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  410  DSNHSDLEASVVKEAESNRTVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  469

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQL--QLRESKKVKVE  492
            Y+LR+VVPNVS+MDKASLL DA+SYINELK K+       EEL+ Q+    +E+   K  
Sbjct  470  YSLRAVVPNVSKMDKASLLGDAISYINELKSKLLKAESDKEELQKQIDGMSKEAANGKSS  529

Query  491  AVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  312
                NQ    +       ++V+VKI+G DAMIRVQ    N+P AK M  L+EL+L V+HA
Sbjct  530  VKERNQEPGVSVE-----MEVDVKIIGWDAMIRVQCSKRNHPGAKFMEALKELDLEVNHA  584

Query  311  SISSVNDIMLQDIVVKVPEGLRSED  237
            S+S VND+M+Q   VK+     ++D
Sbjct  585  SLSVVNDLMIQQATVKMGNEFFTQD  609



>ref|XP_002868032.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44291.1| basic helix-loop-helix family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=598

 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/203 (49%), Positives = 137/203 (67%), Gaps = 10/203 (5%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S HSD +    KE      V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  382  DSNHSDLEASVAKEAESNRFVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  441

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-QLQLRESKKVKVEAVGDNQst  468
            Y+LR+VVPNVS+MDKASLL DA+SYINELK K+++ E  + +L++     ++  G+++S+
Sbjct  442  YSLRAVVPNVSKMDKASLLGDAISYINELKSKLQKAESDKEELQKQFDGMIKEAGNSKSS  501

Query  467  s------saassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASI  306
                   +  SSV   ++V+VKI+G DAMIR+Q    N+P AK M  L+EL+L V+HAS+
Sbjct  502  VKDRRCLNQESSVLIEMEVDVKIIGWDAMIRIQCSKRNHPGAKFMEALKELDLEVNHASL  561

Query  305  SSVNDIMLQDIVVKVPEGLRSED  237
            S VND+M+Q   VK+     ++D
Sbjct  562  SVVNDLMIQQATVKMGNQFFTQD  584



>emb|CAF74710.1| MYC transcription factor [Solanum tuberosum]
Length=692

 Score =   177 bits (449),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/197 (51%), Positives = 128/197 (65%), Gaps = 17/197 (9%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +SEHSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  475  DSEHSDLEASVVKEADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  534

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGD------  480
            ALR+VVPNVS+MDKASLL DA+SYINELK K++  E     +E  K ++E +        
Sbjct  535  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQNTESD---KEDLKSQIEDLKKESRRPG  591

Query  479  ----NQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  312
                NQ        V   VD++VKI+G DAMI +Q    N+P+A+LM  L EL+L VHHA
Sbjct  592  PPPPNQDLKIGGKIVD--VDIDVKIIGWDAMIGIQCNKKNHPAARLMAALMELDLDVHHA  649

Query  311  SISSVNDIMLQDIVVKV  261
            S+S VND+M+Q   VK+
Sbjct  650  SVSVVNDLMIQQATVKM  666



>emb|CDY44507.1| BnaC01g10420D [Brassica napus]
Length=586

 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 134/205 (65%), Gaps = 12/205 (6%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S  SD +   +KE     IV   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  372  DSNRSDLEASVVKEAESGRIVAEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  431

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-QLQLRESKKVKVEAVGD----  480
            Y+LR+VVPNVS+MDKASLL DA+SYINELK K+++ E  + +L++      + VGD    
Sbjct  432  YSLRAVVPNVSKMDKASLLGDAISYINELKAKLQKAEADKEELQKQIGGMSKEVGDGNVK  491

Query  479  ----NQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  312
                +Q      S V+  V+++VKI+G DAMIR+Q    N+P AK M  L+ELEL V+HA
Sbjct  492  SSVKDQKCLDQDSGVSIEVEIDVKIIGWDAMIRIQCGKNNHPGAKFMEALKELELEVNHA  551

Query  311  SISSVNDIMLQDIVVKVPEGLRSED  237
            S+S VN+ M+Q   VK+     ++D
Sbjct  552  SLSVVNEFMIQQATVKMGNQFFTQD  576



>ref|XP_010494857.1| PREDICTED: transcription factor MYC3-like [Camelina sativa]
Length=607

 Score =   176 bits (447),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/204 (45%), Positives = 131/204 (64%), Gaps = 14/204 (7%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +   +KE  +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  393  DSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  452

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstss--  462
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E     +E  + +++ V          
Sbjct  453  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAEID---KEEIQKRLDGVNKEGKGGGGG  509

Query  461  ---------aassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  309
                     +    +  ++++VKI+G D MIRVQ    ++P A+ M  L+EL+L V+HAS
Sbjct  510  GSRARERKCSNQDTSIEMEIDVKIIGWDVMIRVQCSKKDHPGARFMEALKELDLEVNHAS  569

Query  308  ISSVNDIMLQDIVVKVPEGLRSED  237
            +S VND+M+Q   VK+     + D
Sbjct  570  LSVVNDLMIQQATVKMGSQFFNHD  593



>gb|ADH04263.1| bHLH2 transcription factor [Nicotiana benthamiana]
Length=657

 Score =   177 bits (448),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 135/202 (67%), Gaps = 16/202 (8%)
 Frame = -1

Query  806  HSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
             SD +   +KE     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  446  QSDLEASVVKEADSSRVVDPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  504

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVGDN  477
            R+VVPNVS+MDKASLL DA+++INELK KV       EEL  Q+   ES + ++   G N
Sbjct  505  RAVVPNVSKMDKASLLGDAIAFINELKSKVQNSDSDKEELRNQI---ESLRNELANKGSN  561

Query  476  QstssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
             +     +     V  D++VK++G DAMIR+QS   N+P+AKLM  L EL+L VHHAS+S
Sbjct  562  YTGPPPLNQELKIVDMDIDVKVIGWDAMIRIQSNKKNHPAAKLMAALMELDLDVHHASVS  621

Query  302  SVNDIMLQDIVVKVPEGLRSED  237
             VN++M+Q   VK+   L +++
Sbjct  622  VVNELMIQQATVKMGSRLYTQE  643



>gb|KHM99168.1| Transcription factor MYC2 [Glycine soja]
Length=426

 Score =   173 bits (439),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 96/201 (48%), Positives = 126/201 (63%), Gaps = 22/201 (11%)
 Frame = -1

Query  806  HSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSV  627
            HSD +    K+   V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+V
Sbjct  206  HSDLEASVAKQ---VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAV  262

Query  626  VPNVSRMDKASLLSDAVSYINELKGKVEEL-----ECQLQLRESKK--------------  504
            VPNVS+MDKASLL DA+SYINELK K+  L     E + QL  +KK              
Sbjct  263  VPNVSKMDKASLLGDAISYINELKLKLNGLDSEKGELEKQLDSAKKELELATKNPPPPPP  322

Query  503  VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  324
                    N   +   ++  + +++EVKI+G DAMIR+Q    N+P+A+LM  L++L+L 
Sbjct  323  PPPGLPPSNNEEAKKTTTKLADLEIEVKIIGWDAMIRIQCSKKNHPAARLMAALKDLDLE  382

Query  323  VHHASISSVNDIMLQDIVVKV  261
            VHHAS+S VND+M+Q   V +
Sbjct  383  VHHASVSVVNDLMIQQATVNM  403



>gb|KFK31432.1| hypothetical protein AALP_AA6G111200 [Arabis alpina]
Length=585

 Score =   176 bits (446),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 93/202 (46%), Positives = 137/202 (68%), Gaps = 12/202 (6%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +   +KE  +V+  +  P+KRGRKP  GR  P+NHVEAERQRREKLN +FY+L
Sbjct  376  DSDHSDLEASVVKEAIVVEPPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQKFYSL  435

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG---------  483
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E     +E  +  ++ +G         
Sbjct  436  RAVVPNVSKMDKASLLGDAISYINELKTKLQQAEND---KEEIQKLLDGMGKEGNGTRGR  492

Query  482  DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
            + +  S+  S+ +  ++++VKI+G D MIRVQ    N+P A+ M+ L+EL+L V+HAS+S
Sbjct  493  ERKRGSNQDSASSIEMEIDVKIIGWDVMIRVQCSKKNHPGARFMDALKELDLEVNHASLS  552

Query  302  SVNDIMLQDIVVKVPEGLRSED  237
             VN++M+Q   VK+     + D
Sbjct  553  VVNELMIQQATVKMGSQFFNHD  574



>ref|XP_009800420.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=659

 Score =   176 bits (447),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 136/202 (67%), Gaps = 16/202 (8%)
 Frame = -1

Query  806  HSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
             SD +   +KE     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  448  QSDLEASVVKEADSSRVVDPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  506

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVGDN  477
            R+VVPNVS+MDKASLL DA+++INELK KV       EEL  Q+   ES + ++   G N
Sbjct  507  RAVVPNVSKMDKASLLGDAIAFINELKSKVQNSDSDKEELRNQI---ESLRNELANKGSN  563

Query  476  QstssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
             +    ++     V  D++VK++G DAMIR+QS   N+P+A+LM  L EL+L VHHAS+S
Sbjct  564  YTGPPPSNQELKIVDMDIDVKVIGWDAMIRIQSNKKNHPAARLMTALMELDLDVHHASVS  623

