BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2865

Length=743
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006361593.1|  PREDICTED: beta-amylase 8-like                     141   5e-63   Solanum tuberosum [potatoes]
ref|XP_010324503.1|  PREDICTED: beta-amylase 8 isoform X3               137   5e-62   Solanum lycopersicum
ref|XP_010324502.1|  PREDICTED: beta-amylase 8 isoform X1               137   5e-62   Solanum lycopersicum
ref|XP_010324504.1|  PREDICTED: beta-amylase 8 isoform X4               137   5e-62   Solanum lycopersicum
ref|XP_004244442.1|  PREDICTED: beta-amylase 8 isoform X2               137   5e-62   Solanum lycopersicum
ref|XP_010324505.1|  PREDICTED: beta-amylase 8 isoform X5               137   6e-62   Solanum lycopersicum
ref|XP_002270680.1|  PREDICTED: beta-amylase 8                          145   9e-62   Vitis vinifera
emb|CBI29216.3|  unnamed protein product                                145   1e-61   Vitis vinifera
ref|XP_007210828.1|  hypothetical protein PRUPE_ppa019231mg             144   1e-60   
ref|XP_008238070.1|  PREDICTED: beta-amylase 8                          142   2e-60   
ref|XP_009769112.1|  PREDICTED: beta-amylase 8                          141   3e-60   Nicotiana sylvestris
gb|KJB51478.1|  hypothetical protein B456_008G218300                    144   4e-60   Gossypium raimondii
gb|KJB51477.1|  hypothetical protein B456_008G218300                    144   4e-60   Gossypium raimondii
gb|KJB51475.1|  hypothetical protein B456_008G218300                    144   4e-60   Gossypium raimondii
ref|XP_009589916.1|  PREDICTED: beta-amylase 8                          140   9e-60   Nicotiana tomentosiformis
ref|XP_008373437.1|  PREDICTED: beta-amylase 8                          142   2e-59   
ref|XP_009365721.1|  PREDICTED: beta-amylase 8                          141   2e-59   
ref|XP_006432891.1|  hypothetical protein CICLE_v10000490mg             145   9e-59   Citrus clementina [clementine]
ref|XP_006432890.1|  hypothetical protein CICLE_v10000490mg             145   9e-59   
ref|XP_010275178.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase 8     140   1e-58   
ref|XP_007040897.1|  Beta-amylase 2                                     141   2e-58   
gb|AFQ33619.1|  beta-amylase 7                                          143   2e-58   Citrus trifoliata [hardy orange]
ref|XP_010054915.1|  PREDICTED: beta-amylase 8                          136   2e-58   Eucalyptus grandis [rose gum]
ref|XP_011465289.1|  PREDICTED: beta-amylase 8                          135   2e-58   Fragaria vesca subsp. vesca
ref|XP_011082155.1|  PREDICTED: beta-amylase 8 isoform X1               142   3e-58   Sesamum indicum [beniseed]
gb|KDO43644.1|  hypothetical protein CISIN_1g005715mg                   145   4e-58   Citrus sinensis [apfelsine]
gb|KDO43643.1|  hypothetical protein CISIN_1g005715mg                   145   4e-58   Citrus sinensis [apfelsine]
ref|XP_010529274.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase 8     141   5e-58   
ref|XP_011027979.1|  PREDICTED: beta-amylase 8 isoform X1               139   3e-57   Populus euphratica
ref|XP_011027980.1|  PREDICTED: beta-amylase 8 isoform X2               139   3e-57   Populus euphratica
ref|XP_011653241.1|  PREDICTED: beta-amylase 8                          134   7e-57   Cucumis sativus [cucumbers]
ref|XP_002304400.1|  hypothetical protein POPTR_0003s10570g             140   3e-56   
ref|XP_008451866.1|  PREDICTED: beta-amylase 8                          135   3e-56   Cucumis melo [Oriental melon]
gb|KHN11799.1|  Beta-amylase 8                                          138   4e-56   Glycine soja [wild soybean]
ref|XP_003534334.1|  PREDICTED: beta-amylase 8-like                     138   5e-56   Glycine max [soybeans]
ref|XP_004512346.1|  PREDICTED: beta-amylase 8-like                     137   7e-56   Cicer arietinum [garbanzo]
ref|XP_012083880.1|  PREDICTED: beta-amylase 8                          131   1e-55   Jatropha curcas
gb|EYU37446.1|  hypothetical protein MIMGU_mgv1a002385mg                142   1e-55   Erythranthe guttata [common monkey flower]
ref|XP_007158095.1|  hypothetical protein PHAVU_002G123700g             137   4e-55   Phaseolus vulgaris [French bean]
ref|XP_002519919.1|  Beta-amylase, putative                             134   1e-54   
ref|XP_003612541.1|  Beta-amylase                                       136   1e-54   Medicago truncatula
gb|KHG17783.1|  Beta-amylase 8 -like protein                            135   2e-54   Gossypium arboreum [tree cotton]
emb|CDX87798.1|  BnaC02g31510D                                          135   3e-54   
gb|KHN41758.1|  Beta-amylase 8                                          137   5e-54   Glycine soja [wild soybean]
emb|CDY69112.1|  BnaA02g36650D                                          134   5e-54   Brassica napus [oilseed rape]
ref|XP_010481609.1|  PREDICTED: beta-amylase 8-like                     136   7e-54   Camelina sativa [gold-of-pleasure]
ref|XP_003516502.1|  PREDICTED: beta-amylase 8-like isoform X1          136   8e-54   Glycine max [soybeans]
ref|XP_010494622.1|  PREDICTED: beta-amylase 8                          137   1e-53   Camelina sativa [gold-of-pleasure]
ref|XP_011624011.1|  PREDICTED: beta-amylase 8 isoform X1               131   1e-53   Amborella trichopoda
gb|ERM94797.1|  hypothetical protein AMTR_s00011p00265640               131   2e-53   Amborella trichopoda
ref|XP_011624018.1|  PREDICTED: beta-amylase 8 isoform X2               131   2e-53   Amborella trichopoda
ref|XP_010441757.1|  PREDICTED: beta-amylase 8-like                     136   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_009128781.1|  PREDICTED: beta-amylase 8                          135   4e-53   Brassica rapa
ref|NP_001032014.1|  beta-amylase 2                                     131   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_199343.1|  beta-amylase 2                                        131   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006279583.1|  hypothetical protein CARUB_v10025996mg             133   3e-52   
ref|XP_010676684.1|  PREDICTED: beta-amylase 8                          134   4e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002865252.1|  hypothetical protein ARALYDRAFT_356484             131   5e-52   Arabidopsis lyrata subsp. lyrata
ref|XP_010233755.1|  PREDICTED: beta-amylase 8                          134   6e-52   
ref|XP_010910608.1|  PREDICTED: beta-amylase 8                          134   1e-51   
ref|XP_008808792.1|  PREDICTED: beta-amylase 8 isoform X1               135   3e-51   Phoenix dactylifera
ref|XP_008808793.1|  PREDICTED: beta-amylase 8 isoform X2               135   3e-51   Phoenix dactylifera
ref|XP_006398198.1|  hypothetical protein EUTSA_v10001222mg             132   5e-51   
gb|KFK31577.1|  hypothetical protein AALP_AA6G130300                    131   7e-51   Arabis alpina [alpine rockcress]
gb|KFK31578.1|  hypothetical protein AALP_AA6G130300                    131   8e-51   Arabis alpina [alpine rockcress]
ref|XP_006646832.1|  PREDICTED: beta-amylase 8-like                     134   2e-50   
ref|XP_008790180.1|  PREDICTED: beta-amylase 8-like                     132   4e-50   Phoenix dactylifera
gb|EAY84334.1|  hypothetical protein OsI_05709                          132   2e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_008679986.1|  PREDICTED: beta-amylase 8 isoform X3               134   3e-49   Zea mays [maize]
ref|XP_004952019.1|  PREDICTED: beta-amylase 8-like                     129   2e-48   
gb|EAZ21608.1|  hypothetical protein OsJ_05236                          132   2e-48   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84341.1|  hypothetical protein OsI_05718                          128   6e-47   Oryza sativa Indica Group [Indian rice]
ref|XP_008679984.1|  PREDICTED: beta-amylase 8 isoform X1               134   8e-47   
ref|XP_008679985.1|  PREDICTED: beta-amylase 8 isoform X2               134   8e-47   Zea mays [maize]
gb|EYU32116.1|  hypothetical protein MIMGU_mgv1a003882mg                131   2e-46   Erythranthe guttata [common monkey flower]
ref|XP_006396247.1|  hypothetical protein EUTSA_v10028560mg             127   3e-46   Eutrema salsugineum [saltwater cress]
ref|XP_007051810.1|  Beta-amylase 2 isoform 1                           130   5e-46   
ref|XP_008338858.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    128   6e-46   
emb|CDY07213.1|  BnaCnng02280D                                          128   6e-46   
emb|CDY51154.1|  BnaA09g51890D                                          128   7e-46   Brassica napus [oilseed rape]
ref|XP_009111477.1|  PREDICTED: beta-amylase 2, chloroplastic           128   7e-46   Brassica rapa
ref|XP_007051811.1|  Beta-amylase 2 isoform 2                           130   7e-46   
ref|XP_010540283.1|  PREDICTED: beta-amylase 2, chloroplastic           128   4e-45   Tarenaya hassleriana [spider flower]
ref|XP_002875024.1|  beta-amylase 9                                     127   4e-45   
ref|XP_010427089.1|  PREDICTED: beta-amylase 2, chloroplastic           125   6e-45   Camelina sativa [gold-of-pleasure]
ref|XP_006827627.2|  PREDICTED: beta-amylase 2, chloroplastic           127   7e-45   Amborella trichopoda
dbj|BAJ96466.1|  predicted protein                                      125   8e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAC13634.1|  similar to the family of glycosyl hydrolases            127   8e-45   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191958.3|  beta-amylase 2                                        127   1e-44   Arabidopsis thaliana [mouse-ear cress]
gb|EMS56471.1|  Beta-amylase 2, chloroplastic                           125   1e-44   Triticum urartu
gb|ERM95043.1|  hypothetical protein AMTR_s00009p00244310               127   1e-44   Amborella trichopoda
ref|XP_006287426.1|  hypothetical protein CARUB_v10000631mg             125   1e-44   Capsella rubella
gb|KFK30629.1|  hypothetical protein AALP_AA6G006600                    130   2e-44   Arabis alpina [alpine rockcress]
gb|EMT12153.1|  Beta-amylase                                            124   2e-44   
ref|XP_006445046.1|  hypothetical protein CICLE_v10019525mg             126   2e-44   Citrus clementina [clementine]
ref|XP_003576871.1|  PREDICTED: beta-amylase 2, chloroplastic-like      125   2e-44   Brachypodium distachyon [annual false brome]
ref|XP_010456279.1|  PREDICTED: beta-amylase 2, chloroplastic-like      125   3e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010255371.1|  PREDICTED: beta-amylase 2, chloroplastic-lik...    125   5e-44   Nelumbo nucifera [Indian lotus]
ref|XP_010255372.1|  PREDICTED: beta-amylase 7-like isoform X2          125   6e-44   Nelumbo nucifera [Indian lotus]
ref|XP_008338857.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    128   7e-44   
tpg|DAA60723.1|  TPA: hypothetical protein ZEAMMB73_150352              125   8e-44   
gb|ACG29023.1|  beta-amylase                                            125   8e-44   Zea mays [maize]
gb|ACN28597.1|  unknown                                                 125   8e-44   Zea mays [maize]
ref|XP_010670423.1|  PREDICTED: beta-amylase 2, chloroplastic           125   8e-44   Beta vulgaris subsp. vulgaris [field beet]
gb|KHG19612.1|  Beta-amylase 2, chloroplastic -like protein             125   1e-43   Gossypium arboreum [tree cotton]
tpg|DAA60725.1|  TPA: hypothetical protein ZEAMMB73_150352              125   2e-43   
ref|XP_008787503.1|  PREDICTED: beta-amylase 2, chloroplastic-lik...    125   2e-43   Phoenix dactylifera
ref|XP_008787505.1|  PREDICTED: beta-amylase 2, chloroplastic-lik...    125   2e-43   Phoenix dactylifera
ref|XP_010934796.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    123   2e-43   
ref|XP_006661569.1|  PREDICTED: beta-amylase 2, chloroplastic-like      123   2e-43   
emb|CAX51381.1|  beta-amylase                                           120   2e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010934795.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    123   2e-43   Elaeis guineensis
ref|XP_004306786.1|  PREDICTED: beta-amylase 2, chloroplastic           121   2e-43   Fragaria vesca subsp. vesca
ref|XP_010241901.1|  PREDICTED: beta-amylase 2, chloroplastic-like      121   3e-43   Nelumbo nucifera [Indian lotus]
ref|XP_011092236.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    126   3e-43   
ref|XP_010934794.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    123   3e-43   Elaeis guineensis
ref|XP_012083395.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    127   3e-43   Jatropha curcas
ref|XP_010934793.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    123   3e-43   Elaeis guineensis
ref|XP_012083396.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    127   4e-43   Jatropha curcas
ref|NP_182112.2|  beta-amylase 7                                        118   4e-43   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE99337.1|  putative beta-amylase                                  118   4e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009398621.1|  PREDICTED: beta-amylase 2, chloroplastic-lik...    117   6e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC85090.1|  hypothetical protein OsI_32458                          120   7e-43   Oryza sativa Indica Group [Indian rice]
gb|EEE70265.1|  hypothetical protein OsJ_30408                          120   7e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008804013.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    124   7e-43   
gb|AAC28536.1|  putative beta-amylase                                   118   7e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009398630.1|  PREDICTED: beta-amylase 2, chloroplastic-lik...    117   8e-43   
ref|NP_001063976.1|  Os09g0569200                                       120   9e-43   
ref|XP_008804014.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    124   9e-43   Phoenix dactylifera
ref|XP_002511858.1|  Beta-amylase, putative                             127   1e-42   Ricinus communis
ref|XP_008232901.1|  PREDICTED: beta-amylase 2, chloroplastic           125   1e-42   Prunus mume [ume]
ref|XP_010909265.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase...    124   1e-42   
ref|XP_002320794.2|  hypothetical protein POPTR_0014s07950g             129   1e-42   Populus trichocarpa [western balsam poplar]
ref|XP_011092228.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    126   1e-42   Sesamum indicum [beniseed]
ref|XP_002459849.1|  hypothetical protein SORBIDRAFT_02g012320          122   2e-42   
ref|XP_010055131.1|  PREDICTED: beta-amylase 2, chloroplastic           122   2e-42   Eucalyptus grandis [rose gum]
ref|XP_010105936.1|  Beta-amylase 2                                     124   2e-42   Morus notabilis
ref|XP_009392820.1|  PREDICTED: beta-amylase 2, chloroplastic-like      123   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011036179.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    128   2e-42   Populus euphratica
ref|XP_011036188.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    128   2e-42   Populus euphratica
ref|XP_007218058.1|  hypothetical protein PRUPE_ppa006189mg             124   3e-42   
ref|XP_006397762.1|  hypothetical protein EUTSA_v10001342mg             119   4e-42   Eutrema salsugineum [saltwater cress]
ref|XP_002274612.2|  PREDICTED: beta-amylase 2, chloroplastic           122   4e-42   Vitis vinifera
ref|XP_002273843.1|  PREDICTED: beta-amylase 7                          118   6e-42   Vitis vinifera
emb|CBI40368.3|  unnamed protein product                                118   7e-42   Vitis vinifera
ref|XP_008777295.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    120   8e-42   
ref|XP_002882038.1|  hypothetical protein ARALYDRAFT_346398             119   8e-42   Arabidopsis lyrata subsp. lyrata
ref|XP_008804015.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    124   9e-42   Phoenix dactylifera
ref|XP_009757493.1|  PREDICTED: beta-amylase 2, chloroplastic           113   1e-41   Nicotiana sylvestris
ref|XP_008777296.1|  PREDICTED: beta-amylase 2, chloroplastic iso...    121   2e-41   Phoenix dactylifera
ref|XP_010232924.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase...    112   4e-41   
ref|XP_010506568.1|  PREDICTED: beta-amylase 7-like                     117   7e-41   Camelina sativa [gold-of-pleasure]
ref|XP_007220223.1|  hypothetical protein PRUPE_ppa002199mg             122   1e-40   Prunus persica
emb|CDX74771.1|  BnaA05g05170D                                          118   1e-40   
ref|XP_009143179.1|  PREDICTED: beta-amylase 7 isoform X1               118   2e-40   Brassica rapa
ref|XP_009143180.1|  PREDICTED: beta-amylase 7 isoform X2               118   2e-40   Brassica rapa
ref|XP_010508098.1|  PREDICTED: beta-amylase 7                          117   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006293786.1|  hypothetical protein CARUB_v10022771mg             115   3e-40   Capsella rubella
ref|XP_009340422.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase 7     121   3e-40   Pyrus x bretschneideri [bai li]
emb|CDY18893.1|  BnaC04g04570D                                          117   3e-40   Brassica napus [oilseed rape]
ref|XP_010518231.1|  PREDICTED: beta-amylase 7-like                     115   4e-40   Camelina sativa [gold-of-pleasure]
ref|XP_001770103.1|  predicted protein                                  115   5e-40   
ref|XP_008232902.1|  PREDICTED: beta-amylase 7                          123   9e-40   Prunus mume [ume]
ref|XP_009767747.1|  PREDICTED: beta-amylase 2, chloroplastic-like      116   8e-39   Nicotiana sylvestris
ref|XP_002987444.1|  hypothetical protein SELMODRAFT_43201              112   9e-39   
emb|CDP08818.1|  unnamed protein product                                107   1e-38   Coffea canephora [robusta coffee]
ref|XP_010055135.1|  PREDICTED: beta-amylase 7 isoform X3               115   4e-38   
ref|XP_010055132.1|  PREDICTED: beta-amylase 7 isoform X1               115   4e-38   Eucalyptus grandis [rose gum]
gb|KCW71612.1|  hypothetical protein EUGRSUZ_E00139                     115   4e-38   Eucalyptus grandis [rose gum]
ref|XP_010055134.1|  PREDICTED: beta-amylase 7 isoform X2               115   4e-38   
ref|XP_002302585.2|  hypothetical protein POPTR_0002s16070g             105   5e-38   Populus trichocarpa [western balsam poplar]
ref|XP_009764518.1|  PREDICTED: beta-amylase 2, chloroplastic-like      109   5e-38   Nicotiana sylvestris
gb|KJB51476.1|  hypothetical protein B456_008G218300                    144   2e-37   Gossypium raimondii
ref|XP_010523740.1|  PREDICTED: beta-amylase 7                          120   3e-37   Tarenaya hassleriana [spider flower]
ref|XP_011023345.1|  PREDICTED: beta-amylase 7 isoform X3               102   4e-37   Populus euphratica
ref|XP_011023344.1|  PREDICTED: beta-amylase 7 isoform X2               102   5e-37   Populus euphratica
ref|XP_011023342.1|  PREDICTED: beta-amylase 7 isoform X1               102   5e-37   Populus euphratica
ref|XP_011023346.1|  PREDICTED: beta-amylase 7 isoform X4               102   5e-37   Populus euphratica
ref|XP_004492727.1|  PREDICTED: beta-amylase 7-like                     119   6e-37   Cicer arietinum [garbanzo]
ref|XP_002980052.1|  hypothetical protein SELMODRAFT_419538             112   1e-36   
ref|XP_009340429.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase...    102   2e-36   
gb|EMT08980.1|  Beta-amylase                                            130   3e-36   
ref|XP_001755209.1|  predicted protein                                  117   3e-36   
gb|KJB24728.1|  hypothetical protein B456_004G158600                    105   7e-36   Gossypium raimondii
gb|KJB24733.1|  hypothetical protein B456_004G158600                    105   7e-36   Gossypium raimondii
gb|KJB24739.1|  hypothetical protein B456_004G158600                    105   1e-35   Gossypium raimondii
ref|XP_007139874.1|  hypothetical protein PHAVU_008G065600g             114   1e-35   Phaseolus vulgaris [French bean]
ref|XP_003534564.1|  PREDICTED: beta-amylase 7-like                     115   2e-35   Glycine max [soybeans]
ref|XP_002511857.1|  Beta-amylase, putative                             100   3e-35   Ricinus communis
ref|XP_011093139.1|  PREDICTED: beta-amylase 7                          103   3e-35   Sesamum indicum [beniseed]
ref|XP_004229887.1|  PREDICTED: beta-amylase 7 isoform X3               100   1e-34   Solanum lycopersicum
ref|XP_010326322.1|  PREDICTED: beta-amylase 7 isoform X1               100   1e-34   Solanum lycopersicum
ref|XP_010326331.1|  PREDICTED: beta-amylase 7 isoform X2               100   1e-34   Solanum lycopersicum
ref|XP_004306787.1|  PREDICTED: beta-amylase 7                          105   2e-34   Fragaria vesca subsp. vesca
ref|XP_006339564.1|  PREDICTED: beta-amylase 7-like isoform X1          102   2e-34   Solanum tuberosum [potatoes]
gb|EYU35089.1|  hypothetical protein MIMGU_mgv1a002519mg              98.6    2e-34   Erythranthe guttata [common monkey flower]
ref|XP_009632039.1|  PREDICTED: beta-amylase 7-like isoform X1          103   1e-33   Nicotiana tomentosiformis
ref|XP_012083397.1|  PREDICTED: beta-amylase 7 isoform X1             98.2    2e-33   Jatropha curcas
ref|XP_009632042.1|  PREDICTED: beta-amylase 7-like isoform X2          103   2e-33   Nicotiana tomentosiformis
ref|XP_009772614.1|  PREDICTED: beta-amylase 7                          103   2e-33   Nicotiana sylvestris
ref|XP_002451472.1|  hypothetical protein SORBIDRAFT_04g002450          131   1e-32   
ref|XP_012083398.1|  PREDICTED: beta-amylase 7 isoform X2             98.2    2e-32   
emb|CDP08819.1|  unnamed protein product                              93.6    5e-32   Coffea canephora [robusta coffee]
ref|XP_008458240.1|  PREDICTED: beta-amylase 7-like isoform X1          100   7e-32   Cucumis melo [Oriental melon]
gb|EMS60553.1|  Beta-amylase 8                                          115   6e-31   Triticum urartu
ref|XP_011656338.1|  PREDICTED: beta-amylase 7-like                   99.4    9e-31   Cucumis sativus [cucumbers]
gb|EPS60387.1|  hypothetical protein M569_14415                         127   5e-30   Genlisea aurea
gb|AHC32020.1|  beta-amylase 2                                          126   7e-30   Camellia sinensis [black tea]
ref|XP_006287427.1|  hypothetical protein CARUB_v10000631mg             124   2e-29   
gb|KJB41325.1|  hypothetical protein B456_007G099100                    123   2e-28   Gossypium raimondii
ref|NP_001131295.1|  uncharacterized protein LOC100192608             79.7    3e-28   
gb|KJB41327.1|  hypothetical protein B456_007G099100                    123   3e-28   Gossypium raimondii
gb|KJB41323.1|  hypothetical protein B456_007G099100                    123   4e-28   Gossypium raimondii
gb|KJB41326.1|  hypothetical protein B456_007G099100                    123   4e-28   Gossypium raimondii
gb|KJB41331.1|  hypothetical protein B456_007G099200                    121   5e-28   Gossypium raimondii
gb|KJB24734.1|  hypothetical protein B456_004G158600                    106   5e-28   Gossypium raimondii
ref|XP_007220222.1|  hypothetical protein PRUPE_ppa002199mg             122   6e-28   
ref|XP_006491097.1|  PREDICTED: beta-amylase 2, chloroplastic-lik...  80.1    6e-28   Citrus sinensis [apfelsine]
ref|XP_008338860.1|  PREDICTED: beta-amylase 7 isoform X1               122   7e-28   
ref|XP_006491096.1|  PREDICTED: beta-amylase 2, chloroplastic-lik...  80.1    8e-28   Citrus sinensis [apfelsine]
ref|XP_008338862.1|  PREDICTED: beta-amylase 7 isoform X2               122   8e-28   
ref|XP_009384530.1|  PREDICTED: beta-amylase 8                          122   9e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001175243.1|  Os07g0543200                                     98.6    5e-27   
ref|XP_010105161.1|  Beta-amylase 8                                     116   9e-27   
ref|XP_002320793.2|  hypothetical protein POPTR_0014s07940g             118   2e-26   
ref|XP_006445048.1|  hypothetical protein CICLE_v10019617mg             117   2e-26   
dbj|BAC83773.1|  putative beta-amylase                                96.7    2e-26   Oryza sativa Japonica Group [Japonica rice]
gb|AAA33898.1|  beta-amylase                                          96.7    2e-26   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ04228.1|  hypothetical protein OsI_26372                        96.7    2e-26   Oryza sativa Indica Group [Indian rice]
gb|KDO86151.1|  hypothetical protein CISIN_1g0370371mg                  117   2e-26   Citrus sinensis [apfelsine]
gb|AFQ33618.1|  beta-amylase 6                                          117   2e-26   Citrus trifoliata [hardy orange]
ref|XP_008793743.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase...    100   3e-26   
gb|KHG19613.1|  Beta-amylase 7                                          115   3e-26   Gossypium arboreum [tree cotton]
ref|XP_006491094.1|  PREDICTED: beta-amylase 7-like isoform X2          117   3e-26   Citrus sinensis [apfelsine]
ref|XP_006491093.1|  PREDICTED: beta-amylase 7-like isoform X1          117   4e-26   
gb|KEH23361.1|  beta-amylase-like protein                               117   5e-26   Medicago truncatula
pdb|2XFF|A  Chain A, Crystal Structure Of Barley Beta-Amylase Com...    100   8e-26   Hordeum vulgare [barley]
gb|AAO67355.1|AF414081_1  endosperm-specific beta-amylase 1             100   8e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010670436.1|  PREDICTED: beta-amylase 7 isoform X1               116   8e-26   Beta vulgaris subsp. vulgaris [field beet]
gb|AAA33899.1|  beta-amylase                                          96.7    8e-26   Oryza sativa Japonica Group [Japonica rice]
gb|AAG25638.1|  beta-amylase                                            100   8e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGY14536.1|  beta-amylase                                            100   9e-26   Hordeum vulgare subsp. spontaneum [wild barley]
ref|XP_010055136.1|  PREDICTED: beta-amylase 7 isoform X4               115   9e-26   
gb|EMS68884.1|  Beta-amylase                                            101   1e-25   Triticum urartu
ref|XP_003562967.2|  PREDICTED: beta-amylase                          97.4    1e-25   
ref|XP_010931493.1|  PREDICTED: beta-amylase                            101   1e-25   
ref|XP_003552392.1|  PREDICTED: beta-amylase 7-like                     115   1e-25   Glycine max [soybeans]
gb|AGY14527.1|  beta-amylase                                            100   1e-25   Hordeum vulgare subsp. spontaneum [wild barley]
gb|ACF05414.1|  beta-amylase                                            100   1e-25   Hordeum vulgare [barley]
emb|CAA77817.1|  Beta-amylase                                         94.7    1e-25   Secale cereale
gb|AGY14529.1|  beta-amylase                                            100   2e-25   Hordeum vulgare subsp. spontaneum [wild barley]
gb|EMT06941.1|  Beta-amylase                                            100   2e-25   
gb|AGY14524.1|  beta-amylase                                            100   2e-25   Hordeum vulgare [barley]
dbj|BAA04815.1|  beta-amylase                                           100   2e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACN24986.1|  beta-amylase                                            100   2e-25   Hordeum vulgare subsp. spontaneum [wild barley]
gb|AAO67356.1|AF414082_1  endosperm-specific beta-amylase 1             100   2e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006657803.1|  PREDICTED: beta-amylase-like                     94.4    2e-25   Oryza brachyantha
gb|AAR18251.1|  beta-amylase 1                                          100   2e-25   Hordeum vulgare [barley]
dbj|BAK06223.1|  predicted protein                                      100   2e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHM99380.1|  Beta-amylase 7                                          115   2e-25   Glycine soja [wild soybean]
gb|AAG25637.1|  beta-amylase                                            100   2e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAC67245.1|  beta-amylase                                            100   2e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|P16098.1|AMYB_HORVU  RecName: Full=Beta-amylase; AltName: Full...    100   2e-25   Hordeum vulgare [barley]
emb|CAC16789.1|  beta-amylase                                         98.6    3e-25   Hordeum vulgare [barley]
sp|P82993.1|AMYB_HORVS  RecName: Full=Beta-amylase; AltName: Full...  99.4    3e-25   Hordeum vulgare subsp. spontaneum [wild barley]
gb|AGY14530.1|  beta-amylase                                          98.6    6e-25   Hordeum vulgare subsp. spontaneum [wild barley]
sp|P93594.1|AMYB_WHEAT  RecName: Full=Beta-amylase; AltName: Full...  94.4    8e-25   Triticum aestivum [Canadian hard winter wheat]
gb|AFO64358.1|  beta-amylase                                          93.6    1e-24   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
emb|CCW36773.1|  beta-amylase 2                                         100   1e-24   Milium effusum
emb|CCW36772.1|  beta-amylase 2                                         100   1e-24   Milium effusum
pdb|1B1Y|A  Chain A, Sevenfold Mutant Of Barley Beta-Amylase          99.4    2e-24   Hordeum vulgare [barley]
ref|XP_002281003.2|  PREDICTED: beta-amylase                          93.6    2e-24   Vitis vinifera
gb|AAX37357.1|  tissue-ubiquitous beta-amylase 2                      95.5    2e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009387229.1|  PREDICTED: beta-amylase-like                     99.8    3e-24   
emb|CBI28977.3|  unnamed protein product                              92.8    3e-24   Vitis vinifera
gb|AGY14538.1|  beta-amylase                                          95.9    3e-24   Hordeum vulgare subsp. spontaneum [wild barley]
emb|CAN70833.1|  hypothetical protein VITISV_005286                   92.8    3e-24   Vitis vinifera
gb|AAC64904.1|  beta-amylase                                          94.7    4e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAX37358.1|  tissue-ubiquitous beta-amylase 2                      95.5    4e-24   Hordeum vulgare subsp. vulgare [two-rowed barley]
sp|O64407.1|AMYB_VIGUN  RecName: Full=Beta-amylase; AltName: Full...  97.1    7e-24   
gb|AAP80614.1|AF470353_1  beta amylase                                  100   7e-24   
sp|O22585.1|AMYB_MEDSA  RecName: Full=Beta-amylase; AltName: Full...  98.6    7e-24   
ref|XP_003539882.1|  PREDICTED: beta-amylase-like                     99.4    1e-23   
ref|XP_004513548.1|  PREDICTED: beta-amylase-like                     97.1    1e-23   
gb|KHN22864.1|  Beta-amylase                                          99.0    1e-23   
gb|KJB46125.1|  hypothetical protein B456_007G349200                  92.4    1e-23   
ref|XP_007029518.1|  Beta-amylase 6                                   92.8    2e-23   
gb|KEH29555.1|  beta-amylase                                          98.2    2e-23   
ref|XP_011658712.1|  PREDICTED: beta-amylase isoform X1               97.1    2e-23   
gb|KDO59876.1|  hypothetical protein CISIN_1g010067mg                 98.6    2e-23   
gb|AFK33500.1|  unknown                                               98.2    2e-23   
pdb|1WDQ|A  Chain A, The Role Of An Inner Loop In The Catalytic M...  97.4    2e-23   
gb|KHN36566.1|  Beta-amylase                                          97.8    2e-23   
ref|XP_011100422.1|  PREDICTED: beta-amylase-like                     96.7    2e-23   
ref|XP_006414272.1|  hypothetical protein EUTSA_v10024842mg           97.8    2e-23   
ref|XP_011658713.1|  PREDICTED: beta-amylase isoform X2               96.7    2e-23   
ref|XP_011658714.1|  PREDICTED: beta-amylase isoform X3               96.7    2e-23   
ref|NP_001236247.1|  beta-amylase precursor                           97.4    3e-23   
gb|AAY40266.1|  beta-amylase                                          99.0    3e-23   
ref|XP_006372990.1|  hypothetical protein POPTR_0017s06840g           93.6    3e-23   
pdb|1BYA|A  Chain A, Crystal Structures Of Soybean Beta-Amylase R...  97.4    3e-23   
pdb|1BTC|A  Chain A, Three-Dimensional Structure Of Soybean Beta-...  97.4    3e-23   
gb|EYU24930.1|  hypothetical protein MIMGU_mgv1a020099mg                103   3e-23   
gb|KFK45005.1|  hypothetical protein AALP_AA1G332100                  97.4    3e-23   
ref|XP_006447463.1|  hypothetical protein CICLE_v10014929mg           97.4    3e-23   
ref|XP_004957938.1|  PREDICTED: beta-amylase-like                     93.6    3e-23   
gb|AAK30294.1|AF353207_1  beta-amylase                                95.9    4e-23   
ref|XP_006372993.1|  Chain A family protein                           93.2    4e-23   
ref|XP_004487367.1|  PREDICTED: beta-amylase-like                     96.7    4e-23   
gb|EYU32120.1|  hypothetical protein MIMGU_mgv1a019039mg              82.0    4e-23   
ref|XP_008455397.1|  PREDICTED: beta-amylase-like isoform X1          95.5    4e-23   
emb|CDY48276.1|  BnaA05g10780D                                        90.9    4e-23   
ref|XP_010434720.1|  PREDICTED: beta-amylase 3, chloroplastic-like    97.1    4e-23   
ref|XP_009136825.1|  PREDICTED: beta-amylase 3, chloroplastic         96.7    4e-23   
ref|XP_010449668.1|  PREDICTED: beta-amylase 3, chloroplastic-like    97.1    5e-23   
ref|XP_007215122.1|  hypothetical protein PRUPE_ppa004334mg           97.1    5e-23   
sp|O65015.1|AMYB_TRIRP  RecName: Full=Beta-amylase; AltName: Full...  97.4    5e-23   
ref|XP_011006412.1|  PREDICTED: beta-amylase-like                     92.8    5e-23   
ref|XP_006372994.1|  hypothetical protein POPTR_0017s06840g           93.2    5e-23   
pdb|1V3I|A  Chain A, The Roles Of Glu186 And Glu380 In The Cataly...  97.4    5e-23   
ref|XP_008455398.1|  PREDICTED: beta-amylase-like isoform X2          95.5    5e-23   
pdb|1WDR|A  Chain A, The Role Of An Inner Loop In The Catalytic M...  98.2    5e-23   
pdb|2DQX|A  Chain A, Mutant Beta-Amylase (W55r) From Soy Bean         97.4    5e-23   
ref|XP_008455399.1|  PREDICTED: beta-amylase-like isoform X3          95.5    5e-23   
ref|XP_007132589.1|  hypothetical protein PHAVU_011G107700g           97.1    5e-23   
gb|AAG44882.1|AF284857_1  beta-amylase                                99.0    5e-23   
emb|CCW36771.1|  beta-amylase 2                                       98.6    5e-23   
ref|XP_002868085.1|  beta-amylase 8                                   96.7    5e-23   
ref|NP_567523.1|  beta-amylase                                        96.7    6e-23   
pdb|1V3H|A  Chain A, The Roles Of Glu186 And Glu380 In The Cataly...  97.4    6e-23   
emb|CDX90487.1|  BnaA03g42940D                                        96.7    6e-23   
gb|AFQ33617.1|  beta-amylase 5                                        96.7    6e-23   
pdb|1Q6E|A  Chain A, Crystal Structure Of Soybean Beta-Amylase Mu...  97.4    6e-23   
pdb|1Q6C|A  Chain A, Crystal Structure Of Soybean Beta-Amylase Co...  97.4    6e-23   
pdb|1Q6D|A  Chain A, Crystal Structure Of Soybean Beta-Amylase Mu...  97.4    6e-23   
dbj|BAD93288.1|  beta-amylase                                         97.4    6e-23   
pdb|1WDS|A  Chain A, The Role Of An Inner Loop In The Catalytic M...  97.4    6e-23   
dbj|BAA09462.1|  beta-amylase                                         97.4    6e-23   
dbj|BAD93290.1|  beta-amylase                                         97.4    6e-23   
gb|AAA33941.1|  beta-amylase                                          97.4    6e-23   
gb|AAZ38831.1|  beta-amylase                                          97.4    6e-23   
ref|XP_004289151.1|  PREDICTED: beta-amylase-like                     95.9    6e-23   
emb|CDY35597.1|  BnaC01g21190D                                        96.7    6e-23   
pdb|1Q6G|A  Chain A, Crystal Structure Of Soybean Beta-Amylase Mu...  97.4    6e-23   
dbj|BAD93289.1|  beta-amylase                                         97.4    7e-23   
ref|XP_006293904.1|  hypothetical protein CARUB_v10022897mg           90.1    7e-23   
ref|XP_006285145.1|  hypothetical protein CARUB_v10006488mg           96.3    7e-23   
emb|CCW36746.1|  beta-amylase 1                                       94.7    8e-23   
ref|XP_006293905.1|  hypothetical protein CARUB_v10022897mg           90.1    8e-23   
ref|NP_001105496.1|  beta-amylase                                     92.4    9e-23   
ref|XP_010440058.1|  PREDICTED: beta-amylase 3, chloroplastic         95.9    9e-23   
gb|AAD15902.1|  beta-amylase                                          92.4    9e-23   
pdb|1UKP|A  Chain A, Crystal Structure Of Soybean Beta-Amylase Mu...  97.4    9e-23   
pdb|1UKO|A  Chain A, Crystal Structure Of Soybean Beta-Amylase Mu...  97.4    1e-22   
ref|XP_007149944.1|  hypothetical protein PHAVU_005G112400g           93.2    1e-22   
gb|EPS63004.1|  hypothetical protein M569_11781                         105   1e-22   
ref|XP_009143965.1|  PREDICTED: beta-amylase 6                        89.7    1e-22   
emb|CDY12218.1|  BnaC04g12480D                                        88.6    1e-22   
emb|CDY09643.1|  BnaC07g34180D                                        95.5    1e-22   
ref|XP_010510054.1|  PREDICTED: beta-amylase 6 isoform X1             89.7    1e-22   
dbj|BAD93291.1|  beta-amylase                                         97.4    1e-22   
emb|CCW36756.1|  beta-amylase 2                                       94.7    1e-22   
emb|CAB46051.1|  putative beta-amylase                                95.9    1e-22   
gb|KJB31802.1|  hypothetical protein B456_005G208900                  94.7    1e-22   
gb|KJB31801.1|  hypothetical protein B456_005G208900                  94.7    2e-22   
emb|CDY42960.1|  BnaA01g17940D                                        97.4    2e-22   
ref|XP_004244551.1|  PREDICTED: beta-amylase 3, chloroplastic-like    97.4    2e-22   
ref|XP_009144721.1|  PREDICTED: beta-amylase 3, chloroplastic-like    97.4    2e-22   
ref|XP_006362484.1|  PREDICTED: beta-amylase 3, chloroplastic-like    97.1    2e-22   
ref|XP_007039629.1|  Chloroplast beta-amylase isoform 1                 100   2e-22   
ref|XP_010510055.1|  PREDICTED: beta-amylase 6 isoform X2             89.0    2e-22   
emb|CCW36752.1|  beta-amylase 2                                       94.0    2e-22   
gb|KJB24731.1|  hypothetical protein B456_004G158600                    106   2e-22   
gb|ACJ83786.1|  unknown                                               97.1    2e-22   
emb|CCW36748.1|  beta-amylase 2                                       94.4    2e-22   
gb|EYU17858.1|  hypothetical protein MIMGU_mgv1a003946mg                100   2e-22   
emb|CCW36765.1|  beta-amylase 2                                       94.4    2e-22   
emb|CCW36755.1|  beta-amylase 2                                       94.0    3e-22   
gb|KJB24730.1|  hypothetical protein B456_004G158600                    105   3e-22   
emb|CCW36766.1|  beta-amylase 2                                       94.4    3e-22   
gb|AES67296.2|  beta-amylase                                          96.7    3e-22   
ref|XP_004243448.1|  PREDICTED: beta-amylase                          93.2    3e-22   
ref|XP_010522319.1|  PREDICTED: beta-amylase 6                        91.7    3e-22   
ref|XP_010414016.1|  PREDICTED: beta-amylase 6-like                   88.6    3e-22   
sp|P10537.4|AMYB_IPOBA  RecName: Full=Beta-amylase; AltName: Full...  93.2    3e-22   
gb|ADB81912.1|  beta-amylase                                          92.0    3e-22   
emb|CCW36763.1|  beta-amylase 2                                       94.0    3e-22   
emb|CCW36770.1|  beta-amylase 2                                       94.0    3e-22   
ref|XP_009388864.1|  PREDICTED: beta-amylase isoform X1               92.8    3e-22   
emb|CCW36751.1|  beta-amylase 2                                       94.0    3e-22   
dbj|BAA02286.1|  beta-amylase                                         93.2    3e-22   
emb|CCW36762.1|  beta-amylase 2                                       93.6    4e-22   
ref|XP_009388866.1|  PREDICTED: beta-amylase isoform X2               92.8    4e-22   
ref|XP_010469618.1|  PREDICTED: beta-amylase 6 isoform X1             88.6    4e-22   
emb|CCW36767.1|  beta-amylase 2                                       93.6    4e-22   
ref|XP_010688831.1|  PREDICTED: beta-amylase-like                     90.1    4e-22   
dbj|BAJ96121.1|  predicted protein                                      100   4e-22   
emb|CCW36761.1|  beta-amylase 2                                       93.6    5e-22   
pdb|1FA2|A  Chain A, Crystal Structure Of Beta-Amylase From Sweet...  93.2    5e-22   
emb|CCW36750.1|  beta-amylase 2                                       95.1    5e-22   
ref|XP_006477060.1|  PREDICTED: beta-amylase 3, chloroplastic iso...    104   6e-22   
emb|CCW36759.1|  beta-amylase 2                                       93.2    6e-22   
emb|CCW36758.1|  beta-amylase 2                                       92.8    6e-22   
emb|CCW36764.1|  beta-amylase 2                                       92.8    6e-22   
ref|NP_180788.2|  beta-amylase 6                                      87.8    6e-22   
ref|XP_006477059.1|  PREDICTED: beta-amylase 3, chloroplastic iso...    104   6e-22   
emb|CAX51378.1|  beta-amylase                                           100   6e-22   
ref|XP_003540325.2|  PREDICTED: beta-amylase-like                     94.7    6e-22   
ref|XP_010055392.1|  PREDICTED: beta-amylase 3, chloroplastic         97.8    6e-22   
gb|KHN25764.1|  Beta-amylase                                          94.4    7e-22   
ref|XP_006410362.1|  hypothetical protein EUTSA_v10016419mg           87.8    7e-22   
emb|CCW36757.1|  beta-amylase 2                                       92.8    7e-22   
ref|XP_009597613.1|  PREDICTED: beta-amylase isoform X1               92.8    7e-22   
ref|XP_010247031.1|  PREDICTED: beta-amylase-like                     94.4    8e-22   
ref|XP_009341436.1|  PREDICTED: beta-amylase-like                     93.2    8e-22   
gb|EYU24817.1|  hypothetical protein MIMGU_mgv1a005201mg              90.5    8e-22   
gb|AAC69949.1|  putative beta-amylase                                 87.4    9e-22   
ref|XP_010274550.1|  PREDICTED: beta-amylase 3, chloroplastic         98.2    9e-22   
ref|XP_009776413.1|  PREDICTED: beta-amylase-like                     92.0    9e-22   
ref|XP_010531694.1|  PREDICTED: beta-amylase 3, chloroplastic-like    95.1    1e-21   
ref|XP_009353236.1|  PREDICTED: beta-amylase-like                     92.8    1e-21   
gb|AHG94609.1|  beta-amylase                                          92.4    1e-21   
emb|CCW36753.1|  beta-amylase 1                                       94.4    1e-21   
gb|EMH73638.1|  beta-amylase, putative                                  102   1e-21   
ref|NP_001048926.1|  Os03g0141200                                     99.8    1e-21   
gb|EAY88485.1|  hypothetical protein OsI_09956                        99.8    1e-21   
ref|XP_009597614.1|  PREDICTED: beta-amylase isoform X2               92.4    1e-21   
ref|XP_006440139.1|  hypothetical protein CICLE_v10019566mg           99.0    1e-21   
emb|CCW36754.1|  beta-amylase 1                                       95.9    1e-21   
ref|XP_006360578.1|  PREDICTED: beta-amylase-like                     91.3    1e-21   
ref|XP_008860257.1|  beta-amylase, putative                             102   1e-21   
gb|ACF82250.1|  unknown                                                 101   1e-21   
emb|CCW36749.1|  beta-amylase 2                                       94.4    1e-21   
ref|XP_653896.1|  beta-amylase                                          102   1e-21   
dbj|BAN38487.1|  beta-amylase, putative                                 102   1e-21   
ref|XP_008379598.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase...  92.8    1e-21   
ref|XP_003558837.1|  PREDICTED: beta-amylase 1, chloroplastic-like      101   1e-21   
ref|XP_001736776.1|  beta-amylase                                       102   1e-21   
dbj|BAN37621.1|  beta-amylase, putative                                 102   1e-21   
gb|AFO84076.1|  beta-amylase                                          97.4    2e-21   
ref|XP_004985749.1|  PREDICTED: beta-amylase 1, chloroplastic-lik...    102   2e-21   
ref|XP_008365535.1|  PREDICTED: beta-amylase-like                     92.8    2e-21   
ref|XP_004985750.1|  PREDICTED: beta-amylase 1, chloroplastic-lik...    102   2e-21   
gb|KHN24537.1|  Beta-amylase 1, chloroplastic                           101   2e-21   
tpg|DAA43307.1|  TPA: beta-amylase                                      101   2e-21   
emb|CCW36747.1|  beta-amylase 1                                       90.9    2e-21   
gb|KDO35878.1|  hypothetical protein CISIN_1g017328mg                 98.2    3e-21   
gb|AGZ80478.1|  beta-amylase                                          96.7    3e-21   
gb|KCW89435.1|  hypothetical protein EUGRSUZ_A01734                   86.7    3e-21   
ref|XP_003548316.1|  PREDICTED: beta-amylase 1, chloroplastic-like      102   3e-21   
gb|EMS10940.1|  glycosyl hydrolase family 14 protein                    102   3e-21   
ref|XP_010051211.1|  PREDICTED: beta-amylase                          86.7    3e-21   
gb|KHG26296.1|  Beta-amylase                                          93.2    3e-21   
ref|XP_001696500.1|  beta-amylase                                       100   4e-21   
gb|EYU24815.1|  hypothetical protein MIMGU_mgv1a006126mg              89.7    4e-21   
ref|NP_001168436.1|  beta-amylase                                     92.8    4e-21   
tpg|DAA41057.1|  TPA: hypothetical protein ZEAMMB73_683301            92.4    5e-21   
ref|XP_011029718.1|  PREDICTED: beta-amylase 1, chloroplastic-like      102   5e-21   
ref|XP_008230132.1|  PREDICTED: beta-amylase-like                     97.1    5e-21   
tpg|DAA41056.1|  TPA: hypothetical protein ZEAMMB73_683301            92.4    5e-21   
ref|NP_001148159.1|  beta-amylase                                       102   5e-21   
gb|ACG29617.1|  beta-amylase                                            102   5e-21   
tpg|DAA43306.1|  TPA: beta-amylase                                      102   5e-21   
gb|EMT30792.1|  Beta-amylase                                          93.2    5e-21   
ref|NP_001275172.1|  beta-amylase PCT-BMYI                            93.2    6e-21   
emb|CAA76131.1|  beta-amylase                                         93.2    6e-21   
ref|XP_004515248.1|  PREDICTED: beta-amylase 1, chloroplastic-like      101   6e-21   
ref|XP_002282871.1|  PREDICTED: beta-amylase 3, chloroplastic         95.5    6e-21   
ref|XP_004245844.1|  PREDICTED: beta-amylase 3, chloroplastic         94.4    7e-21   
ref|NP_001183801.1|  uncharacterized protein LOC100502394             98.6    7e-21   
ref|XP_007209867.1|  hypothetical protein PRUPE_ppa003812mg           92.8    8e-21   
ref|XP_004300297.1|  PREDICTED: beta-amylase 3, chloroplastic         94.4    8e-21   
gb|KFK31133.1|  hypothetical protein AALP_AA6G072200                  86.3    9e-21   
ref|XP_010919816.1|  PREDICTED: beta-amylase 3, chloroplastic iso...  97.4    1e-20   
ref|XP_002460819.1|  hypothetical protein SORBIDRAFT_02g035590        91.7    1e-20   
ref|XP_003541934.2|  PREDICTED: beta-amylase-like                     91.3    1e-20   
gb|AFQ33620.1|  beta-amylase 8                                        99.0    1e-20   
gb|KJB39785.1|  hypothetical protein B456_007G030600                  97.1    1e-20   
ref|XP_002468533.1|  hypothetical protein SORBIDRAFT_01g047500          100   1e-20   
gb|AGT17079.1|  beta-amylase                                            100   1e-20   
ref|XP_010919815.1|  PREDICTED: beta-amylase 3, chloroplastic iso...  97.4    1e-20   
ref|NP_001236350.1|  beta-amylase                                     96.3    1e-20   
ref|XP_010695452.1|  PREDICTED: beta-amylase 3, chloroplastic         94.0    1e-20   
ref|XP_003539125.1|  PREDICTED: beta-amylase 3, chloroplastic-lik...  92.4    1e-20   
emb|CCW36760.1|  beta-amylase 2                                       91.7    2e-20   
ref|XP_002311706.1|  beta-amylase family protein                        100   2e-20   
gb|KEH26843.1|  beta-amylase                                          98.6    2e-20   
ref|XP_005708840.1|  beta-amylase isoform 2                             100   2e-20   
ref|XP_003534086.1|  PREDICTED: beta-amylase 1, chloroplastic           100   2e-20   
ref|XP_008458244.1|  PREDICTED: beta-amylase 7-like isoform X2          100   2e-20   
ref|XP_008229498.1|  PREDICTED: beta-amylase 3, chloroplastic         92.8    2e-20   
tpg|DAA46351.1|  TPA: hypothetical protein ZEAMMB73_080734            98.2    2e-20   
dbj|BAK00030.1|  predicted protein                                    90.5    2e-20   
gb|KJB51734.1|  hypothetical protein B456_008G230100                  95.9    2e-20   
gb|KHG28698.1|  Beta-amylase 3, chloroplastic -like protein           95.9    2e-20   
ref|XP_010105937.1|  Beta-amylase 7                                     100   2e-20   
gb|KJB51736.1|  hypothetical protein B456_008G230100                  95.9    2e-20   
emb|CDP13430.1|  unnamed protein product                              97.8    2e-20   
gb|AIT51848.1|  beta-amylase                                          97.4    3e-20   
ref|XP_008658465.1|  PREDICTED: beta-amylase 3, chloroplastic-like    98.6    3e-20   



