BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2800

Length=755
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07185.1|  unnamed protein product                                340   5e-109   Coffea canephora [robusta coffee]
ref|XP_009605917.1|  PREDICTED: ABC transporter G family member 1...    333   1e-106   Nicotiana tomentosiformis
ref|XP_009757349.1|  PREDICTED: ABC transporter G family member 1...    331   1e-105   Nicotiana sylvestris
gb|KHN28317.1|  ABC transporter G family member 14                      331   2e-105   Glycine soja [wild soybean]
ref|XP_003517105.2|  PREDICTED: ABC transporter G family member 1...    331   2e-105   Glycine max [soybeans]
ref|XP_004246010.1|  PREDICTED: ABC transporter G family member 14      331   2e-105   
ref|XP_006359961.1|  PREDICTED: ABC transporter G family member 1...    331   2e-105   Solanum tuberosum [potatoes]
ref|XP_003537708.1|  PREDICTED: ABC transporter G family member 1...    330   3e-105   Glycine max [soybeans]
ref|XP_007158067.1|  hypothetical protein PHAVU_002G121200g             330   5e-105   Phaseolus vulgaris [French bean]
ref|XP_011082193.1|  PREDICTED: ABC transporter G family member 1...    327   8e-104   Sesamum indicum [beniseed]
ref|XP_002270533.2|  PREDICTED: ABC transporter G family member 14      325   3e-103   Vitis vinifera
gb|AES95438.2|  white-brown-complex ABC transporter family protein      325   3e-103   Medicago truncatula
ref|XP_003612480.1|  ABC transporter-like protein                       325   3e-103   
gb|KDP37809.1|  hypothetical protein JCGZ_06711                         313   5e-103   Jatropha curcas
ref|XP_010275138.1|  PREDICTED: ABC transporter G family member 14      325   5e-103   Nelumbo nucifera [Indian lotus]
emb|CAN70956.1|  hypothetical protein VITISV_028138                     325   6e-103   Vitis vinifera
ref|XP_010540713.1|  PREDICTED: ABC transporter G family member 14      323   1e-102   Tarenaya hassleriana [spider flower]
gb|KJB51502.1|  hypothetical protein B456_008G219500                    323   2e-102   Gossypium raimondii
gb|KHN16959.1|  ABC transporter G family member 14                      320   3e-102   Glycine soja [wild soybean]
ref|XP_003548769.1|  PREDICTED: ABC transporter G family member 1...    322   3e-102   Glycine max [soybeans]
ref|XP_012072677.1|  PREDICTED: ABC transporter G family member 1...    313   4e-102   
ref|XP_010518955.1|  PREDICTED: ABC transporter G family member 14      322   4e-102   Tarenaya hassleriana [spider flower]
gb|KHG20314.1|  ABC transporter G family member 14                      322   6e-102   Gossypium arboreum [tree cotton]
ref|XP_007040852.1|  ATP-binding cassette 14                            322   9e-102   Theobroma cacao [chocolate]
ref|XP_009114967.1|  PREDICTED: ABC transporter G family member 14      321   9e-102   Brassica rapa
ref|XP_004512314.1|  PREDICTED: ABC transporter G family member 1...    321   1e-101   Cicer arietinum [garbanzo]
ref|XP_007156346.1|  hypothetical protein PHAVU_003G278800g             321   2e-101   Phaseolus vulgaris [French bean]
ref|XP_011071699.1|  PREDICTED: ABC transporter G family member 1...    321   2e-101   Sesamum indicum [beniseed]
ref|XP_009145231.1|  PREDICTED: ABC transporter G family member 1...    320   2e-101   Brassica rapa
ref|XP_003547739.1|  PREDICTED: ABC transporter G family member 1...    320   2e-101   Glycine max [soybeans]
ref|XP_010478591.1|  PREDICTED: ABC transporter G family member 14      320   3e-101   Camelina sativa [gold-of-pleasure]
emb|CDY47690.1|  BnaCnng15320D                                          320   3e-101   Brassica napus [oilseed rape]
ref|XP_010499718.1|  PREDICTED: ABC transporter G family member 1...    320   3e-101   Camelina sativa [gold-of-pleasure]
ref|XP_006303926.1|  hypothetical protein CARUB_v10008545mg             320   4e-101   Capsella rubella
ref|XP_006385164.1|  ABC transporter family protein                     320   4e-101   Populus trichocarpa [western balsam poplar]
emb|CDY12299.1|  BnaA09g24990D                                          321   5e-101   Brassica napus [oilseed rape]
gb|EYU37490.1|  hypothetical protein MIMGU_mgv1a026680mg                315   6e-101   Erythranthe guttata [common monkey flower]
ref|NP_564383.1|  ABC transporter G family member 14                    318   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004291249.1|  PREDICTED: ABC transporter G family member 14      319   1e-100   Fragaria vesca subsp. vesca
gb|AAG50724.1|AC079041_17  ABC transporter, putative                    318   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010054006.1|  PREDICTED: ABC transporter G family member 14      318   1e-100   Eucalyptus grandis [rose gum]
ref|XP_006415305.1|  hypothetical protein EUTSA_v10007027mg             317   3e-100   Eutrema salsugineum [saltwater cress]
ref|XP_002893685.1|  abc transporter family protein                     317   3e-100   
ref|XP_004147769.1|  PREDICTED: ABC transporter G family member 14      317   4e-100   Cucumis sativus [cucumbers]
gb|KJB25133.1|  hypothetical protein B456_004G178100                    316   8e-100   Gossypium raimondii
ref|XP_008451875.1|  PREDICTED: ABC transporter G family member 14      316   9e-100   Cucumis melo [Oriental melon]
gb|KJB25132.1|  hypothetical protein B456_004G178100                    316   1e-99    Gossypium raimondii
ref|XP_012072651.1|  PREDICTED: ABC transporter G family member 1...    316   2e-99    Jatropha curcas
ref|XP_006430907.1|  hypothetical protein CICLE_v10011273mg             315   2e-99    Citrus clementina [clementine]
ref|XP_008221126.1|  PREDICTED: ABC transporter G family member 14      315   6e-99    Prunus mume [ume]
ref|XP_012072650.1|  PREDICTED: ABC transporter G family member 1...    315   6e-99    Jatropha curcas
ref|XP_010111780.1|  ABC transporter G family member 14                 314   6e-99    Morus notabilis
gb|KDP37810.1|  hypothetical protein JCGZ_06712                         314   7e-99    Jatropha curcas
ref|XP_008347335.1|  PREDICTED: ABC transporter G family member 1...    316   1e-98    
ref|XP_002519942.1|  ATP-binding cassette transporter, putative         312   2e-98    Ricinus communis
gb|KFK44944.1|  hypothetical protein AALP_AA1G323000                    312   3e-98    Arabis alpina [alpine rockcress]
ref|XP_007226971.1|  hypothetical protein PRUPE_ppa002442mg             313   3e-98    
ref|XP_006482405.1|  PREDICTED: ABC transporter G family member 1...    311   3e-98    Citrus sinensis [apfelsine]
gb|KDO72270.1|  hypothetical protein CISIN_1g039221mg                   311   4e-98    Citrus sinensis [apfelsine]
ref|XP_008387860.1|  PREDICTED: ABC transporter G family member 14      312   4e-98    Malus domestica [apple tree]
ref|XP_008347334.1|  PREDICTED: ABC transporter G family member 1...    315   4e-98    
gb|EYU29117.1|  hypothetical protein MIMGU_mgv1a002688mg                310   2e-97    Erythranthe guttata [common monkey flower]
gb|KHG16348.1|  ABC transporter G family member 14                      309   4e-97    Gossypium arboreum [tree cotton]
ref|XP_010251517.1|  PREDICTED: ABC transporter G family member 1...    308   1e-96    Nelumbo nucifera [Indian lotus]
ref|XP_010324497.1|  PREDICTED: ABC transporter G family member 1...    301   2e-94    
ref|XP_010918656.1|  PREDICTED: ABC transporter G family member 1...    302   3e-94    
ref|XP_010918655.1|  PREDICTED: ABC transporter G family member 1...    302   4e-94    Elaeis guineensis
ref|XP_006361228.1|  PREDICTED: ABC transporter G family member 1...    301   6e-94    Solanum tuberosum [potatoes]
ref|XP_006361227.1|  PREDICTED: ABC transporter G family member 1...    301   7e-94    Solanum tuberosum [potatoes]
ref|XP_010324496.1|  PREDICTED: ABC transporter G family member 1...    300   8e-94    Solanum lycopersicum
ref|XP_010324495.1|  PREDICTED: ABC transporter G family member 1...    301   8e-94    Solanum lycopersicum
ref|XP_010676724.1|  PREDICTED: ABC transporter G family member 14      300   9e-94    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010943390.1|  PREDICTED: ABC transporter G family member 1...    301   1e-93    Elaeis guineensis
ref|XP_010943389.1|  PREDICTED: ABC transporter G family member 1...    300   1e-93    Elaeis guineensis
ref|XP_009802424.1|  PREDICTED: ABC transporter G family member 1...    300   1e-93    Nicotiana sylvestris
ref|XP_010910173.1|  PREDICTED: ABC transporter G family member 1...    296   3e-92    
ref|XP_009631041.1|  PREDICTED: ABC transporter G family member 1...    296   5e-92    Nicotiana tomentosiformis
ref|XP_010910172.1|  PREDICTED: ABC transporter G family member 1...    296   6e-92    
ref|XP_008805673.1|  PREDICTED: ABC transporter G family member 1...    295   2e-91    Phoenix dactylifera
ref|XP_008797958.1|  PREDICTED: ABC transporter G family member 1...    293   1e-90    Phoenix dactylifera
ref|XP_011028515.1|  PREDICTED: ABC transporter G family member 1...    290   1e-89    Populus euphratica
ref|XP_002304113.2|  hypothetical protein POPTR_0003s03650g             289   3e-89    Populus trichocarpa [western balsam poplar]
ref|XP_009397435.1|  PREDICTED: ABC transporter G family member 14      289   3e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011013139.1|  PREDICTED: ABC transporter G family member 1...    287   1e-88    Populus euphratica
ref|XP_009384518.1|  PREDICTED: ABC transporter G family member 1...    281   2e-86    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006659869.1|  PREDICTED: ABC transporter G family member 1...    258   2e-80    
ref|XP_008390022.1|  PREDICTED: ABC transporter G family member 2...    258   3e-80    
ref|NP_001182828.1|  hypothetical protein                               256   5e-80    
dbj|BAJ97566.1|  predicted protein                                      264   2e-79    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ95904.1|  predicted protein                                      264   2e-79    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAC99536.1|  putative ABC transporter AbcG1                         261   5e-78    Oryza sativa Japonica Group [Japonica rice]
gb|EEC82957.1|  hypothetical protein OsI_27950                          261   5e-78    Oryza sativa Indica Group [Indian rice]
gb|EAZ41641.1|  hypothetical protein OsJ_26175                          261   6e-78    Oryza sativa Japonica Group [Japonica rice]
gb|AFW57205.1|  hypothetical protein ZEAMMB73_095241                    257   1e-77    
ref|XP_009336649.1|  PREDICTED: ABC transporter G family member 2...    259   2e-77    Pyrus x bretschneideri [bai li]
ref|XP_009356025.1|  PREDICTED: ABC transporter G family member 2...    259   2e-77    Pyrus x bretschneideri [bai li]
ref|XP_008389336.1|  PREDICTED: ABC transporter G family member 2...    258   2e-77    
ref|XP_008662280.1|  PREDICTED: hypothetical protein isoform X1         258   1e-76    
ref|XP_012082004.1|  PREDICTED: ABC transporter G family member 21      256   1e-76    Jatropha curcas
ref|XP_003573439.1|  PREDICTED: ABC transporter G family member 14      256   4e-76    Brachypodium distachyon [annual false brome]
gb|EMS54909.1|  ABC transporter G family member 14                      248   7e-76    Triticum urartu
ref|XP_008361741.1|  PREDICTED: ABC transporter G family member 2...    253   2e-75    
ref|XP_008339724.1|  PREDICTED: ABC transporter G family member 2...    253   2e-75    
ref|XP_010096709.1|  ABC transporter G family member 14                 251   4e-75    
ref|XP_010262410.1|  PREDICTED: ABC transporter G family member 2...    249   7e-74    Nelumbo nucifera [Indian lotus]
ref|XP_010265331.1|  PREDICTED: ABC transporter G family member 2...    248   1e-73    Nelumbo nucifera [Indian lotus]
gb|KHN07535.1|  ABC transporter G family member 21                      246   1e-73    Glycine soja [wild soybean]
gb|EPS63929.1|  hypothetical protein M569_10851                         247   1e-73    Genlisea aurea
ref|XP_007225163.1|  hypothetical protein PRUPE_ppa002351mg             248   2e-73    
ref|XP_010556399.1|  PREDICTED: ABC transporter G family member 2...    248   2e-73    Tarenaya hassleriana [spider flower]
ref|XP_008243143.1|  PREDICTED: ABC transporter G family member 21      246   6e-73    Prunus mume [ume]
ref|XP_004972751.1|  PREDICTED: ABC transporter G family member 1...    247   9e-73    Setaria italica
gb|KHN07718.1|  ABC transporter G family member 21                      244   1e-72    Glycine soja [wild soybean]
gb|KHN37813.1|  ABC transporter G family member 21                      245   1e-72    Glycine soja [wild soybean]
ref|XP_006589394.1|  PREDICTED: ABC transporter G family member 2...    245   2e-72    Glycine max [soybeans]
ref|XP_002314895.1|  hypothetical protein POPTR_0010s14180g             245   2e-72    Populus trichocarpa [western balsam poplar]
gb|AIU41651.1|  ABC transporter family protein                          244   5e-72    Hevea brasiliensis [jebe]
ref|XP_002443920.1|  hypothetical protein SORBIDRAFT_07g004390          245   7e-72    Sorghum bicolor [broomcorn]
ref|XP_002524381.1|  ATP-binding cassette transporter, putative         243   2e-71    
ref|XP_004496215.1|  PREDICTED: ABC transporter G family member 2...    243   2e-71    Cicer arietinum [garbanzo]
ref|XP_003520157.2|  PREDICTED: ABC transporter G family member 2...    242   3e-71    
ref|XP_007153314.1|  hypothetical protein PHAVU_003G024700g             242   3e-71    Phaseolus vulgaris [French bean]
ref|XP_010528033.1|  PREDICTED: ABC transporter G family member 2...    241   7e-71    Tarenaya hassleriana [spider flower]
ref|XP_003591854.1|  ABC transporter G family member                    240   1e-70    
gb|KHN00888.1|  ABC transporter G family member 21                      239   2e-70    Glycine soja [wild soybean]
ref|XP_003556255.1|  PREDICTED: ABC transporter G family member 2...    239   3e-70    Glycine max [soybeans]
ref|XP_011008785.1|  PREDICTED: ABC transporter G family member 21      239   4e-70    Populus euphratica
ref|XP_007046353.1|  ABC-2 type transporter family protein              239   6e-70    
ref|XP_006573283.1|  PREDICTED: ABC transporter G family member 2...    238   8e-70    Glycine max [soybeans]
ref|XP_007143780.1|  hypothetical protein PHAVU_007G100900g             238   9e-70    Phaseolus vulgaris [French bean]
ref|XP_004297158.1|  PREDICTED: ABC transporter G family member 21      237   2e-69    Fragaria vesca subsp. vesca
ref|XP_010681458.1|  PREDICTED: ABC transporter G family member 21      229   4e-69    Beta vulgaris subsp. vulgaris [field beet]
gb|KJB50814.1|  hypothetical protein B456_008G188000                    236   6e-69    Gossypium raimondii
ref|XP_010648137.1|  PREDICTED: ABC transporter G family member 21      235   9e-69    Vitis vinifera
emb|CAN62390.1|  hypothetical protein VITISV_039480                     235   1e-68    Vitis vinifera
ref|XP_006484387.1|  PREDICTED: ABC transporter G family member 2...    234   2e-68    Citrus sinensis [apfelsine]
ref|XP_006437762.1|  hypothetical protein CICLE_v10030868mg             234   3e-68    Citrus clementina [clementine]
gb|KDO70136.1|  hypothetical protein CISIN_1g005545mg                   234   3e-68    Citrus sinensis [apfelsine]
ref|XP_010066762.1|  PREDICTED: ABC transporter G family member 21      234   3e-68    Eucalyptus grandis [rose gum]
ref|XP_011077437.1|  PREDICTED: ABC transporter G family member 21      231   5e-67    Sesamum indicum [beniseed]
emb|CDP00551.1|  unnamed protein product                                230   7e-67    Coffea canephora [robusta coffee]
ref|XP_006395639.1|  hypothetical protein EUTSA_v10003766mg             228   6e-66    Eutrema salsugineum [saltwater cress]
ref|XP_006855537.2|  PREDICTED: ABC transporter G family member 14      227   7e-66    
gb|ERN17004.1|  hypothetical protein AMTR_s00057p00214480               227   7e-66    Amborella trichopoda
ref|XP_010514180.1|  PREDICTED: ABC transporter G family member 2...    227   1e-65    Camelina sativa [gold-of-pleasure]
ref|XP_010425209.1|  PREDICTED: ABC transporter G family member 2...    225   5e-65    Camelina sativa [gold-of-pleasure]
ref|XP_002876921.1|  hypothetical protein ARALYDRAFT_904727             225   6e-65    Arabidopsis lyrata subsp. lyrata
gb|EMT29518.1|  hypothetical protein F775_52365                         223   6e-65    
ref|XP_006290691.1|  hypothetical protein CARUB_v10016784mg             224   9e-65    Capsella rubella
ref|XP_010502439.1|  PREDICTED: ABC transporter G family member 2...    224   1e-64    Camelina sativa [gold-of-pleasure]
ref|XP_009586692.1|  PREDICTED: ABC transporter G family member 2...    223   2e-64    Nicotiana tomentosiformis
ref|XP_006878615.1|  PREDICTED: ABC transporter G family member 14      223   2e-64    Amborella trichopoda
emb|CDY46506.1|  BnaA02g27560D                                          223   5e-64    Brassica napus [oilseed rape]
emb|CAN62144.1|  hypothetical protein VITISV_007841                     221   5e-64    Vitis vinifera
ref|XP_009129040.1|  PREDICTED: ABC transporter G family member 2...    223   5e-64    Brassica rapa
ref|XP_009768130.1|  PREDICTED: ABC transporter G family member 2...    222   6e-64    Nicotiana sylvestris
ref|XP_002281949.1|  PREDICTED: ABC transporter G family member 9       221   1e-63    Vitis vinifera
emb|CDY48079.1|  BnaA06g33490D                                          221   1e-63    Brassica napus [oilseed rape]
gb|AFK38841.1|  unknown                                                 207   1e-63    Lotus japonicus
gb|KFK39853.1|  hypothetical protein AALP_AA3G297000                    221   1e-63    Arabis alpina [alpine rockcress]
ref|XP_009152126.1|  PREDICTED: ABC transporter G family member 21      221   1e-63    Brassica rapa
ref|XP_009793168.1|  PREDICTED: ABC transporter G family member 2...    221   2e-63    Nicotiana sylvestris
emb|CDX99764.1|  BnaC02g35560D                                          221   2e-63    
emb|CDY51602.1|  BnaCnng21050D                                          220   3e-63    Brassica napus [oilseed rape]
gb|EYU28941.1|  hypothetical protein MIMGU_mgv1a002356mg                220   4e-63    Erythranthe guttata [common monkey flower]
ref|XP_012084971.1|  PREDICTED: ABC transporter G family member 9...    219   5e-63    Jatropha curcas
ref|XP_006366061.1|  PREDICTED: ABC transporter G family member 2...    219   8e-63    Solanum tuberosum [potatoes]
ref|XP_004236984.1|  PREDICTED: ABC transporter G family member 21      219   8e-63    Solanum lycopersicum
ref|XP_008457190.1|  PREDICTED: ABC transporter G family member 21      219   2e-62    Cucumis melo [Oriental melon]
gb|EYU26406.1|  hypothetical protein MIMGU_mgv1a004006mg                216   2e-62    Erythranthe guttata [common monkey flower]
ref|NP_001189973.1|  ABC transporter G family member 21                 218   2e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011649112.1|  PREDICTED: ABC transporter G family member 21      216   1e-61    Cucumis sativus [cucumbers]
ref|XP_009593646.1|  PREDICTED: ABC transporter G family member 21      215   2e-61    Nicotiana tomentosiformis
ref|XP_010034170.1|  PREDICTED: ABC transporter G family member 9       215   3e-61    Eucalyptus grandis [rose gum]
ref|XP_011098341.1|  PREDICTED: ABC transporter G family member 9       214   3e-61    Sesamum indicum [beniseed]
ref|XP_010502438.1|  PREDICTED: ABC transporter G family member 2...    201   6e-61    
ref|XP_009792869.1|  PREDICTED: ABC transporter G family member 9...    212   2e-60    Nicotiana sylvestris
ref|XP_010277245.1|  PREDICTED: ABC transporter G family member 9...    215   2e-60    Nelumbo nucifera [Indian lotus]
ref|XP_009605775.1|  PREDICTED: ABC transporter G family member 9       212   3e-60    Nicotiana tomentosiformis
emb|CDP05875.1|  unnamed protein product                                211   4e-60    Coffea canephora [robusta coffee]
gb|KHG01243.1|  ABC transporter G family member 9                       211   7e-60    Gossypium arboreum [tree cotton]
ref|XP_009378509.1|  PREDICTED: ABC transporter G family member 9       210   8e-60    Pyrus x bretschneideri [bai li]
gb|KJB62742.1|  hypothetical protein B456_009G433300                    211   9e-60    Gossypium raimondii
ref|XP_006359003.1|  PREDICTED: ABC transporter G family member 9...    210   1e-59    Solanum tuberosum [potatoes]
ref|XP_010520902.1|  PREDICTED: ABC transporter G family member 9...    210   1e-59    Tarenaya hassleriana [spider flower]
ref|XP_009383080.1|  PREDICTED: ABC transporter G family member 9       209   2e-59    
ref|XP_008799253.1|  PREDICTED: ABC transporter G family member 9...    209   3e-59    Phoenix dactylifera
ref|XP_008775311.1|  PREDICTED: ABC transporter G family member 9...    209   4e-59    
ref|XP_008226675.1|  PREDICTED: ABC transporter G family member 9       208   6e-59    Prunus mume [ume]
ref|XP_007214012.1|  hypothetical protein PRUPE_ppa014861mg             208   7e-59    Prunus persica
ref|XP_007021331.1|  White-brown-complex ABC transporter family         207   9e-59    
ref|XP_008386302.1|  PREDICTED: ABC transporter G family member 9...    207   1e-58    
ref|XP_009607601.1|  PREDICTED: ABC transporter G family member 9...    207   2e-58    Nicotiana tomentosiformis
ref|XP_001780064.1|  ATP-binding cassette transporter, subfamily ...    206   3e-58    
ref|XP_003541854.2|  PREDICTED: ABC transporter G family member 9...    206   3e-58    Glycine max [soybeans]
ref|XP_004252105.1|  PREDICTED: ABC transporter G family member 9...    206   3e-58    Solanum lycopersicum
ref|XP_009766511.1|  PREDICTED: ABC transporter G family member 9...    206   5e-58    Nicotiana sylvestris
ref|XP_011042498.1|  PREDICTED: ABC transporter G family member 9...    205   6e-58    Populus euphratica
gb|KHN36795.1|  ABC transporter G family member 9                       204   7e-58    Glycine soja [wild soybean]
ref|XP_010921129.1|  PREDICTED: ABC transporter G family member 9       205   7e-58    Elaeis guineensis
ref|XP_008237669.1|  PREDICTED: ABC transporter G family member 9...    204   2e-57    Prunus mume [ume]
ref|XP_006370303.1|  hypothetical protein POPTR_0001s41450g             204   2e-57    
ref|XP_007199008.1|  hypothetical protein PRUPE_ppa017466mg             203   3e-57    
ref|XP_009143407.1|  PREDICTED: ABC transporter G family member 9       203   4e-57    Brassica rapa
gb|KDP27020.1|  hypothetical protein JCGZ_20955                         202   4e-57    Jatropha curcas
ref|XP_012084914.1|  PREDICTED: ABC transporter G family member 9...    202   1e-56    Jatropha curcas
emb|CDY29304.1|  BnaC01g19560D                                          201   3e-56    Brassica napus [oilseed rape]
ref|XP_010675645.1|  PREDICTED: ABC transporter G family member 9       200   8e-56    
ref|XP_011095242.1|  PREDICTED: ABC transporter G family member 9...    199   1e-55    
ref|XP_006413078.1|  hypothetical protein EUTSA_v10024656mg             199   2e-55    Eutrema salsugineum [saltwater cress]
ref|XP_011095241.1|  PREDICTED: ABC transporter G family member 9...    199   2e-55    Sesamum indicum [beniseed]
ref|XP_004244204.1|  PREDICTED: ABC transporter G family member 9       198   3e-55    Solanum lycopersicum
emb|CDX92829.1|  BnaC07g40870D                                          197   5e-55    
emb|CDY29837.1|  BnaA03g48580D                                          197   6e-55    Brassica napus [oilseed rape]
ref|XP_006359002.1|  PREDICTED: ABC transporter G family member 9...    196   1e-54    Solanum tuberosum [potatoes]
ref|XP_009137658.1|  PREDICTED: ABC transporter G family member 9...    196   2e-54    Brassica rapa
gb|KEH38788.1|  white-brown-complex ABC transporter family protein      196   2e-54    Medicago truncatula
ref|XP_004293103.1|  PREDICTED: ABC transporter G family member 9       196   2e-54    Fragaria vesca subsp. vesca
ref|XP_004252106.1|  PREDICTED: ABC transporter G family member 9...    197   6e-54    
ref|XP_010433373.1|  PREDICTED: ABC transporter G family member 9...    194   7e-54    Camelina sativa [gold-of-pleasure]
ref|XP_007149612.1|  hypothetical protein PHAVU_005G084300g             194   8e-54    Phaseolus vulgaris [French bean]
gb|KFK29257.1|  hypothetical protein AALP_AA7G109600                    194   8e-54    Arabis alpina [alpine rockcress]
ref|XP_009395262.1|  PREDICTED: ABC transporter G family member 9...    194   9e-54    
ref|XP_010448138.1|  PREDICTED: ABC transporter G family member 9       194   1e-53    Camelina sativa [gold-of-pleasure]
ref|XP_002533914.1|  ATP-binding cassette transporter, putative         193   3e-53    Ricinus communis
gb|KJB13426.1|  hypothetical protein B456_002G073600                    192   5e-53    Gossypium raimondii
ref|XP_010438619.1|  PREDICTED: ABC transporter G family member 9...    192   5e-53    Camelina sativa [gold-of-pleasure]