Query  302  SVNDIMLQDIVVKVPEGLRSED  237
             VN++M+Q   VK+   L +++
Sbjct  624  VVNELMIQQATVKMGSRLYTQE  645



>ref|XP_006398371.1| hypothetical protein EUTSA_v10000808mg [Eutrema salsugineum]
 gb|ESQ39824.1| hypothetical protein EUTSA_v10000808mg [Eutrema salsugineum]
Length=665

 Score =   176 bits (447),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 135/202 (67%), Gaps = 10/202 (5%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +   +KE  +V+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  451  DSDHSDLEASVVKEAIVVEPEK-KPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  509

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDNQs  471
            R+VVPNVS+MDKASLL DA+SYINELK K+++ E      Q QL    K      G ++ 
Sbjct  510  RAVVPNVSKMDKASLLGDAISYINELKSKLQQAESDKEEIQKQLDGMSKEGNGKSGGSRV  569

Query  470  t----ssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
                 S+  S+ +  ++++VKI+G D MIRVQ    N+P A+ M  L+EL+L V+HAS+S
Sbjct  570  KERKCSNQDSASSIEMEIDVKIIGWDVMIRVQCSKKNHPGARFMEALKELDLEVNHASLS  629

Query  302  SVNDIMLQDIVVKVPEGLRSED  237
             VND+M+Q   VK+     + D
Sbjct  630  VVNDLMIQQATVKMGSQFFNHD  651



>ref|XP_009587276.1| PREDICTED: transcription factor MYC2-like [Nicotiana tomentosiformis]
 gb|ADH04270.1| MYC2b transcription factor [Nicotiana tabacum]
Length=658

 Score =   176 bits (447),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 100/202 (50%), Positives = 136/202 (67%), Gaps = 16/202 (8%)
 Frame = -1

Query  806  HSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            HSD +   +KE     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  447  HSDLEASVVKEADSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  505

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVE-------ELECQLQLRESKKVKVEAVGDN  477
            R+VVPNVS+MDKASLL DA+++INELK KV+       EL  Q+   ES + ++   G N
Sbjct  506  RAVVPNVSKMDKASLLGDAIAFINELKSKVQNSDSDKDELRNQI---ESLRNELANKGSN  562

Query  476  QstssaassvaSPV--DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
             +     +     V  D++VK++G DAMIR+QS   N+P+A+LM  L EL+L VHHAS+S
Sbjct  563  YTGPPPPNQDLKIVDMDIDVKVIGWDAMIRIQSNKKNHPAARLMAALMELDLDVHHASVS  622

Query  302  SVNDIMLQDIVVKVPEGLRSED  237
             VN++M+Q   VK+   L +++
Sbjct  623  VVNELMIQQATVKMGSRLYTQE  644



>dbj|BAJ33793.1| unnamed protein product [Thellungiella halophila]
Length=606

 Score =   176 bits (446),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 132/194 (68%), Gaps = 10/194 (5%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +   +KE  +V+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY+L
Sbjct  392  DSDHSDLEASVVKEAIVVEPEK-KPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYSL  450

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDNQs  471
            R+VVPNVS MDKASLL DA+SYINELK K+++ E      Q QL    K      G ++ 
Sbjct  451  RAVVPNVSEMDKASLLGDAISYINELKSKLQQAESDKEEIQKQLDGMSKEGNGKSGGSRV  510

Query  470  t----ssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
                 S+  S+ +  ++++VKI+G D MIRVQ    N+P A+ M  L+EL+L V+HAS+S
Sbjct  511  KERKCSNQDSASSIEMEIDVKIIGWDVMIRVQCSKKNHPGARFMEALKELDLEVNHASLS  570

Query  302  SVNDIMLQDIVVKV  261
             VND+M+Q   VK+
Sbjct  571  VVNDLMIQQATVKM  584



>ref|XP_010530031.1| PREDICTED: transcription factor MYC4 [Tarenaya hassleriana]
Length=653

 Score =   176 bits (446),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 134/206 (65%), Gaps = 14/206 (7%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S+HSD +    KE     IV+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  435  DSDHSDVEASVAKEADSSRIVEPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  493

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRE-----SKKVKV  495
            Y+LR+VVPNVS+MDKASLL DA+SYINELK K++E E      Q QL E     S K   
Sbjct  494  YSLRAVVPNVSKMDKASLLGDAISYINELKSKLQEAESDKEDLQKQLNELNKEGSGKDSR  553

Query  494  EAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  315
                 ++   +  S  A  ++++VKI+G D MIR+Q    N+P AK M  L+EL+L V+H
Sbjct  554  PQSSKDRKGLNQDSGPAMEMEIDVKIIGWDVMIRIQCSKKNHPGAKFMEALKELDLEVNH  613

Query  314  ASISSVNDIMLQDIVVKVPEGLRSED  237
            AS+S VND+M+Q   VK+     ++D
Sbjct  614  ASLSVVNDLMIQQATVKMGNRFLTQD  639



>ref|XP_008341963.1| PREDICTED: transcription factor MYC2-like [Malus domestica]
Length=688

 Score =   176 bits (446),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 100/207 (48%), Positives = 138/207 (67%), Gaps = 15/207 (7%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S+HSD +   ++E     +VD Q+  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  467  DSDHSDLEASVVREADSSRVVD-QEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  525

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRES----KKVK  498
            YALR+VVPNVS+MDKASLL DA++YINELK K+       EEL+ QL+        K  +
Sbjct  526  YALRAVVPNVSKMDKASLLGDAIAYINELKLKLQTVETDKEELQNQLESMNKDLPCKDSR  585

Query  497  VEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  318
                  ++      SS    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL++ VH
Sbjct  586  SSGSIMSEDELKGCSSKLLDMDIDVKIIGRDAMIRIQCCKKNHPAARLMAALKELDMDVH  645

Query  317  HASISSVNDIMLQDIVVKVPEGLRSED  237
            +AS+S VND+M+Q   VK+   + ++D
Sbjct  646  YASVSVVNDLMIQQATVKMGSRIYTQD  672



>ref|XP_009765330.1| PREDICTED: transcription factor MYC2-like [Nicotiana sylvestris]
Length=423

 Score =   172 bits (437),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 127/182 (70%), Gaps = 17/182 (9%)
 Frame = -1

Query  749  NAPKKRGRKPGAGRVTP------VNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLL  588
            N  + R RK  +  +        +NHVEAER RREKLNHRFYALRSVVP VS+MDKASLL
Sbjct  221  NINRSRKRKADSSSIITGRSEMAMNHVEAERIRREKLNHRFYALRSVVPYVSKMDKASLL  280

Query  587  SDAVSYINELKGKVEELECQLQLRESKKVKVE---------AVGD--NQstssaassvaS  441
            +DAV+YI ELK KVE+LE ++Q ++ K   +E         AV D  N  + S+++   +
Sbjct  281  ADAVTYIKELKAKVEDLESKIQSQKPKNNLMEQHDSHSASSAVFDPANNKSFSSSNGGRN  340

Query  440  PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKV  261
             +++EVKI+G +AMIRVQS + NYP A+LMN  RE+E  ++HAS+SS  D+MLQDIV++V
Sbjct  341  GMEIEVKIIGTEAMIRVQSLDVNYPCARLMNVFREMEFQIYHASVSSFKDLMLQDIVIRV  400

Query  260  PE  255
            P+
Sbjct  401  PD  402



>ref|XP_009420803.1| PREDICTED: transcription factor MYC3-like [Musa acuminata subsp. 
malaccensis]
Length=399

 Score =   172 bits (436),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 98/198 (49%), Positives = 134/198 (68%), Gaps = 10/198 (5%)
 Frame = -1

Query  827  NSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHR  648
            +S  +SEHSDSDC  L E     ++    ++ G   G     P NHVEAERQRREKLNHR
Sbjct  200  SSSVDSEHSDSDCHLLAERRRPKKRGRK-QESGSHEG-----PANHVEAERQRREKLNHR  253

Query  647  FYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQst  468
            FYALRSVVPNVSRMDKASLLSDAV+YI EL+ KV++LE + +      +K          
Sbjct  254  FYALRSVVPNVSRMDKASLLSDAVAYIKELEAKVDKLEAEAK----TAMKETTTSATTHG  309

Query  467  ssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDI  288
            ++  ++  + ++VEVK++G +A+IR QS++ N+P A+LM  LR+L L VHHAS+S V + 
Sbjct  310  TTTTTTSETAMEVEVKLLGAEALIRAQSDDRNHPPARLMVALRDLGLHVHHASVSCVKES  369

Query  287  MLQDIVVKVPEGLRSEDG  234
            +LQD+VV+VP  L+  +G
Sbjct  370  VLQDVVVEVPCELQGHEG  387



>ref|XP_002280253.1| PREDICTED: transcription factor MYC2-like [Vitis vinifera]
Length=663

 Score =   176 bits (445),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 135/211 (64%), Gaps = 18/211 (9%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S+HSD +   ++E     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  439  DSDHSDLEASVVREADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  498

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC---QLQLRESKKVKVEAVGDNQs  471
            ALR+VVPNVS+MDKASLL DA+SYINEL+ K++  E     LQ   +   K  A  D+Q 
Sbjct  499  ALRAVVPNVSKMDKASLLGDAISYINELRTKLQSAESDKEDLQKEVNSMKKELASKDSQY  558