>ref|XP_006361593.1| PREDICTED: beta-amylase 8-like, partial [Solanum tuberosum]
Length=618

 Score =   141 bits (355),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q LIDHAD +L+ AT AF+   +VVKIP I+WWY 
Sbjct  418  HETGFFCERGDYDSYYGRFFLHWYRQVLIDHADNVLTLATLAFEGIQIVVKIPAIYWWYR  477

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAGYYN +N+DGYSP+FEVLKK
Sbjct  478  TSSHAAELTAGYYNPTNQDGYSPVFEVLKK  507


 Score =   127 bits (320),  Expect(2) = 5e-63, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 76/108 (70%), Gaps = 2/108 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ T+K VS   Q+   D   A ADP GL WQ++N AW+K + +AG+NA   YDRE F
Sbjct  506  KKHSVTIKFVSSGLQVPETD--DALADPEGLSWQIMNSAWDKEINVAGNNAFPCYDREGF  563

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MRLVET+KPRNDP RH  +FF  ++P   +Q+A   SEL+YF+KCMHG
Sbjct  564  MRLVETAKPRNDPDRHRFSFFAFQQPSPLVQSAICFSELDYFIKCMHG  611



>ref|XP_010324503.1| PREDICTED: beta-amylase 8 isoform X3 [Solanum lycopersicum]
Length=663

 Score =   137 bits (346),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q LIDHA+ +L+ A+ AF+   +VVKIP I+WWY 
Sbjct  463  HETGFFCERGDYDSYYGRFFLHWYRQVLIDHANNVLTLASLAFEGIQIVVKIPSIYWWYR  522

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAGYYN +N+DGYSP+FEVLKK
Sbjct  523  TSSHAAELTAGYYNPTNQDGYSPVFEVLKK  552


 Score =   128 bits (321),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 75/108 (69%), Gaps = 2/108 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ T+K VS   Q+   D   A ADP GL WQ++N AW+K + +AG NA   YDRE F
Sbjct  551  KKHSVTIKFVSSGLQVPETD--DALADPEGLSWQIINSAWDKKITVAGQNAFPCYDREGF  608

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MRLVET+KPRNDP RH  +FF  ++P   +Q+A   SEL+YF+KCMHG
Sbjct  609  MRLVETAKPRNDPDRHRFSFFAFQQPSPLVQSAICFSELDYFIKCMHG  656



>ref|XP_010324502.1| PREDICTED: beta-amylase 8 isoform X1 [Solanum lycopersicum]
Length=667

 Score =   137 bits (346),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q LIDHA+ +L+ A+ AF+   +VVKIP I+WWY 
Sbjct  467  HETGFFCERGDYDSYYGRFFLHWYRQVLIDHANNVLTLASLAFEGIQIVVKIPSIYWWYR  526

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAGYYN +N+DGYSP+FEVLKK
Sbjct  527  TSSHAAELTAGYYNPTNQDGYSPVFEVLKK  556


 Score =   127 bits (320),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 75/108 (69%), Gaps = 2/108 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ T+K VS   Q+   D   A ADP GL WQ++N AW+K + +AG NA   YDRE F
Sbjct  555  KKHSVTIKFVSSGLQVPETD--DALADPEGLSWQIINSAWDKKITVAGQNAFPCYDREGF  612

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MRLVET+KPRNDP RH  +FF  ++P   +Q+A   SEL+YF+KCMHG
Sbjct  613  MRLVETAKPRNDPDRHRFSFFAFQQPSPLVQSAICFSELDYFIKCMHG  660



>ref|XP_010324504.1| PREDICTED: beta-amylase 8 isoform X4 [Solanum lycopersicum]
Length=662

 Score =   137 bits (346),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q LIDHA+ +L+ A+ AF+   +VVKIP I+WWY 
Sbjct  462  HETGFFCERGDYDSYYGRFFLHWYRQVLIDHANNVLTLASLAFEGIQIVVKIPSIYWWYR  521

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAGYYN +N+DGYSP+FEVLKK
Sbjct  522  TSSHAAELTAGYYNPTNQDGYSPVFEVLKK  551


 Score =   128 bits (321),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 75/108 (69%), Gaps = 2/108 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ T+K VS   Q+   D   A ADP GL WQ++N AW+K + +AG NA   YDRE F
Sbjct  550  KKHSVTIKFVSSGLQVPETD--DALADPEGLSWQIINSAWDKKITVAGQNAFPCYDREGF  607

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MRLVET+KPRNDP RH  +FF  ++P   +Q+A   SEL+YF+KCMHG
Sbjct  608  MRLVETAKPRNDPDRHRFSFFAFQQPSPLVQSAICFSELDYFIKCMHG  655



>ref|XP_004244442.1| PREDICTED: beta-amylase 8 isoform X2 [Solanum lycopersicum]
Length=666

 Score =   137 bits (346),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q LIDHA+ +L+ A+ AF+   +VVKIP I+WWY 
Sbjct  466  HETGFFCERGDYDSYYGRFFLHWYRQVLIDHANNVLTLASLAFEGIQIVVKIPSIYWWYR  525

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAGYYN +N+DGYSP+FEVLKK
Sbjct  526  TSSHAAELTAGYYNPTNQDGYSPVFEVLKK  555


 Score =   128 bits (321),  Expect(2) = 5e-62, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 75/108 (69%), Gaps = 2/108 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ T+K VS   Q+   D   A ADP GL WQ++N AW+K + +AG NA   YDRE F
Sbjct  554  KKHSVTIKFVSSGLQVPETD--DALADPEGLSWQIINSAWDKKITVAGQNAFPCYDREGF  611

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MRLVET+KPRNDP RH  +FF  ++P   +Q+A   SEL+YF+KCMHG
Sbjct  612  MRLVETAKPRNDPDRHRFSFFAFQQPSPLVQSAICFSELDYFIKCMHG  659



>ref|XP_010324505.1| PREDICTED: beta-amylase 8 isoform X5 [Solanum lycopersicum]
Length=661

 Score =   137 bits (346),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q LIDHA+ +L+ A+ AF+   +VVKIP I+WWY 
Sbjct  467  HETGFFCERGDYDSYYGRFFLHWYRQVLIDHANNVLTLASLAFEGIQIVVKIPSIYWWYR  526

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAGYYN +N+DGYSP+FEVLKK
Sbjct  527  TSSHAAELTAGYYNPTNQDGYSPVFEVLKK  556


 Score =   128 bits (321),  Expect(2) = 6e-62, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 75/108 (69%), Gaps = 2/108 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ T+K VS   Q+   D   A ADP GL WQ++N AW+K + +AG NA   YDRE F
Sbjct  555  KKHSVTIKFVSSGLQVPETD--DALADPEGLSWQIINSAWDKKITVAGQNAFPCYDREGF  612

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MRLVET+KPRNDP RH  +FF  ++P   +Q+A   SEL+YF+KCMHG
Sbjct  613  MRLVETAKPRNDPDRHRFSFFAFQQPSPLVQSAICFSELDYFIKCMHG  660



>ref|XP_002270680.1| PREDICTED: beta-amylase 8 [Vitis vinifera]
Length=670

 Score =   145 bits (365),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q+LIDHAD +LS AT AF+ET L+VK+P ++WWY 
Sbjct  467  HETGFFCERGDYDSYYGRFFLHWYAQSLIDHADNVLSLATLAFEETQLIVKVPAVYWWYR  526

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN +N+DGYSP+FEVLKK
Sbjct  527  TASHAAELTAGYYNPTNQDGYSPVFEVLKK  556


 Score =   119 bits (299),  Expect(2) = 9e-62, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 74/108 (69%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ T+K V    QI+ ++   A+ADP GL WQVLN AW++G+ +AG NA   YDRE +
Sbjct  555  KKHSVTMKFVCSGLQITCQENDDAFADPEGLSWQVLNSAWDRGLTVAGENAVPCYDREGY  614

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MR+ E +KPRNDP R   +FFV ++P   ++     SEL+YF+KCMHG
Sbjct  615  MRIAEIAKPRNDPDRRHLSFFVYQQPSPLVERTIWFSELDYFIKCMHG  662



>emb|CBI29216.3| unnamed protein product [Vitis vinifera]
Length=612

 Score =   145 bits (365),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q+LIDHAD +LS AT AF+ET L+VK+P ++WWY 
Sbjct  409  HETGFFCERGDYDSYYGRFFLHWYAQSLIDHADNVLSLATLAFEETQLIVKVPAVYWWYR  468

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN +N+DGYSP+FEVLKK
Sbjct  469  TASHAAELTAGYYNPTNQDGYSPVFEVLKK  498


 Score =   119 bits (299),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 74/108 (69%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ T+K V    QI+ ++   A+ADP GL WQVLN AW++G+ +AG NA   YDRE +
Sbjct  497  KKHSVTMKFVCSGLQITCQENDDAFADPEGLSWQVLNSAWDRGLTVAGENAVPCYDREGY  556

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MR+ E +KPRNDP R   +FFV ++P   ++     SEL+YF+KCMHG
Sbjct  557  MRIAEIAKPRNDPDRRHLSFFVYQQPSPLVERTIWFSELDYFIKCMHG  604



>ref|XP_007210828.1| hypothetical protein PRUPE_ppa019231mg, partial [Prunus persica]
 gb|EMJ12027.1| hypothetical protein PRUPE_ppa019231mg, partial [Prunus persica]
Length=670

 Score =   144 bits (364),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q+LIDHAD +LS A+ AFDET ++VK+P ++WWY 
Sbjct  476  HETGFFCERGDYDSYYGRFFLHWYAQSLIDHADNVLSLASLAFDETKIIVKVPAVYWWYK  535

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELT+GYYN +N+DGYSP+FEVLKK
Sbjct  536  TSSHAAELTSGYYNPTNQDGYSPVFEVLKK  565


 Score =   116 bits (291),  Expect(2) = 1e-60, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 71/107 (66%), Gaps = 0/107 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ TVK V     IS +D  +A ADP GL WQVLN AW++G+ +AG NA   YDRE  
Sbjct  564  KKHSVTVKFVCSGLHISSQDNDEALADPEGLSWQVLNLAWDQGLLVAGENALSCYDREGC  623

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMH  157
            MR+VE  KPRNDP     +FFV ++P   +Q A   SEL++F+KCMH
Sbjct  624  MRIVEMVKPRNDPDHRHFSFFVYQQPAPLVQGAICFSELDFFIKCMH  670



>ref|XP_008238070.1| PREDICTED: beta-amylase 8 [Prunus mume]
Length=703

 Score =   142 bits (359),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q+LIDHAD +LS A+ AFDET ++VK+P ++WWY 
Sbjct  499  HETGFFCERGDYDSYYGRFFLHWYAQSLIDHADNVLSLASLAFDETKIIVKVPAVYWWYK  558

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELT+GYYN +N++GYSP+FEVLKK
Sbjct  559  TSSHAAELTSGYYNPTNQNGYSPVFEVLKK  588


 Score =   117 bits (294),  Expect(2) = 2e-60, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ TVK V     +S +D  +A ADP GL WQVLN AW++G+ +AG NA   YDRE  
Sbjct  587  KKHSVTVKFVCSGLHMSSQDNDEALADPEGLSWQVLNLAWDQGLLVAGENALSCYDREGC  646

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MR+VE  KPRNDP     +FFV ++P   +Q A   SEL++F+KCMHG
Sbjct  647  MRIVEMVKPRNDPDHRHFSFFVYQQPAPLVQGAICFSELDFFIKCMHG  694



>ref|XP_009769112.1| PREDICTED: beta-amylase 8 [Nicotiana sylvestris]
Length=664

 Score =   141 bits (355),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q LIDHAD +LS AT AF+   +VVKIP I+WWY 
Sbjct  463  HETGFFCERGDYDSYYGRFFLHWYRQVLIDHADNVLSLATLAFEGVQIVVKIPAIYWWYR  522

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAE+TAGYYN +N+DGYSP+FEVLKK
Sbjct  523  TSSHAAEVTAGYYNPTNQDGYSPVFEVLKK  552


 Score =   119 bits (297),  Expect(2) = 3e-60, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 72/108 (67%), Gaps = 2/108 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ TVK +    Q+   D   A ADP+GL WQ+LN AW+K + +AG N    YDRE  
Sbjct  551  KKHSMTVKFICSGFQVPETD--DALADPDGLSWQILNSAWDKALPVAGQNTFPCYDREGL  608

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MRLVET+KPRNDP  H  +FF  ++P   +Q+A  ISEL+YF+K MHG
Sbjct  609  MRLVETAKPRNDPDHHRFSFFAFQQPSPLVQSAICISELDYFIKSMHG  656



>gb|KJB51478.1| hypothetical protein B456_008G218300 [Gossypium raimondii]
Length=655

 Score =   144 bits (363),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY QAL+DHAD +LS A  AF+ET ++VKIP ++WWY 
Sbjct  452  HETGFFCERGDYDSYYGRFFLHWYAQALMDHADNVLSLANLAFEETKIIVKIPAVYWWYK  511

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAGYYN +N+DGYSP+FEVLKK
Sbjct  512  TSSHAAELTAGYYNPTNQDGYSPVFEVLKK  541


 Score =   115 bits (288),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ TVK V    QI   +  +A+ADP GL WQVLN  W++G+ +AG N    YD+E  
Sbjct  540  KKHSVTVKFVCYGLQICSYENDEAFADPEGLSWQVLNSVWDRGLKVAGENTLSCYDKEGC  599

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            +R++ET+KPRNDP R   +FFV ++P   +Q    + +L+YF+KCMHG
Sbjct  600  LRIIETAKPRNDPDRRHFSFFVYQQPSPLVQGVICLPDLDYFIKCMHG  647



>gb|KJB51477.1| hypothetical protein B456_008G218300 [Gossypium raimondii]
Length=644

 Score =   144 bits (363),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY QAL+DHAD +LS A  AF+ET ++VKIP ++WWY 
Sbjct  441  HETGFFCERGDYDSYYGRFFLHWYAQALMDHADNVLSLANLAFEETKIIVKIPAVYWWYK  500

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAGYYN +N+DGYSP+FEVLKK
Sbjct  501  TSSHAAELTAGYYNPTNQDGYSPVFEVLKK  530


 Score =   115 bits (288),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ TVK V    QI   +  +A+ADP GL WQVLN  W++G+ +AG N    YD+E  
Sbjct  529  KKHSVTVKFVCYGLQICSYENDEAFADPEGLSWQVLNSVWDRGLKVAGENTLSCYDKEGC  588

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            +R++ET+KPRNDP R   +FFV ++P   +Q    + +L+YF+KCMHG
Sbjct  589  LRIIETAKPRNDPDRRHFSFFVYQQPSPLVQGVICLPDLDYFIKCMHG  636



>gb|KJB51475.1| hypothetical protein B456_008G218300 [Gossypium raimondii]
Length=637

 Score =   144 bits (362),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY QAL+DHAD +LS A  AF+ET ++VKIP ++WWY 
Sbjct  434  HETGFFCERGDYDSYYGRFFLHWYAQALMDHADNVLSLANLAFEETKIIVKIPAVYWWYK  493

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAGYYN +N+DGYSP+FEVLKK
Sbjct  494  TSSHAAELTAGYYNPTNQDGYSPVFEVLKK  523


 Score =   115 bits (288),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ TVK V    QI   +  +A+ADP GL WQVLN  W++G+ +AG N    YD+E  
Sbjct  522  KKHSVTVKFVCYGLQICSYENDEAFADPEGLSWQVLNSVWDRGLKVAGENTLSCYDKEGC  581

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            +R++ET+KPRNDP R   +FFV ++P   +Q    + +L+YF+KCMHG
Sbjct  582  LRIIETAKPRNDPDRRHFSFFVYQQPSPLVQGVICLPDLDYFIKCMHG  629



>ref|XP_009589916.1| PREDICTED: beta-amylase 8 [Nicotiana tomentosiformis]
Length=665

 Score =   140 bits (354),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q LIDHAD +LS AT AF+   +VVKIP I+WWY 
Sbjct  464  HETGFFCERGDYDSYYGRFFLHWYRQVLIDHADNVLSLATLAFEGVQIVVKIPAIYWWYR  523

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAE+TAGYYN +N+DGYSP+FEVLKK
Sbjct  524  TSSHAAEVTAGYYNPTNQDGYSPVFEVLKK  553


 Score =   117 bits (293),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 55/108 (51%), Positives = 71/108 (66%), Gaps = 2/108 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ TVK +    Q+   D     ADP+GL WQ+LN AW+K + +AG NA   YDRE  
Sbjct  552  KKHSVTVKFICSGFQVPETD--DPLADPDGLSWQILNSAWDKALPVAGQNAFPCYDREGL  609

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            M+LVET+KPRNDP  H  TF   ++P   +Q+A  ISEL+YF+K MHG
Sbjct  610  MKLVETAKPRNDPDHHLFTFLAFQQPLPLVQSAICISELDYFIKSMHG  657



>ref|XP_008373437.1| PREDICTED: beta-amylase 8 [Malus domestica]
Length=685

 Score =   142 bits (357),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q+LIDHAD +LS A+ AFDE  L+VK+P + WWY 
Sbjct  482  HETGFFCERGDYDSYYGRFFLHWYAQSLIDHADSVLSLASLAFDEXKLIVKVPAVFWWYK  541

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELT+GYYN +N+DGYSP+FEVLKK
Sbjct  542  TTSHAAELTSGYYNPTNQDGYSPIFEVLKK  571


 Score =   115 bits (288),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH ATVK V    QIS +D  +A ADP GL WQVLN AW++G+ +AG NA   YDRE  
Sbjct  570  KKHLATVKFVCSGPQISSQD-NEALADPEGLSWQVLNLAWDRGLTVAGENALSCYDREGC  628

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MR+VE  KPRNDP RH  +FFV ++    +Q      EL +F+KCMHG
Sbjct  629  MRIVEMVKPRNDPDRHHFSFFVYQQXSPLVQGTICFPELGFFIKCMHG  676



>ref|XP_009365721.1| PREDICTED: beta-amylase 8 [Pyrus x bretschneideri]
Length=685

 Score =   141 bits (356),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q+LIDHAD +LS A+ AFDET L+VK+P + WWY 
Sbjct  482  HETGFFCERGDYDSYYGRFFLHWYAQSLIDHADSVLSLASLAFDETKLIVKVPSVFWWYK  541

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELT+GYYN +N+DGYSP+ EVLKK
Sbjct  542  TTSHAAELTSGYYNPTNQDGYSPVLEVLKK  571


 Score =   115 bits (288),  Expect(2) = 2e-59, Method: Compositional matrix adjust.
 Identities = 58/112 (52%), Positives = 72/112 (64%), Gaps = 1/112 (1%)
 Frame = -3

Query  489  LRSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYD  310
            L   KKH ATVK V     IS +D  +A ADP GL WQVLN AW++G+ +AG NA   YD
Sbjct  566  LEVLKKHLATVKFVCSGPHISIQD-NEALADPEGLSWQVLNLAWDRGLTVAGENALSCYD  624

Query  309  RETFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            RE  MR+VE  KPRNDP  H  +FFV ++P   +Q      EL++F+KCMHG
Sbjct  625  REGCMRIVEMVKPRNDPDHHHFSFFVYQQPSPLVQGTICFPELDFFIKCMHG  676



>ref|XP_006432891.1| hypothetical protein CICLE_v10000490mg [Citrus clementina]
 ref|XP_006494107.1| PREDICTED: beta-amylase 8-like [Citrus sinensis]
 gb|ESR46131.1| hypothetical protein CICLE_v10000490mg [Citrus clementina]
Length=682

 Score =   145 bits (365),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q LIDHAD +LS A+ AF+ET ++VK+PG++WWY 
Sbjct  482  HETGFFCERGDYDSYYGRFFLNWYAQTLIDHADNVLSLASLAFEETKIIVKVPGVYWWYK  541

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN SN+DGY+P+FEVLKK
Sbjct  542  TASHAAELTAGYYNPSNQDGYAPVFEVLKK  571


 Score =   110 bits (274),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 71/108 (66%), Gaps = 3/108 (3%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ T+K V     +  +   +A ADP GL WQVLN AW++G+A+AG NA   YDRE  
Sbjct  570  KKHSVTMKFVCAVPSLQDQ---EALADPEGLSWQVLNLAWDRGLAVAGENALSCYDREGC  626

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MR+VE +KPRNDP R   +FF+ ++P   +Q     S+L YF+KCMHG
Sbjct  627  MRVVEMAKPRNDPDRRHFSFFMYQQPSSLLQGIICFSDLGYFIKCMHG  674



>ref|XP_006432890.1| hypothetical protein CICLE_v10000490mg [Citrus clementina]
 gb|ESR46130.1| hypothetical protein CICLE_v10000490mg [Citrus clementina]
Length=677

 Score =   145 bits (365),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q LIDHAD +LS A+ AF+ET ++VK+PG++WWY 
Sbjct  482  HETGFFCERGDYDSYYGRFFLNWYAQTLIDHADNVLSLASLAFEETKIIVKVPGVYWWYK  541

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN SN+DGY+P+FEVLKK
Sbjct  542  TASHAAELTAGYYNPSNQDGYAPVFEVLKK  571


 Score =   110 bits (274),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 71/108 (66%), Gaps = 3/108 (3%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ T+K V     +  +   +A ADP GL WQVLN AW++G+A+AG NA   YDRE  
Sbjct  570  KKHSVTMKFVCAVPSLQDQ---EALADPEGLSWQVLNLAWDRGLAVAGENALSCYDREGC  626

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MR+VE +KPRNDP R   +FF+ ++P   +Q     S+L YF+KCMHG
Sbjct  627  MRVVEMAKPRNDPDRRHFSFFMYQQPSSLLQGIICFSDLGYFIKCMHG  674



>ref|XP_010275178.1| PREDICTED: LOW QUALITY PROTEIN: beta-amylase 8 [Nelumbo nucifera]
Length=685

 Score =   140 bits (354),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF ++GDYDSYYGRFF  WY+QALIDHAD +LS A  AF+ET ++VKIP I+WWY 
Sbjct  443  HETGFFCDRGDYDSYYGRFFLNWYSQALIDHADNVLSLANLAFEETQIIVKIPAIYWWYR  502

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN +N++GYSP+F++LKK
Sbjct  503  TTSHAAELTAGYYNPTNQNGYSPIFDILKK  532


 Score =   114 bits (284),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 75/114 (66%), Gaps = 0/114 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ T+K V     +SP++  +A+ADP  L WQVLN AW++G+ +AG NA   YDRE +
Sbjct  531  KKHSVTLKFVCSGLHVSPQENNEAFADPESLTWQVLNSAWDRGLTLAGQNAAPCYDREGY  590

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA*QSR  136
            MRL++++KPRN+P     +FFV ++P   +      S+L+ F+KCMHG   Q +
Sbjct  591  MRLLDSAKPRNNPDHRHVSFFVYQQPSSLLHNGICFSDLDSFIKCMHGSTFQEK  644



>ref|XP_007040897.1| Beta-amylase 2 [Theobroma cacao]
 gb|EOY25398.1| Beta-amylase 2 [Theobroma cacao]
Length=671

 Score =   141 bits (355),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q+L DHAD +LS A+ AF+ET ++VK+P I+WWY 
Sbjct  468  HETGFFCERGDYDSYYGRFFLHWYAQSLTDHADNVLSLASLAFEETKIIVKVPAIYWWYK  527

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAE+TAGYYN +N+DGYSP+FEVLKK
Sbjct  528  TSSHAAEVTAGYYNPTNQDGYSPVFEVLKK  557


 Score =   112 bits (280),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 71/108 (66%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ T+K V    Q+   +  +A+ADP GL WQVLN AW++G+ +AG N    +DRE  
Sbjct  556  KKHSVTIKFVCSGLQVCSYESDEAFADPEGLSWQVLNSAWDRGLTVAGENTLSCFDREGC  615

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            +R++ET+KPRNDP     +FFV ++P   ++      +L+YF+KCMHG
Sbjct  616  LRIIETAKPRNDPDHRHFSFFVYQQPSPLVEGVICFLDLDYFIKCMHG  663



>gb|AFQ33619.1| beta-amylase 7 [Citrus trifoliata]
Length=677

 Score =   143 bits (361),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q LIDH D +LS A+ AF+ET ++VK+PG++WWY 
Sbjct  477  HETGFFCERGDYDSYYGRFFLNWYAQTLIDHTDNVLSLASLAFEETKIIVKVPGVYWWYK  536

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN SN+DGY+P+FEVLKK
Sbjct  537  TASHAAELTAGYYNPSNQDGYAPVFEVLKK  566


 Score =   110 bits (275),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 71/108 (66%), Gaps = 3/108 (3%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ T+K V     +  +   +A ADP GL WQVLN AW++G+A+AG NA   YDRE  
Sbjct  565  KKHSVTMKFVCAVPSLQDQ---EALADPEGLSWQVLNLAWDRGLAVAGENALSCYDREGC  621

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MR+VE +KPRNDP R   +FF+ ++P   +Q     S+L YF+KCMHG
Sbjct  622  MRVVEMAKPRNDPDRRHFSFFMYQQPSSLLQGTICFSDLGYFIKCMHG  669



>ref|XP_010054915.1| PREDICTED: beta-amylase 8 [Eucalyptus grandis]
 gb|KCW78406.1| hypothetical protein EUGRSUZ_D02573 [Eucalyptus grandis]
Length=667

 Score =   136 bits (342),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q L+DHAD +LS A  AF+E  ++VK+P ++WW+ 
Sbjct  465  HETGFFCERGDYDSYYGRFFLHWYAQTLMDHADSVLSLANLAFEEANIIVKVPAVYWWHK  524

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN +N+DGYSP+FEVLK+
Sbjct  525  TASHAAELTAGYYNPTNQDGYSPVFEVLKR  554


 Score =   117 bits (293),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 75/108 (69%), Gaps = 2/108 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            K+H+ T+K V     +  +++ ++ ADP GL WQVLN AW++G+A+AG NAP  YDR+ F
Sbjct  553  KRHSVTLKFVC--LGLHSQEIDESSADPEGLNWQVLNSAWDRGLAVAGENAPSCYDRDGF  610

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MR+VE +KPRNDP RH  +FFV  +P   +Q+    SEL++ +KCM G
Sbjct  611  MRIVEMAKPRNDPDRHHFSFFVYHQPSSLVQSTMGFSELDFVIKCMRG  658



>ref|XP_011465289.1| PREDICTED: beta-amylase 8 [Fragaria vesca subsp. vesca]
Length=645

 Score =   135 bits (340),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY + LIDHAD +LS A+ AFDET ++VK+P ++WWY 
Sbjct  447  HETGFFCERGDYDSYYGRFFLHWYAKTLIDHADNVLSLASLAFDETQVIVKVPSVYWWYK  506

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
              SHAAELT+GYYN  N+DGYS +FEVLKK
Sbjct  507  TPSHAAELTSGYYNPKNQDGYSLVFEVLKK  536


 Score =   118 bits (295),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 71/108 (66%), Gaps = 4/108 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ TVK V      +P D  +A  DP GL WQVLN AW++G+ +AG NA   YDRE  
Sbjct  535  KKHSVTVKFVCS----APNDGDEALGDPEGLSWQVLNLAWDRGLTVAGENALSCYDREGC  590

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MR+VE  KPRNDP RH  TFFV ++P   +Q     SEL++F+KCMHG
Sbjct  591  MRIVELVKPRNDPDRHHFTFFVYQQPSPLVQGTVCFSELDFFIKCMHG  638



>ref|XP_011082155.1| PREDICTED: beta-amylase 8 isoform X1 [Sesamum indicum]
Length=686

 Score =   142 bits (358),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GD+DSYYGRFF  WYT+ LIDHAD +LS A+ AF++  +VV IP ++WWY 
Sbjct  487  HETGFFCERGDFDSYYGRFFLWWYTKVLIDHADNVLSLASLAFEDIQIVVNIPAVYWWYK  546

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAGYYN+SNRDGYSPLFEVLKK
Sbjct  547  TSSHAAELTAGYYNSSNRDGYSPLFEVLKK  576


 Score =   110 bits (276),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH A +K V    Q S +++  A +DP  L WQVLN AW++G+++AG N    YDRE F
Sbjct  575  KKHAARIKFVISGMQASYQEIDDALSDPEALSWQVLNAAWDQGLSVAGQNGQPCYDREGF  634

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             RLVET++PRN+P     +FFV ++P   IQ     SE+EYF+K MHG
Sbjct  635  TRLVETARPRNNPDCRHFSFFVFQQPSPLIQRTICFSEIEYFIKSMHG  682



>gb|KDO43644.1| hypothetical protein CISIN_1g005715mg [Citrus sinensis]
Length=676

 Score =   145 bits (366),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q LIDHAD +LS A+ AF+ET ++VK+PG++WWY 
Sbjct  481  HETGFFCERGDYDSYYGRFFLNWYAQTLIDHADNVLSLASLAFEETKIIVKVPGVYWWYK  540

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN SN+DGY+P+FEVLKK
Sbjct  541  TASHAAELTAGYYNPSNQDGYAPVFEVLKK  570


 Score =   107 bits (267),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 3/108 (3%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ T+K V     +  +   +A ADP GL WQVLN AW++G+A+AG NA   YDRE  
Sbjct  569  KKHSVTMKFVCAVPSLQDQ---EALADPEGLSWQVLNLAWDRGLAVAGENALSCYDREGC  625

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MR+VE +KPRNDP R   +FF+ ++P   +Q     S+L Y +KCMHG
Sbjct  626  MRVVEMAKPRNDPDRRHFSFFMYQQPSSLLQGTICFSDLGYVIKCMHG  673



>gb|KDO43643.1| hypothetical protein CISIN_1g005715mg [Citrus sinensis]
Length=681

 Score =   145 bits (365),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY Q LIDHAD +LS A+ AF+ET ++VK+PG++WWY 
Sbjct  481  HETGFFCERGDYDSYYGRFFLNWYAQTLIDHADNVLSLASLAFEETKIIVKVPGVYWWYK  540

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN SN+DGY+P+FEVLKK
Sbjct  541  TASHAAELTAGYYNPSNQDGYAPVFEVLKK  570


 Score =   107 bits (267),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 3/108 (3%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ T+K V     +  +   +A ADP GL WQVLN AW++G+A+AG NA   YDRE  
Sbjct  569  KKHSVTMKFVCAVPSLQDQ---EALADPEGLSWQVLNLAWDRGLAVAGENALSCYDREGC  625

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MR+VE +KPRNDP R   +FF+ ++P   +Q     S+L Y +KCMHG
Sbjct  626  MRVVEMAKPRNDPDRRHFSFFMYQQPSSLLQGTICFSDLGYVIKCMHG  673



>ref|XP_010529274.1| PREDICTED: LOW QUALITY PROTEIN: beta-amylase 8 [Tarenaya hassleriana]
Length=673

 Score =   141 bits (355),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF ++GDYDSYYGRFF  WY+Q LI+HA+ +LS A+ AFDET ++VK+P I+WWY 
Sbjct  474  HETGFFCDRGDYDSYYGRFFLNWYSQLLIEHAENVLSLASLAFDETKIIVKVPAIYWWYK  533

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN +NRDGYSP+FE LKK
Sbjct  534  TASHAAELTAGYYNPTNRDGYSPVFEALKK  563


 Score =   111 bits (277),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 70/108 (65%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ TVK V    Q+   +  +A ADP GL WQVLN AW+ G++IAG NA   +DRE  
Sbjct  562  KKHSVTVKFVCSGLQMLTTEHDKALADPEGLSWQVLNAAWDGGMSIAGENAVSCFDREGC  621

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MR+VE +KPRN P     +FFV  +P   +Q +   ++L+YF+KCMHG
Sbjct  622  MRIVEMAKPRNHPENRHFSFFVYHQPSPLVQGSTCFADLDYFIKCMHG  669



>ref|XP_011027979.1| PREDICTED: beta-amylase 8 isoform X1 [Populus euphratica]
Length=675

 Score =   139 bits (351),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSY+GRFF  WY+Q+LIDHAD +LS A+ AF++T +++K+P ++WWY 
Sbjct  472  HETGFFCERGDYDSYFGRFFLHWYSQSLIDHADNVLSLASFAFEDTKIIIKVPAVYWWYR  531

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN +N+DGYSP+FEVLKK
Sbjct  532  TASHAAELTAGYYNPTNQDGYSPVFEVLKK  561


 Score =   110 bits (275),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+  +K V    Q+S  +  +A  DP GL WQVLN AW++G+ +AG N    YDRE +
Sbjct  560  KKHSVIMKFVCSGLQVSGFEKDEALVDPEGLSWQVLNSAWDRGLTVAGVNMLACYDREGY  619

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             R+VE +KPRNDP  H  +FFV ++P    Q      EL+YF+KCMHG
Sbjct  620  RRVVEMAKPRNDPDHHHFSFFVYQQPSALAQGTICFPELDYFIKCMHG  667



>ref|XP_011027980.1| PREDICTED: beta-amylase 8 isoform X2 [Populus euphratica]
Length=674

 Score =   139 bits (351),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSY+GRFF  WY+Q+LIDHAD +LS A+ AF++T +++K+P ++WWY 
Sbjct  471  HETGFFCERGDYDSYFGRFFLHWYSQSLIDHADNVLSLASFAFEDTKIIIKVPAVYWWYR  530

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN +N+DGYSP+FEVLKK
Sbjct  531  TASHAAELTAGYYNPTNQDGYSPVFEVLKK  560


 Score =   110 bits (275),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+  +K V    Q+S  +  +A  DP GL WQVLN AW++G+ +AG N    YDRE +
Sbjct  559  KKHSVIMKFVCSGLQVSGFEKDEALVDPEGLSWQVLNSAWDRGLTVAGVNMLACYDREGY  618

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             R+VE +KPRNDP  H  +FFV ++P    Q      EL+YF+KCMHG
Sbjct  619  RRVVEMAKPRNDPDHHHFSFFVYQQPSALAQGTICFPELDYFIKCMHG  666



>ref|XP_011653241.1| PREDICTED: beta-amylase 8 [Cucumis sativus]
 gb|KGN53462.1| hypothetical protein Csa_4G056530 [Cucumis sativus]
Length=669

 Score =   134 bits (337),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H++ FF E+GDYDSYYGRFF QWY Q LI H D +LS A+  F+ET  +VKIP ++WWY 
Sbjct  465  HESGFFCERGDYDSYYGRFFLQWYAQTLIYHVDNVLSLASLVFEETKFIVKIPAVYWWYK  524

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELT+G+YN SN+DGYSP+F+VLKK
Sbjct  525  TSSHAAELTSGFYNPSNQDGYSPVFDVLKK  554


 Score =   114 bits (285),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 72/108 (67%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+  VKLV     ++ +++  A ADP  L WQ+LN AW++G+ +AG N+   YDR+ +
Sbjct  553  KKHSVIVKLVCCGMPVAGQEVDDALADPESLSWQILNSAWDRGLTVAGENSLSCYDRDGY  612

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MR+++ +KPR+DP RH  +FF   +P   IQ A    EL+YF+KCMHG
Sbjct  613  MRIIDMAKPRSDPDRHRFSFFAYRQPSALIQGAVCFPELDYFIKCMHG  660



>ref|XP_002304400.1| hypothetical protein POPTR_0003s10570g [Populus trichocarpa]
 gb|EEE79379.1| hypothetical protein POPTR_0003s10570g [Populus trichocarpa]
Length=701

 Score =   140 bits (352),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 78/90 (87%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSY+GRFF  WY+Q+LIDHAD +LS A+ AF++T +++K+P ++WWY 
Sbjct  471  HETGFFCERGDYDSYFGRFFLHWYSQSLIDHADNVLSLASFAFEDTKIIIKVPAVYWWYR  530

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN +N+DGYSP+FEVLKK
Sbjct  531  TASHAAELTAGYYNPTNQDGYSPVFEVLKK  560


 Score =   107 bits (266),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 67/108 (62%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+  +K V     +S  +  +A  DP GL WQ+LN AW++G+ +AG N    YDRE +
Sbjct  559  KKHSVIMKFVCSGLPLSGFENDEALVDPEGLSWQILNSAWDRGLTVAGVNMLACYDREGY  618

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             R+VE +KPRNDP  H  +FFV ++P    Q      EL+YF+KCMHG
Sbjct  619  RRVVEMAKPRNDPDHHHFSFFVYQQPSALAQGTICFPELDYFIKCMHG  666



>ref|XP_008451866.1| PREDICTED: beta-amylase 8 [Cucumis melo]
Length=668

 Score =   135 bits (340),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF QWY Q LI H D +LS A+  F+ET  +VKIP ++WWY 
Sbjct  464  HETGFFCERGDYDSYYGRFFLQWYAQTLIYHVDNVLSLASLVFEETKFIVKIPAVYWWYK  523

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELT+G+YN SN+DGYSP+F+VLKK
Sbjct  524  TSSHAAELTSGFYNPSNQDGYSPVFDVLKK  553