gb|EPS69022.1|  hypothetical protein M569_05746                         191   1e-52    Genlisea aurea
ref|XP_006447786.1|  hypothetical protein CICLE_v10017645mg             191   2e-52    
ref|XP_006286036.1|  hypothetical protein CARUB_v10007565mg             191   2e-52    Capsella rubella
ref|XP_002316916.1|  ABC transporter family protein                     189   4e-52    
ref|XP_006464709.1|  PREDICTED: ABC transporter G family member 9...    189   6e-52    
ref|NP_194472.3|  ABC transporter G family member 9                     189   7e-52    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009416919.1|  PREDICTED: ABC transporter G family member 2...    189   9e-52    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010256405.1|  PREDICTED: ABC transporter G family member 25      189   1e-51    Nelumbo nucifera [Indian lotus]
emb|CAB43874.1|  putative protei                                        189   1e-51    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011029437.1|  PREDICTED: ABC transporter G family member 9...    188   1e-51    Populus euphratica
ref|XP_008781545.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    188   2e-51    
gb|KDP27018.1|  hypothetical protein JCGZ_20953                         182   2e-51    Jatropha curcas
ref|XP_009406087.1|  PREDICTED: ABC transporter G family member 2...    187   3e-51    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006451938.1|  hypothetical protein CICLE_v10007744mg             187   4e-51    Citrus clementina [clementine]
ref|XP_002867504.1|  abc transporter family protein                     187   4e-51    
ref|XP_007133073.1|  hypothetical protein PHAVU_011G149300g             186   8e-51    Phaseolus vulgaris [French bean]
ref|XP_010463057.1|  PREDICTED: ABC transporter G family member 1...    185   9e-51    
ref|XP_004134251.1|  PREDICTED: ABC transporter G family member 9       186   1e-50    Cucumis sativus [cucumbers]
ref|XP_006493205.1|  PREDICTED: ABC transporter G family member 9...    186   1e-50    Citrus sinensis [apfelsine]
ref|XP_008452359.1|  PREDICTED: ABC transporter G family member 9...    184   3e-50    
ref|XP_009383524.1|  PREDICTED: ABC transporter G family member 2...    184   4e-50    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006441201.1|  hypothetical protein CICLE_v10023692mg             184   4e-50    
ref|XP_004487681.1|  PREDICTED: ABC transporter G family member 9...    184   7e-50    Cicer arietinum [garbanzo]
ref|XP_011096967.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    184   8e-50    
ref|XP_012084913.1|  PREDICTED: ABC transporter G family member 9...    183   1e-49    
ref|XP_009604112.1|  PREDICTED: ABC transporter G family member 25      183   1e-49    Nicotiana tomentosiformis
ref|XP_009769371.1|  PREDICTED: ABC transporter G family member 25      182   2e-49    Nicotiana sylvestris
ref|XP_010912511.1|  PREDICTED: ABC transporter G family member 2...    182   3e-49    Elaeis guineensis
gb|KHN08925.1|  ABC transporter G family member 9                       181   5e-49    Glycine soja [wild soybean]
ref|XP_010930786.1|  PREDICTED: ABC transporter G family member 25      181   6e-49    Elaeis guineensis
ref|XP_003526081.1|  PREDICTED: ABC transporter G family member 9...    181   6e-49    Glycine max [soybeans]
gb|EYU22839.1|  hypothetical protein MIMGU_mgv1a002620mg                180   1e-48    Erythranthe guttata [common monkey flower]
gb|EMS45576.1|  ABC transporter G family member 25                      171   1e-48    Triticum urartu
ref|XP_006376282.1|  hypothetical protein POPTR_0013s11640g             173   2e-48    
ref|XP_004250400.1|  PREDICTED: ABC transporter G family member 25      180   2e-48    Solanum lycopersicum
ref|XP_006351917.1|  PREDICTED: ABC transporter G family member 2...    178   6e-48    
tpg|DAA38971.1|  TPA: hypothetical protein ZEAMMB73_519748              169   7e-48    
gb|EMT03545.1|  ABC transporter G family member 25                      174   8e-48    
ref|XP_011622191.1|  PREDICTED: ABC transporter G family member 21      177   1e-47    
gb|ERN02964.1|  hypothetical protein AMTR_s00134p00069640               177   2e-47    Amborella trichopoda
gb|KGN56224.1|  hypothetical protein Csa_3G102320                       176   2e-47    
ref|XP_004134252.1|  PREDICTED: ABC transporter G family member 9...    176   3e-47    Cucumis sativus [cucumbers]
ref|NP_001136485.1|  uncharacterized protein LOC100216600               167   4e-47    
gb|KEH43567.1|  white-brown-complex ABC transporter family protein      176   4e-47    Medicago truncatula
ref|XP_004496375.1|  PREDICTED: ABC transporter G family member 2...    176   5e-47    Cicer arietinum [garbanzo]
emb|CBI20349.3|  unnamed protein product                                175   6e-47    Vitis vinifera
gb|KHN46331.1|  ABC transporter G family member 9                       175   7e-47    Glycine soja [wild soybean]
ref|XP_003541547.2|  PREDICTED: ABC transporter G family member 9...    175   7e-47    Glycine max [soybeans]
gb|KJB35858.1|  hypothetical protein B456_006G130900                    175   7e-47    Gossypium raimondii
ref|XP_003562060.1|  PREDICTED: ABC transporter G family member 2...    176   8e-47    Brachypodium distachyon [annual false brome]
emb|CDX96365.1|  BnaA07g29760D                                          171   8e-47    
gb|KHG11002.1|  ABC transporter G family member 25                      175   9e-47    Gossypium arboreum [tree cotton]
gb|KJB60113.1|  hypothetical protein B456_009G290300                    175   1e-46    
ref|XP_006301540.1|  hypothetical protein CARUB_v10021973mg             169   1e-46    
ref|XP_003555426.1|  PREDICTED: ABC transporter G family member 2...    174   2e-46    
ref|XP_007143640.1|  hypothetical protein PHAVU_007G088800g             174   2e-46    
dbj|BAJ94414.1|  predicted protein                                      174   2e-46    
gb|ABR17189.1|  unknown                                                 175   3e-46    
ref|XP_002534493.1|  ATP-binding cassette transporter, putative         173   3e-46    
gb|KHG09588.1|  ABC transporter G family member 25                      174   3e-46    
gb|KHN17077.1|  ABC transporter G family member 25                      173   3e-46    
ref|XP_006390724.1|  hypothetical protein EUTSA_v10019071mg             165   3e-46    
ref|XP_011094212.1|  PREDICTED: ABC transporter G family member 2...    173   3e-46    
gb|KDO74147.1|  hypothetical protein CISIN_1g010509mg                   172   4e-46    
ref|XP_009796796.1|  PREDICTED: ABC transporter G family member 2...    173   4e-46    
ref|XP_010105155.1|  ABC transporter G family member 25                 173   4e-46    
gb|KEH19433.1|  white-brown-complex ABC transporter family protein      173   5e-46    
ref|XP_011094211.1|  PREDICTED: ABC transporter G family member 2...    173   5e-46    
ref|XP_003535544.1|  PREDICTED: ABC transporter G family member 2...    173   6e-46    
ref|XP_010553412.1|  PREDICTED: ABC transporter G family member 2...    172   6e-46    
emb|CDX72849.1|  BnaC06g32970D                                          172   7e-46    
ref|XP_011094213.1|  PREDICTED: ABC transporter G family member 2...    172   8e-46    
ref|XP_011077784.1|  PREDICTED: ABC transporter G family member 22      173   8e-46    
gb|EMS65761.1|  ABC transporter G family member 22                      172   9e-46    
ref|XP_009796795.1|  PREDICTED: ABC transporter G family member 2...    172   9e-46    
gb|EMT07325.1|  ABC transporter G family member 22                      172   1e-45    
ref|XP_007019996.1|  ATP-binding casette family G25 isoform 1           168   1e-45    
ref|XP_004228604.1|  PREDICTED: ABC transporter G family member 2...    172   1e-45    
ref|XP_009105860.1|  PREDICTED: ABC transporter G family member 25      172   1e-45    
ref|XP_004978848.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    172   1e-45    
ref|XP_002325552.2|  ABC transporter family protein                     172   1e-45    
ref|XP_010553410.1|  PREDICTED: ABC transporter G family member 2...    172   1e-45    
ref|XP_006348422.1|  PREDICTED: ABC transporter G family member 2...    172   1e-45    
ref|XP_001763976.1|  ATP-binding cassette transporter, subfamily ...    171   2e-45    
gb|KCW50637.1|  hypothetical protein EUGRSUZ_J00337                     171   2e-45    
ref|XP_009375288.1|  PREDICTED: ABC transporter G family member 2...    170   2e-45    
ref|XP_010557969.1|  PREDICTED: ABC transporter G family member 2...    171   3e-45    
gb|KCW69055.1|  hypothetical protein EUGRSUZ_F02609                     169   3e-45    
ref|NP_001065886.1|  Os11g0177400                                       169   3e-45    
ref|XP_011001789.1|  PREDICTED: ABC transporter G family member 2...    171   3e-45    
gb|EEC74548.1|  hypothetical protein OsI_10084                          171   3e-45    
ref|XP_009622617.1|  PREDICTED: ABC transporter G family member 2...    171   3e-45    
ref|XP_007019995.1|  ATP-binding casette family G25                     171   3e-45    
ref|XP_011005152.1|  PREDICTED: ABC transporter G family member 2...    171   4e-45    
ref|XP_002322764.1|  ABC transporter family protein                     171   4e-45    
ref|NP_001049014.1|  Os03g0157400                                       171   4e-45    
gb|KDO40886.1|  hypothetical protein CISIN_1g046786mg                   170   5e-45    
ref|XP_008382026.1|  PREDICTED: ABC transporter G family member 2...    170   5e-45    
dbj|BAK06297.1|  predicted protein                                      171   5e-45    
dbj|BAJ88390.1|  predicted protein                                      171   6e-45    
gb|EYU38702.1|  hypothetical protein MIMGU_mgv1a001826mg                170   6e-45    
gb|AAK63861.1|AF389289_1  AT5g06530/F15M7_6                             167   6e-45    
gb|KFK41612.1|  hypothetical protein AALP_AA2G151000                    169   7e-45    
gb|KJB16513.1|  hypothetical protein B456_002G233500                    169   7e-45    
ref|XP_010471215.1|  PREDICTED: ABC transporter G family member 2...    169   7e-45    
ref|XP_007221428.1|  hypothetical protein PRUPE_ppa019498mg             165   8e-45    
gb|KHG09828.1|  ABC transporter G family member 22                      169   8e-45    
gb|ERM93644.1|  hypothetical protein AMTR_s00004p00153830               167   8e-45    
gb|KJB16514.1|  hypothetical protein B456_002G233500                    169   8e-45    
ref|XP_011042537.1|  PREDICTED: ABC transporter G family member 2...    170   9e-45    
ref|XP_010503974.1|  PREDICTED: ABC transporter G family member 2...    169   1e-44    
gb|KJB14994.1|  hypothetical protein B456_002G153900                    169   1e-44    
ref|XP_004497624.1|  PREDICTED: ABC transporter G family member 2...    169   1e-44    
ref|XP_002450415.1|  hypothetical protein SORBIDRAFT_05g004940          169   1e-44    
ref|XP_002465834.1|  hypothetical protein SORBIDRAFT_01g046620          170   1e-44    
ref|XP_010515694.1|  PREDICTED: ABC transporter G family member 27      169   1e-44    
gb|AAX96020.1|  ABC transporter protein, putative                       169   1e-44    
gb|KJB16511.1|  hypothetical protein B456_002G233500                    169   1e-44    
ref|XP_010503973.1|  PREDICTED: ABC transporter G family member 2...    169   1e-44    
ref|XP_011629211.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    167   2e-44    
gb|KJB16512.1|  hypothetical protein B456_002G233500                    169   2e-44    
gb|EEC67784.1|  hypothetical protein OsI_35326                          168   2e-44    
ref|XP_010503972.1|  PREDICTED: ABC transporter G family member 2...    169   2e-44    
gb|KEH41804.1|  white-brown-complex ABC transporter family protein      168   2e-44    
ref|XP_010064794.1|  PREDICTED: ABC transporter G family member 25      169   2e-44    
emb|CDX68292.1|  BnaA07g23320D                                          168   2e-44    
ref|XP_010519981.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    169   2e-44    
ref|XP_009104883.1|  PREDICTED: ABC transporter G family member 2...    168   3e-44    
ref|XP_010653240.1|  PREDICTED: ABC transporter G family member 2...    167   3e-44    
ref|XP_012065776.1|  PREDICTED: ABC transporter G family member 25      168   3e-44    
ref|XP_008380991.1|  PREDICTED: ABC transporter G family member 25      167   3e-44    
ref|XP_011074938.1|  PREDICTED: ABC transporter G family member 2...    167   4e-44    
gb|KJB36224.1|  hypothetical protein B456_006G147000                    167   4e-44    
ref|XP_004985645.1|  PREDICTED: ABC transporter G family member 2...    167   5e-44    
ref|XP_002524100.1|  ATP-binding cassette transporter, putative         168   5e-44    
ref|XP_010415916.1|  PREDICTED: ABC transporter G family member 2...    167   5e-44    
ref|XP_006292375.1|  hypothetical protein CARUB_v10018588mg             167   5e-44    
gb|KEH41805.1|  white-brown-complex ABC transporter family protein      167   6e-44    
ref|NP_001147989.1|  ATPase, coupled to transmembrane movement of...    167   6e-44    
ref|XP_006399125.1|  hypothetical protein EUTSA_v10012760mg             167   6e-44    
ref|XP_008452272.1|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    167   6e-44    
ref|XP_007028065.1|  White-brown-complex ABC transporter family i...    167   6e-44    
emb|CBI39105.3|  unnamed protein product                                167   7e-44    
ref|XP_008791161.1|  PREDICTED: ABC transporter G family member 2...    167   7e-44    
ref|XP_009345933.1|  PREDICTED: ABC transporter G family member 2...    167   7e-44    
ref|XP_004985644.1|  PREDICTED: ABC transporter G family member 2...    167   7e-44    
ref|XP_011659121.1|  PREDICTED: ABC transporter G family member 2...    166   8e-44    
ref|XP_010653238.1|  PREDICTED: ABC transporter G family member 2...    167   9e-44    
ref|NP_568169.1|  ABC transporter G family member 22                    167   9e-44    
emb|CDX95330.1|  BnaC04g28280D                                          167   1e-43    
sp|Q9FT51.1|AB27G_ARATH  RecName: Full=ABC transporter G family m...    167   1e-43    
ref|XP_004139680.2|  PREDICTED: ABC transporter G family member 2...    166   1e-43    
ref|XP_010428049.1|  PREDICTED: ABC transporter G family member 25      166   1e-43    
emb|CDX82199.1|  BnaC02g20910D                                          166   1e-43    
gb|KJB36225.1|  hypothetical protein B456_006G147000                    167   1e-43    
ref|XP_007028064.1|  White-brown-complex ABC transporter family i...    167   1e-43    
emb|CDY23205.1|  BnaA04g05540D                                          166   1e-43    
ref|XP_008392009.1|  PREDICTED: ABC transporter G family member 2...    166   1e-43    
emb|CDP16843.1|  unnamed protein product                                166   2e-43    
ref|XP_008664829.1|  PREDICTED: uncharacterized protein LOC100216...    166   2e-43    
ref|XP_011047134.1|  PREDICTED: ABC transporter G family member 2...    166   2e-43    
ref|NP_190799.2|  ABC transporter G family member 27                    166   2e-43    
ref|XP_009127887.1|  PREDICTED: ABC transporter G family member 2...    166   2e-43    
ref|XP_007145759.1|  hypothetical protein PHAVU_007G265300g             166   2e-43    
ref|XP_011047133.1|  PREDICTED: ABC transporter G family member 2...    166   2e-43    
ref|XP_002888855.1|  hypothetical protein ARALYDRAFT_476326             165   2e-43    
ref|XP_008664823.1|  PREDICTED: uncharacterized protein LOC100216...    166   2e-43    
emb|CDY03668.1|  BnaA02g15690D                                          165   2e-43    
ref|XP_010244001.1|  PREDICTED: ABC transporter G family member 2...    166   3e-43    
ref|XP_002873263.1|  abc transporter family protein                     166   3e-43    
ref|XP_008359521.1|  PREDICTED: ABC transporter G family member 2...    166   3e-43    
ref|XP_010244004.1|  PREDICTED: ABC transporter G family member 2...    166   3e-43    
gb|KHN10345.1|  ABC transporter G family member 27                      165   3e-43    
ref|XP_010521140.1|  PREDICTED: ABC transporter G family member 2...    165   3e-43    
ref|XP_010426847.1|  PREDICTED: ABC transporter G family member 2...    164   3e-43    
ref|XP_002876135.1|  abc transporter family protein                     165   4e-43    
ref|XP_008461920.1|  PREDICTED: ABC transporter G family member 25      164   4e-43    
ref|XP_006287123.1|  hypothetical protein CARUB_v10000295mg             165   4e-43    
ref|XP_009139468.1|  PREDICTED: ABC transporter G family member 27      165   5e-43    
ref|XP_003535833.2|  PREDICTED: ABC transporter G family member 2...    165   6e-43    
emb|CDY36671.1|  BnaCnng07730D                                          160   6e-43    
ref|XP_010426848.1|  PREDICTED: ABC transporter G family member 2...    164   6e-43    
ref|XP_003519092.1|  PREDICTED: ABC transporter G family member 2...    164   8e-43    
tpg|DAA43438.1|  TPA: hypothetical protein ZEAMMB73_582925              166   8e-43    
gb|KEH41808.1|  white-brown-complex ABC transporter family protein      163   8e-43    
ref|XP_006663256.1|  PREDICTED: ABC transporter G family member 2...    162   1e-42    
ref|XP_008790027.1|  PREDICTED: ABC transporter G family member 2...    164   1e-42    
ref|XP_006575266.1|  PREDICTED: ABC transporter G family member 2...    164   1e-42    
gb|KJB14993.1|  hypothetical protein B456_002G153900                    164   1e-42    
ref|XP_008790010.1|  PREDICTED: ABC transporter G family member 2...    164   1e-42    
emb|CDY14079.1|  BnaC02g01960D                                          164   1e-42    
emb|CDX70095.1|  BnaA10g24440D                                          164   1e-42    
ref|XP_008790019.1|  PREDICTED: ABC transporter G family member 2...    164   1e-42    
emb|CDP08055.1|  unnamed protein product                                163   1e-42    
gb|KHG30511.1|  ABC transporter G family member 22                      163   2e-42    
ref|XP_009122263.1|  PREDICTED: ABC transporter G family member 2...    163   2e-42    
ref|XP_009122262.1|  PREDICTED: ABC transporter G family member 2...    163   2e-42    
emb|CDX98933.1|  BnaC09g49020D                                          163   2e-42    
ref|XP_011627127.1|  PREDICTED: ABC transporter G family member 22      163   2e-42    
ref|XP_007163008.1|  hypothetical protein PHAVU_001G198400g             162   3e-42    
gb|ERN16078.1|  hypothetical protein AMTR_s00030p00144980               163   3e-42    
ref|XP_008237152.1|  PREDICTED: ABC transporter G family member 25      162   3e-42    
emb|CDY04991.1|  BnaAnng01730D                                          162   3e-42    
ref|XP_006403815.1|  hypothetical protein EUTSA_v10010138mg             163   4e-42    
ref|XP_009125649.1|  PREDICTED: ABC transporter G family member 2...    162   4e-42    
ref|XP_002268373.1|  PREDICTED: ABC transporter G family member 25      162   4e-42    
ref|XP_009348556.1|  PREDICTED: ABC transporter G family member 2...    161   5e-42    
ref|XP_012074259.1|  PREDICTED: ABC transporter G family member 22      162   5e-42    
ref|XP_010036577.1|  PREDICTED: ABC transporter G family member 2...    162   6e-42    
ref|XP_010248096.1|  PREDICTED: ABC transporter G family member 2...    161   7e-42    
ref|XP_007163009.1|  hypothetical protein PHAVU_001G198400g             162   7e-42    
ref|XP_010491222.1|  PREDICTED: ABC transporter G family member 2...    162   8e-42    
ref|XP_010452592.1|  PREDICTED: ABC transporter G family member 22      162   8e-42    
ref|XP_010423326.1|  PREDICTED: ABC transporter G family member 2...    162   8e-42    
ref|XP_010917903.1|  PREDICTED: ABC transporter G family member 2...    161   9e-42    
ref|XP_009412322.1|  PREDICTED: ABC transporter G family member 2...    160   1e-41    
gb|AAG52231.1|AC021665_14  putative ABC transporter; 60211-54925        160   1e-41    
dbj|BAH57205.1|  AT1G71960                                              160   1e-41    
ref|XP_010248083.1|  PREDICTED: ABC transporter G family member 2...    161   1e-41    
emb|CBI18157.3|  unnamed protein product                                160   1e-41    
gb|KDO83899.1|  hypothetical protein CISIN_1g0057541mg                  156   1e-41    
gb|AAK92745.1|  putative ABC transporter protein                        160   2e-41    
ref|XP_009348549.1|  PREDICTED: ABC transporter G family member 2...    160   2e-41    
ref|XP_006434602.1|  hypothetical protein CICLE_v10003863mg             156   2e-41    
ref|NP_565030.1|  ABC transporter G family member 25                    160   2e-41    
ref|XP_010244002.1|  PREDICTED: ABC transporter G family member 2...    161   2e-41    
ref|XP_002526137.1|  ATP-binding cassette transporter, putative         159   3e-41    
ref|XP_009415591.1|  PREDICTED: ABC transporter G family member 2...    159   3e-41    
ref|XP_009412321.1|  PREDICTED: ABC transporter G family member 2...    160   4e-41    
ref|XP_012066058.1|  PREDICTED: ABC transporter G family member 2...    159   4e-41    
gb|KDP43029.1|  hypothetical protein JCGZ_25215                         159   6e-41    
ref|XP_010678675.1|  PREDICTED: ABC transporter G family member 25      158   1e-40    
gb|KFK40221.1|  hypothetical protein AALP_AA3G346400                    157   1e-40    
ref|XP_010911944.1|  PREDICTED: ABC transporter G family member 2...    157   2e-40    
ref|XP_009362644.1|  PREDICTED: ABC transporter G family member 2...    157   2e-40    
ref|XP_009362643.1|  PREDICTED: ABC transporter G family member 2...    156   5e-40    
ref|XP_006473186.1|  PREDICTED: ABC transporter G family member 2...    156   6e-40    
ref|XP_003577777.2|  PREDICTED: LOW QUALITY PROTEIN: ABC transpor...    155   6e-40    
ref|XP_009362642.1|  PREDICTED: ABC transporter G family member 2...    156   6e-40    
ref|XP_008442971.1|  PREDICTED: ABC transporter G family member 2...    155   1e-39    
ref|XP_008442969.1|  PREDICTED: ABC transporter G family member 2...    155   1e-39    
ref|XP_006649428.1|  PREDICTED: ABC transporter G family member 2...    154   2e-39    
emb|CDP10560.1|  unnamed protein product                                155   2e-39    
ref|XP_010247278.1|  PREDICTED: ABC transporter G family member 2...    155   3e-39    
ref|XP_004136536.1|  PREDICTED: ABC transporter G family member 22      154   3e-39    
ref|XP_009406088.1|  PREDICTED: ABC transporter G family member 2...    152   6e-39    
emb|CBI35490.3|  unnamed protein product                                154   9e-39    
ref|XP_002263430.1|  PREDICTED: ABC transporter G family member 2...    153   1e-38    
gb|KDO70706.1|  hypothetical protein CISIN_1g0045372mg                  151   1e-38    
ref|XP_006430004.1|  hypothetical protein CICLE_v10011143mg             151   1e-38    
gb|KDO70704.1|  hypothetical protein CISIN_1g0045372mg                  151   2e-38    
emb|CDY12359.1|  BnaC08g08460D                                          146   2e-38    
ref|XP_006481645.1|  PREDICTED: ABC transporter G family member 2...    151   5e-38    
ref|XP_010680137.1|  PREDICTED: ABC transporter G family member 2...    151   6e-38    
ref|XP_006430003.1|  hypothetical protein CICLE_v10011143mg             151   6e-38    
ref|XP_009799080.1|  PREDICTED: ABC transporter G family member 2...    150   2e-37    
ref|XP_010535206.1|  PREDICTED: ABC transporter G family member 2...    148   2e-37    
ref|XP_007019433.1|  White-brown-complex ABC transporter family         149   6e-37    
gb|EPS59306.1|  hypothetical protein M569_15501                         146   9e-37    
ref|XP_008241115.1|  PREDICTED: ABC transporter G family member 2...    143   1e-35    
ref|XP_003521505.1|  PREDICTED: ABC transporter G family member 2...    144   2e-35    
ref|XP_006362828.1|  PREDICTED: ABC transporter G family member 2...    144   2e-35    
gb|EPS64050.1|  hypothetical protein M569_10730                         142   3e-35    
ref|XP_002309268.1|  ABC transporter family protein                     143   4e-35    
gb|AEP14526.1|  ABC transporter                                         137   6e-35    
ref|XP_008241114.1|  PREDICTED: ABC transporter G family member 2...    142   7e-35    
ref|XP_007204637.1|  hypothetical protein PRUPE_ppa001882mg             142   8e-35    
ref|XP_008241111.1|  PREDICTED: ABC transporter G family member 2...    142   8e-35    
ref|XP_006604672.1|  PREDICTED: ABC transporter G family member 2...    140   2e-34    
ref|XP_006604673.1|  PREDICTED: ABC transporter G family member 2...    139   2e-34    
ref|XP_006346115.1|  PREDICTED: ABC transporter G family member 2...    140   2e-34    
gb|KHN43592.1|  ABC transporter G family member 22                      139   6e-34    
ref|XP_003553629.1|  PREDICTED: ABC transporter G family member 2...    139   9e-34    