Query  470  tssaa-------------ssvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELE  330
            + S+               S    +D++VKI+G DAMIR+Q    N+P+AKLM  L+EL+
Sbjct  559  SGSSRPPPDQDLKMSNHHGSKLVEMDIDVKIIGWDAMIRIQCSKKNHPAAKLMGALKELD  618

Query  329  LAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            L V+HAS+S VND+M+Q   VK+     ++D
Sbjct  619  LDVNHASVSVVNDLMIQQATVKMGSRFYTQD  649



>gb|AGL98100.1| transcription factor MYC2 [Nicotiana attenuata]
Length=656

 Score =   176 bits (445),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 124/178 (70%), Gaps = 12/178 (7%)
 Frame = -1

Query  743  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  564
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DA+++IN
Sbjct  468  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAIAFIN  527

Query  563  ELKGKV-------EELECQLQLRESKKVKVEAVGDNQst--ssaassvaSPVDVEVKIVG  411
            ELK KV       EEL  Q+   ES + ++   G N +    S        +D++VK++G
Sbjct  528  ELKSKVQNSDSDKEELRNQI---ESLRKELANKGSNYTGPPPSNQDLKILDMDIDVKVIG  584

Query  410  PDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
             DAMIR+QS   N+P+A+LM  L EL+L VHHAS+S VN++M+Q   VK+   L +++
Sbjct  585  WDAMIRIQSNKKNHPAARLMAALMELDLDVHHASVSVVNELMIQQATVKMGSRLYTQE  642



>gb|KJB25303.1| hypothetical protein B456_004G184800 [Gossypium raimondii]
Length=676

 Score =   176 bits (445),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 132/196 (67%), Gaps = 11/196 (6%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S+HSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN +FY
Sbjct  459  DSDHSDLEASVVKEADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQKFY  518

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQ-LRESKKVKVEAV  486
            ALR+VVPNVS+MDKASLL DA+SYINELK K+       EE++ QL+ L+++   K    
Sbjct  519  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQSADSEKEEMQSQLEALKKNLSSKAPPP  578

Query  485  GDNQst-ssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  309
             D     S+        +++EVKI+G DAMI++Q    N+P+AKLM  L+EL+L VHHAS
Sbjct  579  HDQDLKISNHTGDKLIDLEIEVKIIGWDAMIQIQCSKKNHPAAKLMAALKELDLDVHHAS  638

Query  308  ISSVNDIMLQDIVVKV  261
            +S V D+M+Q   VK+
Sbjct  639  VSVVKDLMIQQANVKM  654



>gb|KJB37703.1| hypothetical protein B456_006G216700 [Gossypium raimondii]
Length=656

 Score =   176 bits (445),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 103/206 (50%), Positives = 132/206 (64%), Gaps = 30/206 (15%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S++SD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN +FY
Sbjct  438  DSDNSDIEASVVKEADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQKFY  497

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKKVKVEAVGDN  477
            ALR+VVPNVS+MDKASLL DA+SYINEL+ KV     E+ E Q QL E KK         
Sbjct  498  ALRAVVPNVSKMDKASLLGDAISYINELRTKVQDADSEKEELQKQLDEMKK---------  548

Query  476  QstssaassvaSP--------------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLR  339
            Q  S  +   A P              +D++VKI+G DAMIR+Q    N+P+A+LM  L+
Sbjct  549  QLASKESCWTAPPPPDEDRNMSNKLIELDIDVKIIGLDAMIRIQCSKKNHPAARLMTALK  608

Query  338  ELELAVHHASISSVNDIMLQDIVVKV  261
            EL+L VHHAS+S VND+M+Q   VK+
Sbjct  609  ELDLDVHHASVSVVNDLMIQQASVKM  634



>ref|XP_007156435.1| hypothetical protein PHAVU_003G285700g [Phaseolus vulgaris]
 gb|ESW28429.1| hypothetical protein PHAVU_003G285700g [Phaseolus vulgaris]
Length=642

 Score =   175 bits (444),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 96/198 (48%), Positives = 126/198 (64%), Gaps = 15/198 (8%)
 Frame = -1

Query  809  EHSDSDCQFLKEPPI-VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  633
            E+SD +   +KE    V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR
Sbjct  423  ENSDLEASVVKEADSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALR  482

Query  632  SVVPNVSRMDKASLLSDAVSYINELKGKVEELEC--------------QLQLRESKKVKV  495
            +VVPNVS+MDKASLL DA+SYINELK K+ ELE               +L+L        
Sbjct  483  AVVPNVSKMDKASLLGDAISYINELKSKLSELESEKGELEKQLELVKKELELATKSPSPP  542

Query  494  EAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  315
                 +   +   +S    +++EVKI+G DAMIR+Q    N+P+A+LM  L+EL+L V+H
Sbjct  543  PGPPPSNKEAKETTSKLIDLELEVKIIGWDAMIRIQCSKKNHPAARLMAALKELDLDVNH  602

Query  314  ASISSVNDIMLQDIVVKV  261
            AS+S VND+M+Q   V +
Sbjct  603  ASVSVVNDLMIQQATVNM  620



>ref|XP_012076236.1| PREDICTED: transcription factor MYC2 [Jatropha curcas]
 gb|KDP34321.1| hypothetical protein JCGZ_12669 [Jatropha curcas]
Length=674

 Score =   176 bits (445),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 100/199 (50%), Positives = 134/199 (67%), Gaps = 14/199 (7%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S+HSD +   ++E     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  455  DSDHSDLEASVVRETDSSRVIEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  514

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQ-LRESKKVKVEAV  486
            ALR+VVPNVS+MDKASLL DA+SYI EL+ K+       EELE Q++ +++    K    
Sbjct  515  ALRAVVPNVSKMDKASLLGDAISYIKELRTKLQTAESEKEELEKQVESIKKEFASKDSRP  574

Query  485  G----DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  318
            G    D +   S+  S    +D++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L VH
Sbjct  575  GPPPPDQELKMSSGGSKLIEMDIDVKIIGWDAMIRIQCCKKNHPAARLMAALKELDLDVH  634

Query  317  HASISSVNDIMLQDIVVKV  261
            HAS+S VND+M+Q   VK+
Sbjct  635  HASVSVVNDLMIQQATVKM  653



>gb|ADH04269.1| MYC2a transcription factor [Nicotiana tabacum]
Length=659

 Score =   175 bits (444),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 94/202 (47%), Positives = 136/202 (67%), Gaps = 16/202 (8%)
 Frame = -1

Query  806  HSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
             SD +   +KE     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  448  QSDLEASVVKEADSSRVVDPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  506

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaa  456
            R+VVPNVS+MDKASLL DA+++INELK KV+  +     +E  + ++E++ +  +   + 
Sbjct  507  RAVVPNVSKMDKASLLGDAIAFINELKSKVQNSDSD---KEDLRNQIESLRNELANKGSN  563

Query  455  ssvaSP---------VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
             +   P         +D++VK++G DAMIR+QS   N+P+A+LM  L EL+L VHHAS+S
Sbjct  564  YTGPPPSNQELKIVDMDIDVKVIGWDAMIRIQSNKKNHPAARLMTALMELDLDVHHASVS  623

Query  302  SVNDIMLQDIVVKVPEGLRSED  237
             VN++M+Q   VK+   L +++
Sbjct  624  VVNELMIQQATVKMGSRLYTQE  645



>gb|ACO53628.1| bHLH domain protein [Gossypium hirsutum]
Length=674

 Score =   175 bits (444),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 133/196 (68%), Gaps = 11/196 (6%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S+HSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN +FY
Sbjct  457  DSDHSDLEASVVKEADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQKFY  516

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQ-LRESKKVKVEAV  486
            ALR+VVPNVS+MDKASLL DA+SYINELK K+       EE++ QL+ L+++   K    
Sbjct  517  ALRAVVPNVSKMDKASLLGDAISYINELKSKLQSADLEKEEMQSQLEALKKNLSSKAPPP  576

Query  485  GDNQst-ssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHAS  309
             D     S+   +    +++EVKI+G DAMI++Q    N+P+AKLM  L+EL+L VHHAS
Sbjct  577  HDQDLKISNHTGNKLIDLEIEVKIIGWDAMIQIQCSKKNHPAAKLMVALKELDLDVHHAS  636

Query  308  ISSVNDIMLQDIVVKV  261
            +S V D+M+Q   VK+
Sbjct  637  VSVVKDLMIQQANVKM  652



>emb|CDX78808.1| BnaA01g08750D [Brassica napus]
Length=579

 Score =   174 bits (441),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 98/205 (48%), Positives = 133/205 (65%), Gaps = 12/205 (6%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S  SD +   +KE     I    +  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  365  DSNRSDLEASVVKEAESGRIAAEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  424

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-QLQLRESKKVKVEAVGD----  480
            Y+LR+VVPNVS+MDKASLL DA+SYINELK K+++ E  + +L++      + VGD    
Sbjct  425  YSLRAVVPNVSKMDKASLLGDAISYINELKAKLQKAEADKEELQKQIDGMSKEVGDGNVK  484

Query  479  ----NQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  312
                +Q      S V+  V+++VKI+G DAMIR+Q    ++P AK M  L+ELEL V+HA
Sbjct  485  SSVKDQKCLEQDSGVSVEVEIDVKIIGWDAMIRIQCGKKDHPGAKFMEALKELELEVNHA  544

Query  311  SISSVNDIMLQDIVVKVPEGLRSED  237
            S+S VN+ M+Q   VK+     ++D
Sbjct  545  SLSVVNEFMIQQATVKMGNQFFTQD  569