 Score =   111 bits (277),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 71/108 (66%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+  VKLV     ++ +D+  A ADP  L WQ+LN AW++G+ +AG N+   YDR+ +
Sbjct  552  KKHSVIVKLVCCGMPVAGQDVDDALADPESLSWQILNSAWDRGLTVAGENSLSCYDRDGY  611

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            +R+++ +KPR+DP R   +FF   +P   IQ A    EL+YF+KCMHG
Sbjct  612  VRIIDMAKPRSDPDRRHFSFFAYRQPSALIQGAVCFPELDYFIKCMHG  659



>gb|KHN11799.1| Beta-amylase 8 [Glycine soja]
Length=565

 Score =   138 bits (348),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYD+YYGRFF  WY+Q LIDHAD +LS AT AF+ET + VK+P ++WWY 
Sbjct  368  HETGFFCERGDYDNYYGRFFLHWYSQTLIDHADNVLSLATLAFEETKITVKVPAVYWWYK  427

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
              SHAAELTAGY+N +N+DGYSP+FEVL+K
Sbjct  428  TPSHAAELTAGYHNPTNQDGYSPVFEVLRK  457


 Score =   107 bits (267),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            +KH  T+K V     +S ++  ++  DP GL WQVLN AW++G+  AG NA   YDRE +
Sbjct  456  RKHAVTMKFVCLGFHLSSQEANESLIDPEGLSWQVLNSAWDRGLMAAGENALLCYDREGY  515

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             +LVE +KPRNDP R   +FFV ++P   +QT    SEL++FVKCMHG
Sbjct  516  KKLVEIAKPRNDPDRRHFSFFVYQQP-SLLQTNVCWSELDFFVKCMHG  562



>ref|XP_003534334.1| PREDICTED: beta-amylase 8-like [Glycine max]
Length=654

 Score =   138 bits (348),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYD+YYGRFF  WY+Q LIDHAD +LS AT AF+ET + VK+P ++WWY 
Sbjct  455  HETGFFCERGDYDNYYGRFFLHWYSQTLIDHADNVLSLATLAFEETKITVKVPAVYWWYK  514

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
              SHAAELTAGY+N +N+DGYSP+FEVL+K
Sbjct  515  TPSHAAELTAGYHNPTNQDGYSPVFEVLRK  544


 Score =   107 bits (267),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 71/108 (66%), Gaps = 1/108 (1%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            +KH  T+K V     +S ++  ++  DP GL WQVLN AW++G+  AG NA   YDRE +
Sbjct  543  RKHAVTMKFVCLGFHLSSQEANESLIDPEGLSWQVLNSAWDRGLMAAGENALLCYDREGY  602

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             +LVE +KPRNDP R   +FFV ++P   +QT    SEL++FVKCMHG
Sbjct  603  KKLVEIAKPRNDPDRRHFSFFVYQQP-SLLQTNVCWSELDFFVKCMHG  649



>ref|XP_004512346.1| PREDICTED: beta-amylase 8-like [Cicer arietinum]
Length=650

 Score =   137 bits (344),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYD+YYGRFF  WY+Q L DHAD +LS A+ AF+ET ++VK+P ++WWY 
Sbjct  450  HETGFFCERGDYDNYYGRFFLHWYSQTLTDHADNVLSLASLAFEETKIIVKVPAVYWWYK  509

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            + SHAAELTAGY+N +N+DGYSP+FEVL+K
Sbjct  510  SPSHAAELTAGYHNPTNQDGYSPVFEVLRK  539


 Score =   108 bits (270),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (65%), Gaps = 1/108 (1%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            +KH  T+K V     +S ++  ++  DP GL WQ LN AWE+G+  AG NA  GYDRE +
Sbjct  538  RKHAVTMKFVCLGFNLSSQEANESLVDPEGLSWQALNSAWERGLITAGENALFGYDRERY  597

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             RLVE +KPRNDP     +FFV ++P   +Q    +SEL++F+KCMHG
Sbjct  598  KRLVEMAKPRNDPDHRHFSFFVYQQP-SLLQGNVCLSELDFFIKCMHG  644



>ref|XP_012083880.1| PREDICTED: beta-amylase 8 [Jatropha curcas]
 gb|KDP28061.1| hypothetical protein JCGZ_19469 [Jatropha curcas]
Length=676

 Score =   131 bits (329),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSY+GRFF  WY Q LIDHAD +LS A+ AF++T ++VKIP ++WWY 
Sbjct  473  HETGFFCERGDYDSYFGRFFLHWYAQTLIDHADNVLSLASLAFEDTKIIVKIPAVYWWYR  532

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGY+N +N DGY+ +F++LKK
Sbjct  533  TASHAAELTAGYHNPTNHDGYATVFDLLKK  562


 Score =   114 bits (284),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 52/109 (48%), Positives = 71/109 (65%), Gaps = 0/109 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ T+K      QI  ++  +A ADP GL WQVLN AW++G+ ++G N    YDRE  
Sbjct  561  KKHSVTMKFACSGLQIPSQESDEALADPEGLSWQVLNSAWDRGLTVSGVNMLSCYDREGC  620

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGY  151
            M++VE +KPRNDP R   +FFV ++P    Q A    EL+YF+KCMHG+
Sbjct  621  MKVVEMAKPRNDPDRRHFSFFVYQQPSPLFQGAICFGELDYFIKCMHGH  669



>gb|EYU37446.1| hypothetical protein MIMGU_mgv1a002385mg [Erythranthe guttata]
Length=681

 Score =   142 bits (359),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WYTQ LIDHAD +LS A+ AF+ET ++VKIP ++WWY 
Sbjct  482  HETGFFCERGDYDSYYGRFFMNWYTQILIDHADNVLSLASLAFEETLILVKIPSVYWWYK  541

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQC  464
             +SHAAELTAGYYN SN+DGYS LFEVLKK Q 
Sbjct  542  TTSHAAELTAGYYNPSNQDGYSRLFEVLKKHQV  574


 Score =   101 bits (252),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 69/108 (64%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH  T+K V        +++  A++D  GL WQVLN AW++G+++AG N    YDRE  
Sbjct  570  KKHQVTMKFVISGLHAPYQEIDGAFSDSEGLNWQVLNSAWDQGLSVAGQNLQPCYDREGL  629

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            +RLVET+KPRN P     +FFV ++P   IQ    +SE+++F+K MHG
Sbjct  630  VRLVETAKPRNHPDSRHFSFFVFQQPSPLIQRTICLSEIDHFIKSMHG  677



>ref|XP_007158095.1| hypothetical protein PHAVU_002G123700g [Phaseolus vulgaris]
 gb|ESW30089.1| hypothetical protein PHAVU_002G123700g [Phaseolus vulgaris]
Length=657

 Score =   137 bits (345),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYD+YYGRFF  WY+Q LIDHAD +LS AT AF+ET ++VK+P ++WWY 
Sbjct  458  HETGFFCERGDYDNYYGRFFLHWYSQTLIDHADNVLSLATLAFEETKIIVKVPAVYWWYK  517

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
              SHAAELTAGY+N +N+DGY P+FEVL+K
Sbjct  518  TPSHAAELTAGYHNPTNQDGYYPVFEVLRK  547


 Score =   105 bits (262),  Expect(2) = 4e-55, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 70/108 (65%), Gaps = 1/108 (1%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            +KH  T+K V     +S ++  ++  DP GL WQVLN AW++G+   G NA   YDRE +
Sbjct  546  RKHAVTMKFVCLGFHLSSQEANESLIDPEGLSWQVLNSAWDRGLMAGGENALLCYDREGY  605

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             RLV+T+KPRNDP     +FFV ++P   +Q    +SEL++FVKCMHG
Sbjct  606  KRLVDTAKPRNDPDHRHFSFFVYQQP-SLLQANVCLSELDFFVKCMHG  652



>ref|XP_002519919.1| Beta-amylase, putative [Ricinus communis]
 gb|EEF42523.1| Beta-amylase, putative [Ricinus communis]
Length=668

 Score =   134 bits (337),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSY+GRFF  WY + LIDHAD +LS A+  F++T ++VKIP ++WWY 
Sbjct  469  HETGFFCERGDYDSYFGRFFLHWYARTLIDHADNVLSLASLTFEDTRIIVKIPAVYWWYK  528

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAGY+N +N+DGYSP+FE LKK
Sbjct  529  TSSHAAELTAGYHNPTNQDGYSPVFEALKK  558


 Score =   107 bits (266),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 67/108 (62%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ TVK V    Q+S  +  +  ADP GL WQVLN AW++G+ +AG N    YDRE  
Sbjct  557  KKHSVTVKFVCSGLQVSAHENDEVLADPEGLSWQVLNSAWDRGLTVAGVNVLSCYDREGC  616

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MR+VE +KPR +P      FFV ++P   +      +EL+YF+KCMHG
Sbjct  617  MRVVEMAKPRCNPDHRQFAFFVYQQPSPLVPGTLCFTELDYFIKCMHG  664



>ref|XP_003612541.1| Beta-amylase [Medicago truncatula]
 gb|AES95499.1| beta-amylase-like protein [Medicago truncatula]
Length=650

 Score =   136 bits (342),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYD+YYGRFF  WY+Q L+DHAD +LS A  AF+ T ++VK+P ++WWY 
Sbjct  450  HETGFFCERGDYDNYYGRFFLHWYSQTLVDHADNVLSLANLAFEGTKIIVKVPAVYWWYK  509

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
              SHAAELTAGY+N +N+DGYSP+FEVLKK
Sbjct  510  TPSHAAELTAGYHNPTNQDGYSPVFEVLKK  539


 Score =   104 bits (260),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 70/108 (65%), Gaps = 1/108 (1%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH  T+K V      S ++  ++  DP+GL WQVLN AWE+G+  +G NA   YDRE +
Sbjct  538  KKHAVTMKFVCLGFNPSNQEANESLVDPDGLSWQVLNSAWERGLITSGENAIFCYDRERY  597

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             RL+E +KPRNDP     +FFV ++P   +Q    +SEL++F+KCMHG
Sbjct  598  ERLIEMAKPRNDPDHRHFSFFVYQQP-SLLQGNVCLSELDFFIKCMHG  644



>gb|KHG17783.1| Beta-amylase 8 -like protein [Gossypium arboreum]
Length=643

 Score =   135 bits (340),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY QAL+DHAD +LS A  AF+ET ++VKIP ++WWY 
Sbjct  456  HETGFFCERGDYDSYYGRFFLHWYAQALMDHADNVLSLANLAFEETKIIVKIPAVYWWYK  515

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEV  482
             SSHAAELTAGY N +N+DGYSP+FEV
Sbjct  516  TSSHAAELTAGYNNPTNQDGYSPVFEV  542


 Score =   105 bits (262),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = -3

Query  411  QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETFMRLVETSKPRNDPYRHXSTFFV  232
            +A+ADP GL WQVLN AW++G+ +AG N    YDRE  +R++ET+KPRNDP R   +FFV
Sbjct  549  EAFADPEGLSWQVLNSAWDRGLKVAGENTLSCYDREGCLRIIETAKPRNDPDRRHFSFFV  608

Query  231  LERPWQRIQTAENISELEYFVKCMHG  154
             ++P   +Q    + +L+YF+KCMHG
Sbjct  609  YQQPSPLVQGVICLPDLDYFIKCMHG  634



>emb|CDX87798.1| BnaC02g31510D [Brassica napus]
Length=700

 Score =   135 bits (340),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF+E+G+YDSYYGRFF  WY+Q LI HA+ +LS A  AF+ET ++VKIP I+W Y 
Sbjct  477  HETGFFQERGEYDSYYGRFFLNWYSQLLIGHAENVLSLANLAFEETKIIVKIPAIYWSYK  536

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN SNRDGYSP+FE LKK
Sbjct  537  TASHAAELTAGYYNPSNRDGYSPVFETLKK  566


 Score =   104 bits (259),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 69/108 (64%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KK++ TVK V    Q+S  +  +A ADP GL WQV+N AW+KG+ I G NA   +DRE  
Sbjct  565  KKYSVTVKFVCPGPQMSSNEHEEALADPEGLSWQVVNAAWDKGLLIGGENAITCFDREGC  624

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MRL+E +KPRN P  +  +FF   +P   +Q +   ++L+YF+K MHG
Sbjct  625  MRLIEMAKPRNHPDSYHFSFFTYRQPSPLVQGSTCFADLDYFIKRMHG  672



>gb|KHN41758.1| Beta-amylase 8 [Glycine soja]
Length=664

 Score =   137 bits (344),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYD+YYGRFF  WY+Q LIDHAD +LS AT AF+ET ++VK+P ++WWY 
Sbjct  467  HETGFFCERGDYDNYYGRFFLHWYSQTLIDHADNVLSLATLAFEETKIIVKVPAVYWWYK  526

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
              SHAAELTAGY+N + +DGYSP+FEVL+K
Sbjct  527  TPSHAAELTAGYHNPTYQDGYSPVFEVLRK  556


 Score =   102 bits (254),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 68/108 (63%), Gaps = 1/108 (1%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            +KH  T+K V     +S ++  +   DP GL WQVLN AW++G+  AG NA   Y RE +
Sbjct  555  RKHAVTMKFVCLGFHLSSQEAYEPLIDPEGLSWQVLNSAWDRGLMAAGENALLCYGREGY  614

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             RLVE +KPRNDP     +FFV ++P   +Q    +SEL++FVKCMHG
Sbjct  615  KRLVEMAKPRNDPDCRHFSFFVYQQP-SLLQANVCLSELDFFVKCMHG  661



>emb|CDY69112.1| BnaA02g36650D [Brassica napus]
Length=632

 Score =   134 bits (337),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF+E+G+YDSYYGRFF  WY+Q LI HA+ +LS A  AF++T ++VKIP I+W Y 
Sbjct  433  HETGFFQERGEYDSYYGRFFLNWYSQLLIGHAENVLSLANLAFEDTKIIVKIPAIYWSYK  492

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN SNRDGYSP+FE LKK
Sbjct  493  TASHAAELTAGYYNPSNRDGYSPVFETLKK  522


 Score =   104 bits (260),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 70/108 (65%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KK++ TVK V    Q+S  +  +A ADP GL WQV+N AW+KG+ I G NA   +DRE+ 
Sbjct  521  KKYSVTVKFVCPGPQMSSNEHEEALADPEGLSWQVVNAAWDKGLLIGGENAITCFDRESC  580

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MRL+E +KPRN P  +  +FF   +P   +Q +   ++L+YF+K MHG
Sbjct  581  MRLIEMAKPRNHPDSNHFSFFTYRQPSPLVQGSTCFADLDYFIKRMHG  628



>ref|XP_010481609.1| PREDICTED: beta-amylase 8-like [Camelina sativa]
Length=665

 Score =   136 bits (343),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF+E+G+YDSYYGRFF  WY+Q LI HA+ +LS A  AF+ET ++VKIP I+W Y 
Sbjct  466  HETGFFQERGEYDSYYGRFFLNWYSQLLIGHAENVLSLANLAFEETKIIVKIPAIYWSYK  525

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN SNRDGYSPLFE LKK
Sbjct  526  TASHAAELTAGYYNPSNRDGYSPLFETLKK  555


 Score =   102 bits (254),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 67/108 (62%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KK++ TVK V    Q+SP +  +A ADP GL WQV+N AW+K + I G NA   +DRE  
Sbjct  554  KKYSVTVKFVCPGPQMSPNEHEEALADPEGLSWQVINAAWDKQLLIGGENAITCFDREGC  613

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MRL++ +KPRN P  +  +FF   +P   +Q      +L+YF+K MHG
Sbjct  614  MRLIDIAKPRNHPDSYHFSFFTYRQPSHLVQGYTCFPDLDYFIKRMHG  661



>ref|XP_003516502.1| PREDICTED: beta-amylase 8-like isoform X1 [Glycine max]
Length=656

 Score =   136 bits (343),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYD+YYGRFF  WY+Q LIDHAD +LS AT AF+ET ++VK+P ++WWY 
Sbjct  457  HETGFFCERGDYDNYYGRFFLHWYSQTLIDHADNVLSLATLAFEETKIIVKVPAVYWWYK  516

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
              SHAAELTAGY+N + +DGYSP+FEVL+K
Sbjct  517  TPSHAAELTAGYHNPTYQDGYSPVFEVLRK  546


 Score =   102 bits (253),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 68/108 (63%), Gaps = 1/108 (1%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            +KH  T+K V     +S ++  +   DP GL WQVLN AW++G+  AG NA   Y RE +
Sbjct  545  RKHAVTMKFVCLGFHLSSQEAYEPLIDPEGLSWQVLNSAWDRGLMAAGENALLCYGREGY  604

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             RLVE +KPRNDP     +FFV ++P   +Q    +SEL++FVKCMHG
Sbjct  605  KRLVEMAKPRNDPDCRHFSFFVYQQP-SLLQANVCLSELDFFVKCMHG  651



>ref|XP_010494622.1| PREDICTED: beta-amylase 8 [Camelina sativa]
Length=683

 Score =   137 bits (346),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF+E+G+YDSYYGRFF  WY+Q LI HA+ +LS A  AF+ET ++VKIP I+W Y 
Sbjct  484  HETGFFQERGEYDSYYGRFFLNWYSQLLIGHAENVLSLANLAFEETKIIVKIPAIYWSYK  543

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAGYYN SNRDGYSPLFE LKK
Sbjct  544  TSSHAAELTAGYYNPSNRDGYSPLFETLKK  573


 Score =   100 bits (249),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 67/108 (62%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KK++ T+K V    Q+SP +  +A ADP GL WQV+N AW+K + I G NA   +DRE  
Sbjct  572  KKYSVTLKFVCPGPQMSPNEHEEALADPEGLSWQVINAAWDKQLLIGGENAITCFDREGC  631

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MRL + +KPRN P  +  +FF   +P   +Q +    +L+YF+K MHG
Sbjct  632  MRLTDIAKPRNHPDSYHFSFFTYRQPSPLVQGSTCFPDLDYFIKRMHG  679



>ref|XP_011624011.1| PREDICTED: beta-amylase 8 isoform X1 [Amborella trichopoda]
Length=676

 Score =   131 bits (330),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF ++GDYDSYYGRFF QWY+Q LIDHAD +L+ A  AF+ TP+V KIP ++WWY 
Sbjct  472  HETGFFCDRGDYDSYYGRFFLQWYSQVLIDHADHVLALANLAFEGTPIVAKIPAVYWWYR  531

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN SN++GY+ +  +LKK
Sbjct  532  TASHAAELTAGFYNPSNQEGYTLILNILKK  561


 Score =   106 bits (264),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 70/111 (63%), Gaps = 1/111 (1%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+AT + +    Q++P+D  +  ADP GL WQVLN AW++ + IA  NA   YDRE F
Sbjct  560  KKHSATFRFIFSGLQLTPQDNDETMADPEGLTWQVLNAAWDQKMNIASQNAVPCYDREGF  619

Query  297  MRLVETSKPRNDPYRHXSTFFVLER-PWQRIQTAENISELEYFVKCMHGYA  148
             R++ET+KPRNDP RH  + F  +R     IQ A   SE + FVK MHG A
Sbjct  620  NRILETAKPRNDPDRHHLSSFAYQRMSPSLIQRASFFSEFDRFVKSMHGEA  670



>gb|ERM94797.1| hypothetical protein AMTR_s00011p00265640 [Amborella trichopoda]
Length=700

 Score =   131 bits (330),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF ++GDYDSYYGRFF QWY+Q LIDHAD +L+ A  AF+ TP+V KIP ++WWY 
Sbjct  472  HETGFFCDRGDYDSYYGRFFLQWYSQVLIDHADHVLALANLAFEGTPIVAKIPAVYWWYR  531

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN SN++GY+ +  +LKK
Sbjct  532  TASHAAELTAGFYNPSNQEGYTLILNILKK  561


 Score =   105 bits (262),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 69/109 (63%), Gaps = 1/109 (1%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+AT + +    Q++P+D  +  ADP GL WQVLN AW++ + IA  NA   YDRE F
Sbjct  560  KKHSATFRFIFSGLQLTPQDNDETMADPEGLTWQVLNAAWDQKMNIASQNAVPCYDREGF  619

Query  297  MRLVETSKPRNDPYRHXSTFFVLER-PWQRIQTAENISELEYFVKCMHG  154
             R++ET+KPRNDP RH  + F  +R     IQ A   SE + FVK MHG
Sbjct  620  NRILETAKPRNDPDRHHLSSFAYQRMSPSLIQRASFFSEFDRFVKSMHG  668



>ref|XP_011624018.1| PREDICTED: beta-amylase 8 isoform X2 [Amborella trichopoda]
Length=668

 Score =   131 bits (330),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF ++GDYDSYYGRFF QWY+Q LIDHAD +L+ A  AF+ TP+V KIP ++WWY 
Sbjct  472  HETGFFCDRGDYDSYYGRFFLQWYSQVLIDHADHVLALANLAFEGTPIVAKIPAVYWWYR  531

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN SN++GY+ +  +LKK
Sbjct  532  TASHAAELTAGFYNPSNQEGYTLILNILKK  561


 Score =   105 bits (262),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 69/109 (63%), Gaps = 1/109 (1%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+AT + +    Q++P+D  +  ADP GL WQVLN AW++ + IA  NA   YDRE F
Sbjct  560  KKHSATFRFIFSGLQLTPQDNDETMADPEGLTWQVLNAAWDQKMNIASQNAVPCYDREGF  619

Query  297  MRLVETSKPRNDPYRHXSTFFVLER-PWQRIQTAENISELEYFVKCMHG  154
             R++ET+KPRNDP RH  + F  +R     IQ A   SE + FVK MHG
Sbjct  620  NRILETAKPRNDPDRHHLSSFAYQRMSPSLIQRASFFSEFDRFVKSMHG  668



>ref|XP_010441757.1| PREDICTED: beta-amylase 8-like [Camelina sativa]
Length=681

 Score =   136 bits (343),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF+E+G+YDSYYGRFF  WY+Q LI HA+ +LS A  AF+ET ++VKIP I+W Y 
Sbjct  482  HETGFFQERGEYDSYYGRFFLNWYSQLLIGHAENVLSLANLAFEETKIIVKIPAIYWSYK  541

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN SNRDGYSPLFE LKK
Sbjct  542  TASHAAELTAGYYNPSNRDGYSPLFETLKK  571


 Score = 99.8 bits (247),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KK++ T+K V    Q+SP +  +A ADP GL WQV+N AW+K + I G NA   +DRE  
Sbjct  570  KKYSVTLKFVCPGPQMSPNEHEEALADPEGLSWQVINAAWDKQLLIGGENAITCFDREGC  629

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            +RL++ +KPRN P  +  +FF   +P   +Q +    +L+YF+K MHG
Sbjct  630  VRLIDIAKPRNHPDSYHFSFFTYRQPSPLVQGSTCFPDLDYFIKRMHG  677



>ref|XP_009128781.1| PREDICTED: beta-amylase 8 [Brassica rapa]
Length=678

 Score =   135 bits (339),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF+E+G+YDSYYGRFF  WY+Q LI HA+ +LS A  AF+ET ++VKIP I+W Y 
Sbjct  479  HETGFFQERGEYDSYYGRFFLNWYSQLLIGHAENVLSLANLAFEETKIIVKIPAIYWSYK  538

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN SNRDGYSP+FE LKK
Sbjct  539  IASHAAELTAGYYNPSNRDGYSPVFETLKK  568


 Score =   100 bits (250),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KK++ TVK V    Q+S  +  +A ADP GL WQV+N AW+KG+ I G NA   +DR   
Sbjct  567  KKYSVTVKFVCPGPQMSSNEHEEALADPEGLSWQVVNAAWDKGLLIGGENAITCFDRGGC  626

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MRL+E +KPRN P  +  +FF   +P   +Q +   ++L+YF+K MHG
Sbjct  627  MRLIEMAKPRNHPDSNHFSFFTYRQPSPLVQGSTCFADLDYFIKRMHG  674



>ref|NP_001032014.1| beta-amylase 2 [Arabidopsis thaliana]
 gb|AED95230.1| beta-amylase [Arabidopsis thaliana]
Length=687

 Score =   131 bits (329),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF+E+G+YDSYYGRFF  WY+Q LI HA+ +LS A  AF+ET ++VKIP I+W Y 
Sbjct  485  HETVFFQERGEYDSYYGRFFLNWYSQLLIGHAENVLSLANLAFEETKIIVKIPAIYWSYK  544

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN SNRDGYS +FE LKK
Sbjct  545  TASHAAELTAGYYNPSNRDGYSLVFETLKK  574


 Score =   103 bits (256),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KK++ TVK V    Q+SP    +A ADP GL WQV+N AW+KG+ I G NA   +DR+  
Sbjct  573  KKYSVTVKFVCPGPQMSPNAHEEALADPEGLSWQVINAAWDKGLQIGGENAITCFDRDGC  632

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MRL++ +KPRN P  +  +FF   +P   +Q +    +L+YF+K MHG
Sbjct  633  MRLIDIAKPRNHPDGYHFSFFTYRQPSPLVQGSTCFPDLDYFIKRMHG  680



>ref|NP_199343.1| beta-amylase 2 [Arabidopsis thaliana]
 sp|Q9FH80.1|BAM8_ARATH RecName: Full=Beta-amylase 8; AltName: Full=1,4-alpha-D-glucan 
maltohydrolase; AltName: Full=Beta-amylase 2 [Arabidopsis 
thaliana]
 dbj|BAB10251.1| beta-amylase-like [Arabidopsis thaliana]
 dbj|BAC41818.1| putative beta-amylase [Arabidopsis thaliana]
 gb|AAP21290.1| At5g45300 [Arabidopsis thaliana]
 gb|AED95229.1| beta-amylase [Arabidopsis thaliana]
Length=689

 Score =   131 bits (329),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF+E+G+YDSYYGRFF  WY+Q LI HA+ +LS A  AF+ET ++VKIP I+W Y 
Sbjct  487  HETVFFQERGEYDSYYGRFFLNWYSQLLIGHAENVLSLANLAFEETKIIVKIPAIYWSYK  546

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN SNRDGYS +FE LKK
Sbjct  547  TASHAAELTAGYYNPSNRDGYSLVFETLKK  576


 Score =   103 bits (256),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 68/108 (63%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KK++ TVK V    Q+SP    +A ADP GL WQV+N AW+KG+ I G NA   +DR+  
Sbjct  575  KKYSVTVKFVCPGPQMSPNAHEEALADPEGLSWQVINAAWDKGLQIGGENAITCFDRDGC  634

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MRL++ +KPRN P  +  +FF   +P   +Q +    +L+YF+K MHG
Sbjct  635  MRLIDIAKPRNHPDGYHFSFFTYRQPSPLVQGSTCFPDLDYFIKRMHG  682



>ref|XP_006279583.1| hypothetical protein CARUB_v10025996mg, partial [Capsella rubella]
 gb|EOA12481.1| hypothetical protein CARUB_v10025996mg, partial [Capsella rubella]
Length=695

 Score =   133 bits (334),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF+E+G+YDSYYGRFF  WY+Q LI HA+ +LS A+ AF+ET ++VKIP I+W Y 
Sbjct  496  HETGFFQERGEYDSYYGRFFLNWYSQLLIGHAENVLSLASLAFEETKIIVKIPAIYWSYK  555

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN SNRDGYS LFE LKK
Sbjct  556  TASHAAELTAGYYNPSNRDGYSLLFETLKK  585


 Score =   100 bits (248),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KK++ TVK V    Q+S  +  +A ADP GL WQV+N AW+K + I G NA   +DRE  
Sbjct  584  KKYSVTVKFVCPGPQMSSNEHEEALADPEGLSWQVINAAWDKKLLIGGENAITCFDREVC  643

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MRLV+ +KPRN P  +  +FF   +P   IQ +    +L YF+K MHG
Sbjct  644  MRLVDIAKPRNHPDSNHFSFFTYRQPSPLIQGSTCFPDLNYFIKHMHG  691



>ref|XP_010676684.1| PREDICTED: beta-amylase 8 [Beta vulgaris subsp. vulgaris]
Length=673

 Score =   134 bits (338),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = -2

Query  739  QTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLA  560
            +T FF E+GDYDSY+GRFF  WY Q LIDHAD +LS A+ AF+ T +VVKIP ++WWY  
Sbjct  470  ETGFFCERGDYDSYFGRFFLHWYAQILIDHADNVLSLASLAFEGTQIVVKIPAVYWWYKT  529

Query  559  SSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SHAAELTAGYYN +NRDGYSP+F+VL+K
Sbjct  530  PSHAAELTAGYYNPTNRDGYSPVFKVLRK  558


 Score = 98.2 bits (243),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 67/108 (62%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            +KH+ T+K V   +     +  + +A P GL WQVLN AW+ G+++AG NA   +DR   
Sbjct  557  RKHSVTMKFVCPTSHFRCPENDELFAYPEGLSWQVLNVAWDCGLSVAGQNADPCFDRGEH  616

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            +R+VETSKPRNDP +   +FFV + P   +Q     +EL YF+K MHG
Sbjct  617  IRMVETSKPRNDPDQRHFSFFVYQLPSPFVQRTYCFTELNYFIKSMHG  664



>ref|XP_002865252.1| hypothetical protein ARALYDRAFT_356484 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41511.1| hypothetical protein ARALYDRAFT_356484 [Arabidopsis lyrata subsp. 
lyrata]
Length=682

 Score =   131 bits (330),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF+E+G+YDSYYGRFF  WY+Q LI HA+ +LS A  AF+ET ++VKIP I+W Y 
Sbjct  483  HETGFFQERGEYDSYYGRFFLNWYSQLLIGHAENVLSLANLAFEETKIIVKIPAIYWSYK  542

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN SNRDGYS +FE LKK
Sbjct  543  TASHAAELTAGYYNPSNRDGYSLVFETLKK  572


 Score =   101 bits (251),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 66/108 (61%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KK++ T K V    Q+SP    +A ADP GL WQV+N AW+KG+ I G N    +DRE  
Sbjct  571  KKYSVTAKFVCPGPQMSPNAHEEALADPEGLSWQVINAAWDKGLLIGGENMITCFDREGC  630

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MRL++ +KPRN P  +  +FF   +P   +Q +    +L+YF+K MHG
Sbjct  631  MRLIDIAKPRNHPDSYHFSFFTYRQPSPLVQGSTCFPDLDYFIKRMHG  678



>ref|XP_010233755.1| PREDICTED: beta-amylase 8 [Brachypodium distachyon]
Length=584

 Score =   134 bits (336),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYDSYYGRFF  WY+  L+DH D +LS AT AFD   +VVKIP I+WWY 
Sbjct  380  HETGFFCDGGDYDSYYGRFFLNWYSGILVDHVDQVLSLATLAFDGAEIVVKIPSIYWWYR  439

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN +NRDGYSP+F +LKK
Sbjct  440  TASHAAELTAGFYNPTNRDGYSPVFRILKK  469


 Score = 98.6 bits (244),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 73/113 (65%), Gaps = 1/113 (1%)
 Frame = -3

Query  489  LRSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYD  310
             R  KKH+ T+KLV    + + +++ +A+ADP GL WQV+N AW+ G++++  +A    D
Sbjct  464  FRILKKHSVTLKLVCYGPEFTVQEIGEAFADPEGLTWQVMNAAWDHGLSLSVESALPCLD  523

Query  309  RETFMRLVETSKPRNDPYRHXSTFFVL-ERPWQRIQTAENISELEYFVKCMHG  154
             E + +++E +KPRNDP RH  +FF   ++P   +Q     SELE FVKCMHG
Sbjct  524  GEMYPQILEIAKPRNDPDRHHVSFFAYRQQPPFLLQRDVCFSELETFVKCMHG  576



>ref|XP_010910608.1| PREDICTED: beta-amylase 8 [Elaeis guineensis]
Length=595

 Score =   134 bits (336),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF ++GDYD YYGRFF  WY Q LIDHAD +LS A  AF+ T +++KIP ++WWY 
Sbjct  391  HETGFFCDRGDYDGYYGRFFLHWYAQTLIDHADQVLSLANLAFEGTQVIIKIPAVYWWYK  450

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAG+YN +N+DGYSP+F++LKK
Sbjct  451  TSSHAAELTAGFYNPTNQDGYSPIFDMLKK  480


 Score = 97.8 bits (242),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 68/109 (62%), Gaps = 1/109 (1%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+A +K V    Q S ++  +A AD  GL WQV+N AW++ +A+A H     +DRETF
Sbjct  479  KKHSAAMKFVCYGPQHSAQESDEALADLEGLSWQVMNSAWDRSLAVAAHGTLPCHDRETF  538

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAEN-ISELEYFVKCMHG  154
            +R++E +KPRNDP R   +FF  ++        E   SEL+ F+KCMHG
Sbjct  539  IRIIENAKPRNDPDRRHLSFFTYQQLTSVFMEREMCFSELDNFIKCMHG  587



>ref|XP_008808792.1| PREDICTED: beta-amylase 8 isoform X1 [Phoenix dactylifera]
Length=658

 Score =   135 bits (340),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF ++GDYDSYYGRFF  WY Q LIDHAD +LS A  AF+ T +VVKIP ++WWY 
Sbjct  454  HETGFFCDRGDYDSYYGRFFLHWYAQTLIDHADQVLSLANLAFEGTQIVVKIPAVYWWYK  513

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN +N+DGYSP+F++LKK
Sbjct  514  TASHAAELTAGFYNPTNQDGYSPIFDMLKK  543


 Score = 94.7 bits (234),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 66/109 (61%), Gaps = 1/109 (1%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ T+K V   TQ    +  +A AD  GL WQ LN AW++GV +A  +    +DRET+
Sbjct  542  KKHSVTMKFVCCGTQALAHENDEALADSEGLSWQALNSAWDRGVTVAAQSILPCHDRETY  601

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAEN-ISELEYFVKCMHG  154
            +R++E +KPRNDP R   +FF  ++        E   SEL+ F+KCMHG
Sbjct  602  IRIIENAKPRNDPDRRHLSFFTYQQLAPVFMQREMCFSELDNFIKCMHG  650



>ref|XP_008808793.1| PREDICTED: beta-amylase 8 isoform X2 [Phoenix dactylifera]
Length=651

 Score =   135 bits (340),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF ++GDYDSYYGRFF  WY Q LIDHAD +LS A  AF+ T +VVKIP ++WWY 
Sbjct  454  HETGFFCDRGDYDSYYGRFFLHWYAQTLIDHADQVLSLANLAFEGTQIVVKIPAVYWWYK  513

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN +N+DGYSP+F++LKK
Sbjct  514  TASHAAELTAGFYNPTNQDGYSPIFDMLKK  543


 Score = 94.4 bits (233),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 66/109 (61%), Gaps = 1/109 (1%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ T+K V   TQ    +  +A AD  GL WQ LN AW++GV +A  +    +DRET+
Sbjct  542  KKHSVTMKFVCCGTQALAHENDEALADSEGLSWQALNSAWDRGVTVAAQSILPCHDRETY  601

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAEN-ISELEYFVKCMHG  154
            +R++E +KPRNDP R   +FF  ++        E   SEL+ F+KCMHG
Sbjct  602  IRIIENAKPRNDPDRRHLSFFTYQQLAPVFMQREMCFSELDNFIKCMHG  650



>ref|XP_006398198.1| hypothetical protein EUTSA_v10001222mg, partial [Eutrema salsugineum]
 gb|ESQ39651.1| hypothetical protein EUTSA_v10001222mg, partial [Eutrema salsugineum]
Length=674

 Score =   132 bits (332),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF+E+G+YDSYYGRFF  WY+Q LI HA+ +LS A  AF+ET ++VKIP I+W Y 
Sbjct  480  HETGFFQERGEYDSYYGRFFLNWYSQLLIGHAENVLSLANLAFEETKIIVKIPAIYWSYK  539

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN SNRDGYS LFE LKK
Sbjct  540  TASHAAELTAGYYNPSNRDGYSLLFETLKK  569


 Score = 97.1 bits (240),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 65/107 (61%), Gaps = 0/107 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KK++ TVK V     +S  +  +  ADP GL WQV+N AW+KG+ I G NA   +DRE  
Sbjct  568  KKYSVTVKFVCPGQLMSTNEHEEGLADPEGLSWQVINAAWDKGLLIGGENAITCFDREGC  627

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMH  157
            MRL+E +KPRN P     +FF   +P   +Q +   ++L+YF+K MH
Sbjct  628  MRLIEMAKPRNHPDSCHFSFFTYRQPSPLVQGSSCFADLDYFIKRMH  674



>gb|KFK31577.1| hypothetical protein AALP_AA6G130300 [Arabis alpina]
Length=676

 Score =   131 bits (330),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF+E+G+YDSYYGRFF  WY+Q LI HA+ +LS A  AF+ET ++VKIP I+W Y 
Sbjct  478  HETGFFQERGEYDSYYGRFFLNWYSQLLIGHAENVLSLANLAFEETKIIVKIPAIYWSYK  537

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN SNRDGYS +FE LKK
Sbjct  538  TASHAAELTAGYYNPSNRDGYSLIFETLKK  567


 Score = 97.1 bits (240),  Expect(2) = 7e-51, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 67/108 (62%), Gaps = 1/108 (1%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KK++ TVK V     +SP    +A ADP GL WQV+N AW+K + I G NA   +DRE  
Sbjct  566  KKYSVTVKFVCPGPHMSPNQHEEA-ADPEGLSWQVINAAWDKELIIGGENAITCFDREGC  624

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MRL+E +KPRN P  +  +FF   +P   +Q +   ++L+YF+K MHG
Sbjct  625  MRLIEMAKPRNHPDSYHFSFFSYRQPSPLVQGSTCFADLDYFIKRMHG  672



>gb|KFK31578.1| hypothetical protein AALP_AA6G130300 [Arabis alpina]
Length=678

 Score =   131 bits (330),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF+E+G+YDSYYGRFF  WY+Q LI HA+ +LS A  AF+ET ++VKIP I+W Y 
Sbjct  480  HETGFFQERGEYDSYYGRFFLNWYSQLLIGHAENVLSLANLAFEETKIIVKIPAIYWSYK  539

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN SNRDGYS +FE LKK
Sbjct  540  TASHAAELTAGYYNPSNRDGYSLIFETLKK  569


 Score = 97.1 bits (240),  Expect(2) = 8e-51, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 67/108 (62%), Gaps = 1/108 (1%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KK++ TVK V     +SP    +A ADP GL WQV+N AW+K + I G NA   +DRE  
Sbjct  568  KKYSVTVKFVCPGPHMSPNQHEEA-ADPEGLSWQVINAAWDKELIIGGENAITCFDREGC  626

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MRL+E +KPRN P  +  +FF   +P   +Q +   ++L+YF+K MHG
Sbjct  627  MRLIEMAKPRNHPDSYHFSFFSYRQPSPLVQGSTCFADLDYFIKRMHG  674



>ref|XP_006646832.1| PREDICTED: beta-amylase 8-like [Oryza brachyantha]
Length=496

 Score =   134 bits (338),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYDSYYGRFF  WY+  LIDH D +LS AT AFD    VVKIP IHWWY 
Sbjct  292  HETGFFCDGGDYDSYYGRFFLNWYSGILIDHVDQVLSLATLAFDGVETVVKIPSIHWWYR  351

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN +NRDGYSP+F +LKK
Sbjct  352  TASHAAELTAGFYNPTNRDGYSPVFRMLKK  381


 Score = 92.8 bits (229),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 46/117 (39%), Positives = 71/117 (61%), Gaps = 1/117 (1%)
 Frame = -3

Query  489  LRSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYD  310
             R  KKH+  +K V  + + S ++  +A+ DP GL WQV+N AW+ G++++  +     D
Sbjct  376  FRMLKKHSVILKFVCYQPEFSVQENNEAFGDPEGLTWQVMNAAWDHGLSVSIESVLPCID  435

Query  309  RETFMRLVETSKPRNDPYRHXSTFFVLER-PWQRIQTAENISELEYFVKCMHGYA*Q  142
             E + ++++T+KPRNDP RH  +FF   + P   +Q     SEL+ FVKCMHG A Q
Sbjct  436  GEMYSQILDTAKPRNDPDRHHVSFFAYRQLPPFLLQRDVCFSELDNFVKCMHGEATQ  492



>ref|XP_008790180.1| PREDICTED: beta-amylase 8-like [Phoenix dactylifera]
Length=432

 Score =   132 bits (332),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF ++GDYD YYGRFF  WY Q LIDHAD +LS A  AF+ T ++VKIP ++WWY 
Sbjct  228  HETGFFCDRGDYDGYYGRFFLHWYAQTLIDHADQVLSLANLAFEGTQIIVKIPAVYWWYK  287

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN +N+DGYSP+F++LKK
Sbjct  288  TASHAAELTAGFYNPTNQDGYSPIFDMLKK  317


 Score = 94.0 bits (232),  Expect(2) = 4e-50, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 70/109 (64%), Gaps = 1/109 (1%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+AT+K V      S ++  +A AD  GL WQV+N AW++G+A+A  +    +DRET+
Sbjct  316  KKHSATMKFVCYGPPHSAQESDEALADLEGLSWQVMNSAWDRGLAVAAQSTFPCHDRETY  375

Query  297  MRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            +R++E +KPRNDP +RH S F   +     ++     SEL+ F+KCMHG
Sbjct  376  IRIIENAKPRNDPDHRHLSFFTYQQLTPVFVEREMCFSELDSFIKCMHG  424



>gb|EAY84334.1| hypothetical protein OsI_05709 [Oryza sativa Indica Group]
Length=565

 Score =   132 bits (332),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYDSYYGRFF  WY+  LIDH D +LS AT AFD    VVKIP I+WWY 
Sbjct  361  HETGFFCDGGDYDSYYGRFFLNWYSGILIDHVDQVLSLATLAFDGVETVVKIPSIYWWYR  420

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN +NRDGYSP+F +LKK
Sbjct  421  TASHAAELTAGFYNPTNRDGYSPVFRMLKK  450


 Score = 91.3 bits (225),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 71/117 (61%), Gaps = 1/117 (1%)
 Frame = -3

Query  489  LRSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYD  310
             R  KKH+  +K V    + + ++  +A+ADP GL WQV+N AW+ G++I+  +A    D
Sbjct  445  FRMLKKHSVILKFVCYGPEFTIQENNEAFADPEGLTWQVMNAAWDHGLSISVESALPCLD  504

Query  309  RETFMRLVETSKPRNDPYRHXSTFFVLER-PWQRIQTAENISELEYFVKCMHGYA*Q  142
             E + ++++T+KPR+DP RH  +FF   + P   +Q     SEL  FVKCMHG A Q
Sbjct  505  GEMYSQILDTAKPRHDPDRHHVSFFAYRQLPSFLLQRDVCFSELGNFVKCMHGEATQ  561



>ref|XP_008679986.1| PREDICTED: beta-amylase 8 isoform X3 [Zea mays]
 gb|AFW66680.1| hypothetical protein ZEAMMB73_523488 [Zea mays]
Length=651

 Score =   134 bits (338),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYDSYYGRFF  WY+  L+DH D +LS AT AFD   +VVK+P I+WWY 
Sbjct  446  HETGFFCDGGDYDSYYGRFFLNWYSGVLMDHVDQVLSLATLAFDGAEIVVKVPSIYWWYR  505

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YNT+NRDGYSP+F +LKK
Sbjct  506  TASHAAELTAGFYNTTNRDGYSPVFRMLKK  535


 Score = 88.6 bits (218),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 70/119 (59%), Gaps = 2/119 (2%)
 Frame = -3

Query  489  LRSSKKHNATVKLV--SKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGG  316
             R  KKH+  +KLV    E  +  +D  +A+ADP GL WQV+N AW++G+ +   +A   
Sbjct  530  FRMLKKHSVILKLVCYGPEYTVHEKDDDEAFADPEGLTWQVINAAWDQGLPLCIESALPC  589

Query  315  YDRETFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA*QS  139
             + E + R+++T+KPR+DP RH +  F   +  Q       +SEL  FVKCMHG A Q+
Sbjct  590  RNGEAYSRILDTAKPRDDPDRHHAASFAYRQQQQPPLREACLSELCTFVKCMHGEAPQN  648