>emb|CDP07185.1| unnamed protein product [Coffea canephora]
Length=655

 Score =   340 bits (873),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 182/203 (90%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYP+YNAVFTFPQERRMLIKERSSGMY LSSYFLAKTVGDLPLELALPTAFTFI+YWMG
Sbjct  453  GFYPIYNAVFTFPQERRMLIKERSSGMYHLSSYFLAKTVGDLPLELALPTAFTFIIYWMG  512

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKPEP TF LSLLIVL+SVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYY+Q
Sbjct  513  GLKPEPATFILSLLIVLYSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYIQ  572

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+YCFKLLLGVQYN NDYYECSKG YCRVADFP VK+VG NH+W+D
Sbjct  573  QIPAFIVWLKYLSYSYYCFKLLLGVQYNGNDYYECSKGVYCRVADFPYVKSVGLNHLWID  632

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VS+MA+M+VGYRFIAYLAL RVR
Sbjct  633  VSIMALMMVGYRFIAYLALRRVR  655



>ref|XP_009605917.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
tomentosiformis]
Length=633

 Score =   333 bits (855),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLP+ELALPTAFTFILYWMG
Sbjct  431  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPIELALPTAFTFILYWMG  490

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK  P TF LSL+IVL+SVLVSQSLGLA+GA+LMDVKQATTLASVTTLVFLIAGGYY+Q
Sbjct  491  GLKANPATFILSLVIVLYSVLVSQSLGLAYGAMLMDVKQATTLASVTTLVFLIAGGYYIQ  550

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYNDNDYYECSKG YC+VADFP +K+VG N+MW+D
Sbjct  551  QIPPFIVWLKYLSYSYYCYKLLLGVQYNDNDYYECSKGVYCQVADFPAIKSVGLNNMWMD  610

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR +AYLAL+RVR
Sbjct  611  VLIMALMLVGYRLLAYLALNRVR  633



>ref|XP_009757349.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
sylvestris]
Length=630

 Score =   331 bits (848),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLP+ELALPTAFTFILYWMG
Sbjct  428  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPIELALPTAFTFILYWMG  487

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK  P TF LSLLIVL+SVLVSQSLGLA+GA+LMDVKQATTLASVTTLVFLIAGGYY+Q
Sbjct  488  GLKANPATFILSLLIVLYSVLVSQSLGLAYGAMLMDVKQATTLASVTTLVFLIAGGYYIQ  547

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQY D DYYECSKG YCRVADFP +K+VG N+MW+D
Sbjct  548  QIPPFIVWLKYLSYSYYCYKLLLGVQYKDKDYYECSKGVYCRVADFPAIKSVGLNNMWMD  607

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR +AYLAL+RVR
Sbjct  608  VLIMALMLVGYRLVAYLALNRVR  630



>gb|KHN28317.1| ABC transporter G family member 14 [Glycine soja]
Length=659

 Score =   331 bits (849),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+T+GDLPLELALPTAF FI+YWMG
Sbjct  457  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTIGDLPLELALPTAFVFIIYWMG  516

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL+SV+VSQSLGLAFGAILM+VKQATTLASVTTLVFLIAGGYY+Q
Sbjct  517  GLKPDPMTFILSLLVVLYSVVVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQ  576

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYN+NDYYECSK   C+VADFP +K++G NH+WVD
Sbjct  577  QIPPFIVWLKYLSYSYYCYKLLLGVQYNENDYYECSKEELCKVADFPPIKSMGLNHLWVD  636

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MAMMLVGYR +AYLALHRVR
Sbjct  637  VCIMAMMLVGYRLVAYLALHRVR  659



>ref|XP_003517105.2| PREDICTED: ABC transporter G family member 14-like [Glycine max]
Length=659

 Score =   331 bits (849),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 173/203 (85%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+T+GDLPLELALPTAF FI+YWMG
Sbjct  457  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTIGDLPLELALPTAFVFIIYWMG  516

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL+SV+VSQSLGLAFGAILM+VKQATTLASVTTLVFLIAGGYY+Q
Sbjct  517  GLKPDPMTFILSLLVVLYSVVVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQ  576

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYN+NDYYECSK   C+VADFP +K++G NH+WVD
Sbjct  577  QIPPFIVWLKYLSYSYYCYKLLLGVQYNENDYYECSKEELCKVADFPPIKSMGLNHLWVD  636

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MAMMLVGYR +AYLALHRVR
Sbjct  637  VCIMAMMLVGYRLVAYLALHRVR  659



>ref|XP_004246010.1| PREDICTED: ABC transporter G family member 14 [Solanum lycopersicum]
Length=646

 Score =   331 bits (848),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG
Sbjct  444  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  503

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK  P TF LSLL+VL+SVLVSQSLGLA+GA+LMDVKQATTLASVTTLVFLIAGGYY+Q
Sbjct  504  GLKANPATFILSLLVVLYSVLVSQSLGLAYGAMLMDVKQATTLASVTTLVFLIAGGYYIQ  563

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYNDNDYYECSKG YC+VA+FP +K++G N+MW+D
Sbjct  564  QIPPFIVWLKYLSYSYYCYKLLLGVQYNDNDYYECSKGVYCQVAEFPAIKSIGLNNMWMD  623

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR IAYLAL+RVR
Sbjct  624  VFIMALMLVGYRLIAYLALNRVR  646



>ref|XP_006359961.1| PREDICTED: ABC transporter G family member 14-like [Solanum tuberosum]
Length=646

 Score =   331 bits (848),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 176/203 (87%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG
Sbjct  444  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  503

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK  P TF LSLL+VL+SVLVSQSLGLA+GA+LMDVKQATTLASVTTLVFLIAGGYY+Q
Sbjct  504  GLKANPATFILSLLVVLYSVLVSQSLGLAYGAMLMDVKQATTLASVTTLVFLIAGGYYIQ  563

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYNDNDYYECSKG YC+VA+FP +K++G N+MW+D
Sbjct  564  QIPPFIVWLKYLSYSYYCYKLLLGVQYNDNDYYECSKGVYCQVAEFPAIKSIGLNNMWMD  623

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR IAYLAL+RVR
Sbjct  624  VFIMALMLVGYRLIAYLALNRVR  646



>ref|XP_003537708.1| PREDICTED: ABC transporter G family member 14-like [Glycine max]
 gb|KHN41781.1| ABC transporter G family member 14 [Glycine soja]
Length=660

 Score =   330 bits (847),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+T+GDLPLELALPTAF FI+YWMG
Sbjct  458  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTIGDLPLELALPTAFVFIIYWMG  517

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL+SV+VSQSLGLAFGAILM+VKQATTLASVTTLVFLIAGGYY+Q
Sbjct  518  GLKPDPVTFILSLLVVLYSVVVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQ  577

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYN+NDYY+CS G  C+VADFP +K++G NH+WVD
Sbjct  578  QIPPFIVWLKYLSYSYYCYKLLLGVQYNENDYYQCSTGELCKVADFPPIKSMGLNHLWVD  637

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MAMMLVGYR +AYLALHRVR
Sbjct  638  VCIMAMMLVGYRLVAYLALHRVR  660



>ref|XP_007158067.1| hypothetical protein PHAVU_002G121200g [Phaseolus vulgaris]
 gb|ESW30061.1| hypothetical protein PHAVU_002G121200g [Phaseolus vulgaris]
Length=658

 Score =   330 bits (846),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 194/203 (96%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+T+GDLPLELALPTAF FI+YWMG
Sbjct  456  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTIGDLPLELALPTAFVFIIYWMG  515

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL+SV+VSQSLGLAFGAILM++KQATTLASVTTLVFLIAGGYY+Q
Sbjct  516  GLKPDPVTFILSLLVVLYSVVVSQSLGLAFGAILMEIKQATTLASVTTLVFLIAGGYYIQ  575

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYN+NDYYECSKG  C+VADFP +K++G NH+WVD
Sbjct  576  QIPPFIVWLKYLSYSYYCYKLLLGVQYNENDYYECSKGELCKVADFPPIKSMGLNHLWVD  635

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR +AY ALHRVR
Sbjct  636  VFIMALMLVGYRLVAYFALHRVR  658



>ref|XP_011082193.1| PREDICTED: ABC transporter G family member 14-like [Sesamum indicum]
Length=653

 Score =   327 bits (837),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+TVGDLPLELALPTAFTFI YWMG
Sbjct  451  GFYPLYNAVFTFPQERNMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFTFIFYWMG  510

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VLFSVLVSQSLGLAFGA+LMDVKQA TLASVTT+VFLIAGGYYV+
Sbjct  511  GLKPDPATFILSLLVVLFSVLVSQSLGLAFGALLMDVKQAATLASVTTMVFLIAGGYYVR  570

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IPPFI WL+YLSYS+YC++LLLG+QYN+NDYYEC+KG YCRVAD+P +KAVG +H+W+D
Sbjct  571  HIPPFIAWLRYLSYSYYCYRLLLGIQYNENDYYECAKGAYCRVADYPPIKAVGLSHLWID  630

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            +S+M +MLVGYRFIAYLALHRVR
Sbjct  631  ISIMMLMLVGYRFIAYLALHRVR  653