>ref|XP_003516794.1| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=637

 Score =   174 bits (441),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 127/202 (63%), Gaps = 20/202 (10%)
 Frame = -1

Query  806  HSDSDCQFLKEPPI-VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRS  630
            HSD +   +K+    V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+
Sbjct  413  HSDLEASMVKQADSRVMEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRA  472

Query  629  VVPNVSRMDKASLLSDAVSYINELKGKVEEL-----ECQLQLRESKK-------------  504
            VVPNVS+MDKASLL DA+SYINELK K+  L     E + QL  +KK             
Sbjct  473  VVPNVSKMDKASLLGDAISYINELKLKLNGLDSEKGELEKQLDSAKKELELATKNPPPPP  532

Query  503  -VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  327
                     N   +   ++  + +++EVKI+G DAMIR+Q    N+P+A+LM  L++L+L
Sbjct  533  PPPPGLPPSNNEEAKKTTTKLADLEIEVKIIGWDAMIRIQCSKKNHPAARLMAALKDLDL  592

Query  326  AVHHASISSVNDIMLQDIVVKV  261
             VHHAS+S VND+M+Q   V +
Sbjct  593  EVHHASVSVVNDLMIQQATVNM  614



>ref|XP_008796257.1| PREDICTED: transcription factor MYC4 [Phoenix dactylifera]
Length=687

 Score =   174 bits (442),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 98/206 (48%), Positives = 138/206 (67%), Gaps = 15/206 (7%)
 Frame = -1

Query  815  ESEHSDSDCQF--LKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S+HSD +     ++  P+V+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  467  DSDHSDLEASVREVESSPVVEPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  525

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQL------RESKKVKV  495
            ALR+VVPNVS+MDKASLL DA+SYINEL+ K++ LE      Q Q+      R+S   + 
Sbjct  526  ALRAVVPNVSKMDKASLLGDAISYINELRSKLQSLESDKEGLQAQIDSLKRDRDSSPARP  585

Query  494  EAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHH  315
              + D Q            V++EVKI+G +AMIRVQ    N+P+A+LM  L++L+L V++
Sbjct  586  LQLPD-QDAKMMNGGRCHGVEIEVKILGLEAMIRVQCHKKNHPAARLMAALKDLDLDVYY  644

Query  314  ASISSVNDIMLQDIVVKVPEGLRSED  237
            AS+S V D+M+Q   VK+P  + S++
Sbjct  645  ASVSVVKDLMIQQTTVKMPSRVYSQE  670



>gb|AET03296.2| basic helix loop helix (bHLH) family transcription factor [Medicago 
truncatula]
Length=648

 Score =   174 bits (441),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 104/202 (51%), Positives = 130/202 (64%), Gaps = 20/202 (10%)
 Frame = -1

Query  806  HSDSDCQFLKE--PPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  633
            HSD D   +KE     V      PKKRGRKP  GR  P+NHVEAERQRREKLN +FYALR
Sbjct  423  HSDLDVSAVKEGESSRVVEPGKRPKKRGRKPANGREEPLNHVEAERQRREKLNQKFYALR  482

Query  632  SVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDNQst  468
            +VVPNVS+MDKASLL DA+SYINELK K++ LE      + QL  +KK        NQS 
Sbjct  483  AVVPNVSKMDKASLLGDAISYINELKSKLQGLESSKGELEKQLGATKKELELVASKNQSQ  542

Query  467  s-------------saassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  327
            +             S +SS    +D++VKI+G DAMIR+Q    N+P+AKLM  L+EL+L
Sbjct  543  NPIPLDKEKEKTTSSTSSSKLIDLDIDVKIMGWDAMIRIQCSKKNHPAAKLMAALKELDL  602

Query  326  AVHHASISSVNDIMLQDIVVKV  261
             V+HAS+S VND+M+Q   V +
Sbjct  603  DVNHASVSVVNDLMIQQASVNM  624



>ref|XP_010940945.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=448

 Score =   171 bits (434),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 109/216 (50%), Positives = 145/216 (67%), Gaps = 30/216 (14%)
 Frame = -1

Query  827  NSYPESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHR  648
            +S  +SEHSDS+   + E     ++   P         GR TPVNHVEAERQRREKLNHR
Sbjct  233  SSSVDSEHSDSEGLLMMERRRPKKRGRKPGT-------GRETPVNHVEAERQRREKLNHR  285

Query  647  FYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQst  468
            FYALRSVVPNVSRMDKASLL+DAV+YI EL+ KV+ELE      E+K+VK E + D    
Sbjct  286  FYALRSVVPNVSRMDKASLLADAVAYIKELRAKVDELET-----EAKRVKKEVIVDQGVG  340

Query  467  ssaassva------------------SPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGL  342
             +A ++                    + +++EVK++GPDA+IRV SEN ++P+AKLM+ L
Sbjct  341  GAATTTTTTTTTTTMSSVVSCGGGGPATMELEVKMLGPDALIRVHSENLSHPTAKLMSAL  400

Query  341  RELELAVHHASISSVNDIMLQDIVVKVPEGLRSEDG  234
            R+LE+ VHHAS+SSV ++M+QD+VV+VP  L+  DG
Sbjct  401  RDLEVHVHHASVSSVKEVMVQDVVVRVPYALQFSDG  436



>ref|XP_008238755.1| PREDICTED: transcription factor bHLH14-like isoform X2 [Prunus 
mume]
Length=483

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 130/184 (71%), Gaps = 16/184 (9%)
 Frame = -1

Query  740  KKRGRKP--GAGRVTPV-NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  570
            KKR R    GA R + + NHVEAERQRREKLNHRFY LRSVVPNVS+MD++SLL+DAV+Y
Sbjct  290  KKRSRSSNNGASRESSLLNHVEAERQRREKLNHRFYLLRSVVPNVSKMDRSSLLADAVAY  349

Query  569  INELKGKVEELE--CQLQLRESKKVKVEAVGDNQstssaas----------svaSPVDVE  426
            IN+LK KVEELE   Q Q +  ++V V  + DNQ + S  S          +   PV+V+
Sbjct  350  INQLKAKVEELELKTQAQPQNPQRVSVNNL-DNQCSQSTNSIVDHHSSYNNTKVVPVEVD  408

Query  425  VKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLR  246
            VKI+G +A+IRVQ  + +YP A+LMN L+ L L V+HASISSV ++M+QD+V ++P G  
Sbjct  409  VKIMGSEAIIRVQCPDQDYPYARLMNALKGLGLQVYHASISSVKELMIQDVVARMPYGFT  468

Query  245  SEDG  234
            SE+ 
Sbjct  469  SEEA  472



>ref|XP_008238754.1| PREDICTED: transcription factor MYC4-like isoform X1 [Prunus 
mume]
Length=484

 Score =   172 bits (435),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 99/184 (54%), Positives = 130/184 (71%), Gaps = 16/184 (9%)
 Frame = -1

Query  740  KKRGRKP--GAGRVTPV-NHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSY  570
            KKR R    GA R + + NHVEAERQRREKLNHRFY LRSVVPNVS+MD++SLL+DAV+Y
Sbjct  291  KKRSRSSNNGASRESSLLNHVEAERQRREKLNHRFYLLRSVVPNVSKMDRSSLLADAVAY  350

Query  569  INELKGKVEELE--CQLQLRESKKVKVEAVGDNQstssaas----------svaSPVDVE  426
            IN+LK KVEELE   Q Q +  ++V V  + DNQ + S  S          +   PV+V+
Sbjct  351  INQLKAKVEELELKTQAQPQNPQRVSVNNL-DNQCSQSTNSIVDHHSSYNNTKVVPVEVD  409

Query  425  VKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLR  246
            VKI+G +A+IRVQ  + +YP A+LMN L+ L L V+HASISSV ++M+QD+V ++P G  
Sbjct  410  VKIMGSEAIIRVQCPDQDYPYARLMNALKGLGLQVYHASISSVKELMIQDVVARMPYGFT  469

Query  245  SEDG  234
            SE+ 
Sbjct  470  SEEA  473



>ref|XP_003531962.1| PREDICTED: transcription factor MYC2 [Glycine max]
Length=654

 Score =   174 bits (440),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/206 (47%), Positives = 128/206 (62%), Gaps = 24/206 (12%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +    K+   V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  429  DSDHSDLEASVAKQ---VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  485

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKV-----EELECQLQLRESKK-----------  504
            R+VVPNVS+MDKASLL DA+ YINELK K+     E+ E + QL  +KK           
Sbjct  486  RAVVPNVSKMDKASLLGDAILYINELKSKLNVLDSEKTELEKQLDSTKKELELATKNPPP  545

Query  503  -----VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLR  339
                         N       +S  + +++EVKI+G DAM+R+Q    N+P+A+LM  L+
Sbjct  546  PPPPPPPPGPPPSNSVEPKKTTSKLADLELEVKIIGWDAMVRIQCSKKNHPAARLMAALK  605

Query  338  ELELAVHHASISSVNDIMLQDIVVKV  261
            +L+L VHHAS+S VND+M+Q   V +
Sbjct  606  DLDLEVHHASVSVVNDLMIQQATVNM  631



>gb|KGN60384.1| Transcription factor AtMYC2 [Cucumis sativus]
Length=679

 Score =   174 bits (440),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 134/213 (63%), Gaps = 20/213 (9%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S+HSD +   ++E     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  452  DSDHSDLEASVIREAESSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  511