>ref|XP_004952019.1| PREDICTED: beta-amylase 8-like, partial [Setaria italica]
Length=609

 Score =   129 bits (323),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
             +T FF + GDYDSYYGRFF  WY+  LIDH D +LS AT AFD   ++VKIP I+WWY 
Sbjct  405  RETGFFCDGGDYDSYYGRFFLNWYSGVLIDHVDQVLSLATLAFDGAEILVKIPSIYWWYR  464

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN +NRDGYSP+ ++LKK
Sbjct  465  TASHAAELTAGFYNPTNRDGYSPVLKMLKK  494


 Score = 91.7 bits (226),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 73/118 (62%), Gaps = 1/118 (1%)
 Frame = -3

Query  489  LRSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYD  310
            L+  KKH+  +KLV    + + ++  +A ADP GL WQV+N AW+ G+++   +A    D
Sbjct  489  LKMLKKHSVILKLVCYGPEFTVQENDEACADPEGLTWQVVNAAWDHGLSLCIESALPCLD  548

Query  309  RETFMRLVETSKPRNDPYRHXSTFFVL-ERPWQRIQTAENISELEYFVKCMHGYA*QS  139
             + + ++++T+KPRNDP RH ++FF   ++P   +Q      EL  FVKCMHG A Q+
Sbjct  549  GDMYSQILDTTKPRNDPDRHHASFFTYRQQPPSLLQRDAYFPELRTFVKCMHGEAPQN  606



>gb|EAZ21608.1| hypothetical protein OsJ_05236 [Oryza sativa Japonica Group]
Length=588

 Score =   132 bits (333),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYDSYYGRFF  WY+  LIDH D +LS AT AFD    VVKIP I+WWY 
Sbjct  335  HETGFFCDGGDYDSYYGRFFLNWYSGILIDHVDQVLSLATLAFDGVETVVKIPSIYWWYR  394

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN +NRDGYSP+F +LKK
Sbjct  395  TASHAAELTAGFYNPTNRDGYSPVFRMLKK  424


 Score = 87.8 bits (216),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 68/112 (61%), Gaps = 1/112 (1%)
 Frame = -3

Query  489  LRSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYD  310
             R  KKH+  +K V    + + ++  +A+ADP GL WQV+N AW+ G++I+  +A    D
Sbjct  419  FRMLKKHSVILKFVCYGPEFTIQENNEAFADPEGLTWQVMNAAWDHGLSISVESALPCLD  478

Query  309  RETFMRLVETSKPRNDPYRHXSTFFVLER-PWQRIQTAENISELEYFVKCMH  157
             E + ++++T+KPR+DP RH  +FF   + P   +Q     SEL  FVKCMH
Sbjct  479  GEMYSQILDTAKPRHDPDRHHVSFFAYRQLPSFLLQRDVCFSELGNFVKCMH  530



>gb|EAY84341.1| hypothetical protein OsI_05718 [Oryza sativa Indica Group]
Length=329

 Score =   128 bits (322),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYDSYYGRFF  WY+  LIDH D +LS AT AFD    VVKIP I+WWY 
Sbjct  76   HETGFFCDGGDYDSYYGRFFLNWYSGILIDHVDQVLSLATLAFDGVETVVKIPSIYWWYR  135

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAG+YN +NRDGYS + ++LKK
Sbjct  136  TSSHAAELTAGFYNPTNRDGYSGVLKMLKK  165


 Score = 87.0 bits (214),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 68/112 (61%), Gaps = 1/112 (1%)
 Frame = -3

Query  489  LRSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYD  310
            L+  KKH+  +KLV    + + ++  +A+ADP GL WQV+N AW+ G+ +   +A    D
Sbjct  160  LKMLKKHSVILKLVCYGPEFTVQENDEAFADPEGLTWQVMNAAWDHGLPLCIESALPCLD  219

Query  309  RETFMRLVETSKPRNDPYRHXSTFFVLER-PWQRIQTAENISELEYFVKCMH  157
             E + ++++T+KPR+DP RH  +FF   + P   +Q     SEL  FVKCMH
Sbjct  220  GEMYSQILDTAKPRHDPDRHHVSFFAYRQLPSFLLQRDVCFSELGNFVKCMH  271



>ref|XP_008679984.1| PREDICTED: beta-amylase 8 isoform X1 [Zea mays]
Length=661

 Score =   134 bits (338),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYDSYYGRFF  WY+  L+DH D +LS AT AFD   +VVK+P I+WWY 
Sbjct  446  HETGFFCDGGDYDSYYGRFFLNWYSGVLMDHVDQVLSLATLAFDGAEIVVKVPSIYWWYR  505

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YNT+NRDGYSP+F +LKK
Sbjct  506  TASHAAELTAGFYNTTNRDGYSPVFRMLKK  535


 Score = 80.5 bits (197),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 70/129 (54%), Gaps = 12/129 (9%)
 Frame = -3

Query  489  LRSSKKHNATVKLV--SKETQISPRDLVQAYADPNGLCWQV----------LNGAWEKGV  346
             R  KKH+  +KLV    E  +  +D  +A+ADP GL WQV          +N AW++G+
Sbjct  530  FRMLKKHSVILKLVCYGPEYTVHEKDDDEAFADPEGLTWQVVEMFQASLPVINAAWDQGL  589

Query  345  AIAGHNAPGGYDRETFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVK  166
             +   +A    + E + R+++T+KPR+DP RH +  F   +  Q       +SEL  FVK
Sbjct  590  PLCIESALPCRNGEAYSRILDTAKPRDDPDRHHAASFAYRQQQQPPLREACLSELCTFVK  649

Query  165  CMHGYA*QS  139
            CMHG A Q+
Sbjct  650  CMHGEAPQN  658



>ref|XP_008679985.1| PREDICTED: beta-amylase 8 isoform X2 [Zea mays]
Length=660

 Score =   134 bits (338),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 72/90 (80%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYDSYYGRFF  WY+  L+DH D +LS AT AFD   +VVK+P I+WWY 
Sbjct  445  HETGFFCDGGDYDSYYGRFFLNWYSGVLMDHVDQVLSLATLAFDGAEIVVKVPSIYWWYR  504

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YNT+NRDGYSP+F +LKK
Sbjct  505  TASHAAELTAGFYNTTNRDGYSPVFRMLKK  534


 Score = 80.5 bits (197),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 70/129 (54%), Gaps = 12/129 (9%)
 Frame = -3

Query  489  LRSSKKHNATVKLV--SKETQISPRDLVQAYADPNGLCWQV----------LNGAWEKGV  346
             R  KKH+  +KLV    E  +  +D  +A+ADP GL WQV          +N AW++G+
Sbjct  529  FRMLKKHSVILKLVCYGPEYTVHEKDDDEAFADPEGLTWQVVEMFQASLPVINAAWDQGL  588

Query  345  AIAGHNAPGGYDRETFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVK  166
             +   +A    + E + R+++T+KPR+DP RH +  F   +  Q       +SEL  FVK
Sbjct  589  PLCIESALPCRNGEAYSRILDTAKPRDDPDRHHAASFAYRQQQQPPLREACLSELCTFVK  648

Query  165  CMHGYA*QS  139
            CMHG A Q+
Sbjct  649  CMHGEAPQN  657



>gb|EYU32116.1| hypothetical protein MIMGU_mgv1a003882mg [Erythranthe guttata]
Length=558

 Score =   131 bits (329),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
             +T+FF + GDYDSYYGRFF  WY+Q LIDH D +L+ A  AF+ TP+  K+ GIHWWY 
Sbjct  340  QETKFFSDGGDYDSYYGRFFLNWYSQVLIDHGDRVLTFANLAFEGTPIAAKLSGIHWWYK  399

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQ  467
             +SHAAELTAG+YN +NRDGY+P+  VLKK +
Sbjct  400  TASHAAELTAGFYNPANRDGYAPIASVLKKHE  431


 Score = 82.4 bits (202),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 59/111 (53%), Gaps = 4/111 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH   +     E  T     D  +A ADP GL WQVLN AW+ G+ +A  NA   YDRE
Sbjct  428  KKHETALNFTCVELRTMDQHEDFPEALADPEGLVWQVLNAAWDVGIPVASENALPCYDRE  487

Query  303  TFMRLVETSKPRNDPY-RHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             + +++E +KP NDP  RH S F  L      I+   N  E E FVK MHG
Sbjct  488  GYNKILENAKPFNDPDGRHLSAFTYLRLSPDLIEE-RNFVEFEQFVKRMHG  537



>ref|XP_006396247.1| hypothetical protein EUTSA_v10028560mg [Eutrema salsugineum]
 gb|ESQ37700.1| hypothetical protein EUTSA_v10028560mg [Eutrema salsugineum]
Length=546

 Score =   127 bits (319),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H T FFR+ GDYDSYYGRFF  WY++ LIDH D +LS A  AF+   +  K+ GIHWWY 
Sbjct  331  HGTGFFRDGGDYDSYYGRFFLNWYSRVLIDHGDRVLSMANLAFEGNCIAAKLSGIHWWYK  390

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN SNRDGY P+  +LKK
Sbjct  391  TASHAAELTAGFYNPSNRDGYGPIAAMLKK  420


 Score = 85.5 bits (210),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 64/113 (57%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH+A +     E  T     D  +A ADP GL WQVLN AW+ G+ +A  NA   YDRE
Sbjct  419  KKHDAALNFTCVELRTLAQHEDFPEALADPEGLVWQVLNAAWDAGIPVASENALPCYDRE  478

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP +DP  RH S F  L R    +  ++N  E E FVK MHG A
Sbjct  479  GYNKILENAKPLDDPDGRHLSCFTYL-RLNPTLMQSQNFIEFERFVKRMHGEA  530



>ref|XP_007051810.1| Beta-amylase 2 isoform 1 [Theobroma cacao]
 gb|EOX95967.1| Beta-amylase 2 isoform 1 [Theobroma cacao]
Length=554

 Score =   130 bits (328),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR+ GDYDSYYGRFF  WY+Q L+DH D +L+ A  AF+ T +  K+ GIHWWY 
Sbjct  331  HETGFFRDGGDYDSYYGRFFLNWYSQVLVDHGDRVLALANLAFEGTCIAAKLSGIHWWYK  390

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN SNRDGY+P+  +LKK
Sbjct  391  TASHAAELTAGFYNPSNRDGYAPIASMLKK  420


 Score = 81.6 bits (200),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 60/113 (53%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH   +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  419  KKHGVALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDVSILVASENALPCYDRE  478

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KPRNDP  RH S F  L R    +    N +E E FV  MHG A
Sbjct  479  GYNKILENAKPRNDPDGRHLSAFTYL-RLNPVLMETHNFAEFERFVTRMHGEA  530



>ref|XP_008338858.1| PREDICTED: beta-amylase 2, chloroplastic isoform X2 [Malus domestica]
Length=548

 Score =   128 bits (322),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 55/92 (60%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR+ GDYDSYYGRFF  WY++ LIDH D +L+ A  AF+ T +  K+ GIHWWY 
Sbjct  345  HETGFFRDGGDYDSYYGRFFLNWYSRVLIDHGDRVLALANLAFEGTHIATKVSGIHWWYK  404

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQ  467
             +SH AELTAG+YN+ NRDGY P+ E+LKK +
Sbjct  405  TASHPAELTAGFYNSCNRDGYVPISEMLKKHE  436


 Score = 83.6 bits (205),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E + S +     +A ADP GL WQVLN AW+  + +A  NA   +DRE
Sbjct  433  KKHEAALNFTCVEMRTSDQHQGFPEALADPEGLVWQVLNAAWDADIPVASENALACFDRE  492

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KPRNDP  RH S F  L      I+   N+ E E FVK MHG A
Sbjct  493  GYNKILENAKPRNDPDGRHLSAFTYLRLSPVLIER-HNLMEFERFVKRMHGEA  544



>emb|CDY07213.1| BnaCnng02280D [Brassica napus]
Length=541

 Score =   128 bits (321),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H T FFR+ GDYDSYYGRFF  WY++ LIDH D +LS A  AF+   +  K+ GIHWWY 
Sbjct  325  HGTGFFRDGGDYDSYYGRFFLNWYSRVLIDHGDRVLSMANLAFEGNSIAAKLSGIHWWYK  384

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN SNRDGY P+  +LKK
Sbjct  385  TASHAAELTAGFYNPSNRDGYGPIAAMLKK  414


 Score = 84.0 bits (206),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH+A +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  413  KKHDAALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDANIPVASENALPCYDRE  472

Query  303  TFMRLVETSKPRNDPY-RHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP NDP  RH S F  L R    +  ++N  E E FVK MHG A
Sbjct  473  GYNKILENAKPLNDPDGRHLSCFTYL-RLNTTLLESQNFVEFERFVKRMHGEA  524



>emb|CDY51154.1| BnaA09g51890D [Brassica napus]
Length=539

 Score =   128 bits (321),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H T FFR+ GDYDSYYGRFF  WY++ LIDH D +LS A  AF+   +  K+ GIHWWY 
Sbjct  323  HGTGFFRDGGDYDSYYGRFFLNWYSRVLIDHGDRVLSMANLAFEGNSIAAKLSGIHWWYK  382

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN SNRDGY P+  +LKK
Sbjct  383  TASHAAELTAGFYNPSNRDGYGPIAAMLKK  412


 Score = 84.0 bits (206),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH+A +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  411  KKHDAALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDANIPVASENALPCYDRE  470

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP NDP  RH S F  L R    +  ++N  E E FVK MHG A
Sbjct  471  GYNKILENAKPLNDPDGRHLSCFTYL-RLNTTLLESQNFVEFERFVKRMHGEA  522



>ref|XP_009111477.1| PREDICTED: beta-amylase 2, chloroplastic [Brassica rapa]
Length=541

 Score =   128 bits (321),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H T FFR+ GDYDSYYGRFF  WY++ LIDH D +LS A  AF+   +  K+ GIHWWY 
Sbjct  325  HGTGFFRDGGDYDSYYGRFFLNWYSRVLIDHGDRVLSMANLAFEGNSIAAKLSGIHWWYK  384

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN SNRDGY P+  +LKK
Sbjct  385  TASHAAELTAGFYNPSNRDGYGPIAAMLKK  414


 Score = 84.0 bits (206),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH+A +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  413  KKHDAALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDANIPVASENALPCYDRE  472

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP NDP  RH S F  L R    +  ++N  E E FVK MHG A
Sbjct  473  GYNKILENAKPLNDPDGRHLSCFTYL-RLNTTLLESQNFVEFERFVKRMHGEA  524



>ref|XP_007051811.1| Beta-amylase 2 isoform 2, partial [Theobroma cacao]
 gb|EOX95968.1| Beta-amylase 2 isoform 2, partial [Theobroma cacao]
Length=571

 Score =   130 bits (327),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR+ GDYDSYYGRFF  WY+Q L+DH D +L+ A  AF+ T +  K+ GIHWWY 
Sbjct  348  HETGFFRDGGDYDSYYGRFFLNWYSQVLVDHGDRVLALANLAFEGTCIAAKLSGIHWWYK  407

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN SNRDGY+P+  +LKK
Sbjct  408  TASHAAELTAGFYNPSNRDGYAPIASMLKK  437


 Score = 81.3 bits (199),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 60/113 (53%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH   +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  436  KKHGVALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDVSILVASENALPCYDRE  495

Query  303  TFMRLVETSKPRNDPY-RHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KPRNDP  RH S F  L R    +    N +E E FV  MHG A
Sbjct  496  GYNKILENAKPRNDPDGRHLSAFTYL-RLNPVLMETHNFAEFERFVTRMHGEA  547



>ref|XP_010540283.1| PREDICTED: beta-amylase 2, chloroplastic [Tarenaya hassleriana]
Length=550

 Score =   128 bits (321),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR+ GDYDSYYGRFF  WY++ LIDH D +L+ A  AF+   +  K+ GIHWWY 
Sbjct  335  HETGFFRDGGDYDSYYGRFFLNWYSRVLIDHGDRVLALANLAFEGNRIAAKLSGIHWWYK  394

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN SNRDGY+P+  +LKK
Sbjct  395  TASHAAELTAGFYNPSNRDGYAPIAAMLKK  424


 Score = 81.3 bits (199),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 61/113 (54%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH+A +     E  T     D  +A ADP GL WQVLN AW+ G+ +A  NA   YDRE
Sbjct  423  KKHDAALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDVGIPVASENALPCYDRE  482

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP NDP  RH S F  L R    +    N  E E FV+ M G A
Sbjct  483  GYNKILENAKPLNDPDQRHLSCFTYL-RLSPILMRPRNFKEFERFVRRMQGEA  534



>ref|XP_002875024.1| beta-amylase 9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51283.1| beta-amylase 9 [Arabidopsis lyrata subsp. lyrata]
Length=542

 Score =   127 bits (318),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H T FFR+ GDYDSYYGRFF  WY++ LIDH D +L+ A  AF+ T +  K+ GIHWWY 
Sbjct  327  HGTGFFRDGGDYDSYYGRFFLNWYSRVLIDHGDRVLAMANLAFEGTCIAAKLSGIHWWYK  386

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN+SNRDGY P+  + KK
Sbjct  387  TASHAAELTAGFYNSSNRDGYGPIAAMFKK  416


 Score = 82.4 bits (202),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH+A +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  415  KKHDAALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDASIPVASENALPCYDRE  474

Query  303  TFMRLVETSKPRNDPY-RHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP  DP  RH S F  L R    +  ++N  E E FVK MHG A
Sbjct  475  GYNKILENAKPLTDPDGRHLSCFTYL-RLNPTLMESQNFKEFERFVKRMHGEA  526



>ref|XP_010427089.1| PREDICTED: beta-amylase 2, chloroplastic [Camelina sativa]
Length=554

 Score =   125 bits (314),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H T FFR+ GDYDSYYGRFF  WY++ LIDH D +L+ A  AF+   +  K+ GIHWWY 
Sbjct  339  HGTGFFRDGGDYDSYYGRFFLNWYSRVLIDHGDRVLAMANLAFEGNCIAAKLSGIHWWYK  398

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN+SNRDGY P+  + KK
Sbjct  399  TASHAAELTAGFYNSSNRDGYGPIAAMFKK  428


 Score = 83.6 bits (205),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH+A +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  427  KKHDAALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDASIPVASENALPCYDRE  486

Query  303  TFMRLVETSKPRNDPY-RHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP NDP  RH S F  L R    +  ++N  E E F+K MHG A
Sbjct  487  GYNKILENAKPLNDPDGRHLSCFTYL-RLNPTLMESQNFKEFERFLKRMHGEA  538



>ref|XP_006827627.2| PREDICTED: beta-amylase 2, chloroplastic [Amborella trichopoda]
Length=687

 Score =   127 bits (319),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H T FF + GDYDSYYGRFF  WY+Q LIDHAD +L+ A  AF+ T +  KI GIHWWY 
Sbjct  482  HDTSFFCDGGDYDSYYGRFFLGWYSQVLIDHADRVLALANLAFEGTRIAAKISGIHWWYK  541

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQ  467
             +SHAAEL AG+YN  NRDGYSP+ ++LKK +
Sbjct  542  TASHAAELAAGFYNPCNRDGYSPIAQMLKKHE  573


 Score = 80.9 bits (198),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 61/113 (54%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH   +     E  T     D  +A ADP GL WQVLN AW+ G+ +A  NA   YDRE
Sbjct  570  KKHEVALNFTCAELRTLDQHEDFPEALADPEGLVWQVLNAAWDVGIPVASENALPCYDRE  629

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP +DP  RH S F  L R    +   +N  E E FVK MHG A
Sbjct  630  GYNKVLENAKPAHDPDGRHLSAFTYL-RLSPALMERQNFLEFERFVKRMHGEA  681



>dbj|BAJ96466.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=670

 Score =   125 bits (314),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            + T FF + GDYDSYYGRFF  WY Q L+DHAD +L  A  AF+ + + VK+ GIHWWY 
Sbjct  465  NNTGFFCDGGDYDSYYGRFFLNWYAQVLLDHADRVLMLARLAFEGSAIAVKVSGIHWWYK  524

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+P+ +VLKK
Sbjct  525  TASHAAELTAGFYNPCNRDGYTPIAQVLKK  554


 Score = 83.2 bits (204),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 59/112 (53%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLV--QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E +   +  V  +A ADP GL WQVLN AW+ G+ +A  NA   YDR+
Sbjct  553  KKHGAALNFTCVELRTMDQHEVFPEALADPEGLVWQVLNAAWDAGIQVASENALPCYDRD  612

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             F + +E +KPRNDP       F   R    +    N+ E E FVK MHG A
Sbjct  613  GFNKTLENAKPRNDPDGRHLFGFTYLRLCSTLFEGPNLPEFERFVKRMHGEA  664



>gb|AAC13634.1| similar to the family of glycosyl hydrolases [Arabidopsis thaliana]
 emb|CAB80858.1| putative beta-amylase [Arabidopsis thaliana]
Length=527

 Score =   127 bits (318),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H T FFR+ GDYDSYYGRFF  WY++ LIDH D +L+ A  AF+ T +  K+ GIHWWY 
Sbjct  312  HGTGFFRDGGDYDSYYGRFFLNWYSRVLIDHGDRVLAMANLAFEGTCIAAKLSGIHWWYK  371

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN+SNRDGY P+  + KK
Sbjct  372  TASHAAELTAGFYNSSNRDGYGPIAAMFKK  401


 Score = 81.3 bits (199),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH+A +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  400  KKHDAALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDASIPVASENALPCYDRE  459

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP  DP  RH S F  L R    +  ++N  E E F+K MHG A
Sbjct  460  GYNKILENAKPLTDPDGRHLSCFTYL-RLNPTLMESQNFKEFERFLKRMHGEA  511



>ref|NP_191958.3| beta-amylase 2 [Arabidopsis thaliana]
 sp|O65258.2|BAM2_ARATH RecName: Full=Beta-amylase 2, chloroplastic; AltName: Full=1,4-alpha-D-glucan 
maltohydrolase; AltName: Full=Beta-amylase 
9; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE81889.1| beta-amylase 2 [Arabidopsis thaliana]
Length=542

 Score =   127 bits (318),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H T FFR+ GDYDSYYGRFF  WY++ LIDH D +L+ A  AF+ T +  K+ GIHWWY 
Sbjct  327  HGTGFFRDGGDYDSYYGRFFLNWYSRVLIDHGDRVLAMANLAFEGTCIAAKLSGIHWWYK  386

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN+SNRDGY P+  + KK
Sbjct  387  TASHAAELTAGFYNSSNRDGYGPIAAMFKK  416


 Score = 81.3 bits (199),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH+A +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  415  KKHDAALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDASIPVASENALPCYDRE  474

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP  DP  RH S F  L R    +  ++N  E E F+K MHG A
Sbjct  475  GYNKILENAKPLTDPDGRHLSCFTYL-RLNPTLMESQNFKEFERFLKRMHGEA  526



>gb|EMS56471.1| Beta-amylase 2, chloroplastic [Triticum urartu]
Length=467

 Score =   125 bits (313),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            + T FF + GDYDSYYGRFF  WY Q L+DHAD +L  A  AF+ + + VK+ GIHWWY 
Sbjct  262  NNTGFFCDGGDYDSYYGRFFLNWYAQVLLDHADRVLMLARLAFEGSAIAVKVSGIHWWYK  321

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+P+ +VLKK
Sbjct  322  TASHAAELTAGFYNPCNRDGYAPIAQVLKK  351


 Score = 83.2 bits (204),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 59/112 (53%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLV--QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E +   +  V  +A ADP GL WQVLN AW+ G+ +A  NA   YDR+
Sbjct  350  KKHGAALNFTCVELRTMDQHEVYPEALADPEGLVWQVLNAAWDAGIQVASENALPCYDRD  409

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             F + +E +KPRNDP       F   R    +    N+ E E FVK MHG A
Sbjct  410  GFNKTLENAKPRNDPDGRHLFGFTYLRLCSTLFEGPNLPEFERFVKRMHGEA  461



>gb|ERM95043.1| hypothetical protein AMTR_s00009p00244310 [Amborella trichopoda]
Length=556

 Score =   127 bits (318),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H T FF + GDYDSYYGRFF  WY+Q LIDHAD +L+ A  AF+ T +  KI GIHWWY 
Sbjct  351  HDTSFFCDGGDYDSYYGRFFLGWYSQVLIDHADRVLALANLAFEGTRIAAKISGIHWWYK  410

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQ  467
             +SHAAEL AG+YN  NRDGYSP+ ++LKK +
Sbjct  411  TASHAAELAAGFYNPCNRDGYSPIAQMLKKHE  442


 Score = 80.9 bits (198),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 61/113 (54%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH   +     E  T     D  +A ADP GL WQVLN AW+ G+ +A  NA   YDRE
Sbjct  439  KKHEVALNFTCAELRTLDQHEDFPEALADPEGLVWQVLNAAWDVGIPVASENALPCYDRE  498

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP +DP  RH S F  L R    +   +N  E E FVK MHG A
Sbjct  499  GYNKVLENAKPAHDPDGRHLSAFTYL-RLSPALMERQNFLEFERFVKRMHGEA  550



>ref|XP_006287426.1| hypothetical protein CARUB_v10000631mg [Capsella rubella]
 gb|EOA20324.1| hypothetical protein CARUB_v10000631mg [Capsella rubella]
Length=549

 Score =   125 bits (313),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H T FFR+ GDYDSYYGRFF  WY++ LIDH D +L  A  AF+   +  K+ GIHWWY 
Sbjct  334  HGTGFFRDGGDYDSYYGRFFLNWYSRVLIDHGDRVLGMANLAFEGNCIAAKLSGIHWWYK  393

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN+SNRDGY P+  + KK
Sbjct  394  TASHAAELTAGFYNSSNRDGYGPIAAMFKK  423


 Score = 82.8 bits (203),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH+A +     E  T     D  +A ADP GL WQVLN AW+ G+ +A  NA   YDRE
Sbjct  422  KKHDAALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDAGIPVASENALPCYDRE  481

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP  DP  RH S F  L R    +  ++N  E E F+K MHG A
Sbjct  482  GYNKILENAKPLTDPDGRHLSCFTYL-RLNPTLMESKNFIEFERFLKRMHGEA  533



>gb|KFK30629.1| hypothetical protein AALP_AA6G006600 [Arabis alpina]
Length=540

 Score =   130 bits (326),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H T FFR+ GDYDSYYGRFF  WY++ LIDH D +L+ A  AF+E  +  K+ GIHWWY 
Sbjct  323  HGTGFFRDGGDYDSYYGRFFLNWYSRVLIDHGDRVLAMANLAFEEIHIAAKLSGIHWWYK  382

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQ  467
             +SHAAELTAG+YN+SNRDGY P+  +LKK +
Sbjct  383  TASHAAELTAGFYNSSNRDGYGPIAAMLKKHE  414


 Score = 77.4 bits (189),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 60/111 (54%), Gaps = 4/111 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH + +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  411  KKHESALNFTCVELRTLDQHEDYPEALADPEGLVWQVLNAAWDVSIPVASENALPCYDRE  470

Query  303  TFMRLVETSKPRNDPY-RHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             + +++  +KP NDP  RH S F  L R    +  ++N  E E F+K MHG
Sbjct  471  GYNKILANAKPLNDPDGRHLSCFTYL-RLNPTLMESQNFKEFERFLKRMHG  520



>gb|EMT12153.1| Beta-amylase [Aegilops tauschii]
Length=533

 Score =   124 bits (312),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            + T FF + GDYDSYYGRFF  WY Q L+DHAD +L  A  AF+ + + VK+ GIHWWY 
Sbjct  273  NNTGFFCDGGDYDSYYGRFFLNWYAQVLLDHADRVLMLARLAFEGSAIAVKVSGIHWWYK  332

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+P+ +VLKK
Sbjct  333  TASHAAELTAGFYNPCNRDGYAPIAQVLKK  362


 Score = 82.4 bits (202),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 58/110 (53%), Gaps = 2/110 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLV--QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E +   +  V  +A ADP GL WQVLN AW+ G+ +A  NA   YDR+
Sbjct  361  KKHGAALNFTCVELRTMDQHEVYPEALADPEGLVWQVLNAAWDAGIQVASENALPCYDRD  420

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             F + +E +KPRNDP       F   R    +    N+ E E FVK MHG
Sbjct  421  GFNKTLENAKPRNDPDGRHLFGFTYLRLCSTLFEGPNLPEFERFVKRMHG  470



>ref|XP_006445046.1| hypothetical protein CICLE_v10019525mg [Citrus clementina]
 ref|XP_006491095.1| PREDICTED: beta-amylase 2, chloroplastic-like isoform X1 [Citrus 
sinensis]
 gb|ESR58286.1| hypothetical protein CICLE_v10019525mg [Citrus clementina]
 gb|KDO86153.1| hypothetical protein CISIN_1g008542mg [Citrus sinensis]
Length=562

 Score =   126 bits (317),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR+ G+YDSYYGRFF  WY+Q LIDH D + + A  AF+ T +  K+ GIHWWY 
Sbjct  343  HETGFFRDGGEYDSYYGRFFLNWYSQVLIDHGDRVFALANLAFEGTCISAKLSGIHWWYK  402

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN SNRDGY+P+  +LKK
Sbjct  403  TASHAAELTAGFYNPSNRDGYAPIAAMLKK  432


 Score = 80.1 bits (196),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 60/113 (53%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH   +     E +   +  D  +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  431  KKHGVALNFTCVELRTVDQHEDFPEALADPEGLVWQVLNAAWDVSILVASENALPCYDRE  490

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP NDP  RH S F  L R    +    N  E E FVK MHG A
Sbjct  491  GYNKILENAKPLNDPDGRHLSAFTYL-RLSPVLTDGHNFIEFERFVKRMHGEA  542



>ref|XP_003576871.1| PREDICTED: beta-amylase 2, chloroplastic-like [Brachypodium distachyon]
Length=690

 Score =   125 bits (314),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            + T FF + GDYDSYYGRFF  WY+Q L+DHAD +L  A  AF+ + + VK+ GIHWWY 
Sbjct  485  NSTGFFCDGGDYDSYYGRFFLNWYSQVLLDHADRVLMLARLAFEGSAIAVKVSGIHWWYK  544

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+P+  VLKK
Sbjct  545  TASHAAELTAGFYNPCNRDGYAPIVTVLKK  574


 Score = 81.6 bits (200),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 61/113 (54%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLV--QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E +   +  V  +A ADP GL WQVLN AW+ G+ +A  NA   YDR+
Sbjct  573  KKHGAALNFTCVELRTMAQHEVFPEALADPEGLVWQVLNAAWDAGIPVASENALPCYDRD  632

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             F + +E +KPRNDP  RH   F  L R    +    N  E E FVK MHG A
Sbjct  633  GFNKTLENAKPRNDPDGRHLFGFTYL-RLCSVLFEKPNFMEFERFVKRMHGEA  684



>ref|XP_010456279.1| PREDICTED: beta-amylase 2, chloroplastic-like [Camelina sativa]
Length=555

 Score =   125 bits (314),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H T FFR+ GDYDSYYGRFF  WY++ LIDH D +L+ A  AF+   +  K+ GIHWWY 
Sbjct  340  HGTGFFRDGGDYDSYYGRFFLNWYSRVLIDHGDRVLAMANLAFEGNCIAAKLSGIHWWYK  399

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN+SNRDGY P+  + KK
Sbjct  400  TASHAAELTAGFYNSSNRDGYGPIAAMFKK  429


 Score = 81.3 bits (199),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH+A +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  428  KKHDAALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDASIPVASENALPCYDRE  487

Query  303  TFMRLVETSKPRNDPY-RHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP  DP  RH S F  L R    +  ++N  E E F+K MHG A
Sbjct  488  GYNKILENAKPLTDPDGRHLSCFTYL-RLNPTLMESQNFKEFERFLKRMHGEA  539



>ref|XP_010255371.1| PREDICTED: beta-amylase 2, chloroplastic-like isoform X1 [Nelumbo 
nucifera]
Length=708

 Score =   125 bits (315),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYDSYYGRFF  WY+Q LIDHAD +LS A  AF+ T + VK+ GIHWWY 
Sbjct  503  HETGFFCDGGDYDSYYGRFFLNWYSQILIDHADRVLSLAKLAFESTCIAVKLSGIHWWYK  562

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELT+G+YN  NRDGY+ +  +LKK
Sbjct  563  TASHAAELTSGFYNPCNRDGYAAIASMLKK  592


 Score = 79.7 bits (195),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 60/113 (53%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   +DRE
Sbjct  591  KKHGAALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDASIPVASENALPCHDRE  650

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP NDP  RH S F  L R    +    N  E E FVK MHG A
Sbjct  651  GYNKILENAKPLNDPDGRHLSAFTYL-RLSPLLMERNNFLEFERFVKRMHGEA  702



>ref|XP_010255372.1| PREDICTED: beta-amylase 7-like isoform X2 [Nelumbo nucifera]
Length=698

 Score =   125 bits (315),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYDSYYGRFF  WY+Q LIDHAD +LS A  AF+ T + VK+ GIHWWY 
Sbjct  493  HETGFFCDGGDYDSYYGRFFLNWYSQILIDHADRVLSLAKLAFESTCIAVKLSGIHWWYK  552

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELT+G+YN  NRDGY+ +  +LKK
Sbjct  553  TASHAAELTSGFYNPCNRDGYAAIASMLKK  582


 Score = 79.7 bits (195),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 60/113 (53%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   +DRE
Sbjct  581  KKHGAALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDASIPVASENALPCHDRE  640

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP NDP  RH S F  L R    +    N  E E FVK MHG A
Sbjct  641  GYNKILENAKPLNDPDGRHLSAFTYL-RLSPLLMERNNFLEFERFVKRMHGEA  692



>ref|XP_008338857.1| PREDICTED: beta-amylase 2, chloroplastic isoform X1 [Malus domestica]
Length=555

 Score =   128 bits (322),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR+ GDYDSYYGRFF  WY++ LIDH D +L+ A  AF+ T +  K+ GIHWWY 
Sbjct  345  HETGFFRDGGDYDSYYGRFFLNWYSRVLIDHGDRVLALANLAFEGTHIATKVSGIHWWYK  404

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SH AELTAG+YN+ NRDGY P+ E+LKK
Sbjct  405  TASHPAELTAGFYNSCNRDGYVPISEMLKK  434


 Score = 76.6 bits (187),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 63/120 (53%), Gaps = 11/120 (9%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQV-------LNGAWEKGVAIAGHNA  325
            KKH A +     E + S +     +A ADP GL WQV       LN AW+  + +A  NA
Sbjct  433  KKHEAALNFTCVEMRTSDQHQGFPEALADPEGLVWQVASTETHVLNAAWDADIPVASENA  492

Query  324  PGGYDRETFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
               +DRE + +++E +KPRNDP  RH S F  L      I+   N+ E E FVK MHG A
Sbjct  493  LACFDREGYNKILENAKPRNDPDGRHLSAFTYLRLSPVLIER-HNLMEFERFVKRMHGEA  551



>tpg|DAA60723.1| TPA: hypothetical protein ZEAMMB73_150352 [Zea mays]
Length=679

 Score =   125 bits (315),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYDSYYGRFF  WY+QAL+DHAD +L  A  AF+ T + VK+ G+HWWY  +
Sbjct  476  TGFFCDGGDYDSYYGRFFLSWYSQALVDHADRVLMLARLAFEGTNIAVKVSGVHWWYKTA  535

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN  NRDGY+P+  VLKK
Sbjct  536  SHAAELTAGFYNPCNRDGYAPIAAVLKK  563


 Score = 79.3 bits (194),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 61/112 (54%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLV--QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KK++A +     E +   +  V  +A+ADP GL WQVLN AW+ G+ +A  NA   YDR+
Sbjct  562  KKYDAALNFTCVELRTMDQHEVYPEAFADPEGLVWQVLNAAWDAGIQVASENALPCYDRD  621

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             F +++E +KP NDP       F   R  + +    N  E E F+K MHG A
Sbjct  622  GFNKILENAKPLNDPDGRHLLGFTYLRLGKDLFERPNFFEFERFIKRMHGEA  673



>gb|ACG29023.1| beta-amylase [Zea mays]
 tpg|DAA60727.1| TPA: beta-amylase [Zea mays]
Length=567

 Score =   125 bits (314),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYDSYYGRFF  WY+QAL+DHAD +L  A  AF+ T + VK+ G+HWWY  +
Sbjct  364  TGFFCDGGDYDSYYGRFFLSWYSQALVDHADRVLMLARLAFEGTNIAVKVSGVHWWYKTA  423

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN  NRDGY+P+  VLKK
Sbjct  424  SHAAELTAGFYNPCNRDGYAPIAAVLKK  451


 Score = 79.7 bits (195),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 61/112 (54%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLV--QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KK++A +     E +   +  V  +A+ADP GL WQVLN AW+ G+ +A  NA   YDR+
Sbjct  450  KKYDAALNFTCVELRTMDQHEVYPEAFADPEGLVWQVLNAAWDAGIQVASENALPCYDRD  509

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             F +++E +KP NDP       F   R  + +    N  E E F+K MHG A
Sbjct  510  GFNKILENAKPLNDPDGRHLLGFTYLRLGKDLFERPNFFEFERFIKRMHGEA  561



>gb|ACN28597.1| unknown [Zea mays]
 tpg|DAA60724.1| TPA: hypothetical protein ZEAMMB73_150352 [Zea mays]
Length=488

 Score =   125 bits (313),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYDSYYGRFF  WY+QAL+DHAD +L  A  AF+ T + VK+ G+HWWY  +
Sbjct  285  TGFFCDGGDYDSYYGRFFLSWYSQALVDHADRVLMLARLAFEGTNIAVKVSGVHWWYKTA  344

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN  NRDGY+P+  VLKK
Sbjct  345  SHAAELTAGFYNPCNRDGYAPIAAVLKK  372


 Score = 80.1 bits (196),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 61/112 (54%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLV--QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KK++A +     E +   +  V  +A+ADP GL WQVLN AW+ G+ +A  NA   YDR+
Sbjct  371  KKYDAALNFTCVELRTMDQHEVYPEAFADPEGLVWQVLNAAWDAGIQVASENALPCYDRD  430

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             F +++E +KP NDP       F   R  + +    N  E E F+K MHG A
Sbjct  431  GFNKILENAKPLNDPDGRHLLGFTYLRLGKDLFERPNFFEFERFIKRMHGEA  482



>ref|XP_010670423.1| PREDICTED: beta-amylase 2, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=574

 Score =   125 bits (315),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = -2

Query  739  QTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLA  560
            +T FFR+ GDYDSYYGRFF  WY++ LIDH D +L+ A  AF+   +  K+ GIHWWY  
Sbjct  340  KTGFFRDGGDYDSYYGRFFLNWYSKVLIDHGDRVLALANLAFEGFSIAAKLSGIHWWYKT  399

Query  559  SSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            +SHAAELTAG+YN  NRDGY+P+ E+LKK
Sbjct  400  ASHAAELTAGFYNPCNRDGYAPIAEMLKK  428


 Score = 79.3 bits (194),  Expect(2) = 8e-44, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 60/111 (54%), Gaps = 4/111 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E  T     +  +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  427  KKHEAALNFTCVELRTLNQHEEYPEALADPEGLVWQVLNAAWDVCIPVASENALCCYDRE  486

Query  303  TFMRLVETSKPRNDPY-RHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             + +++E +KPRNDP  +H S F  L R    +    N  E E FVK MHG
Sbjct  487  GYNKILENAKPRNDPDGKHLSAFTYL-RLNPDLMEESNFMEFERFVKRMHG  536



>gb|KHG19612.1| Beta-amylase 2, chloroplastic -like protein [Gossypium arboreum]
Length=536

 Score =   125 bits (314),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR+ GDYDSYYGRFF  WY+Q L+DH D +L+ A  AF+ T +  K+ GIHWWY 
Sbjct  330  HETGFFRDGGDYDSYYGRFFLNWYSQILVDHGDRVLALANLAFEGTCIAAKLSGIHWWYK  389

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELT+G+YN ++RDGY+P+  +LKK
Sbjct  390  TASHAAELTSGFYNPAHRDGYAPIAAMLKK  419


 Score = 79.3 bits (194),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 59/113 (52%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH   +     E  T        +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  418  KKHGVALNFTCVELRTLNQHEGFPEAMADPEGLVWQVLNAAWDVSIPVASENALPCYDRE  477

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KPRNDP  RH S F  L      I+   N  E E FVK MHG A
Sbjct  478  GYNKILENAKPRNDPDGRHLSAFTYLRLNPALIER-RNFVEFERFVKGMHGEA  529



>tpg|DAA60725.1| TPA: hypothetical protein ZEAMMB73_150352 [Zea mays]
Length=484

 Score =   125 bits (313),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYDSYYGRFF  WY+QAL+DHAD +L  A  AF+ T + VK+ G+HWWY  +
Sbjct  285  TGFFCDGGDYDSYYGRFFLSWYSQALVDHADRVLMLARLAFEGTNIAVKVSGVHWWYKTA  344

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN  NRDGY+P+  VLKK
Sbjct  345  SHAAELTAGFYNPCNRDGYAPIAAVLKK  372


 Score = 79.0 bits (193),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 60/110 (55%), Gaps = 2/110 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLV--QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KK++A +     E +   +  V  +A+ADP GL WQVLN AW+ G+ +A  NA   YDR+
Sbjct  371  KKYDAALNFTCVELRTMDQHEVYPEAFADPEGLVWQVLNAAWDAGIQVASENALPCYDRD  430

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             F +++E +KP NDP       F   R  + +    N  E E F+K MHG
Sbjct  431  GFNKILENAKPLNDPDGRHLLGFTYLRLGKDLFERPNFFEFERFIKRMHG  480



>ref|XP_008787503.1| PREDICTED: beta-amylase 2, chloroplastic-like isoform X1 [Phoenix 
dactylifera]
Length=534

 Score =   125 bits (314),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR+ GDYDSYYGRFF  WY++ L+DHAD +LS A  AF+   +  KI GIHWWY 
Sbjct  329  HETGFFRDGGDYDSYYGRFFLGWYSKVLVDHADRVLSLANFAFEGISIAAKISGIHWWYK  388

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAEL AG+YN  NRDGY+P+  +L+K
Sbjct  389  TASHAAELAAGFYNPCNRDGYAPIAAMLRK  418


 Score = 78.6 bits (192),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 61/111 (55%), Gaps = 4/111 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            +KH+A +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   YDR+
Sbjct  417  RKHDAALNFTCVELRTLDQHEDFPEAMADPEGLVWQVLNAAWDVCIPVASENALPCYDRD  476

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             + +++E +KP NDP  RH S F  L R    +   +N  E E FVK MHG
Sbjct  477  GYNKILENAKPLNDPDGRHLSAFTYL-RLSSVLLERDNFLEFERFVKRMHG  526



>ref|XP_008787505.1| PREDICTED: beta-amylase 2, chloroplastic-like isoform X2 [Phoenix 
dactylifera]
Length=469

 Score =   125 bits (314),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR+ GDYDSYYGRFF  WY++ L+DHAD +LS A  AF+   +  KI GIHWWY 
Sbjct  264  HETGFFRDGGDYDSYYGRFFLGWYSKVLVDHADRVLSLANFAFEGISIAAKISGIHWWYK  323

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAEL AG+YN  NRDGY+P+  +L+K
Sbjct  324  TASHAAELAAGFYNPCNRDGYAPIAAMLRK  353


 Score = 78.6 bits (192),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 61/111 (55%), Gaps = 4/111 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            +KH+A +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   YDR+
Sbjct  352  RKHDAALNFTCVELRTLDQHEDFPEAMADPEGLVWQVLNAAWDVCIPVASENALPCYDRD  411