>ref|XP_002270533.2| PREDICTED: ABC transporter G family member 14 [Vitis vinifera]
 emb|CBI29188.3| unnamed protein product [Vitis vinifera]
Length=657

 Score =   325 bits (834),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+T GDLPLELALPTAF  I+YWMG
Sbjct  453  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVIIIYWMG  512

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLVFLIAGGYYVQ
Sbjct  513  GLKPDPITFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  572

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY+++DYYECSKG +CRV DFP VK+VG NH+W+D
Sbjct  573  QIPPFIVWLKYLSYSYYCYKLLLGIQYSEDDYYECSKGVFCRVVDFPAVKSVGLNHLWID  632

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR +AYLALHRV+
Sbjct  633  VCIMALMLVGYRLVAYLALHRVQ  655



>gb|AES95438.2| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=638

 Score =   325 bits (833),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+T+GDLPLELALPTAF  ILYWMG
Sbjct  436  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTIGDLPLELALPTAFVIILYWMG  495

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL+SV+VSQSLGLAFGAILM++KQATTLASVTTLVFLIAGGYY+Q
Sbjct  496  GLKPDPVTFILSLLVVLYSVVVSQSLGLAFGAILMEIKQATTLASVTTLVFLIAGGYYIQ  555

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYN+NDYYECSKG  C+V DFP +K++G NHMWVD
Sbjct  556  QIPPFIVWLKYLSYSYYCYKLLLGVQYNENDYYECSKGELCKVMDFPPIKSMGLNHMWVD  615

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+ML GYR +AYLAL RVR
Sbjct  616  VFIMALMLFGYRLVAYLALRRVR  638



>ref|XP_003612480.1| ABC transporter-like protein [Medicago truncatula]
Length=652

 Score =   325 bits (833),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+T+GDLPLELALPTAF  ILYWMG
Sbjct  450  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTIGDLPLELALPTAFVIILYWMG  509

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL+SV+VSQSLGLAFGAILM++KQATTLASVTTLVFLIAGGYY+Q
Sbjct  510  GLKPDPVTFILSLLVVLYSVVVSQSLGLAFGAILMEIKQATTLASVTTLVFLIAGGYYIQ  569

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYN+NDYYECSKG  C+V DFP +K++G NHMWVD
Sbjct  570  QIPPFIVWLKYLSYSYYCYKLLLGVQYNENDYYECSKGELCKVMDFPPIKSMGLNHMWVD  629

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+ML GYR +AYLAL RVR
Sbjct  630  VFIMALMLFGYRLVAYLALRRVR  652



>gb|KDP37809.1| hypothetical protein JCGZ_06711 [Jatropha curcas]
Length=290

 Score =   313 bits (802),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKER+SGMY LSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  86   GFYPLYNAVFTFPQERRMLIKERASGMYHLSSYFLARTFGDLPLELALPTAFVFIIYWMG  145

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK +P+TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLVFLIAGGYYVQ
Sbjct  146  GLKADPITFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  205

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+YC+KLLLGVQY+++DYYECSKG  CRV DFP VK++G NH+WVD
Sbjct  206  QIPTFIVWLKYLSYSYYCYKLLLGVQYSEDDYYECSKGVLCRVGDFPAVKSMGLNHLWVD  265

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR +AYLALHRV+
Sbjct  266  VCIMALMLVGYRLVAYLALHRVQ  288



>ref|XP_010275138.1| PREDICTED: ABC transporter G family member 14 [Nelumbo nucifera]
Length=654

 Score =   325 bits (832),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 172/200 (86%), Positives = 190/200 (95%), Gaps = 0/200 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+TVGDLP+ELALPTAFT I+YWMGGLK
Sbjct  453  PLYNAVFTFPQERLMLIKERSSGMYRLSSYFLARTVGDLPMELALPTAFTIIIYWMGGLK  512

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P+  TF LS LIVL++VLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP
Sbjct  513  PDFTTFILSWLIVLYNVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  572

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI+WLKYLSYS+YC+K+LLGVQY++NDYYECS+G +CRVA+FP VKAVG NH+WVDVS+
Sbjct  573  PFIVWLKYLSYSYYCYKMLLGVQYSENDYYECSEGVFCRVAEFPAVKAVGLNHLWVDVSI  632

Query  201  MAMMLVGYRFIAYLALHRVR  142
            MAMMLVGYR IAY+ALHRVR
Sbjct  633  MAMMLVGYRLIAYMALHRVR  652



>emb|CAN70956.1| hypothetical protein VITISV_028138 [Vitis vinifera]
Length=677

 Score =   325 bits (833),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+T GDLPLELALPTAF  I+YWMG
Sbjct  473  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVIIIYWMG  532

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLVFLIAGGYYVQ
Sbjct  533  GLKPDPITFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  592

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY+++DYYECSKG +CRV DFP VK+VG NH+W+D
Sbjct  593  QIPPFIVWLKYLSYSYYCYKLLLGIQYSEDDYYECSKGVFCRVVDFPAVKSVGLNHLWID  652

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR +AYLALHRV+
Sbjct  653  VCIMALMLVGYRLVAYLALHRVQ  675



>ref|XP_010540713.1| PREDICTED: ABC transporter G family member 14 [Tarenaya hassleriana]
Length=649

 Score =   323 bits (829),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ +GDLPLELALPTAF FI+YWMG
Sbjct  445  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNIGDLPLELALPTAFVFIIYWMG  504

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLV+Q LGLAFGA LM++KQATTLASVTTLVFLIAGGYYVQ
Sbjct  505  GLKPDPTTFILSLLVVLYNVLVAQGLGLAFGAFLMNIKQATTLASVTTLVFLIAGGYYVQ  564

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IPPFI+WLKYLSYS+YC+KLLLGVQY+D+DYYECSKG +CRV DFP VK++G N +W+D
Sbjct  565  HIPPFIVWLKYLSYSYYCYKLLLGVQYSDDDYYECSKGVWCRVGDFPAVKSMGLNSLWID  624

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VSVMA+MLVGYRFIAY+ALHRV+
Sbjct  625  VSVMALMLVGYRFIAYMALHRVK  647



>gb|KJB51502.1| hypothetical protein B456_008G219500 [Gossypium raimondii]
Length=657

 Score =   323 bits (828),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERR+LIKERSSGMYRLSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  453  GFYPLYNAVFTFPQERRILIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMG  512

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL++VLVSQSLGLA GAILMDVKQATTLASVTTLVFLIAGGYYVQ
Sbjct  513  GLKPDPVTFILSLLVVLYNVLVSQSLGLAIGAILMDVKQATTLASVTTLVFLIAGGYYVQ  572

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+YC+KLLLGVQY ++DYYECSKG +CRV D P +K++G +HMW+D
Sbjct  573  QIPAFIVWLKYLSYSYYCYKLLLGVQYKEDDYYECSKGVWCRVGDLPAIKSMGLSHMWID  632

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VS+MA+MLVGYR IAY+ALHRVR
Sbjct  633  VSIMALMLVGYRLIAYMALHRVR  655



>gb|KHN16959.1| ABC transporter G family member 14 [Glycine soja]
Length=569

 Score =   320 bits (821),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+TVGDLP+ELALPTAF  I+YWMG
Sbjct  367  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTVGDLPIELALPTAFVIIIYWMG  426

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP P+TF LSLL+VL+SVLVSQSLGLAFGAILM+VKQATTLASVTTLVFLIAGGYY+Q
Sbjct  427  GLKPHPVTFLLSLLVVLYSVLVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQ  486

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI WLKYLSYS+YC+KLL+GVQYND+D+YECSKG  C+V +FP +K+VG NH+WVD
Sbjct  487  QIPPFIEWLKYLSYSYYCYKLLVGVQYNDDDHYECSKGVLCKVGEFPPIKSVGLNHLWVD  546

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V++MA+MLVGYR IAYLAL R+R
Sbjct  547  VAIMALMLVGYRLIAYLALQRMR  569



>ref|XP_003548769.1| PREDICTED: ABC transporter G family member 14-like [Glycine max]
 gb|KHN30742.1| ABC transporter G family member 14 [Glycine soja]
Length=651

 Score =   322 bits (826),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+TVGDLP+ELALPTAF  I+YWMG
Sbjct  449  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTVGDLPIELALPTAFVIIIYWMG  508

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP P+TF LSLL+VL+SVLVSQSLGLAFGAILM+VKQATTLASVTTLVFLIAGGYY+Q
Sbjct  509  GLKPHPVTFLLSLLVVLYSVLVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQ  568

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI WLKYLSYS+YC+KLL+GVQ+ND+DYYECSKG  C+V +FP +K+VG NH+WVD
Sbjct  569  QIPPFIEWLKYLSYSYYCYKLLVGVQFNDDDYYECSKGVLCKVGEFPQIKSVGLNHLWVD  628

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V++MAMMLVGYR IAYLAL RVR
Sbjct  629  VTIMAMMLVGYRLIAYLALLRVR  651



>ref|XP_012072677.1| PREDICTED: ABC transporter G family member 14-like [Jatropha 
curcas]
Length=355

 Score =   313 bits (802),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKER+SGMY LSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  151  GFYPLYNAVFTFPQERRMLIKERASGMYHLSSYFLARTFGDLPLELALPTAFVFIIYWMG  210

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK +P+TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLVFLIAGGYYVQ
Sbjct  211  GLKADPITFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  270

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+YC+KLLLGVQY+++DYYECSKG  CRV DFP VK++G NH+WVD
Sbjct  271  QIPTFIVWLKYLSYSYYCYKLLLGVQYSEDDYYECSKGVLCRVGDFPAVKSMGLNHLWVD  330

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR +AYLALHRV+
Sbjct  331  VCIMALMLVGYRLVAYLALHRVQ  353



>ref|XP_010518955.1| PREDICTED: ABC transporter G family member 14 [Tarenaya hassleriana]
Length=631

 Score =   322 bits (824),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ +GDLPLELALPTAF FI+YWMG
Sbjct  427  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNIGDLPLELALPTAFVFIIYWMG  486

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLV+Q LGLAFGA+LM++KQATTLASVTTLVFLIAGGYYVQ
Sbjct  487  GLKPDPTTFILSLLVVLYNVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  546

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+YC+KLLLGVQY+D+DYYECSKG +CRV DFP VK++G N++W+D
Sbjct  547  QIPSFIVWLKYLSYSYYCYKLLLGVQYSDDDYYECSKGVWCRVGDFPAVKSMGLNNLWID  606

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VSVMA+MLVGYR +AY+ALHRV+
Sbjct  607  VSVMALMLVGYRLVAYMALHRVK  629



>gb|KHG20314.1| ABC transporter G family member 14 [Gossypium arboreum]
Length=657

 Score =   322 bits (825),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+T GDLPLELALPTAF FI+YWM 
Sbjct  453  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMA  512

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL++VLVSQSLGLA GAILMDVKQATTLASVTTLVFLIAGGYYVQ
Sbjct  513  GLKPDPVTFILSLLVVLYNVLVSQSLGLAIGAILMDVKQATTLASVTTLVFLIAGGYYVQ  572

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+YC+KLLLGVQY ++DYYECSKG +CRV D P +K++G +HMW+D
Sbjct  573  QIPAFIVWLKYLSYSYYCYKLLLGVQYKEDDYYECSKGVWCRVGDLPAIKSMGLSHMWID  632

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VS+MA+MLVGYR IAY+ALHRVR
Sbjct  633  VSIMALMLVGYRLIAYMALHRVR  655



>ref|XP_007040852.1| ATP-binding cassette 14 [Theobroma cacao]
 gb|EOY25353.1| ATP-binding cassette 14 [Theobroma cacao]
Length=656

 Score =   322 bits (824),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  452  GFYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMG  511

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P+TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLVFLIAGGYYVQ
Sbjct  512  GLKPDPVTFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  571

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+YC+KLLLGVQYN++DYYECSKG  CRV D P +K++G NH+WVD
Sbjct  572  QIPAFIVWLKYLSYSYYCYKLLLGVQYNEDDYYECSKGVLCRVGDLPAIKSMGLNHLWVD  631

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR IAY+ALHRVR
Sbjct  632  VCIMALMLVGYRLIAYMALHRVR  654



>ref|XP_009114967.1| PREDICTED: ABC transporter G family member 14 [Brassica rapa]
 emb|CDY49155.1| BnaA09g25160D [Brassica napus]
Length=649

 Score =   321 bits (823),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ VGDLPLELALPTAF FI+YWMG
Sbjct  445  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMG  504

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLVFLIAGGYYVQ
Sbjct  505  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  564

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY D+DYYECS+G +CRV DFPG+KA+G N++W+D
Sbjct  565  QIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDYYECSEGVWCRVGDFPGIKAMGLNNLWID  624

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR IAY+ALHRV+
Sbjct  625  VFVMGVMLVGYRLIAYMALHRVK  647



>ref|XP_004512314.1| PREDICTED: ABC transporter G family member 14-like [Cicer arietinum]
Length=661

 Score =   321 bits (823),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+T+GDLPLELALPTAF  ILYWMG
Sbjct  459  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTIGDLPLELALPTAFVIILYWMG  518

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+ +TF LSLL+VL+SV+VSQSLGLAFGAILM+VKQATTLASVTTLVFLIAGGYY+Q
Sbjct  519  GLKPDLVTFILSLLVVLYSVVVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQ  578

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYN+NDYYECSKG  C+V DF  +K++G NHMWVD
Sbjct  579  QIPPFIVWLKYLSYSYYCYKLLLGVQYNENDYYECSKGELCKVVDFGPIKSMGLNHMWVD  638

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR +AY ALHRVR
Sbjct  639  VFIMALMLVGYRLVAYFALHRVR  661



>ref|XP_007156346.1| hypothetical protein PHAVU_003G278800g [Phaseolus vulgaris]
 gb|ESW28340.1| hypothetical protein PHAVU_003G278800g [Phaseolus vulgaris]
Length=648

 Score =   321 bits (822),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 171/203 (84%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+TVGDLP+ELALPTAF FI+YWMG
Sbjct  446  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTVGDLPIELALPTAFVFIIYWMG  505

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GL P PLTF LSLL+VL+SVLVSQSLGLAFGAILM+VKQATTLASVTTLVFLIAGGYY+Q
Sbjct  506  GLNPHPLTFFLSLLVVLYSVLVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQ  565

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI WLKYLSYS+YC+KLL+GVQY D+DYYECSKG  C+V +FP +K+VG NH+WVD
Sbjct  566  QIPPFIEWLKYLSYSYYCYKLLVGVQYMDDDYYECSKGVLCKVGEFPPIKSVGLNHLWVD  625

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            +S+MAMMLVGYR +AYLAL RVR
Sbjct  626  MSIMAMMLVGYRLVAYLALQRVR  648



>ref|XP_011071699.1| PREDICTED: ABC transporter G family member 14-like [Sesamum indicum]
Length=653

 Score =   321 bits (822),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 168/203 (83%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLS+YFLA+TVGDLP+ELALPTAFTFI YWMG
Sbjct  451  GFYPLYNAVFTFPQERNMLIKERSSGMYRLSAYFLARTVGDLPMELALPTAFTFIFYWMG  510

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P +F LSLL+VLFSVLVSQSLGLAFGAILMDVKQA TLASVTTLVFLIAGGYYV+
Sbjct  511  GLKPDPSSFVLSLLVVLFSVLVSQSLGLAFGAILMDVKQAATLASVTTLVFLIAGGYYVR  570

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGV YN++DYYEC+K  YCRV+D+P +K+VG +H+W+D
Sbjct  571  QIPPFIVWLKYLSYSYYCYKLLLGVHYNEDDYYECAKEVYCRVSDYPAIKSVGLSHLWMD  630

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            +S+M +MLVGYRFIAY+ALHRVR
Sbjct  631  MSIMVLMLVGYRFIAYIALHRVR  653



>ref|XP_009145231.1| PREDICTED: ABC transporter G family member 14-like [Brassica 
rapa]
 emb|CDY50951.1| BnaA05g36020D [Brassica napus]
Length=641

 Score =   320 bits (820),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ +GDLPLELALPTAF FI+YWMG
Sbjct  437  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNIGDLPLELALPTAFVFIIYWMG  496

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLVFLIAGGYYVQ
Sbjct  497  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  556

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY+D DYYECS+G +CRV DFPG+KA+G N++W+D
Sbjct  557  QIPPFIVWLKYLSYSYYCYKLLLGIQYSDEDYYECSEGVWCRVGDFPGIKAMGLNNLWID  616

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR +AY+ALHRV+
Sbjct  617  VLVMGVMLVGYRLMAYMALHRVK  639



>ref|XP_003547739.1| PREDICTED: ABC transporter G family member 14-like [Glycine max]
Length=656

 Score =   320 bits (821),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+TVGDLP+ELALPTAF  I+YWMG
Sbjct  454  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTVGDLPIELALPTAFAIIIYWMG  513

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP P+TF LSLL+VL+SVLVSQSLGLAFGAILM+VKQATTLASVTTLVFLIAGGYY+Q
Sbjct  514  GLKPHPVTFLLSLLVVLYSVLVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYYIQ  573

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI WLKYLSYS+YC+KLL+GVQYND+D+YECSKG  C+V +FP +K+VG NH+WVD
Sbjct  574  QIPPFIEWLKYLSYSYYCYKLLVGVQYNDDDHYECSKGVLCKVGEFPPIKSVGLNHLWVD  633

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V++MA+MLVGYR IAYLAL R+R
Sbjct  634  VAIMALMLVGYRLIAYLALQRMR  656



>ref|XP_010478591.1| PREDICTED: ABC transporter G family member 14 [Camelina sativa]
Length=649

 Score =   320 bits (820),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ VGDLPLELALPTAF FI+YWMG
Sbjct  445  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMG  504

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLVFLIAGGYYVQ
Sbjct  505  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  564

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY D+DYYECSKG +CRV DFP +K++G N++W+D
Sbjct  565  QIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLNNLWID  624

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR IAY+ALHRV+
Sbjct  625  VFVMGVMLVGYRLIAYMALHRVK  647



>emb|CDY47690.1| BnaCnng15320D [Brassica napus]
Length=641

 Score =   320 bits (819),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ +GDLPLELALPTAF FI+YWMG
Sbjct  437  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNIGDLPLELALPTAFVFIIYWMG  496

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLVFLIAGGYYVQ
Sbjct  497  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  556

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY D DYYECS+G +CRV DFPG+KA+G N++W+D
Sbjct  557  QIPPFIVWLKYLSYSYYCYKLLLGIQYTDEDYYECSEGVWCRVGDFPGIKAMGLNNLWID  616

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR +AY+ALHRV+
Sbjct  617  VLVMGVMLVGYRLMAYMALHRVK  639



>ref|XP_010499718.1| PREDICTED: ABC transporter G family member 14-like [Camelina 
sativa]
Length=649

 Score =   320 bits (820),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ VGDLPLELALPTAF FI+YWMG
Sbjct  445  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMG  504

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLVFLIAGGYYVQ
Sbjct  505  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  564

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY D+DYYECSKG +CRV DFP +K++G N++W+D
Sbjct  565  QIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLNNLWID  624

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR IAY+ALHRV+
Sbjct  625  VFVMGVMLVGYRLIAYMALHRVK  647



>ref|XP_006303926.1| hypothetical protein CARUB_v10008545mg [Capsella rubella]
 gb|EOA36824.1| hypothetical protein CARUB_v10008545mg [Capsella rubella]
Length=648

 Score =   320 bits (819),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 164/203 (81%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ VGDLPLELALPTAF FI+YWMG
Sbjct  444  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMG  503

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLVFLIAGGYYVQ
Sbjct  504  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  563

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY D+DYYECSKG +CRV DFP +K++G N++W+D
Sbjct  564  QIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLNNLWID  623

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR IAY+ALHRV+
Sbjct  624  VFVMGVMLVGYRLIAYMALHRVK  646



>ref|XP_006385164.1| ABC transporter family protein [Populus trichocarpa]
 gb|ERP62961.1| ABC transporter family protein [Populus trichocarpa]
Length=656

 Score =   320 bits (819),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 191/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRML+KER+SGMY LSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  452  GFYPLYNAVFTFPQERRMLVKERASGMYHLSSYFLARTFGDLPLELALPTAFVFIIYWMG  511

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK +P+TF LSLL+VL+SVLVSQSLGLA GAILMDVKQATTLASVTTLVFLIAGGYYVQ
Sbjct  512  GLKADPITFILSLLVVLYSVLVSQSLGLAIGAILMDVKQATTLASVTTLVFLIAGGYYVQ  571

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYN++D+YECSKG  CRV DFP VK++G NH+WVD
Sbjct  572  QIPPFIVWLKYLSYSYYCYKLLLGVQYNEDDHYECSKGVLCRVGDFPAVKSMGLNHLWVD  631