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVG  483
            ALR+VVPNVS+MDKASLL DA+SYINEL+GK+       E+L+ QL   +   +   +  
Sbjct  512  ALRAVVPNVSKMDKASLLGDAISYINELRGKLQTAESDKEDLQKQLDSVKKMMMSSSSKD  571

Query  482  -----------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  336
                       D    SS  +      D++VKI+  DAMIR+QS   N+P+A+LM  L E
Sbjct  572  SCMSSSNQPPPDQDIKSSNINHNDIETDIDVKIISWDAMIRIQSSKKNHPAARLMAALEE  631

Query  335  LELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            L+L ++HASIS VND+M+Q   VK+   L +++
Sbjct  632  LDLDINHASISVVNDLMIQQATVKMGSRLYTQE  664



>ref|XP_010058170.1| PREDICTED: transcription factor MYC2 [Eucalyptus grandis]
Length=699

 Score =   174 bits (440),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 131/201 (65%), Gaps = 17/201 (8%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S+HSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  481  DSDHSDLEASVVKEADSSRVIEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  540

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV--------------EELECQLQLRESKK  504
            ALR+VVPNVS+MDKASLL DA++YI EL  K+              E L+ +L  ++S+ 
Sbjct  541  ALRAVVPNVSKMDKASLLGDAIAYIKELNSKLQTTESDKENLQKQMESLKKELTNKDSRS  600

Query  503  VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  324
               ++  D  S SS   +    +DV+VKI+G D MIR+QS   N+P+AKLM  L EL+L 
Sbjct  601  ALPQSDKD-LSISSNHGAKLIELDVDVKIIGWDVMIRIQSSKKNHPAAKLMQALMELDLD  659

Query  323  VHHASISSVNDIMLQDIVVKV  261
            VHHAS+S VND+M+Q   VK+
Sbjct  660  VHHASVSVVNDLMIQQATVKM  680



>gb|KCW71784.1| hypothetical protein EUGRSUZ_E00277 [Eucalyptus grandis]
Length=713

 Score =   173 bits (439),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 100/201 (50%), Positives = 131/201 (65%), Gaps = 17/201 (8%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S+HSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  495  DSDHSDLEASVVKEADSSRVIEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  554

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV--------------EELECQLQLRESKK  504
            ALR+VVPNVS+MDKASLL DA++YI EL  K+              E L+ +L  ++S+ 
Sbjct  555  ALRAVVPNVSKMDKASLLGDAIAYIKELNSKLQTTESDKENLQKQMESLKKELTNKDSRS  614

Query  503  VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  324
               ++  D  S SS   +    +DV+VKI+G D MIR+QS   N+P+AKLM  L EL+L 
Sbjct  615  ALPQSDKD-LSISSNHGAKLIELDVDVKIIGWDVMIRIQSSKKNHPAAKLMQALMELDLD  673

Query  323  VHHASISSVNDIMLQDIVVKV  261
            VHHAS+S VND+M+Q   VK+
Sbjct  674  VHHASVSVVNDLMIQQATVKM  694



>ref|XP_011652651.1| PREDICTED: transcription factor MYC2 [Cucumis sativus]
Length=688

 Score =   173 bits (439),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 134/213 (63%), Gaps = 20/213 (9%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S+HSD +   ++E     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  461  DSDHSDLEASVIREAESSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  520

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVG  483
            ALR+VVPNVS+MDKASLL DA+SYINEL+GK+       E+L+ QL   +   +   +  
Sbjct  521  ALRAVVPNVSKMDKASLLGDAISYINELRGKLQTAESDKEDLQKQLDSVKKMMMSSSSKD  580

Query  482  -----------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  336
                       D    SS  +      D++VKI+  DAMIR+QS   N+P+A+LM  L E
Sbjct  581  SCMSSSNQPPPDQDIKSSNINHNDIETDIDVKIISWDAMIRIQSSKKNHPAARLMAALEE  640

Query  335  LELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            L+L ++HASIS VND+M+Q   VK+   L +++
Sbjct  641  LDLDINHASISVVNDLMIQQATVKMGSRLYTQE  673



>ref|XP_010919958.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=691

 Score =   173 bits (439),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 95/200 (48%), Positives = 133/200 (67%), Gaps = 19/200 (10%)
 Frame = -1

Query  815  ESEHSDSDCQF--LKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S+HSD +     ++  P+V+ ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  471  DSDHSDLEASVREVESSPVVEPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  529

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG-------  483
            ALR+VVPNVS+MDKASLL DA+SYINEL+ K++ LE     +E  + ++EA+        
Sbjct  530  ALRAVVPNVSKMDKASLLGDAISYINELRSKLQSLESD---KEGLQTQIEALKRERDSNP  586

Query  482  ------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  321
                   +Q            V++EVKI+G +AMIRVQ    N+P+A+LM  L+EL+L V
Sbjct  587  ARPLQLPDQDMKMMNGGRCHGVEIEVKILGVEAMIRVQCHKRNHPAARLMAALKELDLDV  646

Query  320  HHASISSVNDIMLQDIVVKV  261
            ++AS+S V D+M+Q   VK+
Sbjct  647  YYASVSVVKDLMIQQATVKM  666



>ref|XP_009388411.1| PREDICTED: transcription factor MYC2 [Musa acuminata subsp. malaccensis]
Length=705

 Score =   173 bits (439),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 125/191 (65%), Gaps = 27/191 (14%)
 Frame = -1

Query  743  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  564
            PKKRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DAVSYIN
Sbjct  504  PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAVSYIN  563

Query  563  ELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassvaSP-----------------V  435
            EL+ K+E LE     +E  + +VEA+   + ++        P                 V
Sbjct  564  ELRSKLETLEID---KEELRAQVEALEKERESNPTRPVQPPPDHDLRMMNGSGGDRCHGV  620

Query  434  DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKV--  261
            ++EVKI+G +AMIR+Q    N+P+AKLM  +R+L+L VH+AS+S V D+M+Q   VK+  
Sbjct  621  ELEVKILGSEAMIRLQCLKRNHPAAKLMAAIRDLDLDVHYASVSVVEDLMIQQATVKMSP  680

Query  260  -----PEGLRS  243
                 PE LR+
Sbjct  681  SRTYTPEQLRA  691



>ref|XP_007210924.1| hypothetical protein PRUPE_ppa027182mg [Prunus persica]
 gb|EMJ12123.1| hypothetical protein PRUPE_ppa027182mg [Prunus persica]
Length=478

 Score =   171 bits (433),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 96/186 (52%), Positives = 129/186 (69%), Gaps = 19/186 (10%)
 Frame = -1

Query  740  KKRGRKP--GAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYI  567
            KKRGR    G GR +   HVEAERQRREKLNHRFY LRSVVPNVS+MD++SLL+DAV+YI
Sbjct  282  KKRGRSSNHGTGRESST-HVEAERQRREKLNHRFYVLRSVVPNVSKMDRSSLLADAVAYI  340

Query  566  NELKGKVEELECQLQLR-ESKKV---------------KVEAVGDNQstssaassvaSPV  435
            N+LK KVEELE ++Q + ++ KV                  ++ D+ S+S   +   + +
Sbjct  341  NQLKEKVEELEAKIQAQPQNPKVGHVSNLDHHHHHNSQSTGSIVDHHSSSYNINKAGAAL  400

Query  434  DVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPE  255
            +V+VKI+G +AMIRVQ  + +YP AKLMN L+ L   V+HASISSV ++M+QD+V +VP 
Sbjct  401  EVDVKILGSEAMIRVQCPDQDYPYAKLMNALKALGFQVYHASISSVKELMIQDVVARVPY  460

Query  254  GLRSED  237
            G  SE+
Sbjct  461  GFNSEE  466



>ref|XP_008465979.1| PREDICTED: transcription factor MYC2-like [Cucumis melo]
Length=689

 Score =   173 bits (438),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 99/213 (46%), Positives = 134/213 (63%), Gaps = 20/213 (9%)
 Frame = -1

Query  815  ESEHSDSDCQFLKE--PPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S+HSD +   ++E     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  463  DSDHSDLEASVIREVESSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  522

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAVG  483
            ALR+VVPNVS+MDKASLL DA+SYINEL+GK+       E+L+ QL   +   +   +  
Sbjct  523  ALRAVVPNVSKMDKASLLGDAISYINELRGKLQTAESDKEDLQKQLDSVKKMMMSSSSKD  582

Query  482  -----------DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  336
                       D    SS  +      D++VKI+  DAMIR+QS   N+P+A+LM  L E
Sbjct  583  SCVSSSNQPPPDQDIKSSNINHNDIETDIDVKIISWDAMIRIQSSKKNHPAARLMAALEE  642

Query  335  LELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            L+L ++HASIS VND+M+Q   VK+   L +++
Sbjct  643  LDLDINHASISVVNDLMIQQATVKMGSRLYTQE  675



>ref|XP_004509726.1| PREDICTED: transcription factor MYC2-like [Cicer arietinum]
Length=657

 Score =   173 bits (438),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 98/197 (50%), Positives = 128/197 (65%), Gaps = 12/197 (6%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S+ SD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  439  DSDQSDLEVSVVKEADSSRVIEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  498

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDN  477
            +LR+VVPNVS+MDKASLL DA+SYINELK K++ LE      + QL  +KK    A   N
Sbjct  499  SLRAVVPNVSKMDKASLLGDAISYINELKEKLQGLESSKGELEKQLDTTKKELELASNKN  558