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             + +++E +KP NDP  RH S F  L R    +   +N  E E FVK MHG
Sbjct  412  GYNKILENAKPLNDPDGRHLSAFTYL-RLSSVLLERDNFLEFERFVKRMHG  461



>ref|XP_010934796.1| PREDICTED: beta-amylase 2, chloroplastic isoform X4 [Elaeis guineensis]
Length=433

 Score =   123 bits (309),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR+ GDYDSYYGRFF  W ++ L+DHAD +LS A  AF+   +  KI GIHWWY 
Sbjct  228  HETGFFRDGGDYDSYYGRFFLGWCSRVLVDHADRVLSLANFAFEGISIAAKISGIHWWYK  287

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAEL AG+YN  NRDGY+P+  +LKK
Sbjct  288  TASHAAELAAGFYNPCNRDGYAPIAAMLKK  317


 Score = 80.1 bits (196),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH+A +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   YDR+
Sbjct  316  KKHDAALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDVCIPVASENALPCYDRD  375

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP NDP  RH S F  L R    +   +N  E E FVK MHG A
Sbjct  376  GYNKILENAKPLNDPDGRHLSAFTYL-RLSSVLLERDNFLEFERFVKRMHGEA  427



>ref|XP_006661569.1| PREDICTED: beta-amylase 2, chloroplastic-like [Oryza brachyantha]
Length=521

 Score =   123 bits (309),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 55/88 (63%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYDSYYGRFF  WY+Q L+DHAD +L  A  AF+ T + VK+ G+HWWY  +
Sbjct  318  TGFFCDGGDYDSYYGRFFLNWYSQVLVDHADRVLMLARLAFEGTHIAVKVSGVHWWYKTA  377

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN  NRDGY+P+  VLKK
Sbjct  378  SHAAELTAGFYNPCNRDGYAPIAAVLKK  405


 Score = 80.1 bits (196),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 60/112 (54%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLV--QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E +   +  V  +A++DP GL WQVLN AW+ G+ +A  NA   YDR+
Sbjct  404  KKHGAALNFTCVELRTMDQHEVFPEAFSDPEGLVWQVLNAAWDAGIVVASENALPCYDRD  463

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             F +++E +KP NDP       F   R  + +    N  E E FVK MHG A
Sbjct  464  GFNKILENAKPLNDPDGRHLLGFTYLRLSKVLFERANFLEFERFVKRMHGEA  515



>emb|CAX51381.1| beta-amylase [Hordeum vulgare subsp. vulgare]
Length=423

 Score =   120 bits (301),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = -2

Query  730  FFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLASSH  551
            FF + GDYDSYYGRFF  WY Q L+DHAD +L  A  AF+ + + VK+ GIHWWY  +SH
Sbjct  222  FFCDGGDYDSYYGRFFLNWYAQVLLDHADRVLMLARLAFEGSAIAVKVSGIHWWYKTASH  281

Query  550  AAELTAGYYNTSNRDGYSPLFEVLKK  473
            AAELTAG+YN  +RDGY+P+ +VLKK
Sbjct  282  AAELTAGFYNPCSRDGYTPIAQVLKK  307


 Score = 83.2 bits (204),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 60/112 (54%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLV--QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E + + +  V  +A ADP GL WQVLN AW+ G+ +A  NA   YDR+
Sbjct  306  KKHGAALNFTCVELRATDQHEVFPEALADPEGLVWQVLNAAWDAGIQMASENALPCYDRD  365

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             F + +E +KPRNDP       F   R    +    N+ E E FVK MHG A
Sbjct  366  GFNKTLENAKPRNDPDGRHLFGFTYLRLCSTLFEGPNLPEFERFVKRMHGEA  417



>ref|XP_010934795.1| PREDICTED: beta-amylase 2, chloroplastic isoform X3 [Elaeis guineensis]
Length=498

 Score =   123 bits (309),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR+ GDYDSYYGRFF  W ++ L+DHAD +LS A  AF+   +  KI GIHWWY 
Sbjct  293  HETGFFRDGGDYDSYYGRFFLGWCSRVLVDHADRVLSLANFAFEGISIAAKISGIHWWYK  352

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAEL AG+YN  NRDGY+P+  +LKK
Sbjct  353  TASHAAELAAGFYNPCNRDGYAPIAAMLKK  382


 Score = 80.1 bits (196),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH+A +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   YDR+
Sbjct  381  KKHDAALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDVCIPVASENALPCYDRD  440

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP NDP  RH S F  L R    +   +N  E E FVK MHG A
Sbjct  441  GYNKILENAKPLNDPDGRHLSAFTYL-RLSSVLLERDNFLEFERFVKRMHGEA  492



>ref|XP_004306786.1| PREDICTED: beta-amylase 2, chloroplastic [Fragaria vesca subsp. 
vesca]
Length=544

 Score =   121 bits (304),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 65/88 (74%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FFR+ GDYDSYYGRFF  WY+  L+DH D +L+ A  AF+ T +  K+ GIHWWY  +
Sbjct  326  TGFFRDGGDYDSYYGRFFLNWYSNVLVDHGDRVLTLANLAFEGTSIAAKLSGIHWWYKTA  385

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN  NRDGY+P+  + KK
Sbjct  386  SHAAELTAGFYNPCNRDGYTPIAVMFKK  413


 Score = 81.6 bits (200),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 61/113 (54%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   +DRE
Sbjct  412  KKHAAALNFTCVELRTLNQHEDFPEAMADPEGLVWQVLNAAWDANIPVASENALNCHDRE  471

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KPRNDP  RH S F  L R    +    N  E E FVK MHG A
Sbjct  472  GYNKILENAKPRNDPDGRHLSAFTYL-RLSPVLLERHNFMEFERFVKKMHGEA  523



>ref|XP_010241901.1| PREDICTED: beta-amylase 2, chloroplastic-like [Nelumbo nucifera]
Length=695

 Score =   121 bits (304),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYDSYYGRFF +WY+Q LIDHAD +L  A  AF+ T +  K+ GIHWWY 
Sbjct  490  HETGFFCDGGDYDSYYGRFFLKWYSQVLIDHADRVLFLAKLAFEGTCIAAKLSGIHWWYK  549

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELT G+YN  NRDGY+ +  +LKK
Sbjct  550  TASHAAELTVGFYNPCNRDGYAAIASMLKK  579


 Score = 82.0 bits (201),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 61/113 (54%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   +DRE
Sbjct  578  KKHGAALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDVSIPVASENALPCHDRE  637

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E SKP NDP  RH S F  L R    +   +N  E E FVK MHG A
Sbjct  638  GYNKILENSKPLNDPDGRHLSAFTYL-RLGPHLMERDNFLEFERFVKRMHGEA  689



>ref|XP_011092236.1| PREDICTED: beta-amylase 2, chloroplastic isoform X2 [Sesamum 
indicum]
Length=523

 Score =   126 bits (317),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            ++T+FF + G YD YYGRFF  WY+Q LIDH D +L+ A+ AF  TP+  K+ G+HWWY 
Sbjct  323  YETKFFCDGGAYDGYYGRFFLNWYSQVLIDHGDQVLAMASLAFAGTPIAAKLSGVHWWYK  382

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAG+YN++NRDGY+P+  +LKK
Sbjct  383  TSSHAAELTAGFYNSTNRDGYTPIVLMLKK  412


 Score = 77.0 bits (188),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 58/110 (53%), Gaps = 2/110 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH  T+     E +   +     +A ADP GL WQVLN AW+ G+ +A  NA   Y+R+
Sbjct  411  KKHKTTLNFTCVELRTLDQYAAFPEALADPEGLVWQVLNAAWDAGIHVASENALPCYNRQ  470

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            +F ++++ +KP  DP R   + F   R    +    N+ E   FVK MHG
Sbjct  471  SFYKILQNAKPHGDPDRRHLSAFTYLRLSPDLMEQHNLMEFVRFVKQMHG  520



>ref|XP_010934794.1| PREDICTED: beta-amylase 2, chloroplastic isoform X2 [Elaeis guineensis]
Length=546

 Score =   123 bits (308),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR+ GDYDSYYGRFF  W ++ L+DHAD +LS A  AF+   +  KI GIHWWY 
Sbjct  341  HETGFFRDGGDYDSYYGRFFLGWCSRVLVDHADRVLSLANFAFEGISIAAKISGIHWWYK  400

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAEL AG+YN  NRDGY+P+  +LKK
Sbjct  401  TASHAAELAAGFYNPCNRDGYAPIAAMLKK  430


 Score = 80.1 bits (196),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH+A +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   YDR+
Sbjct  429  KKHDAALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDVCIPVASENALPCYDRD  488

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP NDP  RH S F  L R    +   +N  E E FVK MHG A
Sbjct  489  GYNKILENAKPLNDPDGRHLSAFTYL-RLSSVLLERDNFLEFERFVKRMHGEA  540



>ref|XP_012083395.1| PREDICTED: beta-amylase 2, chloroplastic isoform X1 [Jatropha 
curcas]
 gb|KDP28630.1| hypothetical protein JCGZ_14401 [Jatropha curcas]
Length=537

 Score =   127 bits (319),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR  GDYDSYYGRFF  WY++ LIDH D +L+ A  AF+ TP+  K+ GIHWWY 
Sbjct  337  HETGFFRVGGDYDSYYGRFFLNWYSRVLIDHGDRVLALANLAFEGTPISAKVSGIHWWYK  396

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVL  479
             +SHAAELTAG+YN +NRDGY+P+  +L
Sbjct  397  TASHAAELTAGFYNPANRDGYAPIAAML  424


 Score = 75.9 bits (185),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = -3

Query  411  QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETFMRLVETSKPRNDPY-RHXSTFF  235
            +A ADP GL WQVLN AW+  + +A  NA   YDRE + +++E +KP +DP  RH S F 
Sbjct  449  EALADPEGLVWQVLNAAWDACIPVASENALPCYDREDYNKILENAKPLHDPDGRHLSVFT  508

Query  234  VLERPWQRIQTAENISELEYFVKCMHGYA  148
             L R   ++   +N  E E FVK MHG A
Sbjct  509  YL-RLSPKLMERQNFIEFERFVKRMHGGA  536



>ref|XP_010934793.1| PREDICTED: beta-amylase 2, chloroplastic isoform X1 [Elaeis guineensis]
Length=553

 Score =   123 bits (308),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR+ GDYDSYYGRFF  W ++ L+DHAD +LS A  AF+   +  KI GIHWWY 
Sbjct  348  HETGFFRDGGDYDSYYGRFFLGWCSRVLVDHADRVLSLANFAFEGISIAAKISGIHWWYK  407

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAEL AG+YN  NRDGY+P+  +LKK
Sbjct  408  TASHAAELAAGFYNPCNRDGYAPIAAMLKK  437


 Score = 80.1 bits (196),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH+A +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   YDR+
Sbjct  436  KKHDAALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDVCIPVASENALPCYDRD  495

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP NDP  RH S F  L R    +   +N  E E FVK MHG A
Sbjct  496  GYNKILENAKPLNDPDGRHLSAFTYL-RLSSVLLERDNFLEFERFVKRMHGEA  547



>ref|XP_012083396.1| PREDICTED: beta-amylase 2, chloroplastic isoform X2 [Jatropha 
curcas]
Length=528

 Score =   127 bits (318),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR  GDYDSYYGRFF  WY++ LIDH D +L+ A  AF+ TP+  K+ GIHWWY 
Sbjct  328  HETGFFRVGGDYDSYYGRFFLNWYSRVLIDHGDRVLALANLAFEGTPISAKVSGIHWWYK  387

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVL  479
             +SHAAELTAG+YN +NRDGY+P+  +L
Sbjct  388  TASHAAELTAGFYNPANRDGYAPIAAML  415


 Score = 75.9 bits (185),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 54/89 (61%), Gaps = 2/89 (2%)
 Frame = -3

Query  411  QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETFMRLVETSKPRNDP-YRHXSTFF  235
            +A ADP GL WQVLN AW+  + +A  NA   YDRE + +++E +KP +DP  RH S F 
Sbjct  440  EALADPEGLVWQVLNAAWDACIPVASENALPCYDREDYNKILENAKPLHDPDGRHLSVFT  499

Query  234  VLERPWQRIQTAENISELEYFVKCMHGYA  148
             L R   ++   +N  E E FVK MHG A
Sbjct  500  YL-RLSPKLMERQNFIEFERFVKRMHGGA  527



>ref|NP_182112.2| beta-amylase 7 [Arabidopsis thaliana]
 sp|O80831.2|BAM7_ARATH RecName: Full=Beta-amylase 7; AltName: Full=1,4-alpha-D-glucan 
maltohydrolase; AltName: Full=Beta-amylase 4 [Arabidopsis 
thaliana]
 gb|AEC10613.1| beta-amylase 7 [Arabidopsis thaliana]
Length=691

 Score =   118 bits (296),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYD  YGRFF +WY+Q LIDHAD IL  A   FD + +  K+P +HWWY  +
Sbjct  482  TGFFCDGGDYDGLYGRFFLKWYSQVLIDHADQILCLAKLVFDSSCIAAKLPDVHWWYRTA  541

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN SNRDGYS +   LKK
Sbjct  542  SHAAELTAGFYNPSNRDGYSAIASTLKK  569


 Score = 84.0 bits (206),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 60/112 (54%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH AT+  VS E Q+   P D   A  +P  + WQVLN AW+ G  +A  N+   +DR 
Sbjct  568  KKHGATLSFVSGEVQVLNRPDDFSGALGEPEAVAWQVLNAAWDSGTPVARENSLACHDRV  627

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E+ K RNDP R   + F   R    +    NI E E FVK +HG A
Sbjct  628  GYNKMLESVKFRNDPDRKHLSSFAYSRLVPALMEGHNIVEFERFVKKLHGEA  679



>dbj|BAE99337.1| putative beta-amylase [Arabidopsis thaliana]
Length=691

 Score =   118 bits (296),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYD  YGRFF +WY+Q LIDHAD IL  A   FD + +  K+P +HWWY  +
Sbjct  482  TGFFCDGGDYDGLYGRFFLKWYSQVLIDHADQILCLAKLVFDSSCIAAKLPDVHWWYRTA  541

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN SNRDGYS +   LKK
Sbjct  542  SHAAELTAGFYNPSNRDGYSAIASTLKK  569


 Score = 84.0 bits (206),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 60/112 (54%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH AT+  VS E Q+   P D   A  +P  + WQVLN AW+ G  +A  N+   +DR 
Sbjct  568  KKHGATLSFVSGEVQVLNRPDDFSGALGEPEAVAWQVLNAAWDSGTPVARENSLACHDRV  627

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E+ K RNDP R   + F   R    +    NI E E FVK +HG A
Sbjct  628  GYNKMLESVKFRNDPDRKHLSSFAYSRLVPALMEGHNIVEFERFVKKLHGEA  679



>ref|XP_009398621.1| PREDICTED: beta-amylase 2, chloroplastic-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=702

 Score =   117 bits (293),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T F  + G+Y+S YGRFF  WY+Q L++H D +L  A  AFD + + VKI GIHWWY 
Sbjct  498  HETGFLCDGGEYNSQYGRFFLGWYSQVLVEHGDSVLFLAKLAFDGSSIAVKISGIHWWYK  557

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+P+  +LKK
Sbjct  558  TASHAAELTAGFYNPCNRDGYAPIASMLKK  587


 Score = 84.7 bits (208),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 64/111 (58%), Gaps = 4/111 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E  T     D  +A ADP GL WQVLN AW+ G+ +A  NA   YDR+
Sbjct  586  KKHGAALNFTCTELHTLDHYEDFPEAMADPEGLVWQVLNAAWDVGIPVASENALPCYDRD  645

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            ++ +++E++KP NDP  RH S+F  L      +Q   N+ E E FVK MHG
Sbjct  646  SYNKILESAKPLNDPDGRHLSSFTFLRLSPVLMQN-HNLLEFERFVKQMHG  695



>gb|EEC85090.1| hypothetical protein OsI_32458 [Oryza sativa Indica Group]
Length=651

 Score =   120 bits (301),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYDSYYGRFF  WY+Q L+DHAD +L  A  AF+ + + VK+ G+HWWY  +
Sbjct  448  TGFFSDGGDYDSYYGRFFLNWYSQVLVDHADRVLMLARLAFEGSDIAVKVSGVHWWYKTA  507

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN  NRDGY+ +  VLKK
Sbjct  508  SHAAELTAGFYNPCNRDGYASIAAVLKK  535


 Score = 81.6 bits (200),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 60/112 (54%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLV--QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E +   +  V  +A+ADP GL WQVLN AW+ G+ +A  NA   YDR+
Sbjct  534  KKHGAALNFTCVELRTMDQHEVFPEAFADPEGLVWQVLNAAWDAGIPVASENALPCYDRD  593

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             F +++E +KP NDP       F   R  + +    N  E E FVK MHG A
Sbjct  594  GFNKILENAKPLNDPDGRHLLGFTYLRLTKVLFERANFLEFERFVKRMHGEA  645



>gb|EEE70265.1| hypothetical protein OsJ_30408 [Oryza sativa Japonica Group]
Length=650

 Score =   120 bits (301),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYDSYYGRFF  WY+Q L+DHAD +L  A  AF+ + + VK+ G+HWWY  +
Sbjct  447  TGFFSDGGDYDSYYGRFFLNWYSQVLVDHADRVLMLARLAFEGSDIAVKVSGVHWWYKTA  506

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN  NRDGY+ +  VLKK
Sbjct  507  SHAAELTAGFYNPCNRDGYASIAAVLKK  534


 Score = 81.6 bits (200),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 60/112 (54%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLV--QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E +   +  V  +A+ADP GL WQVLN AW+ G+ +A  NA   YDR+
Sbjct  533  KKHGAALNFTCVELRTMDQHEVFPEAFADPEGLVWQVLNAAWDAGIPVASENALPCYDRD  592

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             F +++E +KP NDP       F   R  + +    N  E E FVK MHG A
Sbjct  593  GFNKILENAKPLNDPDGRHLLGFTYLRLTKVLFERANFLEFERFVKRMHGEA  644



>ref|XP_008804013.1| PREDICTED: beta-amylase 2, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=556

 Score =   124 bits (312),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYDSYYGRFF  WY+Q L+DHAD +LS A  AF+ T +  KI GIHWWY 
Sbjct  343  HETGFFCDGGDYDSYYGRFFLNWYSQVLVDHADRVLSLAKLAFEGTCIAAKISGIHWWYK  402

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+ +  +LKK
Sbjct  403  TASHAAELTAGFYNPCNRDGYASIASMLKK  432


 Score = 77.4 bits (189),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 49/121 (40%), Positives = 64/121 (53%), Gaps = 5/121 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E  T     +  +A ADP GL WQVLN AW+  + +A  NA   +DR+
Sbjct  431  KKHGAALNFTCVELRTLDQHEEFPEALADPEGLVWQVLNAAWDVCIPVASENALPCHDRD  490

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA*QSRSNK  127
             + +++E SKP NDP  RH S F  L R    +    N  E E FVK MHG   ++ S K
Sbjct  491  GYNKILENSKPMNDPDARHLSAFTYL-RLSPDLMERHNFLEFERFVKRMHGVG-ETFSTK  548

Query  126  N  124
            N
Sbjct  549  N  549



>gb|AAC28536.1| putative beta-amylase [Arabidopsis thaliana]
Length=687

 Score =   118 bits (296),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYD  YGRFF +WY+Q LIDHAD IL  A   FD + +  K+P +HWWY  +
Sbjct  482  TGFFCDGGDYDGLYGRFFLKWYSQVLIDHADQILCLAKLVFDSSCIAAKLPDVHWWYRTA  541

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN SNRDGYS +   LKK
Sbjct  542  SHAAELTAGFYNPSNRDGYSAIASTLKK  569


 Score = 83.2 bits (204),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 59/110 (54%), Gaps = 2/110 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH AT+  VS E Q+   P D   A  +P  + WQVLN AW+ G  +A  N+   +DR 
Sbjct  568  KKHGATLSFVSGEVQVLNRPDDFSGALGEPEAVAWQVLNAAWDSGTPVARENSLACHDRV  627

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             + +++E+ K RNDP R   + F   R    +    NI E E FVK +HG
Sbjct  628  GYNKMLESVKFRNDPDRKHLSSFAYSRLVPALMEGHNIVEFERFVKKLHG  677



>ref|XP_009398630.1| PREDICTED: beta-amylase 2, chloroplastic-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=581

 Score =   117 bits (292),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T F  + G+Y+S YGRFF  WY+Q L++H D +L  A  AFD + + VKI GIHWWY 
Sbjct  377  HETGFLCDGGEYNSQYGRFFLGWYSQVLVEHGDSVLFLAKLAFDGSSIAVKISGIHWWYK  436

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+P+  +LKK
Sbjct  437  TASHAAELTAGFYNPCNRDGYAPIASMLKK  466


 Score = 84.7 bits (208),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 64/111 (58%), Gaps = 4/111 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E  T     D  +A ADP GL WQVLN AW+ G+ +A  NA   YDR+
Sbjct  465  KKHGAALNFTCTELHTLDHYEDFPEAMADPEGLVWQVLNAAWDVGIPVASENALPCYDRD  524

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            ++ +++E++KP NDP  RH S+F  L      +Q   N+ E E FVK MHG
Sbjct  525  SYNKILESAKPLNDPDGRHLSSFTFLRLSPVLMQN-HNLLEFERFVKQMHG  574



>ref|NP_001063976.1| Os09g0569200 [Oryza sativa Japonica Group]
 dbj|BAD46222.1| putative beta-amylase [Oryza sativa Japonica Group]
 dbj|BAF25890.1| Os09g0569200 [Oryza sativa Japonica Group]
Length=533

 Score =   120 bits (300),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 66/88 (75%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYDSYYGRFF  WY+Q L+DHAD +L  A  AF+ + + VK+ G+HWWY  +
Sbjct  330  TGFFSDGGDYDSYYGRFFLNWYSQVLVDHADRVLMLARLAFEGSDIAVKVSGVHWWYKTA  389

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN  NRDGY+ +  VLKK
Sbjct  390  SHAAELTAGFYNPCNRDGYASIAAVLKK  417


 Score = 81.6 bits (200),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 60/112 (54%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLV--QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E +   +  V  +A+ADP GL WQVLN AW+ G+ +A  NA   YDR+
Sbjct  416  KKHGAALNFTCVELRTMDQHEVFPEAFADPEGLVWQVLNAAWDAGIPVASENALPCYDRD  475

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             F +++E +KP NDP       F   R  + +    N  E E FVK MHG A
Sbjct  476  GFNKILENAKPLNDPDGRHLLGFTYLRLTKVLFERANFLEFERFVKRMHGEA  527



>ref|XP_008804014.1| PREDICTED: beta-amylase 2, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=548

 Score =   124 bits (312),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYDSYYGRFF  WY+Q L+DHAD +LS A  AF+ T +  KI GIHWWY 
Sbjct  343  HETGFFCDGGDYDSYYGRFFLNWYSQVLVDHADRVLSLAKLAFEGTCIAAKISGIHWWYK  402

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+ +  +LKK
Sbjct  403  TASHAAELTAGFYNPCNRDGYASIASMLKK  432


 Score = 77.0 bits (188),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 60/113 (53%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E  T     +  +A ADP GL WQVLN AW+  + +A  NA   +DR+
Sbjct  431  KKHGAALNFTCVELRTLDQHEEFPEALADPEGLVWQVLNAAWDVCIPVASENALPCHDRD  490

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E SKP NDP  RH S F  L R    +    N  E E FVK MHG A
Sbjct  491  GYNKILENSKPMNDPDARHLSAFTYL-RLSPDLMERHNFLEFERFVKRMHGEA  542



>ref|XP_002511858.1| Beta-amylase, putative [Ricinus communis]
 gb|EEF50527.1| Beta-amylase, putative [Ricinus communis]
Length=609

 Score =   127 bits (319),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR+ GDYDSYYGRFF  WY++ LIDH D +L+ A  AF+ T +  K+ GIHWWY 
Sbjct  336  HETGFFRDGGDYDSYYGRFFLNWYSRVLIDHGDRVLALANLAFEGTCISAKVSGIHWWYK  395

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN SNRDGY+P+  +L K
Sbjct  396  TASHAAELTAGFYNPSNRDGYAPIAAMLNK  425


 Score = 74.3 bits (181),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 56/111 (50%), Gaps = 4/111 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
             KH   +     E +      D  +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  424  NKHGVGLNFTCVEMRTLNQNEDFPEALADPEGLVWQVLNAAWDACIPVASENALPCYDRE  483

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             + +++E +KP  DP  RH S F  L R    +    N  E E FVK MHG
Sbjct  484  GYNKILENAKPLEDPDGRHLSVFTYL-RLSAVLMERHNFIEFERFVKRMHG  533



>ref|XP_008232901.1| PREDICTED: beta-amylase 2, chloroplastic [Prunus mume]
Length=538

 Score =   125 bits (314),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR+ GDYDSYYGRFF  WY++ L+DH D +L+ A  AF+ T +  K+ GIHWWY 
Sbjct  335  HETGFFRDGGDYDSYYGRFFLNWYSRFLVDHGDRVLALANLAFEGTCIAAKVSGIHWWYK  394

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQ  467
             +SH AELTAG+YN  NRDGY+P+  +LKK +
Sbjct  395  TASHPAELTAGFYNPCNRDGYAPIAAMLKKHE  426


 Score = 76.3 bits (186),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 60/113 (53%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E +   +     +A ADP GL WQVLN AW+  + +A  NA   +DRE
Sbjct  423  KKHEAALNFTCVEMRTLDQHEGFPEALADPEGLVWQVLNAAWDANIPVASENALTCHDRE  482

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++  +KP+NDP  RH S F  L R    +    N  E E FVK MHG A
Sbjct  483  GYNKILANAKPQNDPDGRHLSAFTYL-RLSPVLLEGHNFMEFERFVKKMHGEA  534



>ref|XP_010909265.1| PREDICTED: LOW QUALITY PROTEIN: beta-amylase 2, chloroplastic-like 
[Elaeis guineensis]
Length=699

 Score =   124 bits (310),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYDSYYGRFF  WY+Q L+DHAD +LS A  AF+ T +  KI G+HWWY 
Sbjct  494  HETGFFCDGGDYDSYYGRFFLNWYSQVLVDHADRVLSLAKLAFEGTCIAAKISGVHWWYK  553

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+ +  +LK+
Sbjct  554  TASHAAELTAGFYNPCNRDGYASIASMLKR  583


 Score = 77.4 bits (189),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 61/113 (54%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            K+H A +     E  T    ++  +A ADP GL WQVLN AW+  + +A  NA   +DR 
Sbjct  582  KRHGAALNFTCAELRTLDQHKEFPEALADPEGLVWQVLNAAWDVCIPVASENALPCHDRA  641

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E SKP NDP  RH S F  L R    +  + N  E E FVK MHG A
Sbjct  642  GYNKILENSKPMNDPDGRHLSAFTYL-RLSPDLMESHNFLEFERFVKRMHGEA  693



>ref|XP_002320794.2| hypothetical protein POPTR_0014s07950g [Populus trichocarpa]
 gb|EEE99109.2| hypothetical protein POPTR_0014s07950g [Populus trichocarpa]
Length=539

 Score =   129 bits (323),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+  FFR+ GDYDSYYGRFF  WY+Q LIDH D +L+ A  AF+ T +  K+ GIHWWY 
Sbjct  333  HEIGFFRDGGDYDSYYGRFFLNWYSQVLIDHGDRVLALANLAFEGTGISAKLSGIHWWYK  392

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN+SNRDGY+P+  +L+K
Sbjct  393  TASHAAELTAGFYNSSNRDGYAPIAAMLRK  422


 Score = 72.0 bits (175),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 62/119 (52%), Gaps = 5/119 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            +KH   +     E +   +     +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  421  RKHGVALNFTCFEMRTVDQFEGFPEALADPEGLVWQVLNAAWDACIPLASENALPCYDRE  480

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA*QSRSN  130
             + +++E +KP ++P  RH S F  L R    +    N  E E FVK MHG A  S SN
Sbjct  481  GYNKILENAKPLHNPDGRHLSVFTYL-RLSPVLMERHNFQEFERFVKRMHGEA-DSDSN  537



>ref|XP_011092228.1| PREDICTED: beta-amylase 2, chloroplastic isoform X1 [Sesamum 
indicum]
Length=527

 Score =   126 bits (317),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            ++T+FF + G YD YYGRFF  WY+Q LIDH D +L+ A+ AF  TP+  K+ G+HWWY 
Sbjct  323  YETKFFCDGGAYDGYYGRFFLNWYSQVLIDHGDQVLAMASLAFAGTPIAAKLSGVHWWYK  382

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAG+YN++NRDGY+P+  +LKK
Sbjct  383  TSSHAAELTAGFYNSTNRDGYTPIVLMLKK  412


 Score = 74.3 bits (181),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 57/109 (52%), Gaps = 2/109 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH  T+     E +   +     +A ADP GL WQVLN AW+ G+ +A  NA   Y+R+
Sbjct  411  KKHKTTLNFTCVELRTLDQYAAFPEALADPEGLVWQVLNAAWDAGIHVASENALPCYNRQ  470

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMH  157
            +F ++++ +KP  DP R   + F   R    +    N+ E   FVK MH
Sbjct  471  SFYKILQNAKPHGDPDRRHLSAFTYLRLSPDLMEQHNLMEFVRFVKQMH  519



>ref|XP_002459849.1| hypothetical protein SORBIDRAFT_02g012320 [Sorghum bicolor]
 gb|EER96370.1| hypothetical protein SORBIDRAFT_02g012320 [Sorghum bicolor]
Length=469

 Score =   122 bits (305),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 54/88 (61%), Positives = 67/88 (76%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYDSYYGRFF  WY+Q L+DHAD +L  A  AF+ + + VK+ G+HWWY  +
Sbjct  266  TGFFCDGGDYDSYYGRFFLSWYSQTLVDHADRVLMLARLAFEGSNIAVKVSGVHWWYKTA  325

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN  NRDGY+P+  VLKK
Sbjct  326  SHAAELTAGFYNPCNRDGYAPIAAVLKK  353


 Score = 79.0 bits (193),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 64/120 (53%), Gaps = 18/120 (15%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLV--QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KK++A +     E +   +  V  +A+ADP GL WQVLN AW+ G+ +A  NA   YDR+
Sbjct  352  KKYDAALNFTCVELRTMDQHEVYPEAFADPEGLVWQVLNAAWDAGIQVASENALPCYDRD  411

Query  303  TFMRLVETSKPRNDP-YRHXSTF-------FVLERPWQRIQTAENISELEYFVKCMHGYA  148
             F +++E +KP NDP  RH   F        + ERP        N  E E FVK MHG A
Sbjct  412  GFNKILENAKPLNDPDGRHLFGFTYLRLSNVLFERP--------NFFEFERFVKRMHGEA  463



>ref|XP_010055131.1| PREDICTED: beta-amylase 2, chloroplastic [Eucalyptus grandis]
 gb|KCW71611.1| hypothetical protein EUGRSUZ_E00138 [Eucalyptus grandis]
Length=546

 Score =   122 bits (307),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 68/92 (74%), Gaps = 0/92 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H T FFR+ G+YD YYGRFF  WY++ LIDH D +LS A  AF+   + VK+ GIHWWY 
Sbjct  341  HDTSFFRDGGEYDGYYGRFFLNWYSRVLIDHGDRVLSLANLAFEGCCIAVKLSGIHWWYK  400

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQ  467
             +SHAAELTAG+YN+ NRDGY+ +  +LKK +
Sbjct  401  TASHAAELTAGFYNSCNRDGYATIVSMLKKHE  432


 Score = 77.8 bits (190),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 60/111 (54%), Gaps = 4/111 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH   +     E +   +  D  +A ADP GL WQVLN AW+  + +A  NA   YD E
Sbjct  429  KKHEIAMNFTCVELRTLDQYEDFPEAMADPEGLVWQVLNAAWDAQIPVASENALPCYDGE  488

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             + +++E +KPR+DP  RH S F  L R    +    N+ E E FVK MHG
Sbjct  489  GYNKILENAKPRDDPDGRHLSAFTYL-RLSPTLTEGNNLMEFERFVKRMHG  538



>ref|XP_010105936.1| Beta-amylase 2 [Morus notabilis]
 gb|EXC06818.1| Beta-amylase 2 [Morus notabilis]
Length=554

 Score =   124 bits (311),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 52/92 (57%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR+ G+YDSYYGRFF  WY++ L+DH D +L+ A  AF+ T +  K+ GIHWWY 
Sbjct  333  HETGFFRDGGEYDSYYGRFFLNWYSRTLVDHGDRVLALANLAFEGTCIAAKLSGIHWWYK  392

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQ  467
             +SHAAEL AG+YN +NRDGY+P+  +LKK +
Sbjct  393  TASHAAELAAGFYNPANRDGYAPIAAMLKKHE  424


 Score = 76.3 bits (186),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 60/113 (53%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH   +     E  T     D  +A ADP GL WQVLN AW+  + +A   A   +DRE
Sbjct  421  KKHETALNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDVCIPVASEKALPCHDRE  480

Query  303  TFMRLVETSKPRNDPY-RHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP NDP  RH S F  L      ++T  N +E E FVK MHG A
Sbjct  481  GYNKILENAKPLNDPDGRHLSAFTYLRLSPVLMET-HNFTEFERFVKRMHGEA  532



>ref|XP_009392820.1| PREDICTED: beta-amylase 2, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392821.1| PREDICTED: beta-amylase 2, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=541

 Score =   123 bits (308),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR+ GDYD+ YGRFF  WY++ L++H D+++S A  AF+ + + VKI G+HWWY 
Sbjct  337  HETGFFRDGGDYDNSYGRFFLGWYSKVLVEHGDLVVSLAKLAFEGSCIAVKISGVHWWYK  396

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+P+  +LKK
Sbjct  397  TASHAAELTAGFYNPCNRDGYAPIASMLKK  426


 Score = 77.8 bits (190),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 62/111 (56%), Gaps = 4/111 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH AT+     E +   +  D  +A ADP GL WQVLN AW+  V +A  NA   YDR+
Sbjct  425  KKHGATLNFTCVELRTLDQHVDFPEAMADPEGLVWQVLNAAWDVSVPMASENALPCYDRD  484

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             + ++++ +KP +DP  RH STF  L R    +  A N  E   FV+ MHG
Sbjct  485  DYNKILDNAKPLSDPDGRHLSTFTYL-RLNPVLMYAHNFKEFGRFVQRMHG  534



>ref|XP_011036179.1| PREDICTED: beta-amylase 2, chloroplastic isoform X1 [Populus 
euphratica]
Length=539

 Score =   128 bits (322),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+  FFR+ GDYDSYYGRFF  WY+Q LIDH D +L+ A  AF+ T + VK+ GIHWWY 
Sbjct  333  HEIGFFRDGGDYDSYYGRFFLNWYSQVLIDHGDRVLALANLAFEGTGISVKLSGIHWWYK  392

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELT+G+YN SNRDGY+P+  +L+K
Sbjct  393  TASHAAELTSGFYNPSNRDGYAPIAAMLRK  422


 Score = 72.0 bits (175),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 59/113 (52%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            +KH   +     E +   +     +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  421  RKHGVALNFTCFEMRTVDQYEGFPEALADPEGLVWQVLNAAWDACIPLASENALPCYDRE  480

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP ++P  RH S F  L R    +    N  E E FVK MHG A
Sbjct  481  GYNKILENAKPLHNPDGRHLSVFTYL-RLSPVLMERHNFQEFERFVKRMHGEA  532



>ref|XP_011036188.1| PREDICTED: beta-amylase 2, chloroplastic isoform X2 [Populus 
euphratica]
Length=538

 Score =   128 bits (322),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+  FFR+ GDYDSYYGRFF  WY+Q LIDH D +L+ A  AF+ T + VK+ GIHWWY 
Sbjct  333  HEIGFFRDGGDYDSYYGRFFLNWYSQVLIDHGDRVLALANLAFEGTGISVKLSGIHWWYK  392

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELT+G+YN SNRDGY+P+  +L+K
Sbjct  393  TASHAAELTSGFYNPSNRDGYAPIAAMLRK  422


 Score = 71.6 bits (174),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 59/113 (52%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            +KH   +     E +   +     +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  421  RKHGVALNFTCFEMRTVDQYEGFPEALADPEGLVWQVLNAAWDACIPLASENALPCYDRE  480

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP ++P  RH S F  L R    +    N  E E FVK MHG A
Sbjct  481  GYNKILENAKPLHNPDGRHLSVFTYL-RLSPVLMERHNFQEFERFVKRMHGDA  532



>ref|XP_007218058.1| hypothetical protein PRUPE_ppa006189mg [Prunus persica]
 gb|EMJ19257.1| hypothetical protein PRUPE_ppa006189mg [Prunus persica]
Length=423

 Score =   124 bits (311),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 53/92 (58%), Positives = 69/92 (75%), Gaps = 0/92 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR+ GDYDSYYGRFF  WY++ L+DH D +L+ A  AF+ T +  K+ GIHWWY 
Sbjct  220  HETGFFRDGGDYDSYYGRFFLNWYSRFLVDHGDRVLALANLAFEGTCIAAKVSGIHWWYK  279

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQ  467
             +SH AELTAG+YN  NRDGY+P+  +LKK +
Sbjct  280  TASHPAELTAGFYNPCNRDGYAPIAAMLKKHE  311


 Score = 75.5 bits (184),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 61/115 (53%), Gaps = 4/115 (3%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E +   +     +A ADP GL WQVLN AW+  + +A  NA   +DRE
Sbjct  308  KKHEAALNFTCVEMRTLDQHEGFPEALADPEGLVWQVLNAAWDANIPVASENALTCHDRE  367

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA*Q  142
             + +++  +KP+NDP  RH S F  L R    +    N  E E FVK MHG A Q
Sbjct  368  GYNKILANAKPQNDPDGRHLSAFTYL-RLSPVLLEGHNFLEFERFVKKMHGEAAQ  421



>ref|XP_006397762.1| hypothetical protein EUTSA_v10001342mg [Eutrema salsugineum]
 gb|ESQ39215.1| hypothetical protein EUTSA_v10001342mg [Eutrema salsugineum]
Length=687

 Score =   119 bits (299),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYD  YGRFF +WY+Q LIDHAD ILS A   FD + +  K+P +HWWY  +
Sbjct  482  TGFFCDGGDYDGLYGRFFLKWYSQVLIDHADKILSLAKLVFDSSCIAAKLPDVHWWYRTA  541

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN SNRDGY+ +   LKK
Sbjct  542  SHAAELTAGFYNPSNRDGYAAIASALKK  569


 Score = 79.7 bits (195),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 59/112 (53%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH AT+  VS E QI   P D   A  +P+ + WQVLN AW+    IA  N+   +DR 
Sbjct  568  KKHGATLSFVSGEVQILNRPDDFSGALGEPDAVAWQVLNAAWDTNTPIARENSLPCHDRV  627

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E+ K  NDP R   + F   R    +    NI E E FVK +HG A
Sbjct  628  GYNKMLESVKFPNDPDRRRLSSFAYSRLIPALMEGHNIVEFERFVKKLHGEA  679



>ref|XP_002274612.2| PREDICTED: beta-amylase 2, chloroplastic [Vitis vinifera]
 emb|CBI40370.3| unnamed protein product [Vitis vinifera]
Length=554

 Score =   122 bits (305),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + G YDSYYGRFF  WY++ L+DH D +L+ A  AF+ T + VK+ GIHWWY 
Sbjct  343  HETVFFCDGGKYDSYYGRFFLNWYSRVLVDHGDRVLALANLAFEGTCIAVKLSGIHWWYK  402

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHA+ELTAG+YN  NRDGY+P+ E+L+K
Sbjct  403  TASHASELTAGFYNPCNRDGYAPISEMLQK  432


 Score = 77.4 bits (189),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRD--LVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            +KH A +     E +   ++    +A ADP GL WQVLN AW+  + +A  NA   +DRE
Sbjct  431  QKHGAALNFTCVELRTLDQEEGFPEALADPEGLVWQVLNAAWDVSIPVASENALTCHDRE  490

Query  303  TFMRLVETSKPRNDPY-RHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP NDP  RH S F  L      ++T  N +E E FVK MHG A
Sbjct  491  GYNKILENAKPFNDPDGRHLSAFTYLRLSPVLMET-HNFTEFERFVKRMHGEA  542



>ref|XP_002273843.1| PREDICTED: beta-amylase 7 [Vitis vinifera]
Length=699

 Score =   118 bits (296),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD YY RFF  WY+Q L+DH D +LS A  AF+ T +  K+ G+HWWY 
Sbjct  494  HETGFFCDGGDYDGYYARFFLNWYSQVLVDHGDRVLSLAKLAFEGTSIAAKLAGVHWWYK  553

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAEL AG+YN  NRDGY+ +  +LKK
Sbjct  554  TTSHAAELMAGFYNPCNRDGYAAVMAMLKK  583


 Score = 80.5 bits (197),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E  +  R  D  +A ADP GL WQVLN AW+  + +   NA   +DRE
Sbjct  582  KKHGAALNFTCAELHMLNRHEDFPEAMADPEGLAWQVLNAAWDVCIPVVSENALLTHDRE  641

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
            ++ +++E +KP NDP  RH S+F  L R    +    N  E E FVK MHG A
Sbjct  642  SYNKILENAKPLNDPDGRHFSSFTYL-RLSPLLMERHNFLEFERFVKRMHGEA  693



>emb|CBI40368.3| unnamed protein product [Vitis vinifera]
Length=657

 Score =   118 bits (295),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 50/90 (56%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD YY RFF  WY+Q L+DH D +LS A  AF+ T +  K+ G+HWWY 
Sbjct  452  HETGFFCDGGDYDGYYARFFLNWYSQVLVDHGDRVLSLAKLAFEGTSIAAKLAGVHWWYK  511

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAEL AG+YN  NRDGY+ +  +LKK
Sbjct  512  TTSHAAELMAGFYNPCNRDGYAAVMAMLKK  541


 Score = 80.5 bits (197),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E  +  R  D  +A ADP GL WQVLN AW+  + +   NA   +DRE
Sbjct  540  KKHGAALNFTCAELHMLNRHEDFPEAMADPEGLAWQVLNAAWDVCIPVVSENALLTHDRE  599

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
            ++ +++E +KP NDP  RH S+F  L R    +    N  E E FVK MHG A
Sbjct  600  SYNKILENAKPLNDPDGRHFSSFTYL-RLSPLLMERHNFLEFERFVKRMHGEA  651



>ref|XP_008777295.1| PREDICTED: beta-amylase 2, chloroplastic isoform X1 [Phoenix 
dactylifera]
Length=725

 Score =   120 bits (302),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF   GDY+SYYGRFF  WY+Q L+DHAD +LS A  AF+ T +  K+ GIHWWY 
Sbjct  490  HETGFFCGGGDYNSYYGRFFLNWYSQVLVDHADRVLSLAKLAFEGTCIAAKVSGIHWWYK  549

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+ +  +LK+
Sbjct  550  TASHAAELTAGFYNPCNRDGYASIASMLKR  579


 Score = 77.8 bits (190),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 45/112 (40%), Positives = 62/112 (55%), Gaps = 4/112 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            K+H A +K    E  T     +  +A ADP GL WQVLN AW+  + +A  N+   +DR 
Sbjct  578  KRHGAALKFTCAELRTLDQHEEFPEALADPEGLVWQVLNAAWDVCIPVASENSLPCHDRS  637

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGY  151
             + +++E SKP +DP  RH +TF  L R    +  + N  E E FVK MHGY
Sbjct  638  GYNKILENSKPMSDPDGRHLATFTYL-RLSPDLMESHNFLEFERFVKRMHGY  688



>ref|XP_002882038.1| hypothetical protein ARALYDRAFT_346398 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58297.1| hypothetical protein ARALYDRAFT_346398 [Arabidopsis lyrata subsp. 
lyrata]
Length=677