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V++MA+MLVGYR +AYLALHRV+
Sbjct  632  VAIMALMLVGYRMVAYLALHRVQ  654



>emb|CDY12299.1| BnaA09g24990D [Brassica napus]
Length=712

 Score =   321 bits (823),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ VGDLPLELALPTAF FI+YWMG
Sbjct  445  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMG  504

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLVFLIAGGYYVQ
Sbjct  505  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  564

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY D+DYYECS+G +CRV DFPG+KA+G N +W+D
Sbjct  565  QIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDYYECSEGVWCRVGDFPGIKAMGLNSLWID  624

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR IAY+ALHRV+
Sbjct  625  VFVMGVMLVGYRLIAYMALHRVK  647



>gb|EYU37490.1| hypothetical protein MIMGU_mgv1a026680mg [Erythranthe guttata]
Length=524

 Score =   315 bits (808),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+TVGDLPLELALPTAFTFI YWMG
Sbjct  322  GFYPLYNAVFTFPQERNMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFTFIFYWMG  381

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK +P+TF LSLLIVLFSVLVSQ LGLAFGAILMDVKQA TLASVTT+VFLIAGGYYV+
Sbjct  382  GLKADPITFILSLLIVLFSVLVSQGLGLAFGAILMDVKQAATLASVTTMVFLIAGGYYVR  441

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IPPFI WLKYLSYS+YC++LLLGVQYN++D+YEC KG YCRVAD+P +KAVG + +WVD
Sbjct  442  HIPPFISWLKYLSYSYYCYRLLLGVQYNEDDFYECEKGVYCRVADYPAIKAVGLSDLWVD  501

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VS+M +MLVGYR IAYLAL RVR
Sbjct  502  VSIMMVMLVGYRLIAYLALQRVR  524



>ref|NP_564383.1| ABC transporter G family member 14 [Arabidopsis thaliana]
 sp|Q9C6W5.1|AB14G_ARATH RecName: Full=ABC transporter G family member 14; Short=ABC transporter 
ABCG.14; Short=AtABCG14; AltName: Full=White-brown 
complex homolog protein 14; Short=AtWBC14 [Arabidopsis thaliana]
 gb|AAG60152.1|AC074360_17 hypothetical protein [Arabidopsis thaliana]
 gb|AAM67104.1| ABC transporter, putative [Arabidopsis thaliana]
 dbj|BAC42192.1| unknown protein [Arabidopsis thaliana]
 gb|AEE31390.1| ABC transporter G family member 14 [Arabidopsis thaliana]
Length=648

 Score =   318 bits (816),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ VGDLPLELALPTAF FI+YWMG
Sbjct  444  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMG  503

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLVFLIAGGYYVQ
Sbjct  504  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  563

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY D+DYYECSKG +CRV DFP +K++G N++W+D
Sbjct  564  QIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLNNLWID  623

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR +AY+ALHRV+
Sbjct  624  VFVMGVMLVGYRLMAYMALHRVK  646



>ref|XP_004291249.1| PREDICTED: ABC transporter G family member 14 [Fragaria vesca 
subsp. vesca]
Length=660

 Score =   319 bits (817),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 169/204 (83%), Positives = 191/204 (94%), Gaps = 1/204 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+TVGDLPLELALPTAF  I+YWMG
Sbjct  457  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFVVIIYWMG  516

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLVFLIAGGYY+Q
Sbjct  517  GLKPDPFTFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYIQ  576

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVG-FNHMWV  214
            QIPPFI+WLKYLSYSFYC+KLLLGVQY ++DYYECSKG  CRV D P VK++G  N++W+
Sbjct  577  QIPPFIVWLKYLSYSFYCYKLLLGVQYREDDYYECSKGVLCRVGDLPAVKSMGDLNNLWI  636

Query  213  DVSVMAMMLVGYRFIAYLALHRVR  142
            DVS++A+ML+GYRF+AYLALHRVR
Sbjct  637  DVSILALMLLGYRFMAYLALHRVR  660



>gb|AAG50724.1|AC079041_17 ABC transporter, putative [Arabidopsis thaliana]
Length=646

 Score =   318 bits (816),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ VGDLPLELALPTAF FI+YWMG
Sbjct  442  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMG  501

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLVFLIAGGYYVQ
Sbjct  502  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  561

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY D+DYYECSKG +CRV DFP +K++G N++W+D
Sbjct  562  QIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLNNLWID  621

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR +AY+ALHRV+
Sbjct  622  VFVMGVMLVGYRLMAYMALHRVK  644



>ref|XP_010054006.1| PREDICTED: ABC transporter G family member 14 [Eucalyptus grandis]
 gb|KCW78389.1| hypothetical protein EUGRSUZ_D02559 [Eucalyptus grandis]
Length=653

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 169/202 (84%), Positives = 188/202 (93%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRML+KERSSGMYRLSSYFLA+T+GDLPLELALPTAF FI+YWMG
Sbjct  450  GFYPLYNAVFTFPQERRMLLKERSSGMYRLSSYFLARTIGDLPLELALPTAFVFIIYWMG  509

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP P TF LSLLIVL+SVLVSQSLGLAFGAILMDVKQATTLASVTT+VFLIAGGYY+Q
Sbjct  510  GLKPNPATFILSLLIVLYSVLVSQSLGLAFGAILMDVKQATTLASVTTMVFLIAGGYYIQ  569

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI WLKYLSYS+YC++LLLGVQY+++D YEC+KG  CRV DFP VKAVG N++W+D
Sbjct  570  QIPPFIEWLKYLSYSYYCYRLLLGVQYSNDDVYECAKGELCRVGDFPAVKAVGLNNLWLD  629

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V +MA MLVGYR IAY+ALHRV
Sbjct  630  VFIMASMLVGYRLIAYVALHRV  651



>ref|XP_006415305.1| hypothetical protein EUTSA_v10007027mg [Eutrema salsugineum]
 gb|ESQ33658.1| hypothetical protein EUTSA_v10007027mg [Eutrema salsugineum]
Length=648

 Score =   317 bits (813),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ VGDLPLELALPTAF FI+YWMG
Sbjct  444  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMG  503

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLVFLIAGGYYVQ
Sbjct  504  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  563

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY D+DYYECSKG +CRV DFP +K++G +++W+D
Sbjct  564  QIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLSNLWID  623

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR IAY+ALHRV+
Sbjct  624  VFVMGVMLVGYRLIAYMALHRVK  646



>ref|XP_002893685.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69944.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=640

 Score =   317 bits (813),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ VGDLPLELALPTAF FI+YWMG
Sbjct  436  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMG  495

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLVFLIAGGYYVQ
Sbjct  496  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  555

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLG+QY D+DYYECSKG +CRV DFP +K++G N++W+D
Sbjct  556  QIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDYYECSKGVWCRVGDFPAIKSMGLNNLWID  615

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR +AY ALHRV+
Sbjct  616  VFVMGVMLVGYRLMAYFALHRVK  638



>ref|XP_004147769.1| PREDICTED: ABC transporter G family member 14 [Cucumis sativus]
 gb|KGN53471.1| hypothetical protein Csa_4G056620 [Cucumis sativus]
Length=655

 Score =   317 bits (813),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 170/203 (84%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+TVGDLPLELALPTAF FI+Y+MG
Sbjct  451  GFYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFVFIIYFMG  510

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GL P P TF LSLLIVL+SVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYY+Q
Sbjct  511  GLDPHPTTFLLSLLIVLYSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYIQ  570

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQY++ D YEC KG +C+V DFP VK+VG + +WVD
Sbjct  571  QIPPFIVWLKYLSYSYYCYKLLLGVQYHNGDVYECGKGEFCQVVDFPAVKSVGLDRLWVD  630

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR IAYLALHRVR
Sbjct  631  VCIMALMLVGYRLIAYLALHRVR  653



>gb|KJB25133.1| hypothetical protein B456_004G178100 [Gossypium raimondii]
Length=644

 Score =   316 bits (810),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  440  GFYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMG  499

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+PLTF LSLLIVL+SVLVSQSLGLA GAILMD+KQATTLASVTTLVFLIAGGYYVQ
Sbjct  500  GLKPDPLTFILSLLIVLYSVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  559

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FILWLKYLSYS+YC+KLLLGVQYN++D YEC  G  CRV D P +K++G NH+W+D
Sbjct  560  QIPSFILWLKYLSYSYYCYKLLLGVQYNEDDVYECGTGGLCRVGDLPAIKSMGLNHLWID  619

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V++MA+ML+GYR +AY+ALHRVR
Sbjct  620  VAIMALMLLGYRLLAYMALHRVR  642



>ref|XP_008451875.1| PREDICTED: ABC transporter G family member 14 [Cucumis melo]
Length=655

 Score =   316 bits (810),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 186/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+TVGDLPLELALPTAF FI+Y+MG
Sbjct  451  GFYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFVFIIYFMG  510

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GL P P TF LSLL+VL+SVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYY+Q
Sbjct  511  GLDPHPTTFLLSLLVVLYSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYIQ  570

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQY+  D YEC KG +CRV DFP VK+VG + +WVD
Sbjct  571  QIPPFIVWLKYLSYSYYCYKLLLGVQYHKGDVYECGKGEFCRVVDFPAVKSVGLDRLWVD  630

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+ML+GYR IAYLALHRVR
Sbjct  631  VCIMAIMLIGYRLIAYLALHRVR  653



>gb|KJB25132.1| hypothetical protein B456_004G178100 [Gossypium raimondii]
Length=653

 Score =   316 bits (809),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  449  GFYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMG  508

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+PLTF LSLLIVL+SVLVSQSLGLA GAILMD+KQATTLASVTTLVFLIAGGYYVQ
Sbjct  509  GLKPDPLTFILSLLIVLYSVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  568

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FILWLKYLSYS+YC+KLLLGVQYN++D YEC  G  CRV D P +K++G NH+W+D
Sbjct  569  QIPSFILWLKYLSYSYYCYKLLLGVQYNEDDVYECGTGGLCRVGDLPAIKSMGLNHLWID  628

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V++MA+ML+GYR +AY+ALHRVR
Sbjct  629  VAIMALMLLGYRLLAYMALHRVR  651



>ref|XP_012072651.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Jatropha curcas]
Length=681

 Score =   316 bits (810),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKER+SGMY LSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  477  GFYPLYNAVFTFPQERRMLIKERASGMYHLSSYFLARTFGDLPLELALPTAFVFIIYWMG  536

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK +P+TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLVFLIAGGYYVQ
Sbjct  537  GLKADPITFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  596

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+YC+KLLLGVQY+++DYYECSKG  CRV DFP VK++G NH+WVD
Sbjct  597  QIPTFIVWLKYLSYSYYCYKLLLGVQYSEDDYYECSKGVLCRVGDFPAVKSMGLNHLWVD  656

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR +AYLALHRV+
Sbjct  657  VCIMALMLVGYRLVAYLALHRVQ  679



>ref|XP_006430907.1| hypothetical protein CICLE_v10011273mg [Citrus clementina]
 gb|ESR44147.1| hypothetical protein CICLE_v10011273mg [Citrus clementina]
Length=637

 Score =   315 bits (806),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 186/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  435  GFYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMG  494

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK +P+TF LSLL VL+SVLV+Q LGLA GAILMDVKQATTLASVTTLVFL+AGGYYVQ
Sbjct  495  GLKADPVTFILSLLAVLYSVLVAQGLGLAIGAILMDVKQATTLASVTTLVFLMAGGYYVQ  554

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+K+LLG+QY+D+DYYECSKG  CRVAD+P V+++G N++W D
Sbjct  555  QIPPFIIWLKYLSYSYYCYKMLLGIQYDDDDYYECSKGELCRVADYPAVRSMGLNNLWAD  614

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V +MA+MLVGYR IAY+AL RV
Sbjct  615  VCIMALMLVGYRLIAYMALRRV  636



>ref|XP_008221126.1| PREDICTED: ABC transporter G family member 14 [Prunus mume]
Length=675

 Score =   315 bits (806),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 190/204 (93%), Gaps = 1/204 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMY+LSSYFLA+TVGDLPLELALPTAF  I+YWMG
Sbjct  470  GFYPLYNAVFTFPQERRMLIKERSSGMYKLSSYFLARTVGDLPLELALPTAFVVIIYWMG  529

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLVFLIAGGYY+Q
Sbjct  530  GLKPDPFTFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYIQ  589

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAV-GFNHMWV  214
            QIP FI+WLKYLSYS+YC+KLLLGVQY+++DYYECSKG  CRV D P +K++ G NH+W+
Sbjct  590  QIPAFIIWLKYLSYSYYCYKLLLGVQYDEDDYYECSKGVLCRVGDLPAIKSMGGLNHLWI  649

Query  213  DVSVMAMMLVGYRFIAYLALHRVR  142
            DVS++A+ML+GYR +AYLALHRVR
Sbjct  650  DVSILALMLLGYRLLAYLALHRVR  673



>ref|XP_012072650.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Jatropha curcas]
Length=681

 Score =   315 bits (806),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKER+SGMY LSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  477  GFYPLYNAVFTFPQERSMLIKERASGMYHLSSYFLARTFGDLPLELALPTAFVFIIYWMG  536

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK +P+TF LSLL++L++VLVSQSLGLA GAILMD+KQATTLASVTTLVFLIAGGYYVQ
Sbjct  537  GLKADPITFILSLLVILYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  596

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+YC+KLLLGVQY+++DYYECSKG  CRV DFP VK++G NH+WVD
Sbjct  597  QIPTFIVWLKYLSYSYYCYKLLLGVQYSEDDYYECSKGVLCRVGDFPAVKSMGLNHLWVD  656

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR +AYLALHRV+
Sbjct  657  VCIMALMLVGYRLVAYLALHRVQ  679



>ref|XP_010111780.1| ABC transporter G family member 14 [Morus notabilis]
 gb|EXC31694.1| ABC transporter G family member 14 [Morus notabilis]
Length=666

 Score =   314 bits (805),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER ML+KERSSGMYRLSSYFLAKT+GDLPLELALPTAF FI+YWMG
Sbjct  462  GFYPLYNAVFTFPQERTMLMKERSSGMYRLSSYFLAKTIGDLPLELALPTAFVFIIYWMG  521

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK +P+TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLVFLIAGGYYVQ
Sbjct  522  GLKADPITFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  581

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGVQYND+DYYECS G +C +ADFP VK++G  ++W+D
Sbjct  582  QIPPFIVWLKYLSYSYYCYKLLLGVQYNDDDYYECSPGVWCPIADFPAVKSMGLRNLWMD  641

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYRF+AYLAL RVR
Sbjct  642  VFIMALMLVGYRFLAYLALQRVR  664



>gb|KDP37810.1| hypothetical protein JCGZ_06712 [Jatropha curcas]
Length=669

 Score =   314 bits (805),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKER+SGMY LSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  465  GFYPLYNAVFTFPQERSMLIKERASGMYHLSSYFLARTFGDLPLELALPTAFVFIIYWMG  524

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK +P+TF LSLL++L++VLVSQSLGLA GAILMD+KQATTLASVTTLVFLIAGGYYVQ
Sbjct  525  GLKADPITFILSLLVILYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  584

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+YC+KLLLGVQY+++DYYECSKG  CRV DFP VK++G NH+WVD
Sbjct  585  QIPTFIVWLKYLSYSYYCYKLLLGVQYSEDDYYECSKGVLCRVGDFPAVKSMGLNHLWVD  644

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR +AYLALHRV+
Sbjct  645  VCIMALMLVGYRLVAYLALHRVQ  667



>ref|XP_008347335.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Malus domestica]
Length=755

 Score =   316 bits (809),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 190/204 (93%), Gaps = 1/204 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+TVGDLPLELALPTAF  I+YWMG
Sbjct  549  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFVLIIYWMG  608

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLVFLIAGGYY+Q
Sbjct  609  GLKPDPFTFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYIQ  668

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAV-GFNHMWV  214
            QIPPFI+WLKYLSYS+YC+KLLLGVQY+++D+YECSKG  CRV D P VK++ G  H+W+
Sbjct  669  QIPPFIVWLKYLSYSYYCYKLLLGVQYDEDDFYECSKGVLCRVGDLPAVKSMGGLEHLWL  728

Query  213  DVSVMAMMLVGYRFIAYLALHRVR  142
            DVS++A+ML+GYR +AYLALHRVR
Sbjct  729  DVSILALMLLGYRLLAYLALHRVR  752



>ref|XP_002519942.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF42546.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=634

 Score =   312 bits (800),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKER+SGMY LSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  430  GFYPLYNAVFTFPQERRMLIKERASGMYHLSSYFLARTFGDLPLELALPTAFVFIIYWMG  489

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK +P+TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLVFLIAGGYYVQ
Sbjct  490  GLKADPITFILSLLVVLYNVLVSQSLGLALGAILMDIKQATTLASVTTLVFLIAGGYYVQ  549

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKY+SYS+YC+KLLLGVQY ++DYYECSKG  CRV DFP VK++G NH+W+D
Sbjct  550  QIPSFIVWLKYVSYSYYCYKLLLGVQYREDDYYECSKGVLCRVGDFPAVKSMGLNHLWID  609

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+MLVGYR IAYLAL RV+
Sbjct  610  VCIMALMLVGYRLIAYLALSRVQ  632



>gb|KFK44944.1| hypothetical protein AALP_AA1G323000 [Arabis alpina]
Length=640

 Score =   312 bits (799),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 161/203 (79%), Positives = 188/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+T+GDLPLELALPTAF FI+YWMG
Sbjct  436  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARTIGDLPLELALPTAFVFIIYWMG  495

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+  TF LSLL+VL+SVLV+Q LGLAFGA+LM+VKQATTLASVTTLVFLIAGGYYVQ
Sbjct  496  GLKPDATTFILSLLVVLYSVLVAQGLGLAFGALLMNVKQATTLASVTTLVFLIAGGYYVQ  555

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IPPFI+WLKYLSYS+YC+KLLLG+QY D+D YECSKG +CRV DFP +K++G +++WVD
Sbjct  556  HIPPFIVWLKYLSYSYYCYKLLLGIQYTDDDVYECSKGVWCRVGDFPAIKSMGLHNLWVD  615

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VM +MLVGYR +AY+ALHRV+
Sbjct  616  VFVMGVMLVGYRLLAYMALHRVK  638



>ref|XP_007226971.1| hypothetical protein PRUPE_ppa002442mg [Prunus persica]
 gb|EMJ28170.1| hypothetical protein PRUPE_ppa002442mg [Prunus persica]
Length=672

 Score =   313 bits (801),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 164/204 (80%), Positives = 190/204 (93%), Gaps = 1/204 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMY+LSSYFLA+TVGDLPLELALPTAF  I+YWMG
Sbjct  467  GFYPLYNAVFTFPQERRMLIKERSSGMYKLSSYFLARTVGDLPLELALPTAFVVIIYWMG  526

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLVFLIAGGYY+Q
Sbjct  527  GLKPDPFTFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYIQ  586

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAV-GFNHMWV  214
            QIP FI+WLKYLSYS+YC+KLLLGVQY++++YYECSKG  CRV D P +K++ G NH+W+
Sbjct  587  QIPAFIVWLKYLSYSYYCYKLLLGVQYDEDEYYECSKGVLCRVGDLPAIKSMGGLNHLWI  646

Query  213  DVSVMAMMLVGYRFIAYLALHRVR  142
            DVS++A+ML+GYR +AYLALHRVR
Sbjct  647  DVSILALMLLGYRLLAYLALHRVR  670



>ref|XP_006482405.1| PREDICTED: ABC transporter G family member 14-like [Citrus sinensis]
Length=637

 Score =   311 bits (798),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  435  GFYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMG  494

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK + +TF LSLL VL+SVLV+Q LGLA GAILMDVKQATTLASVTTLVFL+AGGYYVQ
Sbjct  495  GLKADSVTFILSLLAVLYSVLVAQGLGLAIGAILMDVKQATTLASVTTLVFLMAGGYYVQ  554

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+K+LLG+QY+D+DYYECSKG  CRVAD+P V+++G N++W D
Sbjct  555  QIPPFIIWLKYLSYSYYCYKMLLGIQYDDDDYYECSKGELCRVADYPAVRSMGLNNLWAD  614

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V +MA+MLVGYR IAY+AL RV
Sbjct  615  VCIMALMLVGYRLIAYMALRRV  636



>gb|KDO72270.1| hypothetical protein CISIN_1g039221mg [Citrus sinensis]
Length=637

 Score =   311 bits (798),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 185/202 (92%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  435  GFYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMG  494