Query  476  -----QstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  312
                        +     +D+EVK++G DAMIRVQ    N+P+AKLM  L+EL++ V+HA
Sbjct  559  PLLPLDKEKLKTNCKLIDLDIEVKVIGWDAMIRVQCSKKNHPAAKLMVALKELDVEVNHA  618

Query  311  SISSVNDIMLQDIVVKV  261
            S+S VND+M+Q   V +
Sbjct  619  SVSVVNDLMIQQATVNM  635



>ref|XP_009617148.1| PREDICTED: transcription factor MYC4-like [Nicotiana tomentosiformis]
Length=344

 Score =   168 bits (425),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 92/182 (51%), Positives = 128/182 (70%), Gaps = 17/182 (9%)
 Frame = -1

Query  749  NAPKKRGRKPGAGRV------TPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLL  588
            N  + R RK G+  +        +NHVEAER RREKLNHRFYALRSVVP VS+MDKASLL
Sbjct  142  NINRSRKRKAGSSSIIIGRSEMAMNHVEAERIRREKLNHRFYALRSVVPYVSKMDKASLL  201

Query  587  SDAVSYINELKGKVEELECQLQLRESKKVKVE---------AVGD--NQstssaassvaS  441
            +DAV+YI ELK KVE+LE ++Q ++ K   +E         +V +  N  + S+ +   +
Sbjct  202  ADAVTYIKELKVKVEDLESKIQSQKPKNNIIEQHDSHSASSSVFNPANNKSFSSCNGGRN  261

Query  440  PVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKV  261
             +++EVKI+G +A+IRVQS + N+P A+LMN  RE+E  ++HAS+SSV D+MLQDIV++V
Sbjct  262  GMEIEVKIIGTEAIIRVQSLDVNFPCARLMNVFREMEFQIYHASVSSVKDLMLQDIVIRV  321

Query  260  PE  255
            P+
Sbjct  322  PD  323



>gb|KHN38923.1| Transcription factor MYC2 [Glycine soja]
Length=471

 Score =   171 bits (432),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 131/202 (65%), Gaps = 20/202 (10%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +   +K+P  V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  251  DSDHSDLEASVVKDP--VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  308

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDN--  477
            R+VVPNVS+MDKASLL DA+SYI ELK K++ LE        QL   KK ++E   DN  
Sbjct  309  RAVVPNVSKMDKASLLGDAISYITELKSKLQTLESDKDVLHKQLEGVKK-ELEKTTDNVS  367

Query  476  -----QstssaassvaSP-----VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  327
                  + ++   S   P     V+++VKI+G DAMI +     N+P+A LM  L EL+L
Sbjct  368  SNHACNNNNNNKLSSNQPALIDLVEMDVKIIGWDAMITITCSKKNHPAATLMTALMELDL  427

Query  326  AVHHASISSVNDIMLQDIVVKV  261
             VH+A+++ VND+M+Q   VK+
Sbjct  428  DVHYATVTLVNDLMIQQATVKM  449



>gb|EPS71023.1| hypothetical protein M569_03732, partial [Genlisea aurea]
Length=549

 Score =   172 bits (435),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 130/215 (60%), Gaps = 32/215 (15%)
 Frame = -1

Query  806  HSDSDCQFLKEP---PIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            HSD +    K+     +VD Q+  PKKRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  332  HSDIEASVAKDAGSSKVVDPQKR-PKKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  390

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQ---------------  522
            R+VVP VS+MDK+SLL DA+SYINELK K+       EE+  QL+               
Sbjct  391  RAVVPTVSKMDKSSLLGDAISYINELKSKLQNSELDMEEMRAQLESLKKKKKKKEEEEEG  450

Query  521  LRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGL  342
            L    + K  A  +N+     A       D+EVKI+G DAMIR+Q    N+P+AKLM   
Sbjct  451  LPPHNETKYSAPSENKYGGGGA------TDIEVKIIGSDAMIRIQCSRKNHPAAKLMAAF  504

Query  341  RELELAVHHASISSVNDIMLQDIVVKVPEGLRSED  237
            +EL+L +HHASIS +N+ M+Q   VK+     S+D
Sbjct  505  KELDLDLHHASISVMNESMIQRATVKMGATSFSQD  539



>ref|XP_007151965.1| hypothetical protein PHAVU_004G090300g [Phaseolus vulgaris]
 gb|ESW23959.1| hypothetical protein PHAVU_004G090300g [Phaseolus vulgaris]
Length=404

 Score =   169 bits (428),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 95/191 (50%), Positives = 129/191 (68%), Gaps = 13/191 (7%)
 Frame = -1

Query  803  SDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVT-PVNHVEAERQRREKLNHRFYALRSV  627
            SD D + L     V+   + P   GR+ G  R T PVNHVEAERQRREKLN RFYALRS 
Sbjct  217  SDHDAEAL--LAFVEANNSVPMM-GRRAGRERETLPVNHVEAERQRREKLNQRFYALRSA  273

Query  626  VPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaassv  447
            VPNVS+MDKASLLSDAV YINELK K+ +L+  L+     + + +A           SS 
Sbjct  274  VPNVSKMDKASLLSDAVDYINELKAKISQLQSALEAEPEAQAQTQA---------QPSSA  324

Query  446  aSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVV  267
             + + VEV+++G +AMIRVQS N N+P A+LM+ LR++ L + HA+IS++ ++MLQD+VV
Sbjct  325  TTDMRVEVQMLGSEAMIRVQSLNINHPWARLMDALRDVNLEILHATISNIKEMMLQDVVV  384

Query  266  KVPEGLRSEDG  234
            +VP  L +++ 
Sbjct  385  RVPHDLMTQEA  395



>ref|XP_010449546.1| PREDICTED: transcription factor MYC4-like [Camelina sativa]
Length=622

 Score =   172 bits (437),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 100/205 (49%), Positives = 126/205 (61%), Gaps = 17/205 (8%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S HS  +   +KE      V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  409  DSNHSVLEASVVKEAESNRTVVEPEKKPRKRGRKPANGREEPLNHVEAERQRREKLNQRF  468

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVEAV  486
            Y+LR+VVPNVS+MDKASLL DA+SYINELK K+       EEL+ Q+       +  EA 
Sbjct  469  YSLRAVVPNVSKMDKASLLGDAISYINELKSKLLKAESDKEELQKQID-----GMSKEAA  523

Query  485  GDNQstssaassvaSPVDVE--VKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHA  312
                            VD+E  VKI+G DAMIRVQ    N+P AK M  L+EL+L V+HA
Sbjct  524  NGKSLVKERNQEPGVSVDMEVDVKIIGWDAMIRVQCSKRNHPGAKFMEALKELDLEVNHA  583

Query  311  SISSVNDIMLQDIVVKVPEGLRSED  237
            S+S VND+M+Q   VK+     ++D
Sbjct  584  SLSVVNDLMIQQATVKMGNEFFTQD  608



>ref|XP_008238769.1| PREDICTED: transcription factor MYC2-like [Prunus mume]
Length=485

 Score =   171 bits (432),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 139/212 (66%), Gaps = 25/212 (12%)
 Frame = -1

Query  818  PESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKP--GAGRVTPV-NHVEAERQRREKLNHR  648
            PES  SDS   F  E     R     KKRGR    GA R + + NHVEAERQRREKLNHR
Sbjct  266  PESP-SDSIGNFTSENTAKPRS----KKRGRSSTNGASRESALSNHVEAERQRREKLNHR  320

Query  647  FYALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVG--DNQ  474
            FY LRSVVPNVS+MDK+SLL+DAVSYIN+LK KVEELE ++Q  +    K  +V   D+Q
Sbjct  321  FYVLRSVVPNVSKMDKSSLLADAVSYINQLKAKVEELEAKIQ-EQPPTPKTGSVSHLDHQ  379

Query  473  stssaass--------------vaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  336
             + S++S                  PV+V+VKI+G +A+IRVQ  + +YP A+LMN L+ 
Sbjct  380  LSKSSSSIVDSHHHHHSSYNNRTVVPVEVDVKIMGSEAIIRVQCPDQDYPYARLMNALKG  439

Query  335  LELAVHHASISSVNDIMLQDIVVKVPEGLRSE  240
            L L V+HASISSV ++M+QD+V +VP G  S+
Sbjct  440  LGLQVYHASISSVKELMIQDVVARVPYGFNSD  471



>emb|CDP13028.1| unnamed protein product [Coffea canephora]
Length=693

 Score =   172 bits (437),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 95/202 (47%), Positives = 133/202 (66%), Gaps = 18/202 (9%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S+HSD +    KE     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  471  DSDHSDLEASVAKEADSSRVVDPEKK-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  529

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC--------------QLQLRESK  507
            YALR+VVPNVS+MDKASLL DA+SYINELK K+  +E               +L  +E++
Sbjct  530  YALRAVVPNVSKMDKASLLGDAISYINELKSKLHNMESDKEELRNQIDSLKKELTSKEAR  589

Query  506  KVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  327
                     +   +S   S +  +D++VKI+G +AMIRVQS   N+P+A++M  L++L+L
Sbjct  590  NFAPPPPDKDLKLASHQGSKSLDMDIDVKIIGWEAMIRVQSSKNNHPAARIMGALKDLDL  649