 Score =   119 bits (298),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYD  YGRFF +WY+Q LIDHAD ILS A   FD + +  K+P +HWWY  +
Sbjct  481  TGFFCDGGDYDGLYGRFFLKWYSQVLIDHADQILSLAKLVFDSSCIAAKLPDVHWWYRTA  540

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN SNRDGY+ +   LKK
Sbjct  541  SHAAELTAGFYNPSNRDGYAAIASTLKK  568


 Score = 79.0 bits (193),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 58/110 (53%), Gaps = 2/110 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH AT+  VS E Q+   P D   A  +P  + WQVLN AW+    +A  N+   +DR 
Sbjct  567  KKHGATLSFVSGEVQVLNRPDDFSGALGEPEAVAWQVLNAAWDSDTPVARENSLPCHDRV  626

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             + +++E+ K RNDP R   + F   R    +    NI E E FVK +HG
Sbjct  627  GYNKMLESVKFRNDPDRRHLSSFAYSRLVPALMEEHNIVEFERFVKKLHG  676



>ref|XP_008804015.1| PREDICTED: beta-amylase 2, chloroplastic isoform X3 [Phoenix 
dactylifera]
Length=547

 Score =   124 bits (312),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYDSYYGRFF  WY+Q L+DHAD +LS A  AF+ T +  KI GIHWWY 
Sbjct  343  HETGFFCDGGDYDSYYGRFFLNWYSQVLVDHADRVLSLAKLAFEGTCIAAKISGIHWWYK  402

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+ +  +LKK
Sbjct  403  TASHAAELTAGFYNPCNRDGYASIASMLKK  432


 Score = 73.6 bits (179),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 45/110 (41%), Positives = 58/110 (53%), Gaps = 4/110 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E  T     +  +A ADP GL WQVLN AW+  + +A  NA   +DR+
Sbjct  431  KKHGAALNFTCVELRTLDQHEEFPEALADPEGLVWQVLNAAWDVCIPVASENALPCHDRD  490

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMH  157
             + +++E SKP NDP  RH S F  L R    +    N  E E FVK MH
Sbjct  491  GYNKILENSKPMNDPDARHLSAFTYL-RLSPDLMERHNFLEFERFVKRMH  539



>ref|XP_009757493.1| PREDICTED: beta-amylase 2, chloroplastic, partial [Nicotiana 
sylvestris]
Length=427

 Score =   113 bits (283),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 50/91 (55%), Positives = 65/91 (71%), Gaps = 0/91 (0%)
 Frame = -2

Query  739  QTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLA  560
             T FFR+ G+Y+S YGRFF +WYTQ LIDH D +L  A  +F  TP+  K+PGI+WW   
Sbjct  215  NTEFFRDGGEYNSIYGRFFLKWYTQVLIDHGDQVLGLANLSFKGTPIAAKLPGIYWWRNT  274

Query  559  SSHAAELTAGYYNTSNRDGYSPLFEVLKKTQ  467
             S AAELTAG+Y+ + RDGYSP+  +LKK +
Sbjct  275  KSGAAELTAGFYSVNCRDGYSPIASMLKKHE  305


 Score = 84.7 bits (208),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 61/111 (55%), Gaps = 3/111 (3%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDL--VQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E     RD+   +A ADP GL WQVLN AWE  + +AG NA   Y RE
Sbjct  302  KKHEAALNFTCLELHTVYRDIDFPEALADPEGLVWQVLNVAWEAYIPVAGENARPCYHRE  361

Query  303  TFMRLVETSKPRNDPY-RHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             + +++E +KPRNDP+ RH  + F   R    +    N  E E FV+ MHG
Sbjct  362  GYNKILENAKPRNDPFGRHYLSAFTYLRLSPTLLEKHNFMEFERFVQKMHG  412



>ref|XP_008777296.1| PREDICTED: beta-amylase 2, chloroplastic isoform X2 [Phoenix 
dactylifera]
Length=695

 Score =   121 bits (303),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF   GDY+SYYGRFF  WY+Q L+DHAD +LS A  AF+ T +  K+ GIHWWY 
Sbjct  490  HETGFFCGGGDYNSYYGRFFLNWYSQVLVDHADRVLSLAKLAFEGTCIAAKVSGIHWWYK  549

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+ +  +LK+
Sbjct  550  TASHAAELTAGFYNPCNRDGYASIASMLKR  579


 Score = 75.9 bits (185),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            K+H A +K    E  T     +  +A ADP GL WQVLN AW+  + +A  N+   +DR 
Sbjct  578  KRHGAALKFTCAELRTLDQHEEFPEALADPEGLVWQVLNAAWDVCIPVASENSLPCHDRS  637

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E SKP +DP  RH +TF  L R    +  + N  E E FVK MHG A
Sbjct  638  GYNKILENSKPMSDPDGRHLATFTYL-RLSPDLMESHNFLEFERFVKRMHGEA  689



>ref|XP_010232924.1| PREDICTED: LOW QUALITY PROTEIN: beta-amylase 2, chloroplastic-like 
[Brachypodium distachyon]
Length=530

 Score =   112 bits (281),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 65/90 (72%), Gaps = 2/90 (2%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            + T  F + GDYDSYYGRFF  WY+Q L+DHAD +L  A  AF+ + + VK+ GIHWWY 
Sbjct  327  NNTGXFCDGGDYDSYYGRFFLNWYSQVLLDHADRVLMLARLAFEGSAIAVKVSGIHWWYK  386

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  N  GY+P+  VLKK
Sbjct  387  TASHAAELTAGFYNPCN--GYAPIVTVLKK  414


 Score = 83.2 bits (204),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 47/112 (42%), Positives = 58/112 (52%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLV--QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E +   R  V  +A ADP GL WQVLN AW+ G+ +A  NA   YDR+
Sbjct  413  KKHGAALNFTCVELRTMARHEVFPEALADPEGLVWQVLNAAWDAGIPVASENALPCYDRD  472

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             F + +E +KPRNDP       F   R    +    N  E E FVK MHG A
Sbjct  473  GFNKTLENAKPRNDPDGRHLFGFTYLRLCSVLFEKPNFMEFERFVKRMHGEA  524



>ref|XP_010506568.1| PREDICTED: beta-amylase 7-like [Camelina sativa]
Length=692

 Score =   117 bits (294),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYD  YGRFF +WY+Q LIDHAD ILS A   F+ + +  K+P +HWWY  +
Sbjct  482  TGFFCDGGDYDGLYGRFFLKWYSQVLIDHADQILSLAKLVFNSSCIAAKLPDVHWWYRTA  541

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN SNRDGY+ +   LKK
Sbjct  542  SHAAELTAGFYNPSNRDGYAAIASTLKK  569


 Score = 77.8 bits (190),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 57/110 (52%), Gaps = 2/110 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH AT+  VS E Q+   P D   A  +P  + WQVLN AW+    IA  N+   +DR 
Sbjct  568  KKHGATLSFVSGEVQVLNRPDDFSGALGEPEAVAWQVLNAAWDSDTPIARENSLPCHDRV  627

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             + +++E+ K  NDP R   + F   R    +    NI E E FVK +HG
Sbjct  628  GYNKMLESVKFPNDPDRRQLSSFAYSRLIPALMEGHNIVEFERFVKKLHG  677



>ref|XP_007220223.1| hypothetical protein PRUPE_ppa002199mg [Prunus persica]
 gb|EMJ21422.1| hypothetical protein PRUPE_ppa002199mg [Prunus persica]
Length=702

 Score =   122 bits (305),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYDSYYGRFF  WY++ L+DH D +LS A  AFD T +  K+ G+HWWY 
Sbjct  495  HETGFFCDGGDYDSYYGRFFLNWYSRVLVDHGDRVLSLAKLAFDGTCIAAKLSGLHWWYK  554

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAEL AG+YN  NRDGY+ +  +LKK
Sbjct  555  TASHAAELAAGFYNPCNRDGYAAIVTMLKK  584


 Score = 72.4 bits (176),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH AT+ L   E  +  +  D  +A  D  GL WQVLNGAW+  V ++  NA   +D  
Sbjct  583  KKHEATLNLACTELHMLDQHEDFQEALGDSEGLFWQVLNGAWDVCVPVSSENALPCHDHV  642

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
            ++ ++++++KP  DP  RH S+F  L R    +    N  E E F+K MHG A
Sbjct  643  SYKKILDSAKPLTDPDGRHLSSFTYL-RLSPLLMERHNFMEFEQFIKRMHGEA  694



>emb|CDX74771.1| BnaA05g05170D [Brassica napus]
Length=676

 Score =   118 bits (296),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYD  YGRFF +WY+Q LIDHAD +LS A   FD + +  K+P +HWWY  +
Sbjct  468  TGFFCDGGDYDGLYGRFFLKWYSQVLIDHADKVLSLAKLVFDTSCIAAKLPDVHWWYRTA  527

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN SNRDGY+ +   LKK
Sbjct  528  SHAAELTAGFYNPSNRDGYAEIASTLKK  555


 Score = 75.5 bits (184),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 57/112 (51%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +  VS E Q+   P D   A  +P  + WQVLN AW+    IA  N+   +DR 
Sbjct  554  KKHGAALSFVSGEVQVLNRPDDFSGALGEPEAVAWQVLNAAWDTDTPIARENSLPCHDRV  613

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             F +++E+ K  NDP R   + F   R    +    N+ E + FVK +HG A
Sbjct  614  GFNKMLESVKFPNDPDRRHLSSFAYSRLVPALMEGHNLVEFDRFVKKLHGEA  665



>ref|XP_009143179.1| PREDICTED: beta-amylase 7 isoform X1 [Brassica rapa]
Length=676

 Score =   118 bits (296),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYD  YGRFF +WY+Q LIDHAD +LS A   FD + +  K+P +HWWY  +
Sbjct  468  TGFFCDGGDYDGLYGRFFLKWYSQVLIDHADKVLSLAKLVFDTSCIAAKLPDVHWWYRTA  527

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN SNRDGY+ +   LKK
Sbjct  528  SHAAELTAGFYNPSNRDGYAEIASTLKK  555


 Score = 75.5 bits (184),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 57/112 (51%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +  VS E Q+   P D   A  +P  + WQVLN AW+    IA  N+   +DR 
Sbjct  554  KKHGAALSFVSGEVQVLNRPDDFSGALGEPEAVAWQVLNAAWDTDTPIARENSLPCHDRV  613

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             F +++E+ K  NDP R   + F   R    +    N+ E + FVK +HG A
Sbjct  614  GFNKMLESVKFPNDPDRRHLSSFAYSRLVPALMEGHNLVEFDRFVKKLHGEA  665



>ref|XP_009143180.1| PREDICTED: beta-amylase 7 isoform X2 [Brassica rapa]
Length=672

 Score =   118 bits (296),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYD  YGRFF +WY+Q LIDHAD +LS A   FD + +  K+P +HWWY  +
Sbjct  464  TGFFCDGGDYDGLYGRFFLKWYSQVLIDHADKVLSLAKLVFDTSCIAAKLPDVHWWYRTA  523

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN SNRDGY+ +   LKK
Sbjct  524  SHAAELTAGFYNPSNRDGYAEIASTLKK  551


 Score = 75.5 bits (184),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 57/112 (51%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +  VS E Q+   P D   A  +P  + WQVLN AW+    IA  N+   +DR 
Sbjct  550  KKHGAALSFVSGEVQVLNRPDDFSGALGEPEAVAWQVLNAAWDTDTPIARENSLPCHDRV  609

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             F +++E+ K  NDP R   + F   R    +    N+ E + FVK +HG A
Sbjct  610  GFNKMLESVKFPNDPDRRHLSSFAYSRLVPALMEGHNLVEFDRFVKKLHGEA  661



>ref|XP_010508098.1| PREDICTED: beta-amylase 7 [Camelina sativa]
Length=691

 Score =   117 bits (294),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYD  YGRFF +WY+Q LIDHAD ILS A   F+ + +  K+P +HWWY  +
Sbjct  482  TGFFCDGGDYDGLYGRFFLKWYSQVLIDHADQILSLAKLVFNSSCIAAKLPDVHWWYRTA  541

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN SNRDGY+ +   LKK
Sbjct  542  SHAAELTAGFYNPSNRDGYAAIASTLKK  569


 Score = 76.3 bits (186),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 57/110 (52%), Gaps = 2/110 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH AT+  VS E Q+   P D   A  +P  + WQVLN AW+    IA  N+   +DR 
Sbjct  568  KKHGATLSFVSGEVQVLNRPDDFSGALGEPEAVAWQVLNAAWDSETPIARENSLPCHDRV  627

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             + +++E+ K  NDP R   + F   R    +    N+ E E FVK +HG
Sbjct  628  GYNKMLESVKFPNDPDRRHLSSFAYSRLIPALMEGHNVVEFERFVKKLHG  677



>ref|XP_006293786.1| hypothetical protein CARUB_v10022771mg [Capsella rubella]
 gb|EOA26684.1| hypothetical protein CARUB_v10022771mg [Capsella rubella]
Length=688

 Score =   115 bits (289),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYD  YGRFF +WY+Q LIDHAD ILS A   F+ + +  K+P +HWWY  +
Sbjct  480  TGFFCDGGDYDGLYGRFFLKWYSQVLIDHADQILSLAKLVFNSSCIAAKLPDVHWWYRTT  539

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN SN+DGY+ +   LKK
Sbjct  540  SHAAELTAGFYNPSNQDGYAAIASTLKK  567


 Score = 77.8 bits (190),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 57/112 (51%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH AT+  VS E Q+   P D      +P  + WQVLN AW+    IA  N+   +DR 
Sbjct  566  KKHGATLSFVSGEVQVLNRPDDFTGGLGEPEAVAWQVLNAAWDSDTPIARENSLPCHDRV  625

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E+ K  NDP R   + F   R    +    NI E E FVK +HG A
Sbjct  626  GYNKMLESVKFPNDPDRRHLSSFAYSRLIPALMEGHNIVEFERFVKKLHGEA  677



>ref|XP_009340422.1| PREDICTED: LOW QUALITY PROTEIN: beta-amylase 7 [Pyrus x bretschneideri]
Length=701

 Score =   121 bits (304),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 66/94 (70%), Gaps = 0/94 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            + T FF E GDYD Y+GRFF  WY++ L+DH D +LS A   FD T +  K+ G+HWWY 
Sbjct  494  NDTGFFSEGGDYDGYHGRFFLNWYSRVLVDHGDRVLSLAKLTFDGTCIAAKLSGLHWWYK  553

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQCD  461
              SHAAELTAG+YN  NRDGYSP+  +LKK + +
Sbjct  554  TVSHAAELTAGFYNPCNRDGYSPIVTMLKKHEAN  587


 Score = 71.6 bits (174),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 42/113 (37%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A + L   E  +  +  D  +A  D  GL WQVLN AW+  + ++  NA   +DR 
Sbjct  582  KKHEANLSLACTELHMLGQHEDFKEALGDSEGLFWQVLNAAWDVCLPVSSENALACHDRI  641

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
            ++ ++++ +KP  DP  RH S+F  L R    +   +N+ E E FVK MHG A
Sbjct  642  SYNKILDNAKPLTDPDGRHLSSFTYL-RLSPLLMERDNLMEFERFVKRMHGEA  693



>emb|CDY18893.1| BnaC04g04570D [Brassica napus]
Length=672

 Score =   117 bits (293),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GDYD  YGRFF +WY+Q LIDHAD +LS A   FD + +  K+P +HWWY  +
Sbjct  467  TGFFCDGGDYDGLYGRFFLKWYSQFLIDHADKVLSLAKLVFDTSCIAAKLPDVHWWYRTA  526

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN SNRDGY+ +   LKK
Sbjct  527  SHAAELTAGFYNPSNRDGYTEIASTLKK  554


 Score = 75.5 bits (184),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 57/112 (51%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +  VS E Q+   P D   A  +P  + WQVLN AW+    IA  N+   +DR 
Sbjct  553  KKHGAALSFVSGEVQVLNRPDDFSAALGEPEAVAWQVLNAAWDTDTPIARENSLPCHDRV  612

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             F +++E+ K  NDP R   + F   R    +    N+ E + FVK +HG A
Sbjct  613  GFNKMLESVKFPNDPDRRHLSSFAYSRLVPALMEGHNLVEFDRFVKKLHGEA  664



>ref|XP_010518231.1| PREDICTED: beta-amylase 7-like [Camelina sativa]
Length=687

 Score =   115 bits (287),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 51/88 (58%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FF + GD+D  YGRFF +WY+Q LIDHAD ILS A   F  + +  K+P +HWWY  +
Sbjct  479  TGFFCDGGDFDGLYGRFFLKWYSQVLIDHADHILSLAKLVFSSSCIAAKLPDVHWWYKTA  538

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELTAG+YN SNRDGY+ +   LKK
Sbjct  539  SHAAELTAGFYNPSNRDGYAAIASTLKK  566


 Score = 77.4 bits (189),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 57/110 (52%), Gaps = 2/110 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH AT+  VS E Q+   P D   A  +P  + WQVLN AW+    IA  N+   +DR 
Sbjct  565  KKHGATLSFVSGEVQVLNRPDDFSGALGEPEAVAWQVLNAAWDSDTPIARENSLPCHDRV  624

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             + +++E+ K  NDP R   + F   R    +    NI E E FVK +HG
Sbjct  625  GYNKMLESVKFPNDPDRRHLSSFAYSRLIPALMEGHNIVEFERFVKKLHG  674



>ref|XP_001770103.1| predicted protein [Physcomitrella patens]
 gb|EDQ65085.1| predicted protein [Physcomitrella patens]
Length=552

 Score =   115 bits (288),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 49/88 (56%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FFR+ GDYDSYYGRFF +WY+  LI H D +L+ A  AF+   +  K+ GIHWWY  +
Sbjct  351  TEFFRDGGDYDSYYGRFFLKWYSDVLIQHGDRVLTFANIAFEGVKIAAKVSGIHWWYKTA  410

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAEL AG+YN +NRDGY+ + ++L K
Sbjct  411  SHAAELAAGFYNPANRDGYAAIAQMLAK  438


 Score = 77.0 bits (188),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 39/109 (36%), Positives = 55/109 (50%), Gaps = 2/109 (2%)
 Frame = -3

Query  474  KHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRET  301
            KH A+      E  T    +   +A ADP GL WQVLN AW+ G+++A  NA G +DR+ 
Sbjct  438  KHGASFNFTCVELRTLAQAKGYPEALADPEGLVWQVLNAAWDAGISVASENALGCFDRQG  497

Query  300  FMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            + +++E +KP  DP       F   R    +    N  E   FVK +HG
Sbjct  498  YNKILENAKPEKDPDGRHLVAFTYLRLSDELMKEHNFKEFSRFVKRLHG  546



>ref|XP_008232902.1| PREDICTED: beta-amylase 7 [Prunus mume]
Length=702

 Score =   123 bits (309),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYDSYYGRFF  WY++ L+DH D +LS A  AFD T +  K+ G+HWWY 
Sbjct  495  HETGFFCDGGDYDSYYGRFFLNWYSRVLVDHGDRVLSLAKLAFDGTCIAAKLSGLHWWYK  554

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+ +  +LKK
Sbjct  555  TASHAAELTAGFYNPCNRDGYAAIVTMLKK  584


 Score = 68.2 bits (165),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 61/113 (54%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH AT+ L   E  +  +  D  +A  D  GL WQVLN AW+  V ++  NA   +D  
Sbjct  583  KKHEATLNLACTELHMLDQHEDFQEALGDSEGLFWQVLNAAWDVCVPVSSENALPCHDHV  642

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
            ++ ++++++KP  DP  RH S+F  L R    +    +  E E F+K MHG A
Sbjct  643  SYKKILDSAKPLTDPDGRHLSSFTYL-RLSPLLMERHSFMEFERFIKRMHGEA  694



>ref|XP_009767747.1| PREDICTED: beta-amylase 2, chloroplastic-like [Nicotiana sylvestris]
Length=442

 Score =   116 bits (290),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 50/92 (54%), Positives = 67/92 (73%), Gaps = 0/92 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
             +T FFR+ G+Y+ +YGRFF +WYTQ LIDHAD +L  A  +F  TP+  K+PGI+WW  
Sbjct  228  QKTEFFRDGGEYNRFYGRFFLKWYTQVLIDHADQVLGLANLSFKGTPIAAKLPGIYWWRN  287

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQ  467
              S AAELTAG+Y+ + RDGYSP+  +LKK +
Sbjct  288  TKSGAAELTAGFYSVNCRDGYSPIASMLKKRE  319


 Score = 72.0 bits (175),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 59/120 (49%), Gaps = 12/120 (10%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQV---------LNGAWEKGVAIAGH  331
            KK  A +     E  T    +D  QA ADP GL WQV         LN AWE  + +AG 
Sbjct  316  KKREAALNFTCLELHTVDQKKDFPQALADPEGLVWQVNMDFPKLQVLNAAWEANIPVAGE  375

Query  330  NAPGGYDRETFMRLVETSKPRNDPY-RHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            NA   Y RE + +++E +KP NDP+ R+  + F   +    +    N  E E FV+ MHG
Sbjct  376  NARPCYRREGYNKILENAKPMNDPFGRYYLSAFTYLKLSPTLLEKHNFMEFERFVQMMHG  435



>ref|XP_002987444.1| hypothetical protein SELMODRAFT_43201, partial [Selaginella moellendorffii]
 gb|EFJ11531.1| hypothetical protein SELMODRAFT_43201, partial [Selaginella moellendorffii]
Length=431

 Score =   112 bits (279),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
             +T FFR+ GDYDSYYGRFF +WY++ LI+H D +L  A  AF+   +  K+ GIHWWY 
Sbjct  231  QETDFFRDGGDYDSYYGRFFLKWYSKVLIEHGDRVLMLAKLAFEGFHIASKVSGIHWWYK  290

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAEL AG+YN  NRDGY  + E+  K
Sbjct  291  TASHAAELAAGFYNPCNRDGYVEIAEMFAK  320


 Score = 76.3 bits (186),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 43/110 (39%), Positives = 60/110 (55%), Gaps = 4/110 (4%)
 Frame = -3

Query  474  KHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRET  301
            KH+A++     E  T     D  +A ADP GL WQVLN AW+ G+ +A  NA   YDR+ 
Sbjct  320  KHDASLNFTCVELRTLAQEEDFPEALADPEGLVWQVLNAAWDAGIYVASENALPCYDRDG  379

Query  300  FMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            + +++E +KP  +P  RH S F  L R    +    N+ E   FVK +HG
Sbjct  380  YNKILENAKPSKNPDGRHISAFTYL-RLSPVLMEEHNLQEFARFVKRLHG  428



>emb|CDP08818.1| unnamed protein product [Coffea canephora]
Length=556

 Score =   107 bits (268),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+TRFF + GDYD YYGRFF  WY+Q L+DH D +LS A  AF+ T +  K+ GIHWWY 
Sbjct  354  HETRFFCDGGDYDGYYGRFFLNWYSQILVDHGDRVLSLANLAFEGTAIAAKLSGIHWWYK  413

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+P+  +LKK
Sbjct  414  TASHAAELTAGFYNPCNRDGYAPIASMLKK  443


 Score = 80.1 bits (196),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 61/111 (55%), Gaps = 4/111 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH+ T+     E  T     D  +A ADP GL WQVLN AW+  +A+A  NA   YDRE
Sbjct  442  KKHDTTLNFTCVELRTLDQHEDFPEALADPEGLVWQVLNAAWDVSIAVASENALPCYDRE  501

Query  303  TFMRLVETSKPRNDPY-RHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             + +++E +KP ++P  RH S F  L R    +    N  E E FVK MHG
Sbjct  502  GYNKILENAKPLSNPDGRHLSAFTYL-RLGPVLMEKHNFVEFERFVKRMHG  551



>ref|XP_010055135.1| PREDICTED: beta-amylase 7 isoform X3 [Eucalyptus grandis]
Length=672

 Score =   115 bits (289),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
             +T FF + GDYD Y+GRFF +WY+Q LIDH D +L+ A  AFD T +  K+ GI+WWY 
Sbjct  468  QETGFFCDGGDYDGYFGRFFLKWYSQVLIDHGDRVLALAKLAFDGTCIAAKLSGIYWWYR  527

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAE TAG+YN SNRDGY+ +  +LKK
Sbjct  528  TASHAAESTAGFYNPSNRDGYATIAAMLKK  557


 Score = 70.5 bits (171),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 60/112 (54%), Gaps = 3/112 (3%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI-SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRET  301
            KKH A +     +  +   +D   A ADP+GL WQVLN AW+ G+ + G N    + R  
Sbjct  556  KKHGAALNFTCAQLHVLDQQDFSSALADPDGLAWQVLNAAWDHGIPVIGENFLPCHTRVG  615

Query  300  FMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
            + ++++ +K  NDP  RH  +F  L R    +   +N+ E E FVK MHG A
Sbjct  616  YNKMLDGAKLLNDPDGRHFLSFTYL-RLNSILMERQNLLEFERFVKRMHGEA  666



>ref|XP_010055132.1| PREDICTED: beta-amylase 7 isoform X1 [Eucalyptus grandis]
 ref|XP_010055133.1| PREDICTED: beta-amylase 7 isoform X1 [Eucalyptus grandis]
 gb|KCW71613.1| hypothetical protein EUGRSUZ_E00139 [Eucalyptus grandis]
Length=698

 Score =   115 bits (289),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
             +T FF + GDYD Y+GRFF +WY+Q LIDH D +L+ A  AFD T +  K+ GI+WWY 
Sbjct  494  QETGFFCDGGDYDGYFGRFFLKWYSQVLIDHGDRVLALAKLAFDGTCIAAKLSGIYWWYR  553

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAE TAG+YN SNRDGY+ +  +LKK
Sbjct  554  TASHAAESTAGFYNPSNRDGYATIAAMLKK  583


 Score = 70.5 bits (171),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 60/112 (54%), Gaps = 3/112 (3%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI-SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRET  301
            KKH A +     +  +   +D   A ADP+GL WQVLN AW+ G+ + G N    + R  
Sbjct  582  KKHGAALNFTCAQLHVLDQQDFSSALADPDGLAWQVLNAAWDHGIPVIGENFLPCHTRVG  641

Query  300  FMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
            + ++++ +K  NDP  RH  +F  L R    +   +N+ E E FVK MHG A
Sbjct  642  YNKMLDGAKLLNDPDGRHFLSFTYL-RLNSILMERQNLLEFERFVKRMHGEA  692



>gb|KCW71612.1| hypothetical protein EUGRSUZ_E00139 [Eucalyptus grandis]
Length=699

 Score =   115 bits (289),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
             +T FF + GDYD Y+GRFF +WY+Q LIDH D +L+ A  AFD T +  K+ GI+WWY 
Sbjct  495  QETGFFCDGGDYDGYFGRFFLKWYSQVLIDHGDRVLALAKLAFDGTCIAAKLSGIYWWYR  554

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAE TAG+YN SNRDGY+ +  +LKK
Sbjct  555  TASHAAESTAGFYNPSNRDGYATIAAMLKK  584


 Score = 70.5 bits (171),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 60/112 (54%), Gaps = 3/112 (3%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI-SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRET  301
            KKH A +     +  +   +D   A ADP+GL WQVLN AW+ G+ + G N    + R  
Sbjct  583  KKHGAALNFTCAQLHVLDQQDFSSALADPDGLAWQVLNAAWDHGIPVIGENFLPCHTRVG  642

Query  300  FMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
            + ++++ +K  NDP  RH  +F  L R    +   +N+ E E FVK MHG A
Sbjct  643  YNKMLDGAKLLNDPDGRHFLSFTYL-RLNSILMERQNLLEFERFVKRMHGEA  693



>ref|XP_010055134.1| PREDICTED: beta-amylase 7 isoform X2 [Eucalyptus grandis]
Length=689

 Score =   115 bits (289),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
             +T FF + GDYD Y+GRFF +WY+Q LIDH D +L+ A  AFD T +  K+ GI+WWY 
Sbjct  485  QETGFFCDGGDYDGYFGRFFLKWYSQVLIDHGDRVLALAKLAFDGTCIAAKLSGIYWWYR  544

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAE TAG+YN SNRDGY+ +  +LKK
Sbjct  545  TASHAAESTAGFYNPSNRDGYATIAAMLKK  574


 Score = 70.5 bits (171),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 60/112 (54%), Gaps = 3/112 (3%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI-SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRET  301
            KKH A +     +  +   +D   A ADP+GL WQVLN AW+ G+ + G N    + R  
Sbjct  573  KKHGAALNFTCAQLHVLDQQDFSSALADPDGLAWQVLNAAWDHGIPVIGENFLPCHTRVG  632

Query  300  FMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
            + ++++ +K  NDP  RH  +F  L R    +   +N+ E E FVK MHG A
Sbjct  633  YNKMLDGAKLLNDPDGRHFLSFTYL-RLNSILMERQNLLEFERFVKRMHGEA  683



>ref|XP_002302585.2| hypothetical protein POPTR_0002s16070g [Populus trichocarpa]
 gb|EEE81858.2| hypothetical protein POPTR_0002s16070g [Populus trichocarpa]
Length=702

 Score =   105 bits (261),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD YYGRFF  WYT+ L+DH D +LS A  AF+ T + VK+ GIHWWY 
Sbjct  497  HETGFFCDGGDYDGYYGRFFLNWYTRILVDHGDRVLSLAKLAFEGTQIAVKLSGIHWWYK  556

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+ + E+LKK
Sbjct  557  TASHAAELTAGFYNPCNRDGYAAIAEMLKK  586


 Score = 80.9 bits (198),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 60/112 (54%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E+++  +  D  +A ADP GL WQVLN AWE G+ IA  NA   +DR 
Sbjct  585  KKHKAALNFSCSESRMGDQQVDFAEALADPEGLVWQVLNAAWEVGIPIASENALPCHDRV  644

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
            T+ ++++ +KP NDP       F   R    +   +   E E FVK MHG A
Sbjct  645  TYNKILDNAKPLNDPDGKHFLSFTHLRLSPLLMERQTFVEFERFVKRMHGEA  696



>ref|XP_009764518.1| PREDICTED: beta-amylase 2, chloroplastic-like [Nicotiana sylvestris]
Length=508

 Score =   109 bits (273),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 62/90 (69%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
             +T FF + G+Y+ +YGRFF  WY+Q LI+H D +L  A  AF  TP+  K+ GIHWWY 
Sbjct  309  QETGFFCDFGEYNGFYGRFFLHWYSQILINHGDRVLGLAALAFKGTPIAAKVSGIHWWYN  368

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
              SHAAELTAG+YN+ N  GYS +  +LKK
Sbjct  369  TKSHAAELTAGFYNSGNFTGYSAIVSMLKK  398


 Score = 76.3 bits (186),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 59/110 (54%), Gaps = 3/110 (3%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E  T    R+  +A +DP GL W+VLN AWE  + +AG NA   Y RE
Sbjct  397  KKHGAALNFTCLELRTVDQEREFPEALSDPEGLVWKVLNAAWEVKIPVAGENALPCYHRE  456

Query  303  TFMRLVETSKPRNDPY-RHXSTFFVLERPWQRIQTAENISELEYFVKCMH  157
             + ++++ +KP NDP+ RH  + F   R    +    N  E E FV+ MH
Sbjct  457  GYNKILQIAKPMNDPFGRHYLSAFTYLRLSPTLLEKHNFIEFERFVQKMH  506



>gb|KJB51476.1| hypothetical protein B456_008G218300 [Gossypium raimondii]
Length=580

 Score =   144 bits (363),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF E+GDYDSYYGRFF  WY QAL+DHAD +LS A  AF+ET ++VKIP ++WWY 
Sbjct  452  HETGFFCERGDYDSYYGRFFLHWYAQALMDHADNVLSLANLAFEETKIIVKIPAVYWWYK  511

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAGYYN +N+DGYSP+FEVLKK
Sbjct  512  TSSHAAELTAGYYNPTNQDGYSPVFEVLKK  541


 Score = 39.3 bits (90),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 22/35 (63%), Gaps = 0/35 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQV  373
            KKH+ TVK V    QI   +  +A+ADP GL WQV
Sbjct  540  KKHSVTVKFVCYGLQICSYENDEAFADPEGLSWQV  574



>ref|XP_010523740.1| PREDICTED: beta-amylase 7 [Tarenaya hassleriana]
Length=687

 Score =   120 bits (302),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD +YGRFF +WY+Q LIDH D +LS A  AF+ T +  K+PG+HWWY 
Sbjct  483  HETGFFCDGGDYDDFYGRFFLKWYSQVLIDHTDRVLSLAKLAFEGTCIAAKLPGVHWWYR  542

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
              SHAAE+TAG+YN  N DGY+ +  VLKK
Sbjct  543  TVSHAAEITAGFYNPCNHDGYAAVASVLKK  572


 Score = 62.4 bits (150),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 56/116 (48%), Gaps = 11/116 (9%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNA----PGG  316
            KKH A +     E  +  R  D   A A+P  L WQ  N AW+  + IA  +A     GG
Sbjct  571  KKHGACLNYAPGEVHVVNRSEDFSGALAEPEALAWQASNAAWDADIPIARESALPFHDGG  630

Query  315  YDRETFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
            Y++     ++ ++K  NDP R   + F   R    +  A+N+ E E FVK MHG A
Sbjct  631  YNK-----ILASAKFLNDPDRRHVSCFAYSRLNPALMEAQNLVEFERFVKKMHGEA  681



>ref|XP_011023345.1| PREDICTED: beta-amylase 7 isoform X3 [Populus euphratica]
Length=684

 Score =   102 bits (255),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD YYGRFF  WYT+ L+DH D +LS A  AF+ T + VK+ GIHWWY 
Sbjct  479  HETGFFCDGGDYDGYYGRFFLNWYTRILVDHGDRVLSLAKLAFEGTQIAVKLSGIHWWYK  538

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+ +  +LKK
Sbjct  539  TASHAAELTAGFYNPCNRDGYAAISAMLKK  568


 Score = 80.1 bits (196),  Expect(2) = 4e-37, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E ++  +  D  +A ADP GL WQVLN AWE G+ IA  NA   +DR 
Sbjct  567  KKHKAALNFSCSELRMVDQQVDFAEALADPEGLVWQVLNAAWEVGIPIASENALPCHDRV  626

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
            T+ ++++ +KP NDP  RH  +F  L R    +   +   E E FVK MHG A
Sbjct  627  TYNKILDKAKPSNDPDGRHFLSFTHL-RLSPLLMERQTFMEFERFVKRMHGEA  678



>ref|XP_011023344.1| PREDICTED: beta-amylase 7 isoform X2 [Populus euphratica]
Length=702

 Score =   102 bits (255),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD YYGRFF  WYT+ L+DH D +LS A  AF+ T + VK+ GIHWWY 
Sbjct  497  HETGFFCDGGDYDGYYGRFFLNWYTRILVDHGDRVLSLAKLAFEGTQIAVKLSGIHWWYK  556

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+ +  +LKK
Sbjct  557  TASHAAELTAGFYNPCNRDGYAAISAMLKK  586


 Score = 79.7 bits (195),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E ++  +  D  +A ADP GL WQVLN AWE G+ IA  NA   +DR 
Sbjct  585  KKHKAALNFSCSELRMVDQQVDFAEALADPEGLVWQVLNAAWEVGIPIASENALPCHDRV  644

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
            T+ ++++ +KP NDP  RH  +F  L R    +   +   E E FVK MHG A
Sbjct  645  TYNKILDKAKPSNDPDGRHFLSFTHL-RLSPLLMERQTFMEFERFVKRMHGEA  696



>ref|XP_011023342.1| PREDICTED: beta-amylase 7 isoform X1 [Populus euphratica]
 ref|XP_011023343.1| PREDICTED: beta-amylase 7 isoform X1 [Populus euphratica]
Length=703

 Score =   102 bits (255),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD YYGRFF  WYT+ L+DH D +LS A  AF+ T + VK+ GIHWWY 
Sbjct  498  HETGFFCDGGDYDGYYGRFFLNWYTRILVDHGDRVLSLAKLAFEGTQIAVKLSGIHWWYK  557

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+ +  +LKK
Sbjct  558  TASHAAELTAGFYNPCNRDGYAAISAMLKK  587


 Score = 79.7 bits (195),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E ++  +  D  +A ADP GL WQVLN AWE G+ IA  NA   +DR 
Sbjct  586  KKHKAALNFSCSELRMVDQQVDFAEALADPEGLVWQVLNAAWEVGIPIASENALPCHDRV  645

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
            T+ ++++ +KP NDP  RH  +F  L R    +   +   E E FVK MHG A
Sbjct  646  TYNKILDKAKPSNDPDGRHFLSFTHL-RLSPLLMERQTFMEFERFVKRMHGEA  697



>ref|XP_011023346.1| PREDICTED: beta-amylase 7 isoform X4 [Populus euphratica]
Length=679

 Score =   102 bits (254),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD YYGRFF  WYT+ L+DH D +LS A  AF+ T + VK+ GIHWWY 
Sbjct  474  HETGFFCDGGDYDGYYGRFFLNWYTRILVDHGDRVLSLAKLAFEGTQIAVKLSGIHWWYK  533

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+ +  +LKK
Sbjct  534  TASHAAELTAGFYNPCNRDGYAAISAMLKK  563


 Score = 80.1 bits (196),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E ++  +  D  +A ADP GL WQVLN AWE G+ IA  NA   +DR 
Sbjct  562  KKHKAALNFSCSELRMVDQQVDFAEALADPEGLVWQVLNAAWEVGIPIASENALPCHDRV  621

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
            T+ ++++ +KP NDP  RH  +F  L R    +   +   E E FVK MHG A
Sbjct  622  TYNKILDKAKPSNDPDGRHFLSFTHL-RLSPLLMERQTFMEFERFVKRMHGEA  673



>ref|XP_004492727.1| PREDICTED: beta-amylase 7-like [Cicer arietinum]
Length=703

 Score =   119 bits (297),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 69/98 (70%), Gaps = 0/98 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD +YGRFF  WY+Q L+DH + +LS A  AF+ + +  K+ GI+WWY 
Sbjct  498  HETGFFCDGGDYDGFYGRFFLNWYSQVLVDHGNRVLSLAKLAFEGSCIAAKLSGIYWWYK  557

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQCDSEVS  449
             +SHAAELTAGYYN  NRDGY+ + E+LK+      ++
Sbjct  558  TASHAAELTAGYYNPCNRDGYAAIMEMLKRNGVSLNIA  595


 Score = 63.2 bits (152),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 52/89 (58%), Gaps = 2/89 (2%)
 Frame = -3

Query  411  QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETFMRLVETSKPRNDP-YRHXSTFF  235
            + +ADP  L WQVLN  W+ G+ +   NA    +R ++ ++++ +KP +DP  RH S+F 
Sbjct  610  EPFADPERLVWQVLNAGWDVGLPVISENALPCLNRVSYNKILDNTKPVSDPDGRHFSSFT  669

Query  234  VLERPWQRIQTAENISELEYFVKCMHGYA  148
             L R    +   +N +E E FVK MHG A
Sbjct  670  YL-RLSSLLMERQNFTEFERFVKRMHGEA  697



>ref|XP_002980052.1| hypothetical protein SELMODRAFT_419538 [Selaginella moellendorffii]
 gb|EFJ18922.1| hypothetical protein SELMODRAFT_419538 [Selaginella moellendorffii]
Length=496

 Score =   112 bits (279),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
             +T FFR+ GDYDSYYGRFF +WY++ LI+H D +L  A  AF+   +  K+ GIHWWY 
Sbjct  295  QETDFFRDGGDYDSYYGRFFLKWYSKVLIEHGDRVLMLAKLAFEGFHIASKVSGIHWWYK  354

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAEL AG+YN  NRDGY  + E+  K
Sbjct  355  TASHAAELAAGFYNPCNRDGYVEIAEMFAK  384


 Score = 68.9 bits (167),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 49/85 (58%), Gaps = 3/85 (4%)
 Frame = -3

Query  474  KHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRET  301
            KH+A++     E  T     D  +A ADP GL WQVLN AW+ G+ +A  NA   YDR+ 
Sbjct  384  KHDASLNFTCVELRTLAQEEDFPEALADPEGLVWQVLNAAWDAGIYVASENALPCYDRDG  443

Query  300  FMRLVETSKPRNDP-YRHXSTFFVL  229
            + +++E +KP  +P  RH S F  L
Sbjct  444  YNKILENAKPSKNPDGRHISAFTYL  468



>ref|XP_009340429.1| PREDICTED: LOW QUALITY PROTEIN: beta-amylase 2, chloroplastic-like 
[Pyrus x bretschneideri]
Length=444

 Score =   102 bits (254),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 65/95 (68%), Gaps = 2/95 (2%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGI--HWW  569
            H+T FFR+ GDYDSYYGRFF  WY++ LIDH D +L+ A  AF+ T +  K+     H +
Sbjct  239  HETGFFRDGGDYDSYYGRFFLNWYSRVLIDHGDRVLALANLAFEGTRIATKVSHFIGHXF  298

Query  568  YLASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQC  464
            Y     +AELTAG+YN+ NRDGY+P+  +LKK + 
Sbjct  299  YTIPLFSAELTAGFYNSCNRDGYAPISAMLKKHEA  333


 Score = 78.2 bits (191),  Expect(2) = 2e-36, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E +   +     +A ADP GL WQVLN AW+  + +A  NA   +DRE
Sbjct  329  KKHEAALNFTCVEMRTLDQHEGFPEALADPEGLVWQVLNAAWDANIPVASENALTCFDRE  388

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP NDP  RH S F  L      I+   N++E E FVK MHG A
Sbjct  389  GYNKILENAKPWNDPDGRHLSAFTYLRLSPVLIEK-HNLTEFERFVKRMHGEA  440



>gb|EMT08980.1| Beta-amylase [Aegilops tauschii]
Length=248

 Score =   130 bits (328),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYDSYYGRFF  WY+  LIDH D +LS AT AFD   +VVKIP I+WW+ 
Sbjct  49   HETGFFCDGGDYDSYYGRFFLNWYSGILIDHVDQVLSLATLAFDGAAIVVKIPSIYWWHR  108

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN +NRDGYSP+F +LKK
Sbjct  109  TASHAAELTAGFYNPTNRDGYSPVFRMLKK  138


 Score = 48.9 bits (115),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 36/55 (65%), Gaps = 0/55 (0%)
 Frame = -3

Query  489  LRSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNA  325
             R  KKH+  +K+V    + + ++  +A+ADP GL WQV+N AW+ G++++  +A
Sbjct  133  FRMLKKHSIILKVVCYGPEFTVQENDEAFADPEGLTWQVMNAAWDHGLSVSVESA  187



>ref|XP_001755209.1| predicted protein [Physcomitrella patens]
 gb|EDQ80153.1| predicted protein [Physcomitrella patens]
Length=468

 Score =   117 bits (293),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 53/88 (60%), Positives = 63/88 (72%), Gaps = 0/88 (0%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLAS  557
            T FFR+ GDYDSYYGRFF  WY++ LI+H D +LS A   F  T +  KI GIHWWY  +
Sbjct  254  TEFFRDGGDYDSYYGRFFLGWYSKTLIEHGDRVLSIAITVFSGTKIAAKISGIHWWYQTA  313

Query  556  SHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            SHAAELT GYYNTS RDGYS + ++  K
Sbjct  314  SHAAELTCGYYNTSFRDGYSSIAQMFAK  341


 Score = 62.4 bits (150),  Expect(2) = 3e-36, Method: Compositional matrix adjust.
 Identities = 38/109 (35%), Positives = 54/109 (50%), Gaps = 3/109 (3%)
 Frame = -3

Query  474  KHNATVKLVSKETQISPRDLV--QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRET  301
            KH AT      E   S ++    +A ADP GL  QV    W  GV++A  NA   YDR  
Sbjct  341  KHKATFNFTCVELLTSEQNKYHPEAMADPEGLVQQVFKSVWGAGVSVASENALACYDRRG  400