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK + +TF LSLL VL+SVLV+Q LGLA GAILMDVKQATTLASVTTLVFL+AGGYYVQ
Sbjct  495  GLKADSVTFILSLLAVLYSVLVAQGLGLAIGAILMDVKQATTLASVTTLVFLMAGGYYVQ  554

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+K+LLG+QY+D+DYYECSKG  CRVAD+P V+++G N++W D
Sbjct  555  QIPPFIIWLKYLSYSYYCYKMLLGIQYDDDDYYECSKGELCRVADYPAVRSMGLNNLWAD  614

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V +MA+MLVGYR IAY+AL RV
Sbjct  615  VCIMALMLVGYRLIAYMALRRV  636



>ref|XP_008387860.1| PREDICTED: ABC transporter G family member 14 [Malus domestica]
Length=668

 Score =   312 bits (800),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 165/204 (81%), Positives = 190/204 (93%), Gaps = 1/204 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMY+LSSYFLA+TVGDLPLELALPTAF  I+YWMG
Sbjct  462  GFYPLYNAVFTFPQERRMLIKERSSGMYQLSSYFLARTVGDLPLELALPTAFVLIIYWMG  521

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLVSQSLGLA GAILMD+KQATTLASVTTLVFLIAGGYY+Q
Sbjct  522  GLKPDPFTFILSLLVVLYSVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYIQ  581

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAV-GFNHMWV  214
            QIPPFI+WLKYLSYS+YC+KLLLGVQY+++D+YECSKG  CRV D P VK++ G +H+W+
Sbjct  582  QIPPFIVWLKYLSYSYYCYKLLLGVQYDEDDFYECSKGVLCRVGDLPAVKSMGGLDHLWL  641

Query  213  DVSVMAMMLVGYRFIAYLALHRVR  142
            DVS++ +ML+GYR +AYLALHRVR
Sbjct  642  DVSILGLMLLGYRLLAYLALHRVR  665



>ref|XP_008347334.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Malus domestica]
Length=771

 Score =   315 bits (807),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 166/204 (81%), Positives = 190/204 (93%), Gaps = 1/204 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLA+TVGDLPLELALPTAF  I+YWMG
Sbjct  565  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLARTVGDLPLELALPTAFVLIIYWMG  624

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLVSQSLGLA GAILMD+KQATTLASVTTLVFLIAGGYY+Q
Sbjct  625  GLKPDPFTFILSLLVVLYNVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYIQ  684

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAV-GFNHMWV  214
            QIPPFI+WLKYLSYS+YC+KLLLGVQY+++D+YECSKG  CRV D P VK++ G  H+W+
Sbjct  685  QIPPFIVWLKYLSYSYYCYKLLLGVQYDEDDFYECSKGVLCRVGDLPAVKSMGGLEHLWL  744

Query  213  DVSVMAMMLVGYRFIAYLALHRVR  142
            DVS++A+ML+GYR +AYLALHRVR
Sbjct  745  DVSILALMLLGYRLLAYLALHRVR  768



>gb|EYU29117.1| hypothetical protein MIMGU_mgv1a002688mg [Erythranthe guttata]
Length=646

 Score =   310 bits (794),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 165/203 (81%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLS+YFLA+TV DLP+ELALPTAFTFI YWMG
Sbjct  444  GFYPLYNAVFTFPQERSMLIKERSSGMYRLSAYFLARTVADLPMELALPTAFTFIFYWMG  503

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLLIVLFSVLVSQSLGLAFGA+LMDVKQA TLASVTTLVFLIAGGYYV+
Sbjct  504  GLKPDPTTFVLSLLIVLFSVLVSQSLGLAFGAVLMDVKQAATLASVTTLVFLIAGGYYVR  563

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+YC+KLLLGV Y +NDYYEC++  YCRV+D+P VK+VG  ++WVD
Sbjct  564  QIPPFIVWLKYLSYSYYCYKLLLGVHYTENDYYECAEKVYCRVSDYPAVKSVGLTNLWVD  623

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            +SVM +ML+GYR +AY ALHRV+
Sbjct  624  MSVMLLMLIGYRLVAYRALHRVQ  646



>gb|KHG16348.1| ABC transporter G family member 14 [Gossypium arboreum]
Length=653

 Score =   309 bits (792),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 163/203 (80%), Positives = 187/203 (92%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  449  GFYPLYNAVFTFPQERTMLIKERSSGMYRLSSYFLARTFGDLPLELALPTAFVFIIYWMG  508

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+PLTF LSLLIVL+SVLVSQSLGLA GAILMD+KQATTLASVTTLVFLIAGGYYVQ
Sbjct  509  GLKPDPLTFILSLLIVLYSVLVSQSLGLAIGAILMDIKQATTLASVTTLVFLIAGGYYVQ  568

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+YC+KLLLG+QY+++D YEC  G  CRV D P +K++G NH+W+D
Sbjct  569  QIPSFIVWLKYLSYSYYCYKLLLGIQYDEDDVYECGTGGLCRVGDLPAIKSMGLNHLWID  628

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V++MA+ML+GYR +AY+AL+RVR
Sbjct  629  VAIMALMLLGYRLLAYMALYRVR  651



>ref|XP_010251517.1| PREDICTED: ABC transporter G family member 14-like [Nelumbo nucifera]
Length=650

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 164/200 (82%), Positives = 181/200 (91%), Gaps = 0/200 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLP+ELALPTAF  I+YWMGGLK
Sbjct  449  PLYNAVFTFPQERSMLIKERSSGMYRLSSYFLARTAGDLPMELALPTAFVIIIYWMGGLK  508

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P+   F LS L+VLFSVLVSQSLGLA+GAILMDVKQA TLASVTTLVFLIAGGYYVQQIP
Sbjct  509  PDFTAFVLSWLVVLFSVLVSQSLGLAYGAILMDVKQAATLASVTTLVFLIAGGYYVQQIP  568

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI+WLKYLSYSFYC+KLLLG+QY +NDYYECS+G +CRV DFP VK VG  ++WVDVS+
Sbjct  569  PFIVWLKYLSYSFYCYKLLLGIQYTENDYYECSQGMFCRVVDFPAVKVVGLKNLWVDVSI  628

Query  201  MAMMLVGYRFIAYLALHRVR  142
            MAMMLVGYR IAY+AL RV+
Sbjct  629  MAMMLVGYRLIAYMALRRVQ  648



>ref|XP_010324497.1| PREDICTED: ABC transporter G family member 14-like isoform X3 
[Solanum lycopersicum]
 ref|XP_010324498.1| PREDICTED: ABC transporter G family member 14-like isoform X3 
[Solanum lycopersicum]
Length=598

 Score =   301 bits (770),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG
Sbjct  396  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  455

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLVSQSLGLAFGA+LMDVKQATTLASVTTLVFLIAGGYY+Q
Sbjct  456  GLKPDPTTFILSLLVVLYNVLVSQSLGLAFGALLMDVKQATTLASVTTLVFLIAGGYYIQ  515

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+Y +KLLLGVQYNDNDYYECSKG YC+VA+ P +++VG N+MW+D
Sbjct  516  QIPTFIVWLKYLSYSYYSYKLLLGVQYNDNDYYECSKGVYCQVANLPAIESVGLNNMWID  575

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VSVMA+MLVGYR +AYLAL RVR
Sbjct  576  VSVMAVMLVGYRVVAYLALTRVR  598



>ref|XP_010918656.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Elaeis guineensis]
Length=648

 Score =   302 bits (773),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFPQER MLIKERSSGMY LSSY+LA+T GDLP+ELALPTAF  I+YWMGGLK
Sbjct  447  PLYNAVFTFPQERPMLIKERSSGMYHLSSYYLARTAGDLPMELALPTAFVLIIYWMGGLK  506

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P P  F LSL++VLFSVLVSQSLGLA GA+LM+VKQATTLASVTTLVFLIAGGYYVQQIP
Sbjct  507  PHPTAFILSLIVVLFSVLVSQSLGLAMGALLMNVKQATTLASVTTLVFLIAGGYYVQQIP  566

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI+WLKYLSYSFYC+KLLLGVQ+N+ND YECS G  C V +FP +K+VG NH+WVD S+
Sbjct  567  PFIVWLKYLSYSFYCYKLLLGVQFNENDSYECSPGVMCPVVEFPAIKSVGLNHLWVDASI  626

Query  201  MAMMLVGYRFIAYLALHRVR  142
            MA+ML+GYR IAYLALHR++
Sbjct  627  MALMLMGYRLIAYLALHRLQ  646



>ref|XP_010918655.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Elaeis guineensis]
Length=666

 Score =   302 bits (773),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFPQER MLIKERSSGMY LSSY+LA+T GDLP+ELALPTAF  I+YWMGGLK
Sbjct  465  PLYNAVFTFPQERPMLIKERSSGMYHLSSYYLARTAGDLPMELALPTAFVLIIYWMGGLK  524

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P P  F LSL++VLFSVLVSQSLGLA GA+LM+VKQATTLASVTTLVFLIAGGYYVQQIP
Sbjct  525  PHPTAFILSLIVVLFSVLVSQSLGLAMGALLMNVKQATTLASVTTLVFLIAGGYYVQQIP  584

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI+WLKYLSYSFYC+KLLLGVQ+N+ND YECS G  C V +FP +K+VG NH+WVD S+
Sbjct  585  PFIVWLKYLSYSFYCYKLLLGVQFNENDSYECSPGVMCPVVEFPAIKSVGLNHLWVDASI  644

Query  201  MAMMLVGYRFIAYLALHRVR  142
            MA+ML+GYR IAYLALHR++
Sbjct  645  MALMLMGYRLIAYLALHRLQ  664



>ref|XP_006361228.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Solanum tuberosum]
Length=659

 Score =   301 bits (771),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTV DLPLELALPTAFTFILYWMG
Sbjct  457  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVVDLPLELALPTAFTFILYWMG  516

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLVSQSLGLAFGA+LMDVKQATTLASVTTLVFLIAGGYY+Q
Sbjct  517  GLKPDPTTFILSLLVVLYNVLVSQSLGLAFGALLMDVKQATTLASVTTLVFLIAGGYYIQ  576

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+Y +KLLLGVQYNDNDYYECSKG YC+VA+ P +++VG N+MW+D
Sbjct  577  QIPPFIVWLKYLSYSYYSYKLLLGVQYNDNDYYECSKGVYCQVANLPAIESVGLNNMWID  636

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VSVMA+MLVGYR +AYLAL RVR
Sbjct  637  VSVMAVMLVGYRVVAYLALTRVR  659



>ref|XP_006361227.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Solanum tuberosum]
Length=662

 Score =   301 bits (771),  Expect = 7e-94, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTV DLPLELALPTAFTFILYWMG
Sbjct  460  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVVDLPLELALPTAFTFILYWMG  519

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLVSQSLGLAFGA+LMDVKQATTLASVTTLVFLIAGGYY+Q
Sbjct  520  GLKPDPTTFILSLLVVLYNVLVSQSLGLAFGALLMDVKQATTLASVTTLVFLIAGGYYIQ  579

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+Y +KLLLGVQYNDNDYYECSKG YC+VA+ P +++VG N+MW+D
Sbjct  580  QIPPFIVWLKYLSYSYYSYKLLLGVQYNDNDYYECSKGVYCQVANLPAIESVGLNNMWID  639

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VSVMA+MLVGYR +AYLAL RVR
Sbjct  640  VSVMAVMLVGYRVVAYLALTRVR  662



>ref|XP_010324496.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Solanum lycopersicum]
Length=639

 Score =   300 bits (769),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG
Sbjct  437  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  496

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLVSQSLGLAFGA+LMDVKQATTLASVTTLVFLIAGGYY+Q
Sbjct  497  GLKPDPTTFILSLLVVLYNVLVSQSLGLAFGALLMDVKQATTLASVTTLVFLIAGGYYIQ  556

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+Y +KLLLGVQYNDNDYYECSKG YC+VA+ P +++VG N+MW+D
Sbjct  557  QIPTFIVWLKYLSYSYYSYKLLLGVQYNDNDYYECSKGVYCQVANLPAIESVGLNNMWID  616

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VSVMA+MLVGYR +AYLAL RVR
Sbjct  617  VSVMAVMLVGYRVVAYLALTRVR  639



>ref|XP_010324495.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Solanum lycopersicum]
Length=671

 Score =   301 bits (771),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 175/203 (86%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG
Sbjct  469  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  528

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL++VLVSQSLGLAFGA+LMDVKQATTLASVTTLVFLIAGGYY+Q
Sbjct  529  GLKPDPTTFILSLLVVLYNVLVSQSLGLAFGALLMDVKQATTLASVTTLVFLIAGGYYIQ  588

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+Y +KLLLGVQYNDNDYYECSKG YC+VA+ P +++VG N+MW+D
Sbjct  589  QIPTFIVWLKYLSYSYYSYKLLLGVQYNDNDYYECSKGVYCQVANLPAIESVGLNNMWID  648

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VSVMA+MLVGYR +AYLAL RVR
Sbjct  649  VSVMAVMLVGYRVVAYLALTRVR  671



>ref|XP_010676724.1| PREDICTED: ABC transporter G family member 14 [Beta vulgaris 
subsp. vulgaris]
Length=634

 Score =   300 bits (768),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 183/207 (88%), Gaps = 4/207 (2%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKER+SGMY+LSSYFLA+T+GDLPLELALPTAF FI+YWMG
Sbjct  428  GFYPLYNAVFTFPQERRMLIKERTSGMYKLSSYFLARTIGDLPLELALPTAFVFIIYWMG  487

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP P+ F LSL++VL++VLV+QSLGLA GAILMD+K ATTLASVTTLVFLIAGGYYVQ
Sbjct  488  GLKPNPIVFVLSLIVVLYNVLVAQSLGLAIGAILMDIKPATTLASVTTLVFLIAGGYYVQ  547

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC----SKGHYCRVADFPGVKAVGFNH  223
            QIPPFI+WLKYLSYS+YC+KLLLGVQY  ND Y C    +K  +C+V D P VK++G +H
Sbjct  548  QIPPFIVWLKYLSYSYYCYKLLLGVQYQQNDTYPCIKMGNKWEWCKVVDVPAVKSMGLDH  607

Query  222  MWVDVSVMAMMLVGYRFIAYLALHRVR  142
            +W+DV V+ +MLVGYR +AYLAL RVR
Sbjct  608  LWIDVCVLGLMLVGYRLLAYLALQRVR  634



>ref|XP_010943390.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Elaeis guineensis]
Length=660

 Score =   301 bits (770),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLP+ELALPTAF  I+YWMG
Sbjct  456  GFYPLYNAVFTFPQERPMLIKERSSGMYRLSSYFLARTAGDLPMELALPTAFVLIIYWMG  515

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GL P+   F LSLL+VLFSVLVSQSLGLA GA+LMDVKQATTLASVTTLVFLIAGGYYVQ
Sbjct  516  GLNPQAAAFILSLLVVLFSVLVSQSLGLAMGALLMDVKQATTLASVTTLVFLIAGGYYVQ  575

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IPPFI+WLKYLSYSFYC+KLLLG+Q+++NDYYECS G  C V +FP +K+VG N+MWVD
Sbjct  576  HIPPFIVWLKYLSYSFYCYKLLLGIQFSENDYYECSPGVMCPVVEFPAIKSVGLNNMWVD  635

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+ML+GYR +AYLALH ++
Sbjct  636  VCIMAIMLLGYRLVAYLALHHLQ  658



>ref|XP_010943389.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Elaeis guineensis]
Length=661

 Score =   300 bits (769),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 160/203 (79%), Positives = 182/203 (90%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLP+ELALPTAF  I+YWMG
Sbjct  457  GFYPLYNAVFTFPQERPMLIKERSSGMYRLSSYFLARTAGDLPMELALPTAFVLIIYWMG  516

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GL P+   F LSLL+VLFSVLVSQSLGLA GA+LMDVKQATTLASVTTLVFLIAGGYYVQ
Sbjct  517  GLNPQAAAFILSLLVVLFSVLVSQSLGLAMGALLMDVKQATTLASVTTLVFLIAGGYYVQ  576

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IPPFI+WLKYLSYSFYC+KLLLG+Q+++NDYYECS G  C V +FP +K+VG N+MWVD
Sbjct  577  HIPPFIVWLKYLSYSFYCYKLLLGIQFSENDYYECSPGVMCPVVEFPAIKSVGLNNMWVD  636

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V +MA+ML+GYR +AYLALH ++
Sbjct  637  VCIMAIMLLGYRLVAYLALHHLQ  659



>ref|XP_009802424.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
sylvestris]
Length=658

 Score =   300 bits (769),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 174/203 (86%), Positives = 193/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG
Sbjct  456  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  515

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK +P TF LSLL+VL++VLVSQSLGLAFGA+LMDVKQATTLASVTTLVFLIAGGYY+Q
Sbjct  516  GLKADPTTFILSLLVVLYNVLVSQSLGLAFGALLMDVKQATTLASVTTLVFLIAGGYYIQ  575

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+Y +KLLLGVQYND+DYYECSKG YC+VADFP +K++G N+MW+D
Sbjct  576  QIPSFIVWLKYLSYSYYSYKLLLGVQYNDSDYYECSKGVYCQVADFPAIKSIGLNNMWID  635

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VS+MA+MLVGYR +AYLAL RVR
Sbjct  636  VSIMAVMLVGYRLVAYLALTRVR  658



>ref|XP_010910173.1| PREDICTED: ABC transporter G family member 14-like isoform X2 
[Elaeis guineensis]
Length=653

 Score =   296 bits (759),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLP+ELALPTAF  I+YWMGGL+
Sbjct  452  PLYNAVFTFPQERSMLIKERSSGMYRLSSYFLARTAGDLPMELALPTAFVVIIYWMGGLQ  511

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P   +F LSLL+VLFSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ IP
Sbjct  512  PGASSFLLSLLVVLFSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQHIP  571

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI+WLKYLS+SFYC+KLLLGVQ+ D+D YECS G  CRV DFP +K+VG +HMW+DV +
Sbjct  572  SFIVWLKYLSFSFYCYKLLLGVQFRDDDVYECSPGVLCRVVDFPAIKSVGLHHMWIDVCI  631

Query  201  MAMMLVGYRFIAYLALHRVR  142
            MA+ML+ YR IAYLALHR++
Sbjct  632  MALMLIAYRLIAYLALHRLQ  651



>ref|XP_009631041.1| PREDICTED: ABC transporter G family member 14-like [Nicotiana 
tomentosiformis]
Length=660

 Score =   296 bits (758),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 172/203 (85%), Positives = 192/203 (95%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG
Sbjct  457  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  516

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK +P TF LSLL+VL++VLVSQSLGLAFGA+LMDVKQATTLASVTTLVFLIAGGYY+Q
Sbjct  517  GLKADPTTFILSLLVVLYNVLVSQSLGLAFGALLMDVKQATTLASVTTLVFLIAGGYYIQ  576

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIP FI+WLKYLSYS+Y +KLLL VQYND+D+YECSKG YC+VADFP +K+VG N+MW+D
Sbjct  577  QIPSFIVWLKYLSYSYYSYKLLLEVQYNDSDFYECSKGVYCQVADFPAIKSVGLNNMWID  636

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            VS+MA+ML+GYR +AYLAL RVR
Sbjct  637  VSIMAVMLIGYRLVAYLALTRVR  659



>ref|XP_010910172.1| PREDICTED: ABC transporter G family member 14-like isoform X1 
[Elaeis guineensis]
Length=668

 Score =   296 bits (758),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 159/200 (80%), Positives = 179/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFPQER MLIKERSSGMYRLSSYFLA+T GDLP+ELALPTAF  I+YWMGGL+
Sbjct  467  PLYNAVFTFPQERSMLIKERSSGMYRLSSYFLARTAGDLPMELALPTAFVVIIYWMGGLQ  526

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P   +F LSLL+VLFSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ IP
Sbjct  527  PGASSFLLSLLVVLFSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQHIP  586

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI+WLKYLS+SFYC+KLLLGVQ+ D+D YECS G  CRV DFP +K+VG +HMW+DV +
Sbjct  587  SFIVWLKYLSFSFYCYKLLLGVQFRDDDVYECSPGVLCRVVDFPAIKSVGLHHMWIDVCI  646

Query  201  MAMMLVGYRFIAYLALHRVR  142
            MA+ML+ YR IAYLALHR++
Sbjct  647  MALMLIAYRLIAYLALHRLQ  666



>ref|XP_008805673.1| PREDICTED: ABC transporter G family member 14-like [Phoenix dactylifera]
Length=666

 Score =   295 bits (755),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 157/200 (79%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFPQER +LIKERSSGMY LSSYFLA+T GDLP+ELALP AF  I+YWMGGLK
Sbjct  465  PLYNAVFTFPQERPILIKERSSGMYHLSSYFLARTAGDLPMELALPIAFVLIIYWMGGLK  524