Query  326  AVHHASISSVNDIMLQDIVVKV  261
             + HAS+S VND+M+Q   V++
Sbjct  650  ELLHASVSVVNDLMIQQNTVRM  671



>ref|XP_007039493.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
 gb|EOY23994.1| Basic helix-loop-helix DNA-binding family protein [Theobroma 
cacao]
Length=669

 Score =   172 bits (437),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 132/201 (66%), Gaps = 17/201 (8%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S+HSD +   +KE     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  448  DSDHSDLEASVVKEADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  507

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEE--------------LECQLQLRESKK  504
            ALR+VVPNVS+MDKASLL DA+SYINEL+ K++               ++ +L  ++S+ 
Sbjct  508  ALRAVVPNVSKMDKASLLGDAISYINELRTKLQNADSEKEELQKELEAMKKELSSKDSRS  567

Query  503  VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  324
                A   +   S+   +    ++++VKI+G DAMIR+Q    N+P+A+LM  L+EL+L 
Sbjct  568  AP-PAPDQDLKMSNHLGNKLVELEIDVKIIGWDAMIRIQCNKKNHPAARLMAALKELDLD  626

Query  323  VHHASISSVNDIMLQDIVVKV  261
            VHHAS+S VND+M+Q   VK+
Sbjct  627  VHHASVSVVNDLMIQQATVKM  647



>gb|ABD59338.1| G-box element binding protein [Pisum sativum]
Length=646

 Score =   172 bits (436),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/201 (47%), Positives = 132/201 (66%), Gaps = 19/201 (9%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEP--PIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S+HSD +   +K+     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  427  DSDHSDLEVSVVKKTVSSRVIEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  486

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC--------------QLQLRESKK  504
            ALR+VVPNVS+MDKASLL DA+SYINELK K++ LE               +L++   K 
Sbjct  487  ALRAVVPNVSKMDKASLLGDAISYINELKLKLQGLESSKDELEKELDTTRKELEIATKKP  546

Query  503  VKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELA  324
            V++      +  +++       +D++VKI+G DAMIR+Q    N+P+AKLM  L+EL+L 
Sbjct  547  VRLNEEEKEKPENNSKLID---LDIDVKIMGWDAMIRIQCSKKNHPAAKLMAALKELDLD  603

Query  323  VHHASISSVNDIMLQDIVVKV  261
            V+HAS+S VND+M+Q   + +
Sbjct  604  VNHASVSVVNDLMIQQASINM  624



>ref|XP_008448683.1| PREDICTED: transcription factor MYC2-like [Cucumis melo]
Length=662

 Score =   172 bits (436),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/199 (48%), Positives = 131/199 (66%), Gaps = 15/199 (8%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQ---QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S+HSD +   ++E     +    +  P+KRGRKP  GR  P+NHVEAERQRREKLN +F
Sbjct  434  DSDHSDLEASVIREVDSCTKSLEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQKF  493

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQ-------LQLRESKKVKVEAV  486
            YALR+VVPNVS+MDKASLL DAVSYINELK K++  E +       L+L + K++  + V
Sbjct  494  YALRAVVPNVSKMDKASLLGDAVSYINELKSKLQMAESEKTDMGKHLELLK-KEMGGKDV  552

Query  485  G----DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVH  318
            G     N             +++EVKI+G DAMIR+QS   N+P+A+LM   ++L+L + 
Sbjct  553  GCYTNPNDEDLKIGKRKVMDMEIEVKIMGWDAMIRIQSNKKNHPAARLMTAFKDLDLEML  612

Query  317  HASISSVNDIMLQDIVVKV  261
            HAS+S VND+M+Q   VK+
Sbjct  613  HASVSVVNDLMIQQATVKM  631



>ref|XP_010441529.1| PREDICTED: transcription factor bHLH28-like [Camelina sativa]
Length=461

 Score =   170 bits (430),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 95/170 (56%), Positives = 112/170 (66%), Gaps = 7/170 (4%)
 Frame = -1

Query  740  KKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYINE  561
            KKRGRKP  GR  P+NHVEAER RREKLNHRFYALR+VVPNVS+MDK SLL DAV YINE
Sbjct  278  KKRGRKPMHGREKPLNHVEAERMRREKLNHRFYALRAVVPNVSKMDKTSLLEDAVRYINE  337

Query  560  LKGKVEELE-----CQLQLRESKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMI  396
            LK   E  E      Q QL E KK+       +    +      S + +EVK +G D MI
Sbjct  338  LKSTAENAESERNAVQNQLNELKKITGRQNATSSVVCNDDKENVSELKIEVKAMGSDVMI  397

Query  395  RVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGLR  246
            RV+S   N+P A+LMN L +LEL V HASIS +ND+M+Q   VK+  GLR
Sbjct  398  RVESGKRNHPGARLMNALMDLELEVSHASISVMNDLMIQQATVKM--GLR  445



>ref|XP_010104300.1| hypothetical protein L484_023250 [Morus notabilis]
 gb|EXB99720.1| hypothetical protein L484_023250 [Morus notabilis]
Length=683

 Score =   172 bits (436),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 136/210 (65%), Gaps = 13/210 (6%)
 Frame = -1

Query  827  NSYPESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLN  654
            N   +S++SD +   ++E     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN
Sbjct  460  NGTADSDNSDLEASVVREADSSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLN  519

Query  653  HRFYALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQL----QLRESK  507
             RFYALR+VVPNVS+MDKASLL DA+SYINELK K+       E+L+ Q+    +L    
Sbjct  520  QRFYALRAVVPNVSKMDKASLLGDAISYINELKSKLQGAESDKEDLQKQIDSVKELAGKD  579

Query  506  KVKVEAVGDNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  327
              +     D   ++   SS    +D++VKI+G DAMIR+Q    N+P+A+ M+ L+EL+L
Sbjct  580  SSRPPTDPDLSMSNHHGSSKLIDLDIDVKIIGWDAMIRMQCSKKNHPAARFMSALKELDL  639

Query  326  AVHHASISSVNDIMLQDIVVKVPEGLRSED  237
             V+HAS+S VND+M+Q   VK+     ++D
Sbjct  640  DVNHASVSVVNDLMIQQATVKMGSRFYTQD  669



>gb|ACM48567.1| JAMYC [Taxus cuspidata]
Length=660

 Score =   172 bits (435),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 104/219 (47%), Positives = 138/219 (63%), Gaps = 34/219 (16%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEP-----PIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNH  651
            ESEHSD +   +KEP       V+R+   P+KRGRKP  GR  P+NHVEAERQRREKLN 
Sbjct  425  ESEHSDIEAS-IKEPECSQATFVERK---PRKRGRKPANGREEPLNHVEAERQRREKLNQ  480

Query  650  RFYALRSVVPNVSRMDKASLLSDAVSYINELKGKV-------EELECQLQLRESKKVKVE  492
            R YALR+VVPNVS+MDKASLL DA++YINEL+ KV       +EL+ Q++  + + V V 
Sbjct  481  RVYALRAVVPNVSKMDKASLLGDAIAYINELRSKVVDAETHKKELQVQVEALKKELVVVR  540

Query  491  ---AVGDNQstssaassvaSPVDV---------------EVKIVGPDAMIRVQSENANYP  366
               A G N          A   DV               EV+++G +AMIRVQS   N+P
Sbjct  541  ESGASGPNFGLIKDHYPTADSSDVKGHGLNNSKCHGIELEVRLLGREAMIRVQSPKQNHP  600

Query  365  SAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEGL  249
             A+LM  L+EL+L VHHAS+S+V ++M+Q ++VK+  G+
Sbjct  601  VARLMGALKELDLEVHHASVSAVKELMIQTVIVKMTGGI  639



>gb|AAY90122.1| basic helix-loop-helix transcription factor protein [Rheum australe]
Length=720

 Score =   172 bits (436),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 137/213 (64%), Gaps = 29/213 (14%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S+HSD +   +KE     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  486  DSDHSDLEASVVKEADSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  544

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQ----LQLRESKKVKVEAVGDN  477
            YALR+VVPNVS+MDKASLL DA+S+INELK K++ +E +    L   E  K +V A  D+
Sbjct  545  YALRAVVPNVSKMDKASLLGDAISFINELKSKLQNVESEKETLLSQVECLKTEVLASRDH  604

Query  476  Qstssaass---------------------vaSPVDVEVKIVGPDAMIRVQSENANYPSA  360
            QS SS                           S +DV+VKI+G DAM+RV    +N+P+A
Sbjct  605  QSRSSNGGGGVQNHHHPSLEQDMNMLNGSCKQSDLDVDVKIIGRDAMVRVNCSKSNHPAA  664

Query  359  KLMNGLRELELAVHHASISSVNDIMLQDIVVKV  261
            +LM  L+EL+L V HAS+S VND+M+Q   V++
Sbjct  665  RLMVALKELDLEVTHASVSVVNDLMIQQATVRM  697



>ref|XP_004148739.1| PREDICTED: transcription factor MYC2-like [Cucumis sativus]
 gb|KGN55759.1| Transcription factor AtMYC2 [Cucumis sativus]
Length=661

 Score =   172 bits (435),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 128/205 (62%), Gaps = 27/205 (13%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQ---QNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S+HSD +   ++E     +    +  P+KRGRKP  GR  P+NHVEAERQRREKLN +F
Sbjct  434  DSDHSDLEASAIREVDSCTKSLEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQKF  493