Query  300  FMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            + +++E +KPR D  R+  +F  L R    +   +N  E   FV+ +HG
Sbjct  401  YNKILENAKPRIDSERNVVSFTYL-RLNPELMEHDNYLEFTRFVRRLHG  448



>gb|KJB24728.1| hypothetical protein B456_004G158600 [Gossypium raimondii]
 gb|KJB24729.1| hypothetical protein B456_004G158600 [Gossypium raimondii]
Length=703

 Score =   105 bits (263),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + G YD YYGRFF  WY+Q L++H D +LS A  AFD T +  K+PGIHWWY 
Sbjct  498  HETGFFCDGGGYDGYYGRFFLNWYSQVLLNHGDRVLSLAKLAFDGTCITAKLPGIHWWYK  557

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            A+SHAAELTAGYYN  NRDGY+ +  +L+K
Sbjct  558  AASHAAELTAGYYNPCNRDGYTAIATMLQK  587


 Score = 72.4 bits (176),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 57/112 (51%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRD--LVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            +KH A +     E  I  +   L +A ADP GL WQVLN AW+  + IA  NA   +DR 
Sbjct  586  QKHGAALSFSCAEHHILEQQDHLREALADPRGLVWQVLNAAWDVSIPIASENAFLCHDRV  645

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + ++++  KP NDP     + F   R    +   +N  E E FVK MHG A
Sbjct  646  GYNKILDNVKPVNDPDGRHFSSFTYHRLSPLLMERQNFMEFERFVKRMHGEA  697



>gb|KJB24733.1| hypothetical protein B456_004G158600 [Gossypium raimondii]
Length=703

 Score =   105 bits (263),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + G YD YYGRFF  WY+Q L++H D +LS A  AFD T +  K+PGIHWWY 
Sbjct  498  HETGFFCDGGGYDGYYGRFFLNWYSQVLLNHGDRVLSLAKLAFDGTCITAKLPGIHWWYK  557

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            A+SHAAELTAGYYN  NRDGY+ +  +L+K
Sbjct  558  AASHAAELTAGYYNPCNRDGYTAIATMLQK  587


 Score = 72.4 bits (176),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 57/112 (51%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRD--LVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            +KH A +     E  I  +   L +A ADP GL WQVLN AW+  + IA  NA   +DR 
Sbjct  586  QKHGAALSFSCAEHHILEQQDHLREALADPRGLVWQVLNAAWDVSIPIASENAFLCHDRV  645

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + ++++  KP NDP     + F   R    +   +N  E E FVK MHG A
Sbjct  646  GYNKILDNVKPVNDPDGRHFSSFTYHRLSPLLMERQNFMEFERFVKRMHGEA  697



>gb|KJB24739.1| hypothetical protein B456_004G158600 [Gossypium raimondii]
Length=714

 Score =   105 bits (263),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + G YD YYGRFF  WY+Q L++H D +LS A  AFD T +  K+PGIHWWY 
Sbjct  498  HETGFFCDGGGYDGYYGRFFLNWYSQVLLNHGDRVLSLAKLAFDGTCITAKLPGIHWWYK  557

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            A+SHAAELTAGYYN  NRDGY+ +  +L+K
Sbjct  558  AASHAAELTAGYYNPCNRDGYTAIATMLQK  587


 Score = 72.0 bits (175),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 59/111 (53%), Gaps = 4/111 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRD--LVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            +KH A +     E  I  +   L +A ADP GL WQVLN AW+  + IA  NA   +DR 
Sbjct  586  QKHGAALSFSCAEHHILEQQDHLREALADPRGLVWQVLNAAWDVSIPIASENAFLCHDRV  645

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             + ++++  KP NDP  RH S+ F   R    +   +N  E E FVK MHG
Sbjct  646  GYNKILDNVKPVNDPDGRHFSS-FTYHRLSPLLMERQNFMEFERFVKRMHG  695



>ref|XP_007139874.1| hypothetical protein PHAVU_008G065600g [Phaseolus vulgaris]
 gb|ESW11868.1| hypothetical protein PHAVU_008G065600g [Phaseolus vulgaris]
Length=700

 Score =   114 bits (286),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD +YGRFF  WY+Q L+DH + +LS A  AF+ + +  K+ GI+WWY 
Sbjct  495  HETGFFCDGGDYDGFYGRFFLSWYSQVLVDHGNRVLSLAKLAFEGSCVTAKLSGIYWWYK  554

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLK  476
             +SHAAELTAGYYN  NRDGY+ +  +LK
Sbjct  555  TASHAAELTAGYYNPCNRDGYAAILTMLK  583


 Score = 62.8 bits (151),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 50/89 (56%), Gaps = 2/89 (2%)
 Frame = -3

Query  411  QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETFMRLVETSKPRNDP-YRHXSTFF  235
            + +ADP GL WQVLN  W+  + +   N     +R ++ ++++ +KP NDP  RH S+F 
Sbjct  607  ETFADPEGLVWQVLNAGWDVDLPVTSQNGFPCLNRVSYNKVLDHAKPMNDPDGRHFSSFT  666

Query  234  VLERPWQRIQTAENISELEYFVKCMHGYA  148
             L R    +   +N  E E FVK MHG A
Sbjct  667  YL-RLSPVLMERQNFIEFERFVKRMHGEA  694



>ref|XP_003534564.1| PREDICTED: beta-amylase 7-like [Glycine max]
Length=705

 Score =   115 bits (287),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 49/89 (55%), Positives = 65/89 (73%), Gaps = 0/89 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD +YGRFF  WY+Q L+DH + +LS A  AF+ + +  K+ GI+WWY 
Sbjct  499  HETGFFCDGGDYDGFYGRFFLSWYSQVLVDHGNRVLSLAKLAFEGSCIAAKLSGIYWWYK  558

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLK  476
             +SHAAELTAGYYN  NRDGY+ +  +LK
Sbjct  559  TASHAAELTAGYYNPCNRDGYAAIMTMLK  587


 Score = 62.0 bits (149),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 46/88 (52%), Gaps = 0/88 (0%)
 Frame = -3

Query  411  QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETFMRLVETSKPRNDPYRHXSTFFV  232
            + +ADP G+ WQ+LN  W+  + + G N     +R  + ++++ +KP NDP     + F 
Sbjct  612  ETFADPEGIVWQLLNAGWDVDLPVTGQNGFPCLNRVGYNKVLDNAKPMNDPDGRLFSSFT  671

Query  231  LERPWQRIQTAENISELEYFVKCMHGYA  148
              R    +   +N  E E FVK MHG A
Sbjct  672  YLRLSPLLMEQQNFVEFERFVKRMHGEA  699



>ref|XP_002511857.1| Beta-amylase, putative [Ricinus communis]
 gb|EEF50526.1| Beta-amylase, putative [Ricinus communis]
Length=704

 Score =   100 bits (248),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD YYGRFF  WY++ L++H D +LS A  AF+ T +  K+ GIHWWY 
Sbjct  499  HETGFFHDGGDYDGYYGRFFLNWYSRVLVEHGDRVLSLAKLAFEGTQIAAKLSGIHWWYK  558

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN+ NRDGY+ +  +LKK
Sbjct  559  TASHAAELTAGFYNSCNRDGYNAIAMMLKK  588


 Score = 76.3 bits (186),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 61/113 (54%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E ++   P D V+A  DP+GL WQVLN AW+    IA  N    +DR 
Sbjct  587  KKHGAALNFSCSEARMLDQPGDFVEALGDPDGLLWQVLNAAWDVDTLIASENVLPCHDRV  646

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + ++++ +KP N+P  RH  +F  L R    +   +N  E E FVK MHG A
Sbjct  647  GYNKILDNAKPLNNPDGRHFLSFTYL-RLSPLLMERQNFMEFERFVKRMHGEA  698



>ref|XP_011093139.1| PREDICTED: beta-amylase 7 [Sesamum indicum]
Length=707

 Score =   103 bits (257),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 68/90 (76%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD YYGRFF +WY+Q L+DH D +LS A  AF+ T +  K+ GIHWWY 
Sbjct  502  HETGFFCDGGDYDGYYGRFFLKWYSQGLVDHGDRVLSLAKLAFEGTFVAAKLSGIHWWYK  561

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAGYYN+ NRDGY+ +  +LK+
Sbjct  562  TASHAAELTAGYYNSCNRDGYAAIMAMLKR  591


 Score = 72.8 bits (177),  Expect(2) = 3e-35, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 59/113 (52%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            K+H A +        +     D  ++ ADP GL WQVLN AW+  + +A  N+   +DRE
Sbjct  590  KRHGAAICFTCSHMSMVDHHMDFSESLADPEGLTWQVLNAAWDASIPVASENSFPCHDRE  649

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             +  L+E +KP  DP  RH S F  L R    +   +N+ E E FVK MHG A
Sbjct  650  GYNYLLEKAKPIGDPDGRHFSAFTYL-RLNPLLMERQNLVEFEQFVKRMHGEA  701



>ref|XP_004229887.1| PREDICTED: beta-amylase 7 isoform X3 [Solanum lycopersicum]
Length=695

 Score =   100 bits (249),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
             +T FF + GDYD YYGRFF  WY+  LIDHAD +LS A  AFD T +  K+ GIHWWY 
Sbjct  490  QETGFFCDGGDYDGYYGRFFLNWYSHVLIDHADRVLSLAKLAFDGTCIAAKLSGIHWWYK  549

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN SNRDGY  +  +LKK
Sbjct  550  TASHAAELTAGFYNPSNRDGYVVIAAMLKK  579


 Score = 73.9 bits (180),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 54/112 (48%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E ++   P D   A  DP GL WQVLN AW+  + +   NA   +DR 
Sbjct  578  KKHGAALNFKCAEMRMLEEPVDFCDALGDPEGLAWQVLNAAWDVSLPVCSENALLCHDRG  637

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             +  L+E +KP NDP       F   R    +   +N  E E FVK MHG A
Sbjct  638  GYNCLLEKAKPLNDPDGKHIFAFTYLRLSPLLMDGQNYMEFERFVKRMHGEA  689



>ref|XP_010326322.1| PREDICTED: beta-amylase 7 isoform X1 [Solanum lycopersicum]
 ref|XP_010326326.1| PREDICTED: beta-amylase 7 isoform X1 [Solanum lycopersicum]
Length=707

 Score =   100 bits (249),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
             +T FF + GDYD YYGRFF  WY+  LIDHAD +LS A  AFD T +  K+ GIHWWY 
Sbjct  502  QETGFFCDGGDYDGYYGRFFLNWYSHVLIDHADRVLSLAKLAFDGTCIAAKLSGIHWWYK  561

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN SNRDGY  +  +LKK
Sbjct  562  TASHAAELTAGFYNPSNRDGYVVIAAMLKK  591


 Score = 73.9 bits (180),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 54/112 (48%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E ++   P D   A  DP GL WQVLN AW+  + +   NA   +DR 
Sbjct  590  KKHGAALNFKCAEMRMLEEPVDFCDALGDPEGLAWQVLNAAWDVSLPVCSENALLCHDRG  649

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             +  L+E +KP NDP       F   R    +   +N  E E FVK MHG A
Sbjct  650  GYNCLLEKAKPLNDPDGKHIFAFTYLRLSPLLMDGQNYMEFERFVKRMHGEA  701



>ref|XP_010326331.1| PREDICTED: beta-amylase 7 isoform X2 [Solanum lycopersicum]
Length=698

 Score =   100 bits (249),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
             +T FF + GDYD YYGRFF  WY+  LIDHAD +LS A  AFD T +  K+ GIHWWY 
Sbjct  493  QETGFFCDGGDYDGYYGRFFLNWYSHVLIDHADRVLSLAKLAFDGTCIAAKLSGIHWWYK  552

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN SNRDGY  +  +LKK
Sbjct  553  TASHAAELTAGFYNPSNRDGYVVIAAMLKK  582


 Score = 73.9 bits (180),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 42/112 (38%), Positives = 54/112 (48%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E ++   P D   A  DP GL WQVLN AW+  + +   NA   +DR 
Sbjct  581  KKHGAALNFKCAEMRMLEEPVDFCDALGDPEGLAWQVLNAAWDVSLPVCSENALLCHDRG  640

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             +  L+E +KP NDP       F   R    +   +N  E E FVK MHG A
Sbjct  641  GYNCLLEKAKPLNDPDGKHIFAFTYLRLSPLLMDGQNYMEFERFVKRMHGEA  692



>ref|XP_004306787.1| PREDICTED: beta-amylase 7 [Fragaria vesca subsp. vesca]
 ref|XP_011469023.1| PREDICTED: beta-amylase 7 [Fragaria vesca subsp. vesca]
Length=695

 Score =   105 bits (263),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H++ FF + GDYD YYGRFF  WY+Q L+DH D +LS A  AFD T + VK+ GIHWWY 
Sbjct  490  HESGFFCDGGDYDGYYGRFFLNWYSQVLVDHGDRVLSLAKLAFDGTSIAVKLSGIHWWYK  549

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
              SHAAELTAG+YN+ NRDGY+ +  +LKK
Sbjct  550  TPSHAAELTAGFYNSCNRDGYAAIMTMLKK  579


 Score = 68.2 bits (165),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 41/113 (36%), Positives = 60/113 (53%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH  ++ LV  +  +     D  +A  DP GL WQVLN AW+  + ++  NA   ++R 
Sbjct  578  KKHGVSLNLVCTQLPMLDENIDFQEALGDPEGLFWQVLNAAWDVCIPVSSENALLCHNRV  637

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + ++++ SKP  DP  RH S+F  L R    +    N  E + FVK MHG A
Sbjct  638  GYNKILDNSKPLTDPDGRHLSSFTYL-RLSPILMERHNFMEFDRFVKRMHGEA  689



>ref|XP_006339564.1| PREDICTED: beta-amylase 7-like isoform X1 [Solanum tuberosum]
 ref|XP_006339565.1| PREDICTED: beta-amylase 7-like isoform X2 [Solanum tuberosum]
 ref|XP_006339566.1| PREDICTED: beta-amylase 7-like isoform X3 [Solanum tuberosum]
Length=695

 Score =   102 bits (254),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 55/90 (61%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
             +T FF + GDYD YYGRFF  WY+Q +IDHAD +LS A  AFD T +  K+ GIHWWY 
Sbjct  490  QETGFFCDGGDYDGYYGRFFLNWYSQVMIDHADRVLSLAKLAFDGTCIAAKLSGIHWWYK  549

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN SNRDGY  +  +LKK
Sbjct  550  TASHAAELTAGFYNPSNRDGYVAIAAMLKK  579


 Score = 71.2 bits (173),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 41/112 (37%), Positives = 54/112 (48%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E ++     D  +A  DP GL WQVLN AW+  + +   NA   +DR 
Sbjct  578  KKHGAALNFKCAEMRMLEEAVDFCEALGDPEGLAWQVLNAAWDVSLPVCSENALLCHDRG  637

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             +  L+E +KP NDP       F   R    +   +N  E E FVK MHG A
Sbjct  638  GYNCLLEKAKPLNDPDGKHIFAFTYLRLSPLLMDGQNYMEFERFVKRMHGEA  689



>gb|EYU35089.1| hypothetical protein MIMGU_mgv1a002519mg [Erythranthe guttata]
Length=664

 Score = 98.6 bits (244),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD YYGRFF  WY+Q L+DH D +LS A  AF+ T +  K+ G HWWY 
Sbjct  462  HETGFFCDGGDYDGYYGRFFLNWYSQVLVDHGDRVLSLAKLAFEGTCVSAKLSGFHWWYK  521

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN+SNR+GY+ +  +LK+
Sbjct  522  TASHAAELTAGFYNSSNRNGYAAITAMLKR  551


 Score = 75.1 bits (183),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 44/111 (40%), Positives = 63/111 (57%), Gaps = 3/111 (3%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            K+H A +     ET I   DL Q+ +DP GL WQV++GAW+  + +A  N+   +DR+ +
Sbjct  550  KRHKAALCFTCSETSID-MDLSQSLSDPEGLSWQVVSGAWDACIPVASENSFPCHDRQGY  608

Query  297  MRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
              L+E +KP + P  RH S F  L R    +   +N+ E E FVK MHG A
Sbjct  609  SYLLERAKPMSHPDGRHFSAFTYL-RLSPLLTERQNLIEFERFVKRMHGEA  658



>ref|XP_009632039.1| PREDICTED: beta-amylase 7-like isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009632041.1| PREDICTED: beta-amylase 7-like isoform X1 [Nicotiana tomentosiformis]
Length=707

 Score =   103 bits (258),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
             +T FF + GDYD YYGRFF  WY+Q L+DHAD +LS A  AFD T +  K+ GIHWWY 
Sbjct  491  QETGFFCDGGDYDGYYGRFFLNWYSQVLVDHADRVLSLAKLAFDGTCIAAKLSGIHWWYK  550

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAG+YN SNRDGY  +  +LKK
Sbjct  551  TSSHAAELTAGFYNPSNRDGYVAIAAMLKK  580


 Score = 67.0 bits (162),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 53/112 (47%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E  +  +  D  +A  DP GL WQVLN AW+  + +   NA   +DR 
Sbjct  579  KKHGAALNFKCAEMSMLEQAVDFSEALGDPEGLAWQVLNAAWDVSLPVCSENALLCHDRG  638

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             +  L+E +K  NDP       F   R    +   +N  E E FVK MHG A
Sbjct  639  GYNCLLEKAKLLNDPDGKHIFAFTYLRLGPLLIDGQNFMEFERFVKRMHGEA  690



>ref|XP_012083397.1| PREDICTED: beta-amylase 7 isoform X1 [Jatropha curcas]
 gb|KDP28631.1| hypothetical protein JCGZ_14402 [Jatropha curcas]
Length=701

 Score = 98.2 bits (243),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD YYGRFF  WY++ L++H D +LS A  AF+ T +  K+ GIHWWY 
Sbjct  496  HETGFFCDGGDYDGYYGRFFLNWYSRVLVEHGDRVLSLAKLAFEGTQIAAKLSGIHWWYK  555

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SH+AELTAG+YN SNRDGY+ +  +LKK
Sbjct  556  TASHSAELTAGFYNPSNRDGYAAIAIMLKK  585


 Score = 72.4 bits (176),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 62/113 (55%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E ++  +  +  +A ADP+GL WQVLN AW+  + IA  NA   +DR 
Sbjct  584  KKHGAALNFSCSELRMLDQQVEFAEALADPDGLLWQVLNTAWDVNIPIASENALPCHDRV  643

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + ++++ +KP N+P  RH  +F  L R    +    N  E E FVK MHG A
Sbjct  644  GYNKILDNAKPLNNPDGRHFLSFTYL-RLSPLLMERHNFMEFERFVKRMHGEA  695



>ref|XP_009632042.1| PREDICTED: beta-amylase 7-like isoform X2 [Nicotiana tomentosiformis]
Length=696

 Score =   103 bits (257),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
             +T FF + GDYD YYGRFF  WY+Q L+DHAD +LS A  AFD T +  K+ GIHWWY 
Sbjct  491  QETGFFCDGGDYDGYYGRFFLNWYSQVLVDHADRVLSLAKLAFDGTCIAAKLSGIHWWYK  550

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAG+YN SNRDGY  +  +LKK
Sbjct  551  TSSHAAELTAGFYNPSNRDGYVAIAAMLKK  580


 Score = 67.0 bits (162),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 53/112 (47%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E  +  +  D  +A  DP GL WQVLN AW+  + +   NA   +DR 
Sbjct  579  KKHGAALNFKCAEMSMLEQAVDFSEALGDPEGLAWQVLNAAWDVSLPVCSENALLCHDRG  638

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             +  L+E +K  NDP       F   R    +   +N  E E FVK MHG A
Sbjct  639  GYNCLLEKAKLLNDPDGKHIFAFTYLRLGPLLIDGQNFMEFERFVKRMHGEA  690



>ref|XP_009772614.1| PREDICTED: beta-amylase 7 [Nicotiana sylvestris]
Length=694

 Score =   103 bits (257),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/90 (62%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
             +T FF + GDYD YYGRFF  WY+Q L+DHAD +LS A  AFD T +  K+ GIHWWY 
Sbjct  489  QETGFFCDGGDYDGYYGRFFLNWYSQVLVDHADRVLSLAKLAFDGTCIAAKLSGIHWWYK  548

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAG+YN SNRDGY  +  +LKK
Sbjct  549  TSSHAAELTAGFYNPSNRDGYVAIAAMLKK  578


 Score = 67.0 bits (162),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 40/112 (36%), Positives = 53/112 (47%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E  +  +  D  +A  DP GL WQVLN AW+  + +   NA   +DR 
Sbjct  577  KKHGAALNFKCAEMSMLEQAVDFSEALGDPEGLAWQVLNAAWDVSLPVCSENALLCHDRG  636

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             +  L+E +K  NDP       F   R    +   +N  E E FVK MHG A
Sbjct  637  GYNCLLEKAKLLNDPDGKHIFAFTYLRLGPLLIDGQNFMEFERFVKRMHGEA  688



>ref|XP_002451472.1| hypothetical protein SORBIDRAFT_04g002450 [Sorghum bicolor]
 gb|EES04448.1| hypothetical protein SORBIDRAFT_04g002450 [Sorghum bicolor]
Length=566

 Score =   131 bits (329),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYDSYYGRFF  WY+  L+DH D +LS A+ AFD   +VVK+P I+WWY 
Sbjct  441  HETGFFCDGGDYDSYYGRFFLNWYSGVLMDHVDHVLSLASLAFDGAEIVVKVPSIYWWYR  500

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN +NRDGYSP+F +LKK
Sbjct  501  TASHAAELTAGFYNPTNRDGYSPVFRMLKK  530


 Score = 36.6 bits (83),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 24/39 (62%), Gaps = 0/39 (0%)
 Frame = -3

Query  489  LRSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQV  373
             R  KKH+  +KLV    + + ++  +A+ADP GL WQV
Sbjct  525  FRMLKKHSVILKLVCYGPEFTIQENDEAFADPEGLTWQV  563



>ref|XP_012083398.1| PREDICTED: beta-amylase 7 isoform X2 [Jatropha curcas]
Length=698

 Score = 98.2 bits (243),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD YYGRFF  WY++ L++H D +LS A  AF+ T +  K+ GIHWWY 
Sbjct  496  HETGFFCDGGDYDGYYGRFFLNWYSRVLVEHGDRVLSLAKLAFEGTQIAAKLSGIHWWYK  555

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SH+AELTAG+YN SNRDGY+ +  +LKK
Sbjct  556  TASHSAELTAGFYNPSNRDGYAAIAIMLKK  585


 Score = 68.9 bits (167),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 60/110 (55%), Gaps = 4/110 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH A +     E ++  +  +  +A ADP+GL WQVLN AW+  + IA  NA   +DR 
Sbjct  584  KKHGAALNFSCSELRMLDQQVEFAEALADPDGLLWQVLNTAWDVNIPIASENALPCHDRV  643

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMH  157
             + ++++ +KP N+P  RH  +F  L R    +    N  E E FVK MH
Sbjct  644  GYNKILDNAKPLNNPDGRHFLSFTYL-RLSPLLMERHNFMEFERFVKRMH  692



>emb|CDP08819.1| unnamed protein product [Coffea canephora]
Length=696

 Score = 93.6 bits (231),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 49/90 (54%), Positives = 64/90 (71%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD YYGRFF  WY+Q LI+H D +LS A   F+ T + VK+ G  WWY 
Sbjct  491  HETGFFCDGGDYDGYYGRFFLNWYSQVLIEHGDRVLSLANLVFEGTCIAVKLSGAPWWYK  550

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHA ELT+G+YN+ NRDGY+ +  +LKK
Sbjct  551  TASHATELTSGFYNSCNRDGYAAIVAMLKK  580


 Score = 72.0 bits (175),  Expect(2) = 5e-32, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 58/114 (51%), Gaps = 6/114 (5%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH   +        +  +  D  +A ADP GL WQVLN AW+  V +A  NA   +DRE
Sbjct  579  KKHGVILNFTCAGMSMLNQNVDFSEALADPEGLTWQVLNTAWDVCVPVASENALPCHDRE  638

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLE-RPWQRIQTAENISELEYFVKCMHGYA  148
             +  L E +KP NDP  RH  +F  L  RP   +    N  E E FVK MHG A
Sbjct  639  GYNYLSEKAKPTNDPDGRHLFSFTYLRLRPL--LMERHNFLEFERFVKRMHGEA  690



>ref|XP_008458240.1| PREDICTED: beta-amylase 7-like isoform X1 [Cucumis melo]
 ref|XP_008458241.1| PREDICTED: beta-amylase 7-like isoform X1 [Cucumis melo]
 ref|XP_008458242.1| PREDICTED: beta-amylase 7-like isoform X1 [Cucumis melo]
 ref|XP_008458243.1| PREDICTED: beta-amylase 7-like isoform X1 [Cucumis melo]
Length=698

 Score =   100 bits (250),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD YYGRFF  WY++ L+DH D +L  A  AF+ T +V K+ GIHWWY 
Sbjct  493  HETGFFCDGGDYDGYYGRFFLNWYSKVLVDHGDRVLYLAKLAFEGTRIVAKLSGIHWWYK  552

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+ +  +LKK
Sbjct  553  TASHAAELTAGFYNPCNRDGYAAIMAMLKK  582


 Score = 64.3 bits (155),  Expect(2) = 7e-32, Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 54/112 (48%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH+A++     E  +     D   + +DP  + WQV N AW+ GV +   N     DR 
Sbjct  581  KKHSASLNFTPAEFHMLHQREDFSNSLSDPEAVVWQVTNAAWDVGVEVVSENPLPFLDRV  640

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + ++++ +KP  DP     + F+  R    +   +N  E E FVK MHG A
Sbjct  641  GYNKILDNAKPLADPDGRYLSSFIYHRLSPLLLERQNFMEFERFVKRMHGEA  692



>gb|EMS60553.1| Beta-amylase 8 [Triticum urartu]
Length=634

 Score =   115 bits (287),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 71/130 (55%), Gaps = 40/130 (31%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVK---------  590
            H+T FF + GDYDSYYGRFF  WY+  LIDH D +LS AT AFD   +VVK         
Sbjct  437  HETGFFCDGGDYDSYYGRFFLNWYSGILIDHVDQVLSLATLAFDGAAIVVKFPMYITSNF  496

Query  589  -------------------------------IPGIHWWYLASSHAAELTAGYYNTSNRDG  503
                                           IP I+WWY  +SHAAELTAG+YN +NRDG
Sbjct  497  ARNGYPLSSFFFILYSGLHFCSKQPMIAQKLIPSIYWWYRTASHAAELTAGFYNPTNRDG  556

Query  502  YSPLFEVLKK  473
            YSP+F +LKK
Sbjct  557  YSPVFRMLKK  566


 Score = 47.0 bits (110),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 48/117 (41%), Gaps = 46/117 (39%)
 Frame = -3

Query  489  LRSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYD  310
             R  KKH+  +K+V    + + ++  +A+ADP GL WQV+N AW+ G++           
Sbjct  561  FRMLKKHSIILKVVCYGPEFTVQENDEAFADPEGLTWQVMNAAWDHGLS-----------  609

Query  309  RETFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA*QS  139
            R+                                      SELE FVKCMHG A Q+
Sbjct  610  RDV-----------------------------------CFSELETFVKCMHGEATQN  631



>ref|XP_011656338.1| PREDICTED: beta-amylase 7-like [Cucumis sativus]
 gb|KGN45653.1| hypothetical protein Csa_6G003450 [Cucumis sativus]
Length=698

 Score = 99.4 bits (246),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD YYGRFF  WY++ L+DH D +L  A  AF+ + +V K+ GIHWWY 
Sbjct  493  HETGFFCDGGDYDGYYGRFFLNWYSKVLVDHGDRVLYLAKLAFEGSRIVAKLSGIHWWYK  552

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN  NRDGY+ +  +LKK
Sbjct  553  TASHAAELTAGFYNPCNRDGYAAIMTMLKK  582


 Score = 62.0 bits (149),  Expect(2) = 9e-31, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 53/112 (47%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQI--SPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH+A++     E  +     D   + +DP  + WQV N AW+  V +   N     DR 
Sbjct  581  KKHSASLNFTPAEFHMLHQREDFSNSLSDPEAVVWQVTNAAWDVNVEVVSENPLPFLDRV  640

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + ++++ +KP  DP     + F+  R    +   +N  E E FVK MHG A
Sbjct  641  GYNKILDNAKPLADPDGRYLSSFIYHRLSPLLLERQNFMEFERFVKRMHGEA  692



>gb|EPS60387.1| hypothetical protein M569_14415, partial [Genlisea aurea]
Length=617

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 71/106 (67%), Gaps = 0/106 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD +YGRFF  WY+  L+DHAD ILS A   F ET +V K+PGIHWWY 
Sbjct  424  HETGFFCDGGDYDGHYGRFFLGWYSGVLLDHADRILSLARLVFGETRIVAKLPGIHWWYK  483

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQCDSEVSQQGNTDFT  425
             +SHAAELTAGY N+ NRDGY     VLKK    + +   G  DF+
Sbjct  484  TASHAAELTAGYNNSCNRDGYGAAMAVLKKHGTSALLFPNGEMDFS  529


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 59/128 (46%), Gaps = 20/128 (16%)
 Frame = -3

Query  519  HQTEMAILHSLRSSKKHNATVKLV-SKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVA  343
            +   MA+L      KKH  +  L  + E   S     ++ ADP+GL WQV N  W+  V 
Sbjct  504  YGAAMAVL------KKHGTSALLFPNGEMDFSEE---ESLADPDGLAWQVTNCGWDSEVE  554

Query  342  IAGHNA----PGGYDRETFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELE  178
            +   ++     GGY       LVE +KP   P  +H S+F  L      I    N++E E
Sbjct  555  MVLESSLPSNGGGYG-----YLVEKAKPLGHPDGKHFSSFTFLRLNPLVIMERHNLNEFE  609

Query  177  YFVKCMHG  154
             FV+ MHG
Sbjct  610  SFVRKMHG  617



>gb|AHC32020.1| beta-amylase 2 [Camellia sinensis]
Length=556

 Score =   126 bits (317),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 80/127 (63%), Gaps = 7/127 (6%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+TRFF + GDYDSYYGRFF  WY+Q L+DH D +L+ A  AF+ T +  K+ GIHWWY 
Sbjct  333  HETRFFCDGGDYDSYYGRFFLNWYSQVLVDHGDRVLALANLAFEGTCIATKLSGIHWWYK  392

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQ------CDSEVSQQGNTDFTPRSCSSIC  401
             +SHA ELTAG+YN  NRDGY+P+  +LKK +      C    +   N DF P + +   
Sbjct  393  TASHATELTAGFYNPCNRDGYAPIATMLKKHETALNFTCVELRTMDQNEDF-PEALADPE  451

Query  400  RSQWLVL  380
               W VL
Sbjct  452  GLVWQVL  458


 Score = 80.9 bits (198),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 59/113 (52%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH   +     E  T     D  +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  421  KKHETALNFTCVELRTMDQNEDFPEALADPEGLVWQVLNAAWDVSIPVASENALPCYDRE  480

Query  303  TFMRLVETSKPRNDPY-RHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP NDP  RH S F  L R    +    N  E E FVK MHG A
Sbjct  481  GYNKILENAKPLNDPDGRHLSAFTYL-RLSPVLMENHNFVEFERFVKKMHGEA  532



>ref|XP_006287427.1| hypothetical protein CARUB_v10000631mg [Capsella rubella]
 gb|EOA20325.1| hypothetical protein CARUB_v10000631mg [Capsella rubella]
Length=463

 Score =   124 bits (312),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H T FFR+ GDYDSYYGRFF  WY++ LIDH D +L  A  AF+   +  K+ GIHWWY 
Sbjct  334  HGTGFFRDGGDYDSYYGRFFLNWYSRVLIDHGDRVLGMANLAFEGNCIAAKLSGIHWWYK  393

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELTAG+YN+SNRDGY P+  + KK
Sbjct  394  TASHAAELTAGFYNSSNRDGYGPIAAMFKK  423



>gb|KJB41325.1| hypothetical protein B456_007G099100 [Gossypium raimondii]
Length=618

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF ++GDYD YYGRFF  WY+Q LI+H D++LS A  AF+ + +  K+PGIHWWY 
Sbjct  492  HETGFFCDEGDYDGYYGRFFLNWYSQLLINHGDLVLSLAKLAFEGSCIAAKLPGIHWWYK  551

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAG+YN  NRDGY  +  +L K
Sbjct  552  TSSHAAELTAGFYNPCNRDGYIAIAAMLHK  581



>ref|NP_001131295.1| uncharacterized protein LOC100192608 [Zea mays]
 gb|ACF79637.1| unknown [Zea mays]
Length=166

 Score = 79.7 bits (195),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 42/110 (38%), Positives = 60/110 (55%), Gaps = 2/110 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLV--QAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KK++A +     E +   +  V  +A+ADP GL WQVLN AW+ G+ +A  NA   YDR+
Sbjct  53   KKYDAALNFTCVELRTMDQHEVYPEAFADPEGLVWQVLNAAWDAGIQVASENALPCYDRD  112

Query  303  TFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
             F +++E +KP NDP       F   R  + +    N  E E F+K MHG
Sbjct  113  GFNKILENAKPLNDPDGRHLLGFTYLRLGKDLFERPNFFEFERFIKRMHG  162


 Score = 73.6 bits (179),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 32/52 (62%), Positives = 40/52 (77%), Gaps = 0/52 (0%)
 Frame = -2

Query  628  ATEAFDETPLVVKIPGIHWWYLASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            A  AF+ T + VK+ G+HWWY  +SHAAELTAG+YN  NRDGY+P+  VLKK
Sbjct  3    ARLAFEGTNIAVKVSGVHWWYKTASHAAELTAGFYNPCNRDGYAPIAAVLKK  54



>gb|KJB41327.1| hypothetical protein B456_007G099100 [Gossypium raimondii]
Length=671

 Score =   123 bits (309),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF ++GDYD YYGRFF  WY+Q LI+H D++LS A  AF+ + +  K+PGIHWWY 
Sbjct  466  HETGFFCDEGDYDGYYGRFFLNWYSQLLINHGDLVLSLAKLAFEGSCIAAKLPGIHWWYK  525

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAG+YN  NRDGY  +  +L K
Sbjct  526  TSSHAAELTAGFYNPCNRDGYIAIAAMLHK  555


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 64/122 (52%), Gaps = 10/122 (8%)
 Frame = -3

Query  504  AILHSLRSSKKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGH  331
            A+LH      KH A +     E Q   +  DL +A A+P GL WQVLN AWE  + +   
Sbjct  551  AMLH------KHGAALNFARAELQFLEQREDLQEALANPQGLVWQVLNAAWETCITVVSE  604

Query  330  NAPGGYDRETFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            NA   +DR  + +++E  KP NDP  RH S+F  L R    +   +N  E E FVK MHG
Sbjct  605  NAFVCHDRVGYNKILENVKPVNDPDGRHFSSFTYL-RLTPLLMERQNFMEFERFVKRMHG  663

Query  153  YA  148
             A
Sbjct  664  EA  665



>gb|KJB41323.1| hypothetical protein B456_007G099100 [Gossypium raimondii]
Length=697

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF ++GDYD YYGRFF  WY+Q LI+H D++LS A  AF+ + +  K+PGIHWWY 
Sbjct  492  HETGFFCDEGDYDGYYGRFFLNWYSQLLINHGDLVLSLAKLAFEGSCIAAKLPGIHWWYK  551

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAG+YN  NRDGY  +  +L K
Sbjct  552  TSSHAAELTAGFYNPCNRDGYIAIAAMLHK  581


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 64/122 (52%), Gaps = 10/122 (8%)
 Frame = -3

Query  504  AILHSLRSSKKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGH  331
            A+LH      KH A +     E Q   +  DL +A A+P GL WQVLN AWE  + +   
Sbjct  577  AMLH------KHGAALNFARAELQFLEQREDLQEALANPQGLVWQVLNAAWETCITVVSE  630

Query  330  NAPGGYDRETFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            NA   +DR  + +++E  KP NDP  RH S+F  L R    +   +N  E E FVK MHG
Sbjct  631  NAFVCHDRVGYNKILENVKPVNDPDGRHFSSFTYL-RLTPLLMERQNFMEFERFVKRMHG  689

Query  153  YA  148
             A
Sbjct  690  EA  691



>gb|KJB41326.1| hypothetical protein B456_007G099100 [Gossypium raimondii]
Length=699

 Score =   123 bits (308),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/90 (59%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF ++GDYD YYGRFF  WY+Q LI+H D++LS A  AF+ + +  K+PGIHWWY 
Sbjct  492  HETGFFCDEGDYDGYYGRFFLNWYSQLLINHGDLVLSLAKLAFEGSCIAAKLPGIHWWYK  551

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAG+YN  NRDGY  +  +L K
Sbjct  552  TSSHAAELTAGFYNPCNRDGYIAIAAMLHK  581


 Score = 75.5 bits (184),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 48/120 (40%), Positives = 63/120 (53%), Gaps = 10/120 (8%)
 Frame = -3

Query  504  AILHSLRSSKKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGH  331
            A+LH      KH A +     E Q   +  DL +A A+P GL WQVLN AWE  + +   
Sbjct  577  AMLH------KHGAALNFARAELQFLEQREDLQEALANPQGLVWQVLNAAWETCITVVSE  630

Query  330  NAPGGYDRETFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            NA   +DR  + +++E  KP NDP  RH S+F  L R    +   +N  E E FVK MHG
Sbjct  631  NAFVCHDRVGYNKILENVKPVNDPDGRHFSSFTYL-RLTPLLMERQNFMEFERFVKRMHG  689



>gb|KJB41331.1| hypothetical protein B456_007G099200 [Gossypium raimondii]
Length=536

 Score =   121 bits (303),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 69/90 (77%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FFR+ GDYDSYYGRFF  WY+Q L+DH D +L+ A  AF+ T +  K+ GIHWWY 
Sbjct  330  HETGFFRDGGDYDSYYGRFFLNWYSQILVDHGDRVLALANLAFEGTCIAAKLSGIHWWYK  389

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAELT+G+YN ++RDGY+ +  +LKK
Sbjct  390  TASHAAELTSGFYNPAHRDGYALIAAMLKK  419


 Score = 79.3 bits (194),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 66/128 (52%), Gaps = 6/128 (5%)
 Frame = -3

Query  522  THQTEMAILHSLRSSKKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKG  349
             H+   A++ ++   KKH   +     E  T        +A ADP GL WQVLN AW+  
Sbjct  405  AHRDGYALIAAML--KKHGVALNFTCVELRTLNQHEGFPEAMADPEGLVWQVLNAAWDVS  462

Query  348  VAIAGHNAPGGYDRETFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYF  172
            + +A  NA   YDRE + +++E +KPRNDP  RH S F  L      I+   N  E E F
Sbjct  463  IPVASENALPCYDREGYNKILENAKPRNDPDGRHLSAFTYLRLNPALIER-RNFVEFERF  521

Query  171  VKCMHGYA  148
            VK MHG A
Sbjct  522  VKGMHGEA  529



>gb|KJB24734.1| hypothetical protein B456_004G158600 [Gossypium raimondii]
 gb|KJB24735.1| hypothetical protein B456_004G158600 [Gossypium raimondii]
 gb|KJB24736.1| hypothetical protein B456_004G158600 [Gossypium raimondii]
Length=658

 Score =   106 bits (264),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 67/90 (74%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + G YD YYGRFF  WY+Q L++H D +LS A  AFD T +  K+PGIHWWY 
Sbjct  498  HETGFFCDGGGYDGYYGRFFLNWYSQVLLNHGDRVLSLAKLAFDGTCITAKLPGIHWWYK  557

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            A+SHAAELTAGYYN  NRDGY+ +  +L+K
Sbjct  558  AASHAAELTAGYYNPCNRDGYTAIATMLQK  587


 Score = 45.8 bits (107),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 32/59 (54%), Gaps = 2/59 (3%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRD--LVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDR  307
            +KH A +     E  I  +   L +A ADP GL WQVLN AW+  + IA  NA   +DR
Sbjct  586  QKHGAALSFSCAEHHILEQQDHLREALADPRGLVWQVLNAAWDVSIPIASENAFLCHDR  644



>ref|XP_007220222.1| hypothetical protein PRUPE_ppa002199mg [Prunus persica]
 gb|EMJ21421.1| hypothetical protein PRUPE_ppa002199mg [Prunus persica]
Length=618

 Score =   122 bits (305),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYDSYYGRFF  WY++ L+DH D +LS A  AFD T +  K+ G+HWWY 
Sbjct  495  HETGFFCDGGDYDSYYGRFFLNWYSRVLVDHGDRVLSLAKLAFDGTCIAAKLSGLHWWYK  554

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAEL AG+YN  NRDGY+ +  +LKK
Sbjct  555  TASHAAELAAGFYNPCNRDGYAAIVTMLKK  584



>ref|XP_006491097.1| PREDICTED: beta-amylase 2, chloroplastic-like isoform X3 [Citrus 
sinensis]
 gb|KDO86152.1| hypothetical protein CISIN_1g008542mg [Citrus sinensis]
Length=511

 Score = 80.1 bits (196),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 60/113 (53%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH   +     E +   +  D  +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  380  KKHGVALNFTCVELRTVDQHEDFPEALADPEGLVWQVLNAAWDVSILVASENALPCYDRE  439

Query  303  TFMRLVETSKPRNDPY-RHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP NDP  RH S F  L R    +    N  E E FVK MHG A
Sbjct  440  GYNKILENAKPLNDPDGRHLSAFTYL-RLSPVLTDGHNFIEFERFVKRMHGEA  491


 Score = 71.6 bits (174),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = -2

Query  631  AATEAFDETPLVVKIPGIHWWYLASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            A   AF+ T +  K+ GIHWWY  +SHAAELTAG+YN SNRDGY+P+  +LKK
Sbjct  329  ARGPAFEGTCISAKLSGIHWWYKTASHAAELTAGFYNPSNRDGYAPIAAMLKK  381



>ref|XP_008338860.1| PREDICTED: beta-amylase 7 isoform X1 [Malus domestica]
 ref|XP_008338861.1| PREDICTED: beta-amylase 7 isoform X1 [Malus domestica]
Length=706

 Score =   122 bits (306),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            ++T FF E GDYD YYGRFF  WY++ L+DH D +LS A  AFD T +  K+ G+H WY 
Sbjct  498  NETSFFSEGGDYDGYYGRFFLNWYSRVLVDHGDRVLSLAKLAFDGTCIAAKLSGLHXWYK  557

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQCDSEVS  449
             +SHAAELTAG+YN+ NRDGY+P+  +LKK +   +++
Sbjct  558  TASHAAELTAGFYNSCNRDGYAPIMTMLKKHEATVKLA  595


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH ATVKL   E  +  +  +  +A  D  GL WQVLN AW+  V ++  NA   +DR 
Sbjct  586  KKHEATVKLACTELHVLDQHEEFQEALGDSEGLFWQVLNAAWDVCVPVSSENALACHDRI  645

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
            ++ ++++ SKP  DP  RH S+F  L R    +   +N  E E FV+ MHG A
Sbjct  646  SYNKILDNSKPLTDPDGRHLSSFTYL-RLSPLLMERQNFMEFERFVRRMHGEA  697



>ref|XP_006491096.1| PREDICTED: beta-amylase 2, chloroplastic-like isoform X2 [Citrus 
sinensis]
Length=530

 Score = 80.1 bits (196),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 60/113 (53%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH   +     E +   +  D  +A ADP GL WQVLN AW+  + +A  NA   YDRE
Sbjct  399  KKHGVALNFTCVELRTVDQHEDFPEALADPEGLVWQVLNAAWDVSILVASENALPCYDRE  458

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
             + +++E +KP NDP  RH S F  L R    +    N  E E FVK MHG A
Sbjct  459  GYNKILENAKPLNDPDGRHLSAFTYL-RLSPVLTDGHNFIEFERFVKRMHGEA  510