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P P +F LSLLIVLFSVLVSQSLGLA GA+LM+VKQATTLASVTTLVFLIAGGYYVQQIP
Sbjct  525  PHPASFILSLLIVLFSVLVSQSLGLAMGALLMNVKQATTLASVTTLVFLIAGGYYVQQIP  584

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI+WLKYLSYSFYC+KLL+GVQ+++ DY+ECS G  C V +FP +K+VG NHMWVDV +
Sbjct  585  PFIVWLKYLSYSFYCYKLLIGVQFSEEDYFECSPGVLCPVVEFPAIKSVGLNHMWVDVCI  644

Query  201  MAMMLVGYRFIAYLALHRVR  142
            MA+ML+GYR +AYLALHR++
Sbjct  645  MALMLLGYRLVAYLALHRLQ  664



>ref|XP_008797958.1| PREDICTED: ABC transporter G family member 14-like [Phoenix dactylifera]
Length=649

 Score =   293 bits (749),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFPQER MLIKERSSG YRLSSYFLA+T GDLP+ELALPTAF  I+YWMGGL+
Sbjct  447  PLYNAVFTFPQERSMLIKERSSGTYRLSSYFLARTAGDLPMELALPTAFVVIIYWMGGLQ  506

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P   +F LSLL+VL SVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ IP
Sbjct  507  PSASSFLLSLLVVLLSVLVSQSLGLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQHIP  566

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI+WLKYLS+SFYC+KLLLGVQ+ D+D Y+CS G  CR ADFP +K+VG +HMW+DV +
Sbjct  567  RFIVWLKYLSFSFYCYKLLLGVQFRDDDVYQCSPGVLCRAADFPAIKSVGLHHMWIDVCI  626

Query  201  MAMMLVGYRFIAYLALHRVR  142
            M +ML+GYR IAYLALHR++
Sbjct  627  MVLMLIGYRLIAYLALHRLQ  646



>ref|XP_011028515.1| PREDICTED: ABC transporter G family member 14-like [Populus euphratica]
Length=656

 Score =   290 bits (742),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 169/203 (83%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRML+KER+SGMY LSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  452  GFYPLYNAVFTFPQERRMLVKERASGMYHLSSYFLARTCGDLPLELALPTAFVFIIYWMG  511

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK +P+TF LSLL+VL+SVLVSQSLGLA GAILMDVKQATTLASVTTLVFLIAGGYYVQ
Sbjct  512  GLKADPITFILSLLVVLYSVLVSQSLGLAIGAILMDVKQATTLASVTTLVFLIAGGYYVQ  571

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+Y +KLLLGVQYN++DYYECSKG  CRV DFP VK++G NH+WVD
Sbjct  572  QIPPFIVWLKYLSYSYYSYKLLLGVQYNEDDYYECSKGVLCRVGDFPSVKSMGLNHLWVD  631

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V++MA+MLVGYR +AYLALHRV+
Sbjct  632  VAIMALMLVGYRMVAYLALHRVQ  654



>ref|XP_002304113.2| hypothetical protein POPTR_0003s03650g [Populus trichocarpa]
 gb|EEE79092.2| hypothetical protein POPTR_0003s03650g [Populus trichocarpa]
Length=656

 Score =   289 bits (739),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 190/203 (94%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRML+KER+SGMY LSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  452  GFYPLYNAVFTFPQERRMLVKERASGMYHLSSYFLARTFGDLPLELALPTAFVFIIYWMG  511

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK +P+TF LSLL+VL+SVLVSQSLGLA GA+LMD+KQATTLASVTTLVFLIAGGYYVQ
Sbjct  512  GLKADPITFILSLLVVLYSVLVSQSLGLAIGALLMDIKQATTLASVTTLVFLIAGGYYVQ  571

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            QIPPFI+WLKYLSYS+Y +KLLLGVQYN++DYYECSKG  CRV DFP VK++G NH+WVD
Sbjct  572  QIPPFIVWLKYLSYSYYSYKLLLGVQYNEDDYYECSKGVLCRVGDFPSVKSMGLNHLWVD  631

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V++MA+MLVGYR +AYLALHRV+
Sbjct  632  VAIMALMLVGYRLVAYLALHRVQ  654



>ref|XP_009397435.1| PREDICTED: ABC transporter G family member 14 [Musa acuminata 
subsp. malaccensis]
Length=656

 Score =   289 bits (739),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 152/200 (76%), Positives = 180/200 (90%), Gaps = 0/200 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFPQER ML KE++SGMYRLSSYFLA+T GDLP+ELALPTAFTFI+YWMGGL+
Sbjct  455  PLYNAVFTFPQERPMLRKEQASGMYRLSSYFLARTAGDLPMELALPTAFTFIIYWMGGLR  514

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
             +P+ F LSLL+VLFSVLV+QSLGLA GAILMDVKQATTLASVTTLVFL+AGGYYVQQIP
Sbjct  515  SDPVAFLLSLLVVLFSVLVAQSLGLAVGAILMDVKQATTLASVTTLVFLMAGGYYVQQIP  574

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PF++WLKYLSYSFYC+KLLLGVQ++++D YECS G  C V D+P +K+VG  H+W+DV +
Sbjct  575  PFVVWLKYLSYSFYCYKLLLGVQFSEHDAYECSSGVMCPVIDYPAIKSVGLGHIWIDVCI  634

Query  201  MAMMLVGYRFIAYLALHRVR  142
            M +MLVGYR +AYLALH ++
Sbjct  635  MGLMLVGYRLVAYLALHHLQ  654



>ref|XP_011013139.1| PREDICTED: ABC transporter G family member 14-like [Populus euphratica]
 ref|XP_011015812.1| PREDICTED: ABC transporter G family member 14-like [Populus euphratica]
Length=656

 Score =   287 bits (735),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 166/203 (82%), Positives = 189/203 (93%), Gaps = 0/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQERRML+KER+SGMY LSSYFLA+T GDLPLELALPTAF FI+YWMG
Sbjct  452  GFYPLYNAVFTFPQERRMLVKERASGMYHLSSYFLARTCGDLPLELALPTAFVFIIYWMG  511

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK +P+TF LSLL+VL+SVLVSQSLGLA GA+LMD+KQATTLASVTTLVFLIAGGYYVQ
Sbjct  512  GLKADPITFILSLLVVLYSVLVSQSLGLAIGALLMDIKQATTLASVTTLVFLIAGGYYVQ  571

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IPPFI+WLKYLSYS+Y +KLLLGVQYN++DYYECSKG  CRV DFP VK++G NH+WVD
Sbjct  572  HIPPFIVWLKYLSYSYYSYKLLLGVQYNEDDYYECSKGVLCRVGDFPSVKSMGLNHLWVD  631

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V++MA+MLVGYR +AYLALHRV+
Sbjct  632  VAIMALMLVGYRLVAYLALHRVQ  654



>ref|XP_009384518.1| PREDICTED: ABC transporter G family member 14-like [Musa acuminata 
subsp. malaccensis]
Length=643

 Score =   281 bits (719),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 177/200 (89%), Gaps = 0/200 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFPQER ML KE+++GMYRLSSYFLA+T GDLP+ELALPTAFTFI+YWMGGL 
Sbjct  442  PLYNAVFTFPQERPMLRKEQAAGMYRLSSYFLARTAGDLPMELALPTAFTFIMYWMGGLD  501

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P PLTF LSLL+VLFSVLV+QSLGLA GA+LMDVKQATTLASVTTLVFL+AGGYYVQQIP
Sbjct  502  PHPLTFLLSLLVVLFSVLVAQSLGLAVGAMLMDVKQATTLASVTTLVFLMAGGYYVQQIP  561

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WL+YLSYSFYC+KLLLGVQ+ ++D YECSKG  C V ++  +K+VG   MWVDV V
Sbjct  562  PFIAWLRYLSYSFYCYKLLLGVQFTEHDSYECSKGVMCPVMEYQAIKSVGLRRMWVDVCV  621

Query  201  MAMMLVGYRFIAYLALHRVR  142
            MA+MLVGYR +AYLAL  ++
Sbjct  622  MAVMLVGYRIVAYLALRHLQ  641



>ref|XP_006659869.1| PREDICTED: ABC transporter G family member 14-like [Oryza brachyantha]
Length=379

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/202 (71%), Positives = 169/202 (84%), Gaps = 2/202 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFP ER ML+KERSSGMYRLSSYF A+T  DLP+ELALPTAF  ILYWMGGL 
Sbjct  176  PLYNAVFTFPLERPMLLKERSSGMYRLSSYFAARTAADLPMELALPTAFVVILYWMGGLD  235

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P P  F LSLL+VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+VFLIAGGYYVQ IP
Sbjct  236  PRPGAFLLSLLVVLYSVLVAQSLGLAIGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  295

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDND-YYEC-SKGHYCRVADFPGVKAVGFNHMWVDV  208
            PF+ WL++L+YSFYC++LL+G+Q+ D   +Y+C   G  C VADFP +KAVG N+ WVDV
Sbjct  296  PFVGWLRWLNYSFYCYRLLIGIQFGDGGAHYDCGGGGARCLVADFPAIKAVGLNNHWVDV  355

Query  207  SVMAMMLVGYRFIAYLALHRVR  142
             VMA++LVGYR IAY+AL R++
Sbjct  356  CVMALLLVGYRVIAYIALDRLK  377



>ref|XP_008390022.1| PREDICTED: ABC transporter G family member 21-like [Malus domestica]
Length=367

 Score =   258 bits (658),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 136/196 (69%), Positives = 164/196 (84%), Gaps = 0/196 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL NA+F+FP ER MLIKERSSGMYRLSSYF A+TVGDLP+EL LPT F  I YWM GLK
Sbjct  166  PLSNAIFSFPMERPMLIKERSSGMYRLSSYFFARTVGDLPMELVLPTVFXTICYWMSGLK  225

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+L IVL++VLV+Q +GLA GAILMDVKQ TTLASVTTLVFL+ GGYY+Q +P
Sbjct  226  PSIVTFALTLFIVLYNVLVAQGIGLALGAILMDVKQGTTLASVTTLVFLLVGGYYIQHMP  285

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+SYS YC+KLL+GVQY+ ++ YEC  G +CRV DFPG+K VG + MW+DV+ 
Sbjct  286  PFIAWLKYISYSHYCYKLLVGVQYSVHEVYECGMGVHCRVLDFPGIKCVGLDDMWIDVAA  345

Query  201  MAMMLVGYRFIAYLAL  154
            +A+MLVGYR +AY+AL
Sbjct  346  LAVMLVGYRVLAYVAL  361



>ref|NP_001182828.1| hypothetical protein [Zea mays]
 gb|ACR34766.1| unknown [Zea mays]
 gb|AFW57204.1| hypothetical protein ZEAMMB73_095241 [Zea mays]
Length=331

 Score =   256 bits (653),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 164/201 (82%), Gaps = 1/201 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFP ER ML+KER+SGMYRLSSY  ++   DLP+EL LPTAF  ILYWMGGL 
Sbjct  129  PLYNAVFTFPLERPMLLKERASGMYRLSSYVASRAATDLPMELGLPTAFVLILYWMGGLD  188

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P P  F LSL +VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+VFLIAGGYYVQ IP
Sbjct  189  PRPGPFLLSLAVVLYSVLVAQSLGLAIGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  248

Query  381  PFILWLKYLSYSFYCFKLLLGVQYND-NDYYECSKGHYCRVADFPGVKAVGFNHMWVDVS  205
            PF+ WL++L+YSFYC++LLLG+Q+ D   YY+C  G  C VA+FP +KAVG N+ WVD  
Sbjct  249  PFVAWLRWLNYSFYCYRLLLGIQFPDGGGYYDCGHGALCPVAEFPAIKAVGLNNHWVDAC  308

Query  204  VMAMMLVGYRFIAYLALHRVR  142
            VMA+MLVGYR +AY+AL R++
Sbjct  309  VMALMLVGYRVVAYIALDRLK  329



>dbj|BAJ97566.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=686

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 167/201 (83%), Gaps = 1/201 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVF FP ER ML+KERSSGMYRLSSYF A+T  DLP+EL LPTAF  ILYWMGGL 
Sbjct  484  PLYNAVFVFPLERPMLLKERSSGMYRLSSYFAARTTADLPMELGLPTAFVLILYWMGGLD  543

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P P +F LSLL+VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+VFLIAGGYYVQ IP
Sbjct  544  PRPASFLLSLLVVLYSVLVAQSLGLAVGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  603

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDND-YYECSKGHYCRVADFPGVKAVGFNHMWVDVS  205
            PFI WLK+L+YSFYC++LLLG+Q+ D    Y+C  G  C VADFP +KAVG N+ WVDV 
Sbjct  604  PFIGWLKWLNYSFYCYRLLLGIQFRDGSAVYDCGGGALCPVADFPAIKAVGLNNHWVDVC  663

Query  204  VMAMMLVGYRFIAYLALHRVR  142
            VMA++LVGYR +AYLAL R++
Sbjct  664  VMALLLVGYRVVAYLALDRLQ  684



>dbj|BAJ95904.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96160.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=686

 Score =   264 bits (674),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 144/201 (72%), Positives = 167/201 (83%), Gaps = 1/201 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVF FP ER ML+KERSSGMYRLSSYF A+T  DLP+EL LPTAF  ILYWMGGL 
Sbjct  484  PLYNAVFVFPLERPMLLKERSSGMYRLSSYFAARTAADLPMELGLPTAFVLILYWMGGLD  543

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P P +F LSLL+VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+VFLIAGGYYVQ IP
Sbjct  544  PRPASFLLSLLVVLYSVLVAQSLGLAVGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  603

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDND-YYECSKGHYCRVADFPGVKAVGFNHMWVDVS  205
            PFI WLK+L+YSFYC++LLLG+Q+ D    Y+C  G  C VADFP +KAVG N+ WVDV 
Sbjct  604  PFIGWLKWLNYSFYCYRLLLGIQFRDGSAVYDCGGGALCPVADFPAIKAVGLNNHWVDVC  663

Query  204  VMAMMLVGYRFIAYLALHRVR  142
            VMA++LVGYR +AYLAL R++
Sbjct  664  VMALLLVGYRVVAYLALDRLQ  684



>dbj|BAC99536.1| putative ABC transporter AbcG1 [Oryza sativa Japonica Group]
 dbj|BAC99846.1| putative ABC transporter AbcG1 [Oryza sativa Japonica Group]
Length=757

 Score =   261 bits (668),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 169/202 (84%), Gaps = 2/202 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFP ER ML+KERSSGMYRLSSYF A+T  DLP+ELALPTAF  ILYWMGGL 
Sbjct  554  PLYNAVFTFPLERPMLVKERSSGMYRLSSYFAARTAADLPMELALPTAFVVILYWMGGLD  613

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P P  F LSLL+VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+VFLIAGGYYVQ IP
Sbjct  614  PRPGPFLLSLLVVLYSVLVAQSLGLAIGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  673

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDN-DYYEC-SKGHYCRVADFPGVKAVGFNHMWVDV  208
            PF+ WL++L+YSFYC++LL+G+Q+ D   +Y+C   G  C VADFP +KAVG N+ WVDV
Sbjct  674  PFVGWLRWLNYSFYCYRLLIGIQFGDGAAHYDCGGGGARCLVADFPAIKAVGLNNHWVDV  733

Query  207  SVMAMMLVGYRFIAYLALHRVR  142
             VMA++LVGYR IAYLAL R++
Sbjct  734  CVMALLLVGYRVIAYLALDRLK  755



>gb|EEC82957.1| hypothetical protein OsI_27950 [Oryza sativa Indica Group]
Length=761

 Score =   261 bits (668),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 169/202 (84%), Gaps = 2/202 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFP ER ML+KERSSGMYRLSSYF A+T  DLP+ELALPTAF  ILYWMGGL 
Sbjct  558  PLYNAVFTFPLERPMLVKERSSGMYRLSSYFAARTAADLPMELALPTAFVVILYWMGGLD  617

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P P  F LSLL+VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+VFLIAGGYYVQ IP
Sbjct  618  PRPGPFLLSLLVVLYSVLVAQSLGLAIGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  677

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDN-DYYEC-SKGHYCRVADFPGVKAVGFNHMWVDV  208
            PF+ WL++L+YSFYC++LL+G+Q+ D   +Y+C   G  C VADFP +KAVG N+ WVDV
Sbjct  678  PFVGWLRWLNYSFYCYRLLIGIQFGDGAAHYDCGGGGARCLVADFPAIKAVGLNNHWVDV  737

Query  207  SVMAMMLVGYRFIAYLALHRVR  142
             VMA++LVGYR IAYLAL R++
Sbjct  738  CVMALLLVGYRVIAYLALDRLK  759



>gb|EAZ41641.1| hypothetical protein OsJ_26175 [Oryza sativa Japonica Group]
Length=757

 Score =   261 bits (668),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 144/202 (71%), Positives = 169/202 (84%), Gaps = 2/202 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFP ER ML+KERSSGMYRLSSYF A+T  DLP+ELALPTAF  ILYWMGGL 
Sbjct  554  PLYNAVFTFPLERPMLVKERSSGMYRLSSYFAARTAADLPMELALPTAFVVILYWMGGLD  613

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P P  F LSLL+VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+VFLIAGGYYVQ IP
Sbjct  614  PRPGPFLLSLLVVLYSVLVAQSLGLAIGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  673

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDN-DYYEC-SKGHYCRVADFPGVKAVGFNHMWVDV  208
            PF+ WL++L+YSFYC++LL+G+Q+ D   +Y+C   G  C VADFP +KAVG N+ WVDV
Sbjct  674  PFVGWLRWLNYSFYCYRLLIGIQFGDGAAHYDCGGGGARCLVADFPAIKAVGLNNHWVDV  733

Query  207  SVMAMMLVGYRFIAYLALHRVR  142
             VMA++LVGYR IAYLAL R++
Sbjct  734  CVMALLLVGYRVIAYLALDRLK  755



>gb|AFW57205.1| hypothetical protein ZEAMMB73_095241 [Zea mays]
Length=595

 Score =   257 bits (656),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 164/201 (82%), Gaps = 1/201 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFP ER ML+KER+SGMYRLSSY  ++   DLP+EL LPTAF  ILYWMGGL 
Sbjct  393  PLYNAVFTFPLERPMLLKERASGMYRLSSYVASRAATDLPMELGLPTAFVLILYWMGGLD  452

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P P  F LSL +VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+VFLIAGGYYVQ IP
Sbjct  453  PRPGPFLLSLAVVLYSVLVAQSLGLAIGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  512

Query  381  PFILWLKYLSYSFYCFKLLLGVQYND-NDYYECSKGHYCRVADFPGVKAVGFNHMWVDVS  205
            PF+ WL++L+YSFYC++LLLG+Q+ D   YY+C  G  C VA+FP +KAVG N+ WVD  
Sbjct  513  PFVAWLRWLNYSFYCYRLLLGIQFPDGGGYYDCGHGALCPVAEFPAIKAVGLNNHWVDAC  572

Query  204  VMAMMLVGYRFIAYLALHRVR  142
            VMA+MLVGYR +AY+AL R++
Sbjct  573  VMALMLVGYRVVAYIALDRLK  593



>ref|XP_009336649.1| PREDICTED: ABC transporter G family member 21-like [Pyrus x bretschneideri]
Length=683

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 165/197 (84%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL NA+F+FP ER MLIKERSSGMYRLSSYF A+TVGDLP+EL LPT F  I YWM GLK
Sbjct  482  PLSNAIFSFPMERPMLIKERSSGMYRLSSYFFARTVGDLPMELVLPTVFVTISYWMSGLK  541

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+L IVL++VLV+Q +GLA GAILMDVKQ TTLASVTTLVFL+ GGYY+Q +P
Sbjct  542  PSIVTFALTLFIVLYNVLVAQGIGLALGAILMDVKQGTTLASVTTLVFLLVGGYYIQHLP  601

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+SYS YC+KLL+GVQY+ ++ YEC  G +CRV DFPG+K VG ++MW+DV+ 
Sbjct  602  PFIAWLKYISYSHYCYKLLVGVQYSVHEVYECGMGVHCRVLDFPGIKCVGLDNMWIDVAA  661

Query  201  MAMMLVGYRFIAYLALH  151
            +A+MLVGYR +AY+AL 
Sbjct  662  LAVMLVGYRVLAYVALR  678



>ref|XP_009356025.1| PREDICTED: ABC transporter G family member 21-like [Pyrus x bretschneideri]
Length=683