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKK---------VKVE  492
            YALR+VVPNVS+MDKASLL DAVSYINELK K       LQ+ ES+K         +K E
Sbjct  494  YALRAVVPNVSKMDKASLLGDAVSYINELKSK-------LQMAESEKTDMGKHLELLKKE  546

Query  491  AVGD--------NQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRE  336
              G         N             +++EVKI+G DAMIR+QS   N+P+A+LM   ++
Sbjct  547  MGGKDLGCYSNPNDEDLKTGKRKVMDMEIEVKIMGWDAMIRIQSNKKNHPAARLMTAFKD  606

Query  335  LELAVHHASISSVNDIMLQDIVVKV  261
            L+L + HAS+S VND+M+Q   VK+
Sbjct  607  LDLEMLHASVSVVNDLMIQQATVKM  631



>ref|XP_003628820.1| Transcription factor MYC2 [Medicago truncatula]
Length=648

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 129/202 (64%), Gaps = 20/202 (10%)
 Frame = -1

Query  806  HSDSDCQFLKE--PPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  633
            HSD D   +KE     V      PKKRGRKP  GR  P+NHVEAERQRREKLN +FYALR
Sbjct  423  HSDLDVSAVKEGESSRVVEPGKRPKKRGRKPANGREEPLNHVEAERQRREKLNQKFYALR  482

Query  632  SVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDNQst  468
            +VVPN S+MDKASLL DA+SYINELK K++ LE      + QL  +KK        NQS 
Sbjct  483  AVVPNGSKMDKASLLGDAISYINELKSKLQGLESSKGELEKQLGATKKELELVASKNQSQ  542

Query  467  s-------------saassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  327
            +             S +SS    +D++VKI+G DAMIR+Q    N+P+AKLM  L+EL+L
Sbjct  543  NPIPLDKEKEKTTSSTSSSKLIDLDIDVKIMGWDAMIRIQCSKKNHPAAKLMAALKELDL  602

Query  326  AVHHASISSVNDIMLQDIVVKV  261
             V+HAS+S VND+M+Q   V +
Sbjct  603  DVNHASVSVVNDLMIQQASVNM  624



>ref|XP_009384126.1| PREDICTED: transcription factor MYC4-like [Musa acuminata subsp. 
malaccensis]
Length=676

 Score =   171 bits (434),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 123/170 (72%), Gaps = 7/170 (4%)
 Frame = -1

Query  743  PKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALRSVVPNVSRMDKASLLSDAVSYIN  564
            P+KRGRKP  GR  P+NHVEAERQRREKLN RFYALR+VVPNVS+MDKASLL DAVSYIN
Sbjct  481  PRKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSKMDKASLLGDAVSYIN  540

Query  563  ELKGKVEELEC-QLQLRE-----SKKVKVEAVGDNQstssaassvaSPVDVEVKIVGPDA  402
            EL+  ++ LE  + +LR+      KK+ V+   D+   ++        V++EVKI+G +A
Sbjct  541  ELRSNLQTLEADKEELRDRVEALEKKLPVQPPPDHNLRTTTNGRCHG-VEMEVKILGSEA  599

Query  401  MIRVQSENANYPSAKLMNGLRELELAVHHASISSVNDIMLQDIVVKVPEG  252
            MIR+Q +  N+P+A LM  L++L+L +H+AS+S V D+M+Q + VK+  G
Sbjct  600  MIRLQCQKRNHPAASLMAALKDLDLELHYASVSVVKDLMIQQVTVKMSPG  649



>ref|XP_002519814.1| Transcription factor AtMYC2, putative [Ricinus communis]
 gb|EEF42418.1| Transcription factor AtMYC2, putative [Ricinus communis]
Length=663

 Score =   171 bits (433),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/200 (48%), Positives = 132/200 (66%), Gaps = 15/200 (8%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPI--VDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFY  642
            +S+HSD +   ++E     V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFY
Sbjct  443  DSDHSDLEASVVRETESSRVVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFY  502

Query  641  ALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQ--LRESKKVKVEAVGDNQ--  474
            ALR+VVPNVS+MDKASLL DA+SYI EL+ K++  E   +   +E + +K E +  +   
Sbjct  503  ALRAVVPNVSKMDKASLLGDAISYIKELRTKLQTAESDKEELEKEVESMKKEFLSKDSRP  562

Query  473  ---------stssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAV  321
                       S+   S A  +D++VKI+G DAMIR+Q    N+P+A+LM  L++L+L V
Sbjct  563  GSPPPDKELKMSNNHGSKAIDMDIDVKIIGWDAMIRIQCSKKNHPAARLMAALKDLDLDV  622

Query  320  HHASISSVNDIMLQDIVVKV  261
            HHAS+S VND+M+Q   VK+
Sbjct  623  HHASVSVVNDLMIQQATVKM  642



>ref|XP_010910582.1| PREDICTED: transcription factor MYC4-like [Elaeis guineensis]
Length=441

 Score =   168 bits (426),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 96/202 (48%), Positives = 133/202 (66%), Gaps = 18/202 (9%)
 Frame = -1

Query  812  SEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYALR  633
            S   DS+  + KE   V       KK GR+ G G+   VNHV+AERQRREKLN RFYALR
Sbjct  229  SSWVDSEQSYAKEGTTVR-----GKKLGRRLGTGKEVTVNHVDAERQRREKLNQRFYALR  283

Query  632  SVVPNVSRMDKASLLSDAVSYINELKGKVEELECQLQLRESKKVKVEAVGDNQstssaas  453
            SVVPNVSRMDKASLL+DAV YI EL+ ++EELE +++  + +   V+ VG   + ++  +
Sbjct  284  SVVPNVSRMDKASLLADAVDYIKELRARIEELEDEIKTAKKEPEVVDQVGSGHAITATIT  343

Query  452  svaSP------------VDVEVKIVGP-DAMIRVQSENANYPSAKLMNGLRELELAVHHA  312
            S  S             V++EV  VG  +A++RV++EN  +P A+LM  LR+LE  VHHA
Sbjct  344  SSNSTVSSEMAEGGEKVVELEVVAVGAEEAVVRVRTENVKHPPARLMGALRDLEAVVHHA  403

Query  311  SISSVNDIMLQDIVVKVPEGLR  246
             ++SV+ +M+QD+VV++P GLR
Sbjct  404  IVASVDGVMVQDVVVRMPRGLR  425



>ref|XP_003534274.2| PREDICTED: transcription factor MYC2-like [Glycine max]
Length=731

 Score =   171 bits (433),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 98/202 (49%), Positives = 131/202 (65%), Gaps = 20/202 (10%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPPIVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRFYAL  636
            +S+HSD +   +K+P  V   +  P+KRGRKP  GR  P+NHVEAERQRREKLN RFYAL
Sbjct  511  DSDHSDLEASVVKDP--VVEPEKRPRKRGRKPANGREEPLNHVEAERQRREKLNQRFYAL  568

Query  635  RSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRESKKVKVEAVGDN--  477
            R+VVPNVS+MDKASLL DA+SYI ELK K++ LE        QL   KK ++E   DN  
Sbjct  569  RAVVPNVSKMDKASLLGDAISYITELKSKLQTLESDKDVLHKQLEGVKK-ELEKTTDNVS  627

Query  476  -----QstssaassvaSP-----VDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELEL  327
                  + ++   S   P     V+++VKI+G DAMI +     N+P+A LM  L EL+L
Sbjct  628  SNHACNNNNNNKLSSNQPALIDLVEMDVKIIGWDAMITITCSKKNHPAATLMTALMELDL  687

Query  326  AVHHASISSVNDIMLQDIVVKV  261
             VH+A+++ VND+M+Q   VK+
Sbjct  688  DVHYATVTLVNDLMIQQATVKM  709



>ref|XP_004300239.1| PREDICTED: transcription factor MYC2-like [Fragaria vesca subsp. 
vesca]
Length=682

 Score =   171 bits (432),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 96/194 (49%), Positives = 129/194 (66%), Gaps = 10/194 (5%)
 Frame = -1

Query  815  ESEHSDSDCQFLKEPP---IVDRQQNAPKKRGRKPGAGRVTPVNHVEAERQRREKLNHRF  645
            +S+HSD +    KE     +VD ++  P+KRGRKP  GR  P+NHVEAERQRREKLN RF
Sbjct  468  DSDHSDLEASVAKEADSSRVVDPEKR-PRKRGRKPANGREEPLNHVEAERQRREKLNQRF  526

Query  644  YALRSVVPNVSRMDKASLLSDAVSYINELKGKVEELEC-----QLQLRE-SKKVKVEAVG  483
            YALR+VVPNVS+MDKASLL DA+SYI ELK K++  E      Q Q+   SK+++     
Sbjct  527  YALRAVVPNVSKMDKASLLGDAISYITELKTKLQTTESDKEDMQKQVETLSKELQESRSC  586

Query  482  DNQstssaassvaSPVDVEVKIVGPDAMIRVQSENANYPSAKLMNGLRELELAVHHASIS  303
                     S+    +D++VKI+G DA I++Q    N+P+A+LM  L EL+L VHHAS+S
Sbjct  587  SGLDQELKGSTKLIDLDIDVKILGWDARIQIQCSKKNHPAARLMAALMELDLDVHHASVS  646

Query  302  SVNDIMLQDIVVKV  261
             VND+M+Q   V++
Sbjct  647  VVNDLMIQQATVRM  660



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2529774447726