 Score = 71.2 bits (173),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 31/49 (63%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = -2

Query  619  AFDETPLVVKIPGIHWWYLASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            AF+ T +  K+ GIHWWY  +SHAAELTAG+YN SNRDGY+P+  +LKK
Sbjct  352  AFEGTCISAKLSGIHWWYKTASHAAELTAGFYNPSNRDGYAPIAAMLKK  400



>ref|XP_008338862.1| PREDICTED: beta-amylase 7 isoform X2 [Malus domestica]
Length=688

 Score =   122 bits (306),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            ++T FF E GDYD YYGRFF  WY++ L+DH D +LS A  AFD T +  K+ G+H WY 
Sbjct  480  NETSFFSEGGDYDGYYGRFFLNWYSRVLVDHGDRVLSLAKLAFDGTCIAAKLSGLHXWYK  539

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQCDSEVS  449
             +SHAAELTAG+YN+ NRDGY+P+  +LKK +   +++
Sbjct  540  TASHAAELTAGFYNSCNRDGYAPIMTMLKKHEATVKLA  577


 Score = 75.5 bits (184),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 63/113 (56%), Gaps = 4/113 (4%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRE  304
            KKH ATVKL   E  +  +  +  +A  D  GL WQVLN AW+  V ++  NA   +DR 
Sbjct  568  KKHEATVKLACTELHVLDQHEEFQEALGDSEGLFWQVLNAAWDVCVPVSSENALACHDRI  627

Query  303  TFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
            ++ ++++ SKP  DP  RH S+F  L R    +   +N  E E FV+ MHG A
Sbjct  628  SYNKILDNSKPLTDPDGRHLSSFTYL-RLSPLLMERQNFMEFERFVRRMHGEA  679



>ref|XP_009384530.1| PREDICTED: beta-amylase 8 [Musa acuminata subsp. malaccensis]
Length=694

 Score =   122 bits (305),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 74/110 (67%), Gaps = 7/110 (6%)
 Frame = -2

Query  739  QTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYLA  560
            +T FF ++GDYDSYYGRFF  WY Q LIDHAD ILS    A + T ++ KIP I+WWY  
Sbjct  490  ETGFFCDKGDYDSYYGRFFLHWYAQTLIDHADQILSLTNLALEGTEIIAKIPAIYWWYRT  549

Query  559  SSHAAELTAGYYNTSNRDGYSPLFEVLKKTQ-------CDSEVSQQGNTD  431
            +SHAAELTAG++N +N+DGY+ +F +LKK         C  + S Q N +
Sbjct  550  ASHAAELTAGFHNPTNQDGYASIFNMLKKHSVTIKFMCCGPQASMQENEE  599


 Score = 90.5 bits (223),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/112 (41%), Positives = 67/112 (60%), Gaps = 2/112 (2%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH+ T+K +    Q S ++  +A AD   L WQVLN AWE G+ +A  +      RET+
Sbjct  577  KKHSVTIKFMCCGPQASMQENEEALADAEALSWQVLNTAWESGLRVAAQSTLPCDVRETY  636

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQR--IQTAENISELEYFVKCMHGYA  148
             +++E +KPRNDP RH  +FF  ++      IQ    +S+L+ F+KCMHG A
Sbjct  637  TKILEIAKPRNDPDRHLLSFFTFQQQLSPIIIQREMFLSDLDNFIKCMHGEA  688



>ref|NP_001175243.1| Os07g0543200 [Oryza sativa Japonica Group]
 dbj|BAH93971.1| Os07g0543200 [Oryza sativa Japonica Group]
Length=1429

 Score = 98.6 bits (244),  Expect(2) = 5e-27, Method: Composition-based stats.
 Identities = 45/91 (49%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = -2

Query  739   QTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAF--DETPLVVKIPGIHWWY  566
             +TRFF + G Y +  G+FF  WY+  LI H D IL  A + F      L +KI GIHWWY
Sbjct  1183  KTRFFADNGTYVTEKGKFFLTWYSNKLIKHGDKILDEANKVFLGCRVQLAIKISGIHWWY  1242

Query  565   LASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
                +HAAELTAGYYN  NRDGY  +  +L +
Sbjct  1243  RVPNHAAELTAGYYNLDNRDGYRTIARMLTR  1273


 Score = 50.4 bits (119),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 51/114 (45%), Gaps = 5/114 (4%)
 Frame = -3

Query  486   RSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDR  307
             R   +H A V     E + S +   +A + P  L  QVL+  W +G+ +A  NA G YD 
Sbjct  1269  RMLTRHRACVNFTCAEMRDSEQS-SEAKSAPEELVQQVLSAGWREGLHVACENALGRYDA  1327

Query  306   ETFMRLVETSKP----RNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMH  157
               +  ++  S+P    +N P  H    F   R    +   +N S  + FVK MH
Sbjct  1328  TAYNTILRNSRPTGINKNGPPEHKLFGFTYLRLSDELLEGQNYSTFKTFVKRMH  1381



>ref|XP_010105161.1| Beta-amylase 8 [Morus notabilis]
 gb|EXC03995.1| Beta-amylase 8 [Morus notabilis]
Length=341

 Score =   116 bits (290),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 70/108 (65%), Gaps = 0/108 (0%)
 Frame = -3

Query  477  KKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDRETF  298
            KKH  TVK V    Q+S +D  +  ADP GL WQV N AW++G+ IAG N    Y+RE +
Sbjct  75   KKHGVTVKFVCSGLQMSTQDSNEFLADPEGLSWQVCNSAWDRGLTIAGENLLSCYEREGY  134

Query  297  MRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            MR+VE +KPRNDP R   +FFV ++P   +Q     SEL+YF+K MHG
Sbjct  135  MRIVEMAKPRNDPDRRHFSFFVYQQPSPLVQGTMCFSELDYFIKSMHG  182


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 51/85 (60%), Gaps = 13/85 (15%)
 Frame = -2

Query  589  IPGIHWWYLASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQ------CDS-EVSQQGNTD  431
            +  ++WWY   SHAAELT+GYYN +N+DGYSP+FEVLKK        C   ++S Q + +
Sbjct  38   VNAVYWWYKTPSHAAELTSGYYNPTNQDGYSPVFEVLKKHGVTVKFVCSGLQMSTQDSNE  97

Query  430  FT--PRSCS-SICRSQW---LVLAG  374
            F   P   S  +C S W   L +AG
Sbjct  98   FLADPEGLSWQVCNSAWDRGLTIAG  122



>ref|XP_002320793.2| hypothetical protein POPTR_0014s07940g [Populus trichocarpa]
 ref|XP_006375337.1| hypothetical protein POPTR_0014s07940g [Populus trichocarpa]
 gb|EEE99108.2| hypothetical protein POPTR_0014s07940g [Populus trichocarpa]
 gb|ERP53134.1| hypothetical protein POPTR_0014s07940g [Populus trichocarpa]
Length=680

 Score =   118 bits (295),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/90 (58%), Positives = 65/90 (72%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + G+YD YYGRFF  WY + L+DH D +LS A  AF+ T + VK+ GIHWWY 
Sbjct  475  HETGFFCDGGEYDGYYGRFFLNWYARILVDHGDRVLSLAKLAFEGTRIAVKLLGIHWWYK  534

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             SSHAAELTAG+YN  N DGY+ +  +LKK
Sbjct  535  TSSHAAELTAGFYNPCNHDGYAAIVAMLKK  564


 Score = 78.2 bits (191),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 67/128 (52%), Gaps = 7/128 (5%)
 Frame = -3

Query  522  THQTEMAILHSLRSSKKHNATVKLVSKE--TQISPRDLVQAYADPNGLCWQVLNGAWEKG  349
             H    AI+  L   KKH A +     E  T     D  +A+ADP GL WQVLN AW+ G
Sbjct  551  NHDGYAAIVAML---KKHGAVLNFSCSELWTVDQQVDFAEAHADPEGLVWQVLNAAWDVG  607

Query  348  VAIAGHNAPGGYDRETFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYF  172
              +AG NA   YDR T+ ++++ +KP +DP  RH  +F  L R    +   +   E E F
Sbjct  608  TPVAGENALPCYDRVTYNKILDNAKPLSDPDGRHFLSFTYL-RLSPLLMERQAYMEFERF  666

Query  171  VKCMHGYA  148
            VK MHG A
Sbjct  667  VKRMHGDA  674



>ref|XP_006445048.1| hypothetical protein CICLE_v10019617mg [Citrus clementina]
 gb|ESR58288.1| hypothetical protein CICLE_v10019617mg [Citrus clementina]
Length=541

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDY+ YYGRFF  WY+Q L+DH D +LS A  AF+ T +  K+ G HWWY 
Sbjct  336  HETGFFCDGGDYNGYYGRFFLNWYSQVLVDHGDRVLSLAKLAFEGTCIGAKLSGFHWWYK  395

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKT  470
             +SHAAELTAG+YN  NRDGY+ +   LKK 
Sbjct  396  TASHAAELTAGFYNPCNRDGYAAIVATLKKN  426


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 65/122 (53%), Gaps = 7/122 (6%)
 Frame = -3

Query  504  AILHSLRSSKKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGH  331
            AI+ +L   KK+ A +   S E     R  +  +A ADP+GL WQV+N AW+    +A  
Sbjct  418  AIVATL---KKNGAVLNFASAELHTLERQEEFSEALADPDGLMWQVMNAAWDVCTPVASE  474

Query  330  NAPGGYDRETFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            N    +DR  + ++++ +KP +DP  RH  +F  L R    +   EN  E E FVK MHG
Sbjct  475  NTLPCHDRVGYNKILDNAKPLSDPDGRHFLSFSYL-RLGLGLMERENFMEFERFVKRMHG  533

Query  153  YA  148
             A
Sbjct  534  EA  535



>dbj|BAC83773.1| putative beta-amylase [Oryza sativa Japonica Group]
 gb|EAZ40178.1| hypothetical protein OsJ_24623 [Oryza sativa Japonica Group]
Length=488

 Score = 96.7 bits (239),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 56/92 (61%), Gaps = 2/92 (2%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFD--ETPLVVKIPGIHWW  569
             +TRFF + G Y +  G+FF  WY+  LI H D IL  A + F      L +KI GIHWW
Sbjct  241  EKTRFFADNGTYVTEKGKFFLTWYSNKLIKHGDKILDEANKVFLGCRVQLAIKISGIHWW  300

Query  568  YLASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            Y   +HAAELTAGYYN  NRDGY  +  +L +
Sbjct  301  YRVPNHAAELTAGYYNLDNRDGYRTIARMLTR  332


 Score = 50.1 bits (118),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 51/114 (45%), Gaps = 5/114 (4%)
 Frame = -3

Query  486  RSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDR  307
            R   +H A V     E + S +   +A + P  L  QVL+  W +G+ +A  NA G YD 
Sbjct  328  RMLTRHRACVNFTCAEMRDSEQS-SEAKSAPEELVQQVLSAGWREGLHVACENALGRYDA  386

Query  306  ETFMRLVETSKP----RNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMH  157
              +  ++  S+P    +N P  H    F   R    +   +N S  + FVK MH
Sbjct  387  TAYNTILRNSRPTGINKNGPPEHKLFGFTYLRLSDELLEGQNYSTFKTFVKRMH  440



>gb|AAA33898.1| beta-amylase [Oryza sativa Japonica Group]
Length=488

 Score = 96.7 bits (239),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 56/92 (61%), Gaps = 2/92 (2%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFD--ETPLVVKIPGIHWW  569
             +TRFF + G Y +  G+FF  WY+  LI H D IL  A + F      L +KI GIHWW
Sbjct  241  EKTRFFADNGTYVTEKGKFFLTWYSNKLIKHGDKILDEANKVFLGCRVQLAIKISGIHWW  300

Query  568  YLASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            Y   +HAAELTAGYYN  NRDGY  +  +L +
Sbjct  301  YRVPNHAAELTAGYYNLDNRDGYRTIARMLTR  332


 Score = 50.4 bits (119),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 51/114 (45%), Gaps = 5/114 (4%)
 Frame = -3

Query  486  RSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDR  307
            R   +H A V     E + S +   +A + P  L  QVL+  W +G+ +A  NA G YD 
Sbjct  328  RMLTRHRACVNFTCAEMRDSEQS-SEAKSAPEELVQQVLSAGWREGLHVACENALGRYDA  386

Query  306  ETFMRLVETSKP----RNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMH  157
              +  ++  S+P    +N P  H    F   R    +   +N S  + FVK MH
Sbjct  387  TAYNTILRNSRPHGINKNGPPEHKLFGFTYLRLSDELLEGQNYSTFKTFVKRMH  440



>gb|EAZ04228.1| hypothetical protein OsI_26372 [Oryza sativa Indica Group]
Length=488

 Score = 96.7 bits (239),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 45/92 (49%), Positives = 56/92 (61%), Gaps = 2/92 (2%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFD--ETPLVVKIPGIHWW  569
             +TRFF + G Y +  G+FF  WY+  LI H D IL  A + F      L +KI GIHWW
Sbjct  241  EKTRFFTDNGTYVTEKGKFFLTWYSNKLIKHGDKILDEANKVFLGCRVQLAIKISGIHWW  300

Query  568  YLASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            Y   +HAAELTAGYYN  NRDGY  +  +L +
Sbjct  301  YRVPNHAAELTAGYYNLDNRDGYRTIARMLTR  332


 Score = 50.1 bits (118),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 34/114 (30%), Positives = 51/114 (45%), Gaps = 5/114 (4%)
 Frame = -3

Query  486  RSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDR  307
            R   +H A V     E + S +   +A + P  L  QVL+  W +G+ +A  NA G YD 
Sbjct  328  RMLTRHRACVNFTCAEMRDSEQS-SEAKSAPEELVQQVLSAGWREGLHVACENALGRYDA  386

Query  306  ETFMRLVETSKP----RNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMH  157
              +  ++  S+P    +N P  H    F   R    +   +N S  + FVK MH
Sbjct  387  TAYNTILRNSRPTGINKNGPPEHKLFGFTYLRLSDELLEGQNYSTFKTFVKRMH  440



>gb|KDO86151.1| hypothetical protein CISIN_1g0370371mg, partial [Citrus sinensis]
Length=619

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDY+ YYGRFF  WY+Q L+DH D +LS A  AF+ T +  K+ G HWWY 
Sbjct  496  HETGFFCDGGDYNGYYGRFFLNWYSQVLVDHGDRVLSLAKLAFEGTCIGAKLSGFHWWYK  555

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKT  470
             +SHAAELTAG+YN  NRDGY+ +   LKK 
Sbjct  556  TASHAAELTAGFYNPCNRDGYAAIVATLKKN  586



>gb|AFQ33618.1| beta-amylase 6 [Citrus trifoliata]
Length=701

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 65/91 (71%), Gaps = 0/91 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDY+ YYGRFF  WY+Q L+DH D +LS A  AF+ T +  K+ G HWWY 
Sbjct  496  HETGFFCDGGDYNGYYGRFFLNWYSQVLVDHGDRVLSLAKLAFEGTCIGAKLSGFHWWYK  555

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKT  470
             +SHAAELTAG+YN  NRDGY+ +   LKK+
Sbjct  556  TASHAAELTAGFYNPCNRDGYAAIVATLKKS  586


 Score = 67.8 bits (164),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 64/122 (52%), Gaps = 7/122 (6%)
 Frame = -3

Query  504  AILHSLRSSKKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGH  331
            AI+ +L   KK  A +   S E     R  +  +A ADP+GL WQV+N +W+    +A  
Sbjct  578  AIVATL---KKSGAVLNFASAELHTLERQEEFSEALADPDGLMWQVMNASWDVCTPVASE  634

Query  330  NAPGGYDRETFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            N    +DR  + ++++ +KP +DP  RH  +F  L R    +   EN  E E FVK MHG
Sbjct  635  NTLPCHDRVGYNKILDNAKPLSDPDGRHFLSFTYL-RLGLGLMERENFMEFERFVKRMHG  693

Query  153  YA  148
             A
Sbjct  694  EA  695



>ref|XP_008793743.1| PREDICTED: LOW QUALITY PROTEIN: beta-amylase-like [Phoenix dactylifera]
Length=524

 Score =   100 bits (248),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 47/90 (52%), Positives = 59/90 (66%), Gaps = 2/90 (2%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFD--ETPLVVKIPGIHWWYL  563
            T+FF E G Y +  G FF  WY+  LI+H D IL AA +AF   +T L  K+ GIHWWY 
Sbjct  251  TKFFAEHGTYLTERGNFFLTWYSNKLIEHGDQILDAANQAFLGCKTKLAAKVSGIHWWYR  310

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
              +HAAELTAGYYN +NRDGY  +  +L +
Sbjct  311  VDNHAAELTAGYYNLNNRDGYRTIARMLTR  340


 Score = 46.6 bits (109),  Expect(2) = 3e-26, Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 54/115 (47%), Gaps = 5/115 (4%)
 Frame = -3

Query  486  RSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDR  307
            R   +H+A +     E + S +   +A + P  L  QVL+  W +G+ +A  NA   YDR
Sbjct  336  RMLTRHDAILNFTCVEMRDSEQ-TAEAMSGPEELVQQVLSAGWREGIEVACENALNRYDR  394

Query  306  ETFMRLVETSKP----RNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            + + ++++  +P    R+ P +   T     R    +  A+N    + FV+ MH 
Sbjct  395  KAYNQILKNCRPNGVNRDGPPKLRVTAVTYLRLSDELLKAKNYRIFKTFVRKMHA  449



>gb|KHG19613.1| Beta-amylase 7 [Gossypium arboreum]
Length=392

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 67/96 (70%), Gaps = 6/96 (6%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKI------PG  581
            H+T FF ++GDYD YYGRFF  WY++ LI+H D++LS A  AF+ + +  K+      PG
Sbjct  181  HETGFFCDEGDYDGYYGRFFLNWYSELLINHGDLVLSLAKLAFEGSCIAAKVSLPALLPG  240

Query  580  IHWWYLASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            IHWWY  SSHAAELTAG+YN  NRDGY  +  +L K
Sbjct  241  IHWWYKTSSHAAELTAGFYNPCNRDGYIAIAAMLHK  276


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/122 (40%), Positives = 64/122 (52%), Gaps = 10/122 (8%)
 Frame = -3

Query  504  AILHSLRSSKKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGH  331
            A+LH      KH A +     E Q   +  DL +A A+P GL WQVLN AWE  + +   
Sbjct  272  AMLH------KHRAALNFACAELQFLEQLEDLQEALANPQGLVWQVLNAAWEACITVVSE  325

Query  330  NAPGGYDRETFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            NA   +DR  + +++E  KP NDP  RH S+F  L R    +   +N  E E FVK MHG
Sbjct  326  NAFVCHDRVGYNKILENVKPVNDPDGRHFSSFTYL-RLTPLLMERQNFMEFERFVKRMHG  384

Query  153  YA  148
             A
Sbjct  385  EA  386



>ref|XP_006491094.1| PREDICTED: beta-amylase 7-like isoform X2 [Citrus sinensis]
Length=701

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDY+ YYGRFF  WY+Q L+DH D +LS A  AF+ T +  K+ G HWWY 
Sbjct  496  HETGFFCDGGDYNGYYGRFFLNWYSQVLVDHGDRVLSLAKLAFEGTCIGAKLSGFHWWYK  555

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKT  470
             +SHAAELTAG+YN  NRDGY+ +   LKK 
Sbjct  556  TASHAAELTAGFYNPCNRDGYAAIVATLKKN  586


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 65/122 (53%), Gaps = 7/122 (6%)
 Frame = -3

Query  504  AILHSLRSSKKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGH  331
            AI+ +L   KK+ A +   S E     R  +  +A ADP+GL WQV+N AW+    +A  
Sbjct  578  AIVATL---KKNGAVLNFASAELHTLERQEEFSEALADPDGLMWQVMNAAWDVCTPVASE  634

Query  330  NAPGGYDRETFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            N    +DR  + ++++ +KP +DP  RH  +F  L R    +   EN  E E FVK MHG
Sbjct  635  NTLPCHDRVGYNKILDNAKPLSDPDGRHFLSFSYL-RLGLGLMERENFMEFERFVKRMHG  693

Query  153  YA  148
             A
Sbjct  694  EA  695



>ref|XP_006491093.1| PREDICTED: beta-amylase 7-like isoform X1 [Citrus sinensis]
Length=702

 Score =   117 bits (293),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/91 (56%), Positives = 64/91 (70%), Gaps = 0/91 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDY+ YYGRFF  WY+Q L+DH D +LS A  AF+ T +  K+ G HWWY 
Sbjct  497  HETGFFCDGGDYNGYYGRFFLNWYSQVLVDHGDRVLSLAKLAFEGTCIGAKLSGFHWWYK  556

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKT  470
             +SHAAELTAG+YN  NRDGY+ +   LKK 
Sbjct  557  TASHAAELTAGFYNPCNRDGYAAIVATLKKN  587


 Score = 69.3 bits (168),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 45/122 (37%), Positives = 65/122 (53%), Gaps = 7/122 (6%)
 Frame = -3

Query  504  AILHSLRSSKKHNATVKLVSKETQISPR--DLVQAYADPNGLCWQVLNGAWEKGVAIAGH  331
            AI+ +L   KK+ A +   S E     R  +  +A ADP+GL WQV+N AW+    +A  
Sbjct  579  AIVATL---KKNGAVLNFASAELHTLERQEEFSEALADPDGLMWQVMNAAWDVCTPVASE  635

Query  330  NAPGGYDRETFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            N    +DR  + ++++ +KP +DP  RH  +F  L R    +   EN  E E FVK MHG
Sbjct  636  NTLPCHDRVGYNKILDNAKPLSDPDGRHFLSFSYL-RLGLGLMERENFMEFERFVKRMHG  694

Query  153  YA  148
             A
Sbjct  695  EA  696



>gb|KEH23361.1| beta-amylase-like protein [Medicago truncatula]
Length=702

 Score =   117 bits (292),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 49/98 (50%), Positives = 70/98 (71%), Gaps = 0/98 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD +YGRFF  WY+QAL+DH + +LS A  AF+ + +  K+ GI+WWY 
Sbjct  497  HETGFFCDGGDYDGFYGRFFLNWYSQALVDHGNRVLSMAKLAFEGSCIAAKVSGIYWWYK  556

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQCDSEVS  449
             +SHAAELT+GYYN  NRDGY+ +  +LK+   +  ++
Sbjct  557  TASHAAELTSGYYNPCNRDGYAAITAMLKRNGVNLNIA  594


 Score = 63.5 bits (153),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 60/127 (47%), Gaps = 16/127 (13%)
 Frame = -3

Query  504  AILHSLRSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNA  325
            A + ++      N  +  V   T        + +ADP  L WQVLN  W+ G+ +   NA
Sbjct  578  AAITAMLKRNGVNLNIACVDLHTFNQHESFPEPFADPERLVWQVLNAGWDVGLPVVSENA  637

Query  324  PGGYDRETFMRLVETSKPRNDP-YRHXSTF-------FVLERPWQRIQTAENISELEYFV  169
                +R ++ ++++ +KP NDP  RH S+F        ++ERP        N  E E FV
Sbjct  638  LPCLNRVSYNKVLDNTKPINDPDGRHFSSFTYLRLSPLLMERP--------NFIEFERFV  689

Query  168  KCMHGYA  148
            K MHG A
Sbjct  690  KRMHGEA  696



>pdb|2XFF|A Chain A, Crystal Structure Of Barley Beta-Amylase Complexed With 
Acarbose
 pdb|2XFR|A Chain A, Crystal Structure Of Barley Beta-Amylase At Atomic Resolution
 pdb|2XFY|A Chain A, Crystal Structure Of Barley Beta-Amylase Complexed With 
Alpha-Cyclodextrin
 pdb|2XG9|A Chain A, Crystal Structure Of Barley Beta-Amylase Complexed With 
4-O- Alpha-D-Glucopyranosylmoranoline
 pdb|2XGB|A Chain A, Crystal Structure Of Barley Beta-Amylase Complexed With 
2,3- Epoxypropyl-Alpha-D-Glucopyranoside
 pdb|2XGI|A Chain A, Crystal Structure Of Barley Beta-Amylase Complexed With 
3,4- Epoxybutyl Alpha-D-Glucopyranoside
Length=535

 Score =   100 bits (248),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 59/91 (65%), Gaps = 2/91 (2%)
 Frame = -2

Query  739  QTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFD--ETPLVVKIPGIHWWY  566
            +T+FFR+ G Y S  GRFF  WY+  LI H D IL  A + F   +  L +KI GIHWWY
Sbjct  242  RTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWY  301

Query  565  LASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
               SHAAELTAGYYN  +RDGY  +  +LK+
Sbjct  302  KVPSHAAELTAGYYNLHDRDGYRTIARMLKR  332


 Score = 44.7 bits (104),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 52/114 (46%), Gaps = 5/114 (4%)
 Frame = -3

Query  486  RSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDR  307
            R  K+H A++     E + S +   QA + P  L  QVL+  W +G+ +A  NA   YD 
Sbjct  328  RMLKRHRASINFTCAEMRDSEQS-SQAMSAPEELVQQVLSAGWREGLNVACENALPRYDP  386

Query  306  ETFMRLVETSKP----RNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMH  157
              +  ++  ++P    ++ P  H    F   R   ++   +N +  + FV  MH
Sbjct  387  TAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMH  440



>gb|AAO67355.1|AF414081_1 endosperm-specific beta-amylase 1 [Hordeum vulgare subsp. vulgare]
 dbj|BAB39391.1| Sd1 beta-amylase [Hordeum vulgare subsp. vulgare]
 gb|ACF05415.1| beta-amylase [Hordeum vulgare subsp. vulgare]
 gb|ACN24987.1| beta-amylase [Hordeum vulgare subsp. vulgare]
 emb|CAX51376.1| beta-amylase [Hordeum vulgare subsp. vulgare]
 gb|AGY14523.1| beta-amylase [Hordeum vulgare]
 gb|AGY14528.1| beta-amylase [Hordeum vulgare subsp. spontaneum]
 gb|AGY14531.1| beta-amylase [Hordeum vulgare]
Length=535

 Score =   100 bits (248),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 59/91 (65%), Gaps = 2/91 (2%)
 Frame = -2

Query  739  QTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFD--ETPLVVKIPGIHWWY  566
            +T+FFR+ G Y S  GRFF  WY+  LI H D IL  A + F   +  L +KI GIHWWY
Sbjct  242  RTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWY  301

Query  565  LASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
               SHAAELTAGYYN  +RDGY  +  +LK+
Sbjct  302  KVPSHAAELTAGYYNLHDRDGYRTIARMLKR  332


 Score = 44.7 bits (104),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 52/114 (46%), Gaps = 5/114 (4%)
 Frame = -3

Query  486  RSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDR  307
            R  K+H A++     E + S +   QA + P  L  QVL+  W +G+ +A  NA   YD 
Sbjct  328  RMLKRHRASINFTCAEMRDSEQS-SQAMSAPEELVQQVLSAGWREGLNVACENALPRYDP  386

Query  306  ETFMRLVETSKP----RNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMH  157
              +  ++  ++P    ++ P  H    F   R   ++   +N +  + FV  MH
Sbjct  387  TAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMH  440



>ref|XP_010670436.1| PREDICTED: beta-amylase 7 isoform X1 [Beta vulgaris subsp. vulgaris]
Length=703

 Score =   116 bits (291),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/126 (44%), Positives = 75/126 (60%), Gaps = 5/126 (4%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + G+YD YYGRFF  WY+Q L+DH D ILS A   F+ T +  K+ G+HWWY 
Sbjct  496  HETGFFCDGGEYDGYYGRFFLNWYSQVLVDHGDRILSLAKLVFEGTCIAAKLSGVHWWYK  555

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQC-----DSEVSQQGNTDFTPRSCSSICR  398
             +SHAAE+TAG+ N  NRDGY+ +  +LKK         +EV      + +P + +    
Sbjct  556  TASHAAEITAGFCNPCNRDGYAAVMSMLKKNGAALNFTTAEVDMLDQLEVSPEALADPEG  615

Query  397  SQWLVL  380
              W VL
Sbjct  616  LAWQVL  621


 Score = 72.8 bits (177),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/116 (35%), Positives = 60/116 (52%), Gaps = 10/116 (9%)
 Frame = -3

Query  477  KKHNATVKLVSKET------QISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGG  316
            KK+ A +   + E       ++SP    +A ADP GL WQVLN AW+  + +A  N+   
Sbjct  584  KKNGAALNFTTAEVDMLDQLEVSP----EALADPEGLAWQVLNAAWDVCIPVASENSVPC  639

Query  315  YDRETFMRLVETSKPRNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
            + RE + +++E +KP NDP       F   R   ++    N+ E E FVK MHG A
Sbjct  640  HSREVYNKILENAKPFNDPDGRHLLSFTYHRLSLQLMERHNLVEFERFVKKMHGEA  695



>gb|AAA33899.1| beta-amylase [Oryza sativa Japonica Group]
Length=488

 Score = 96.7 bits (239),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 45/91 (49%), Positives = 56/91 (62%), Gaps = 2/91 (2%)
 Frame = -2

Query  739  QTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFD--ETPLVVKIPGIHWWY  566
            +TRFF + G Y +  G+FF  WY+  LI H D IL  A + F      L +KI GIHWWY
Sbjct  242  KTRFFTDNGTYVTEKGKFFLTWYSNKLIKHGDKILDEANKVFLGCRVQLAIKISGIHWWY  301

Query  565  LASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
               +HAAELTAGYYN  NRDGY  +  +L +
Sbjct  302  RVPNHAAELTAGYYNLDNRDGYRTIARMLTR  332


 Score = 48.1 bits (113),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 33/114 (29%), Positives = 51/114 (45%), Gaps = 5/114 (4%)
 Frame = -3

Query  486  RSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDR  307
            R   +H A V     E + S +   +A + P  L  QVL+  W +G+ +A  NA G YD 
Sbjct  328  RMLTRHRACVNFTCAEMRDSEQS-SEAKSAPEELVQQVLSAGWREGLHVACENALGRYDA  386

Query  306  ETFMRLVETSKP----RNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMH  157
              +  ++  S+P    +N P  +    F   R    +   +N S  + FVK MH
Sbjct  387  TAYNTILRNSRPHGINKNGPPEYKLFGFTYLRLSDELLEGQNYSTFKTFVKRMH  440



>gb|AAG25638.1| beta-amylase [Hordeum vulgare subsp. vulgare]
Length=533

 Score =   100 bits (248),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 59/91 (65%), Gaps = 2/91 (2%)
 Frame = -2

Query  739  QTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFD--ETPLVVKIPGIHWWY  566
            +T+FFR+ G Y S  GRFF  WY+  LI H D IL  A + F   +  L +KI GIHWWY
Sbjct  240  RTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWY  299

Query  565  LASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
               SHAAELTAGYYN  +RDGY  +  +LK+
Sbjct  300  KVPSHAAELTAGYYNLHDRDGYRTIARMLKR  330


 Score = 44.7 bits (104),  Expect(2) = 8e-26, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 52/114 (46%), Gaps = 5/114 (4%)
 Frame = -3

Query  486  RSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDR  307
            R  K+H A++     E + S +   QA + P  L  QVL+  W +G+ +A  NA   YD 
Sbjct  326  RMLKRHRASINFTCAEMRDSEQS-SQAMSAPEELVQQVLSAGWREGLNVACENALPRYDP  384

Query  306  ETFMRLVETSKP----RNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMH  157
              +  ++  ++P    ++ P  H    F   R   ++   +N +  + FV  MH
Sbjct  385  TAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYANFKTFVDRMH  438



>gb|AGY14536.1| beta-amylase [Hordeum vulgare subsp. spontaneum]
Length=535

 Score =   100 bits (248),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 59/91 (65%), Gaps = 2/91 (2%)
 Frame = -2

Query  739  QTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFD--ETPLVVKIPGIHWWY  566
            +T+FFR+ G Y S  GRFF  WY+  LI H D IL  A + F   +  L +KI GIHWWY
Sbjct  242  RTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWY  301

Query  565  LASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
               SHAAELTAGYYN  +RDGY  +  +LK+
Sbjct  302  KVPSHAAELTAGYYNLHDRDGYRTIARMLKR  332


 Score = 44.3 bits (103),  Expect(2) = 9e-26, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 52/114 (46%), Gaps = 5/114 (4%)
 Frame = -3

Query  486  RSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDR  307
            R  K+H A++     E + S +   QA + P  L  QVL+  W +G+ +A  NA   YD 
Sbjct  328  RMLKRHRASINFTCAEMRDSEQS-SQAMSAPEELVQQVLSAGWREGLNVACENALPRYDP  386

Query  306  ETFMRLVETSKP----RNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMH  157
              +  ++  ++P    ++ P  H    F   R   ++   +N +  + FV  MH
Sbjct  387  TAYNTILRNARPHGINQSGPPEHRLFGFTYLRLSNQLVEGQNYANFKTFVDRMH  440



>ref|XP_010055136.1| PREDICTED: beta-amylase 7 isoform X4 [Eucalyptus grandis]
Length=616

 Score =   115 bits (289),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 51/90 (57%), Positives = 66/90 (73%), Gaps = 0/90 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
             +T FF + GDYD Y+GRFF +WY+Q LIDH D +L+ A  AFD T +  K+ GI+WWY 
Sbjct  494  QETGFFCDGGDYDGYFGRFFLKWYSQVLIDHGDRVLALAKLAFDGTCIAAKLSGIYWWYR  553

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
             +SHAAE TAG+YN SNRDGY+ +  +LKK
Sbjct  554  TASHAAESTAGFYNPSNRDGYATIAAMLKK  583



>gb|EMS68884.1| Beta-amylase [Triticum urartu]
Length=525

 Score =   101 bits (251),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAF--DETPLVVKIPGIHWW  569
             +TRFF + G Y +  GRFF  WY+  LI H D IL  A + F      L +KI GIHWW
Sbjct  242  QRTRFFVDNGTYLTEQGRFFLAWYSNNLIKHGDKILDEANKVFLGHRVQLAIKISGIHWW  301

Query  568  YLASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
            Y   SHAAE+TAGYYN  +RDGY P+  +LK+
Sbjct  302  YKVPSHAAEITAGYYNLHDRDGYRPIARMLKR  333


 Score = 43.1 bits (100),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (45%), Gaps = 5/114 (4%)
 Frame = -3

Query  486  RSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDR  307
            R  K+H A++     E + S +   QA + P  L  QVL+  W +G+ +A  NA   YD 
Sbjct  329  RMLKRHRASLNFTCAEMRDSEQS-SQAMSAPEELVQQVLSAGWREGLNMACENALPRYDP  387

Query  306  ETFMRLVETSKP----RNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMH  157
              +  ++  ++P    ++ P  H    F   R   ++   +N    + FV  MH
Sbjct  388  TAYNTILRNARPHGINKSGPPEHKLFGFTYLRLSNQLVEGQNYVNFKTFVDRMH  441



>ref|XP_003562967.2| PREDICTED: beta-amylase [Brachypodium distachyon]
Length=811

 Score = 97.4 bits (241),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 44/91 (48%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = -2

Query  739  QTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAF--DETPLVVKIPGIHWWY  566
            +T+FF++ G Y +  G FF  WY+  LI H D IL  A + F      L +KI GIHWWY
Sbjct  242  KTQFFKDNGTYVTEKGDFFLSWYSNKLIKHGDKILDEANKVFVGYTVQLAIKISGIHWWY  301

Query  565  LASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
               +HAAELTAGYYN  +RDGY  +  +LK+
Sbjct  302  RVPNHAAELTAGYYNLDDRDGYRTIARMLKR  332


 Score = 47.0 bits (110),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 53/114 (46%), Gaps = 5/114 (4%)
 Frame = -3

Query  486  RSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDR  307
            R  K+H+A++     E + S +   +A + P  L  QVL+  W +G+ +A  NA G YD 
Sbjct  328  RMLKRHHASLNFTCAEMRDSEQS-SEAKSAPEELVQQVLSAGWREGLDVACENALGRYDA  386

Query  306  ETFMRLVETSKP----RNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMH  157
              +  ++  ++P    ++ P  H    F   R    +   +N    + FVK MH
Sbjct  387  TGYNTILRNARPKGVNKSGPPEHKLHGFTYLRLSDELLQGQNYVTFQTFVKRMH  440



>ref|XP_010931493.1| PREDICTED: beta-amylase [Elaeis guineensis]
Length=519

 Score =   101 bits (252),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/90 (53%), Positives = 60/90 (67%), Gaps = 2/90 (2%)
 Frame = -2

Query  736  TRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFD--ETPLVVKIPGIHWWYL  563
            T+FF E G Y +  G+FF  WY+  LI+H D IL AA +AF   +T L  KI GIHWWY 
Sbjct  251  TKFFAENGTYLTEKGKFFLTWYSNKLIEHGDQILDAANQAFLGCKTKLAAKISGIHWWYR  310

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
              +HAAELTAGYYN +NRDGY  +  +L +
Sbjct  311  VDNHAAELTAGYYNLNNRDGYRTIARMLTR  340


 Score = 42.7 bits (99),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 29/115 (25%), Positives = 52/115 (45%), Gaps = 5/115 (4%)
 Frame = -3

Query  486  RSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDR  307
            R   +H+A +     E + S +   +A + P  L  QVL+  W +G+ +A  NA   Y+R
Sbjct  336  RMLTRHDAILNFTCVEMRDSEQ-TAEAKSGPEELVQQVLSAGWREGIEVACENALNRYER  394

Query  306  ETFMRLVETSKP----RNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHG  154
            + + +++   +P    R+ P +   T     R    +  A N    + FV+ MH 
Sbjct  395  KAYNQILRNCRPNGVNRDGPPKLRVTSMTYLRLSDELLKAINYRIFKTFVRKMHA  449



>ref|XP_003552392.1| PREDICTED: beta-amylase 7-like [Glycine max]
Length=704

 Score =   115 bits (289),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 67/97 (69%), Gaps = 0/97 (0%)
 Frame = -2

Query  742  HQTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFDETPLVVKIPGIHWWYL  563
            H+T FF + GDYD +YGRFF  WY+Q LIDH + +LS A  AF+ + +  K+ GI+WWY 
Sbjct  499  HETGFFCDGGDYDGFYGRFFLSWYSQVLIDHGNRVLSLAKLAFEGSCIAAKLSGIYWWYK  558

Query  562  ASSHAAELTAGYYNTSNRDGYSPLFEVLKKTQCDSEV  452
             +SHAAELTAGYYN  NRDGY+ +  +LK    +  +
Sbjct  559  TASHAAELTAGYYNPCNRDGYAAIMTMLKTNGINLNI  595


 Score = 66.2 bits (160),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 58/120 (48%), Gaps = 2/120 (2%)
 Frame = -3

Query  504  AILHSLRSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNA  325
            A + ++  +   N  +  V   T        + +ADP GL WQVLN  WE  + +   N 
Sbjct  580  AAIMTMLKTNGINLNIPCVDLHTLNQHEGFPETFADPEGLVWQVLNAGWEVDLPVTSQNG  639

Query  324  PGGYDRETFMRLVETSKPRNDP-YRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA  148
                +R  + ++++ +KP NDP  RH S+F  L R    +   +N  E E FVK MHG A
Sbjct  640  FPCLNRVGYNKVLDNAKPMNDPDGRHFSSFTYL-RLSSLLMERQNFIEFERFVKRMHGEA  698



>gb|AGY14527.1| beta-amylase [Hordeum vulgare subsp. spontaneum]
 gb|AGY14535.1| beta-amylase [Hordeum vulgare subsp. spontaneum]
Length=535

 Score =   100 bits (249),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 59/91 (65%), Gaps = 2/91 (2%)
 Frame = -2

Query  739  QTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFD--ETPLVVKIPGIHWWY  566
            +T+FFR+ G Y S  GRFF  WY+  LI H D IL  A + F   +  L +KI GIHWWY
Sbjct  242  RTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWY  301

Query  565  LASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
               SHAAELTAGYYN  +RDGY  +  +LK+
Sbjct  302  KVPSHAAELTAGYYNLHDRDGYRTIARMLKR  332


 Score = 43.5 bits (101),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (45%), Gaps = 5/114 (4%)
 Frame = -3

Query  486  RSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDR  307
            R  K+H A++     E + S +   QA + P  L  QVL+  W +G+ +A  NA   YD 
Sbjct  328  RMLKRHRASINFTCAEMRDSEQS-SQAMSAPEELVQQVLSAGWREGLNVACENALPRYDP  386

Query  306  ETFMRLVETSKP----RNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMH  157
              +  ++  ++P    ++ P  H    F   R   ++   +N    + FV  MH
Sbjct  387  TAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYVNFKTFVDRMH  440



>gb|ACF05414.1| beta-amylase [Hordeum vulgare]
Length=535

 Score =   100 bits (249),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/91 (53%), Positives = 59/91 (65%), Gaps = 2/91 (2%)
 Frame = -2

Query  739  QTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFD--ETPLVVKIPGIHWWY  566
            +T+FFR+ G Y S  GRFF  WY+  LI H D IL  A + F   +  L +KI GIHWWY
Sbjct  242  RTQFFRDNGTYLSEKGRFFLAWYSNNLIKHGDRILDEANKVFLGYKVQLAIKISGIHWWY  301

Query  565  LASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
               SHAAELTAGYYN  +RDGY  +  +LK+
Sbjct  302  KVPSHAAELTAGYYNLHDRDGYRTIARMLKR  332


 Score = 43.5 bits (101),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 51/114 (45%), Gaps = 5/114 (4%)
 Frame = -3

Query  486  RSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDR  307
            R  K+H A++     E + S +   QA + P  L  QVL+  W +G+ +A  NA   YD 
Sbjct  328  RMLKRHRASINFTCAEMRDSEQS-SQAMSAPEELVQQVLSAGWREGLNVACENALPRYDP  386

Query  306  ETFMRLVETSKP----RNDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMH  157
              +  ++  ++P    ++ P  H    F   R   ++   +N    + FV  MH
Sbjct  387  TAYNTILRNARPHGINQSGPPEHKLFGFTYLRLSNQLVEGQNYVNFKTFVDRMH  440



>emb|CAA77817.1| Beta-amylase [Secale cereale]
Length=503

 Score = 94.7 bits (234),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = -2

Query  739  QTRFFREQGDYDSYYGRFFFQWYTQALIDHADIILSAATEAFD--ETPLVVKIPGIHWWY  566
            +T+FF+E G Y +  G+FF  WY+  LI H D IL  A + F      L +K+ GIHWWY
Sbjct  242  KTQFFKENGTYLTEKGKFFLSWYSNKLIKHGDKILDEANKVFLGCRVQLAIKVSGIHWWY  301

Query  565  LASSHAAELTAGYYNTSNRDGYSPLFEVLKK  473
               +HAAELTAGYYN  +RDGY  +  +L +
Sbjct  302  RVPNHAAELTAGYYNLDDRDGYRTIARMLTR  332


 Score = 48.9 bits (115),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 58/128 (45%), Gaps = 14/128 (11%)
 Frame = -3

Query  486  RSSKKHNATVKLVSKETQISPRDLVQAYADPNGLCWQVLNGAWEKGVAIAGHNAPGGYDR  307
            R   +H+A++     E + S +   +A   P  L  QVL+  W +G+ +A  NA G YD 
Sbjct  328  RMLTRHHASMNFTCAEMRHSEQS-EEAKNAPEELVQQVLSAGWREGLHVACENALGRYDA  386

Query  306  ETFMRLVETSKPR----NDPYRHXSTFFVLERPWQRIQTAENISELEYFVKCMHGYA*QS  139
              +  ++  ++P+    N P +H    F   R    +Q  +N +  + FV+ MH      
Sbjct  387  TAYNTILRNARPKGINENGPPQHKLYGFTYLRLSNELQEGQNYATFQTFVEKMHA-----  441

Query  138  RSNKNLGH  115
                NLGH
Sbjct  442  ----NLGH  445



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1400076157675