 Score =   259 bits (661),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 137/197 (70%), Positives = 166/197 (84%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL NA+F+FP ER MLIKERSSGMYRLSSY+ A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  482  PLSNAIFSFPMERPMLIKERSSGMYRLSSYYFARTVGDLPMELVLPTVFITISYWMGGLK  541

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+L IVL++VLVSQ LGLA GAILM+VKQ TTLASVT LVFL+ GGYY+Q IP
Sbjct  542  PSLVTFALTLFIVLYNVLVSQGLGLALGAILMNVKQGTTLASVTMLVFLLVGGYYIQHIP  601

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S YC+KLL+GVQY+ ++ YEC  G +CRV DFPG+K VG ++MW+DV+ 
Sbjct  602  PFIAWLKYVSFSHYCYKLLVGVQYSAHEVYECEMGMHCRVIDFPGIKCVGLDNMWIDVAA  661

Query  201  MAMMLVGYRFIAYLALH  151
            +A+MLVGYRF+AY+AL 
Sbjct  662  LAVMLVGYRFLAYMALR  678



>ref|XP_008389336.1| PREDICTED: ABC transporter G family member 21-like isoform X1 
[Malus domestica]
 ref|XP_008367026.1| PREDICTED: ABC transporter G family member 21-like isoform X1 
[Malus domestica]
Length=683

 Score =   258 bits (660),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 136/197 (69%), Positives = 164/197 (83%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL NA+F+FP ER MLIKERSSGMYRLSSYF A+TVGDLP+EL LPT F  I YWM GLK
Sbjct  482  PLSNAIFSFPMERPMLIKERSSGMYRLSSYFFARTVGDLPMELVLPTVFXTICYWMSGLK  541

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+L IVL++VLV+Q +GLA GAILMDVKQ TTLASVTTLVFL+ GGYY+Q +P
Sbjct  542  PSIVTFALTLFIVLYNVLVAQGIGLALGAILMDVKQGTTLASVTTLVFLLVGGYYIQHMP  601

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+SYS YC+KLL+GVQY+ ++ YEC  G +CRV DFPG+K VG + MW+DV+ 
Sbjct  602  PFIAWLKYISYSHYCYKLLVGVQYSVHEVYECGMGVHCRVLDFPGIKCVGLDDMWIDVAA  661

Query  201  MAMMLVGYRFIAYLALH  151
            +A+MLVGYR +AY+AL 
Sbjct  662  LAVMLVGYRVLAYVALR  678



>ref|XP_008662280.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=727

 Score =   258 bits (658),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 137/201 (68%), Positives = 164/201 (82%), Gaps = 1/201 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFP ER ML+KER+SGMYRLSSY  ++   DLP+EL LPTAF  ILYWMGGL 
Sbjct  525  PLYNAVFTFPLERPMLLKERASGMYRLSSYVASRAATDLPMELGLPTAFVLILYWMGGLD  584

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P P  F LSL +VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+VFLIAGGYYVQ IP
Sbjct  585  PRPGPFLLSLAVVLYSVLVAQSLGLAIGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  644

Query  381  PFILWLKYLSYSFYCFKLLLGVQYND-NDYYECSKGHYCRVADFPGVKAVGFNHMWVDVS  205
            PF+ WL++L+YSFYC++LLLG+Q+ D   YY+C  G  C VA+FP +KAVG N+ WVD  
Sbjct  645  PFVAWLRWLNYSFYCYRLLLGIQFPDGGGYYDCGHGALCPVAEFPAIKAVGLNNHWVDAC  704

Query  204  VMAMMLVGYRFIAYLALHRVR  142
            VMA+MLVGYR +AY+AL R++
Sbjct  705  VMALMLVGYRVVAYIALDRLK  725



>ref|XP_012082004.1| PREDICTED: ABC transporter G family member 21 [Jatropha curcas]
 gb|KDP29341.1| hypothetical protein JCGZ_18262 [Jatropha curcas]
Length=682

 Score =   256 bits (655),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 139/196 (71%), Positives = 167/196 (85%), Gaps = 0/196 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSGMYRLSSY+LA+  GDLP+EL LPT F  I YWMGGLK
Sbjct  481  PLFNAIFTFPQERPMLIKERSSGMYRLSSYYLARIAGDLPMELVLPTIFVTISYWMGGLK  540

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ LGLA GAILM+VKQATTLASVT LVFL+AGGYY+Q IP
Sbjct  541  PSLVTFILTLLIILFNVLVSQGLGLALGAILMEVKQATTLASVTMLVFLLAGGYYIQHIP  600

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC KG +CRV DFP +K +G ++MW DV+ 
Sbjct  601  QFIAWLKYISFSHYCYKLLVGVQYSVNEVYECEKGIHCRVMDFPAIKYLGVDNMWGDVAA  660

Query  201  MAMMLVGYRFIAYLAL  154
            +++MLVGYR +AYLAL
Sbjct  661  LSIMLVGYRILAYLAL  676



>ref|XP_003573439.1| PREDICTED: ABC transporter G family member 14 [Brachypodium distachyon]
Length=711

 Score =   256 bits (653),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 142/202 (70%), Positives = 167/202 (83%), Gaps = 2/202 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVF FP ER  L+KERSSGMYRLSSYF A+T  DLP+EL LPTAF  ILYWMGGL 
Sbjct  508  PLYNAVFVFPLERPFLLKERSSGMYRLSSYFAARTAADLPMELGLPTAFVLILYWMGGLD  567

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P P +F LSLL+VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+VFLIAGGYYVQ IP
Sbjct  568  PRPASFLLSLLVVLYSVLVAQSLGLAVGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  627

Query  381  PFILWLKYLSYSFYCFKLLLGVQYND-NDYYEC-SKGHYCRVADFPGVKAVGFNHMWVDV  208
            PF+ WL++L+YSFYC++LLLG+Q+ D   YYEC S G  C VA+FP +KAVG  + WVDV
Sbjct  628  PFVGWLRWLNYSFYCYRLLLGIQFPDGGGYYECGSGGAMCPVAEFPAIKAVGLENHWVDV  687

Query  207  SVMAMMLVGYRFIAYLALHRVR  142
             VMA++LVGYR +AYLAL R++
Sbjct  688  CVMALLLVGYRVVAYLALDRLQ  709



>gb|EMS54909.1| ABC transporter G family member 14 [Triticum urartu]
Length=421

 Score =   248 bits (632),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 140/201 (70%), Positives = 164/201 (82%), Gaps = 1/201 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVF FP ER ML+KERSSGMYRLSSYF A+T  DLP+EL LPTAF  ILYWMGGL 
Sbjct  219  PLYNAVFVFPLERPMLLKERSSGMYRLSSYFAARTAADLPMELGLPTAFVLILYWMGGLD  278

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P P +F LSLL+VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+VFLIAGGYYVQ IP
Sbjct  279  PRPASFLLSLLVVLYSVLVAQSLGLAVGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  338

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH-YCRVADFPGVKAVGFNHMWVDVS  205
            PFI WLK+L+YSFYC++LLLG+Q+ D        G   C +A+FP +KAVG N+ WVDV 
Sbjct  339  PFIGWLKWLNYSFYCYRLLLGIQFRDGGGLYDCGGGALCPIAEFPAIKAVGLNNHWVDVC  398

Query  204  VMAMMLVGYRFIAYLALHRVR  142
            VMA++LVGYR +AYLAL R++
Sbjct  399  VMALLLVGYRVVAYLALDRLQ  419



>ref|XP_008361741.1| PREDICTED: ABC transporter G family member 21-like [Malus domestica]
Length=683

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL NA+F+FP ER MLIKERSSGMYRLSSY+ A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  482  PLSNAIFSFPMERPMLIKERSSGMYRLSSYYFARTVGDLPMELVLPTVFITISYWMGGLK  541

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P   TF L+L +VL++VLVSQ LGLA GAILM+VKQ TTLASVT LVFL+ GGYY+Q IP
Sbjct  542  PSLXTFALTLFVVLYNVLVSQGLGLALGAILMNVKQGTTLASVTMLVFLLVGGYYIQHIP  601

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY S+S YC+KLL+GVQY+ ++ YEC  G +CRV DFPG+  VG ++MW+DV+ 
Sbjct  602  PFIAWLKYASFSHYCYKLLVGVQYSAHEVYECEMGMHCRVIDFPGIXCVGLDNMWIDVAA  661

Query  201  MAMMLVGYRFIAYLALH  151
            +A+M VGYRF+AY+AL 
Sbjct  662  LAVMXVGYRFLAYVALR  678



>ref|XP_008339724.1| PREDICTED: ABC transporter G family member 21-like [Malus domestica]
Length=683

 Score =   253 bits (647),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL NA+F+FP ER MLIKERSSGMYRLSSY+ A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  482  PLSNAIFSFPMERPMLIKERSSGMYRLSSYYFARTVGDLPMELVLPTVFITISYWMGGLK  541

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P   TF L+L +VL++VLVSQ LGLA GAILM+VKQ TTLASVT LVFL+ GGYY+Q IP
Sbjct  542  PSLXTFALTLFVVLYNVLVSQGLGLALGAILMNVKQGTTLASVTMLVFLLVGGYYIQHIP  601

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY S+S YC+KLL+GVQY+ ++ YEC  G +CRV DFPG+  VG ++MW+DV+ 
Sbjct  602  PFIAWLKYASFSHYCYKLLVGVQYSAHEVYECEMGMHCRVIDFPGIXCVGLDNMWIDVAA  661

Query  201  MAMMLVGYRFIAYLALH  151
            +A+M VGYRF+AY+AL 
Sbjct  662  LAVMXVGYRFLAYVALR  678



>ref|XP_010096709.1| ABC transporter G family member 14 [Morus notabilis]
 gb|EXB65561.1| ABC transporter G family member 14 [Morus notabilis]
Length=634

 Score =   251 bits (642),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 133/196 (68%), Positives = 162/196 (83%), Gaps = 0/196 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FPQER MLIKERSSGMYRLSSY+ A+  GDLP+EL LPT F  + YWMGGLK
Sbjct  433  PLFNAIFAFPQERPMLIKERSSGMYRLSSYYFARMAGDLPMELVLPTVFVTVTYWMGGLK  492

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ LGLA GAILMDVKQATTLASVT LVFL+ GGYY+Q+IP
Sbjct  493  PSLITFLLTLLIILFNVLVSQGLGLALGAILMDVKQATTLASVTMLVFLLVGGYYIQKIP  552

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY DN++YEC  G +CRV DFP +K +G ++ W DV+ 
Sbjct  553  AFIAWLKYISFSHYCYKLLVGVQYTDNEFYECGIGMHCRVMDFPAIKCLGLDNKWWDVAA  612

Query  201  MAMMLVGYRFIAYLAL  154
            + +M VGYR +AY+AL
Sbjct  613  LTVMFVGYRLLAYVAL  628



>ref|XP_010262410.1| PREDICTED: ABC transporter G family member 21-like [Nelumbo nucifera]
Length=685

 Score =   249 bits (636),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 163/197 (83%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            P++NA+FTFPQER MLIKERSSGMYRLSSY+ A+  GDLP+EL LPT F  + YWMGGL+
Sbjct  484  PMFNAIFTFPQERPMLIKERSSGMYRLSSYYFARMAGDLPMELVLPTIFVAVTYWMGGLR  543

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P P+ F L+LLI+L++VLVSQ LGLA GAI+M+VKQATTLASVT LVFL+AGGYY+Q IP
Sbjct  544  PSPVNFMLTLLIILYNVLVSQGLGLALGAIVMEVKQATTLASVTMLVFLLAGGYYIQHIP  603

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY S+S YC+KLL+G QY ++DYY C  G +C++ DFP VK++G ++  +DV+ 
Sbjct  604  PFIAWLKYSSFSHYCYKLLVGAQYTEDDYYNCGTGVHCKIMDFPSVKSLGLDNKRLDVAA  663

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLVGYR +AY+AL 
Sbjct  664  LTVMLVGYRLMAYVALR  680



>ref|XP_010265331.1| PREDICTED: ABC transporter G family member 21-like [Nelumbo nucifera]
Length=666

 Score =   248 bits (634),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 164/197 (83%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            P++NA+FTFPQER MLIKERSSGMYRLSSY+ A+  GDLP+EL LPT F  + YWMGGL+
Sbjct  465  PMFNAIFTFPQERPMLIKERSSGMYRLSSYYFARIAGDLPMELVLPTIFVSVTYWMGGLR  524

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P P+ F L+LLI+L++VLVSQ LGLA GAILM++KQATTLASVT LVFL+A GYY+Q IP
Sbjct  525  PSPVNFLLTLLIILYNVLVSQGLGLALGAILMELKQATTLASVTMLVFLLASGYYIQHIP  584

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI+WLKY S+S YC+KLL+GVQY ++DYY+C  G +C++ +FP VK +G N+M +DV+ 
Sbjct  585  AFIVWLKYTSFSHYCYKLLVGVQYTEDDYYDCGIGLHCKIFNFPAVKNLGINNMGLDVAA  644

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLVGYR IAY+AL 
Sbjct  645  LTVMLVGYRLIAYVALR  661



>gb|KHN07535.1| ABC transporter G family member 21 [Glycine soja]
Length=566

 Score =   246 bits (627),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 133/199 (67%), Positives = 165/199 (83%), Gaps = 0/199 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPL+NAVF FP ER ML+KERSSGMY LSSY++A+ VGDLP+E  LPT F  I YWMG
Sbjct  362  GFYPLFNAVFAFPLERPMLMKERSSGMYHLSSYYVARMVGDLPMEFVLPTIFVAISYWMG  421

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP  +TF L+LLI+LF+VLVSQ +GLA GAILMDVKQATTLASVT LVFL+AGGYY++
Sbjct  422  GLKPSLVTFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATTLASVTMLVFLLAGGYYIR  481

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IP FI WLKY+S+S YC+KLL+GVQY+ N+ Y+C  G +CR+ DF  +K +G + +W D
Sbjct  482  HIPFFIAWLKYISFSHYCYKLLVGVQYSVNEVYQCRHGLHCRIRDFLAIKCLGLDSLWGD  541

Query  210  VSVMAMMLVGYRFIAYLAL  154
            V+V+A+ML+GYR +AYLAL
Sbjct  542  VAVLAVMLIGYRVVAYLAL  560



>gb|EPS63929.1| hypothetical protein M569_10851 [Genlisea aurea]
Length=634

 Score =   247 bits (631),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 165/206 (80%), Gaps = 4/206 (2%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQ+R +L KE+SS MYRLSSYFLA+TV DLPL+LALP AFT + Y+MG
Sbjct  428  GFYPLYNAVFTFPQDRAILRKEKSSSMYRLSSYFLARTVADLPLDLALPAAFTVVFYFMG  487

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GL P PL F LSLL +L +VLVSQ LGL FGA+LMDVKQA TLASVTTLVFLIAGGYYV+
Sbjct  488  GLTPRPLPFLLSLLNILLAVLVSQGLGLLFGALLMDVKQAATLASVTTLVFLIAGGYYVR  547

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC----SKGHYCRVADFPGVKAVGFNH  223
            +IPPFI W++YLS+S+Y +++LLGVQY + D YEC        YCRVADFP VKAVG   
Sbjct  548  RIPPFIGWIRYLSFSYYSYRMLLGVQYGEGDVYECGGGGGGTSYCRVADFPAVKAVGLGG  607

Query  222  MWVDVSVMAMMLVGYRFIAYLALHRV  145
            +WVD + M  MLVGYR +AY AL R 
Sbjct  608  LWVDAAAMVAMLVGYRVLAYFALRRA  633



>ref|XP_007225163.1| hypothetical protein PRUPE_ppa002351mg [Prunus persica]
 gb|EMJ26362.1| hypothetical protein PRUPE_ppa002351mg [Prunus persica]
Length=683

 Score =   248 bits (633),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 135/200 (68%), Positives = 163/200 (82%), Gaps = 1/200 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER MLIKERSSGMYRLSSY+ A+TVGDLP+EL LPT F  + YWMGGLK
Sbjct  482  PLFNAIFAFPMERPMLIKERSSGMYRLSSYYFARTVGDLPMELVLPTVFVTVSYWMGGLK  541

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+L IVL++VLVSQ LGLA GAILMDVKQ TTLASVT LVFL+ GGYY+Q IP
Sbjct  542  PSFVTFALTLSIVLYNVLVSQGLGLALGAILMDVKQGTTLASVTMLVFLLVGGYYIQHIP  601

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC  G +C V DFP +K +G + MW DV+ 
Sbjct  602  SFIAWLKYISFSHYCYKLLVGVQYSANEVYECEMGMHCSVMDFPAIKYLGLDSMWSDVAA  661

Query  201  MAMMLVGYRFIAYLALHRVR  142
            +A+MLVGYR +AY+AL R+R
Sbjct  662  LAVMLVGYRVLAYVAL-RMR  680



>ref|XP_010556399.1| PREDICTED: ABC transporter G family member 21-like [Tarenaya 
hassleriana]
Length=685

 Score =   248 bits (632),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 135/201 (67%), Positives = 165/201 (82%), Gaps = 2/201 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER ML+KERSSGMYRLSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  485  PLFNAIFTFPQERPMLVKERSSGMYRLSSYYIARTVGDLPMELILPTIFVTISYWMGGLK  544

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P P TF L+LLIVL++VLV+Q++GLA GAILMDVKQATTL+SVT LVFL+AGGYY+Q IP
Sbjct  545  PSPTTFLLTLLIVLYNVLVAQAVGLAMGAILMDVKQATTLSSVTMLVFLLAGGYYIQHIP  604

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKA--VGFNHMWVDV  208
             FI WLKY+S+S YC+KLL+GVQY  N+ YEC  G  CRV D+ G++   +G N+M  DV
Sbjct  605  GFIAWLKYISFSHYCYKLLVGVQYTGNEVYECGLGLRCRVMDYEGIRNLMIGNNNMMWDV  664

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              + +MLVGYR +AYLAL  +
Sbjct  665  LALGIMLVGYRVLAYLALRNL  685



>ref|XP_008243143.1| PREDICTED: ABC transporter G family member 21 [Prunus mume]
Length=683

 Score =   246 bits (629),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER ML+KERSSGMYRLSSY+ A+TVGDLP+EL LPT F  + YWMGGLK
Sbjct  482  PLFNAIFAFPMERPMLVKERSSGMYRLSSYYFARTVGDLPMELVLPTVFVTVSYWMGGLK  541

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+L IVL++VLVSQ LGLA GAILMDVKQ TTLASVT LVFL+AGGYY+Q IP
Sbjct  542  PSFVTFALTLSIVLYNVLVSQGLGLALGAILMDVKQGTTLASVTMLVFLLAGGYYIQHIP  601

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC  G +C V +FP +K +G + MW DV+ 
Sbjct  602  SFIAWLKYISFSHYCYKLLVGVQYSANEVYECEMGMHCSVMNFPAIKYLGLDSMWSDVAA  661

Query  201  MAMMLVGYRFIAYLALH  151
            +A+MLVGYR +AY+AL 
Sbjct  662  LAVMLVGYRVLAYVALR  678



>ref|XP_004972751.1| PREDICTED: ABC transporter G family member 14-like [Setaria italica]
Length=747

 Score =   247 bits (631),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 139/201 (69%), Positives = 166/201 (83%), Gaps = 1/201 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFP ER ML+KERSSGMYRLSSYF ++   DLP+EL LPTAF  ILYWMGGL 
Sbjct  539  PLYNAVFTFPLERPMLLKERSSGMYRLSSYFASRAAADLPMELGLPTAFVLILYWMGGLD  598

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P P  F LSL +VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+VFLIAGGYYVQ IP
Sbjct  599  PHPGPFLLSLAVVLYSVLVAQSLGLAIGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  658

Query  381  PFILWLKYLSYSFYCFKLLLGVQY-NDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVS  205
            PF+ WL++L+YSFYC++LLLG+Q+ N   YY+C  G  C VA+FP +KAVG N+ WVDV 
Sbjct  659  PFVAWLRWLNYSFYCYRLLLGIQFPNGGGYYDCGGGAMCPVAEFPAIKAVGLNNHWVDVC  718

Query  204  VMAMMLVGYRFIAYLALHRVR  142
            VMA++LVGYR +AY+AL R++
Sbjct  719  VMALLLVGYRVVAYIALDRLK  739



>gb|KHN07718.1| ABC transporter G family member 21, partial [Glycine soja]
Length=602

 Score =   244 bits (623),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 133/198 (67%), Positives = 166/198 (84%), Gaps = 1/198 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP +R ML KERSSGMY LSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  400  PLFNAIFAFPLDRPMLTKERSSGMYHLSSYYVARTVGDLPMELVLPTIFVTISYWMGGLK  459

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ +GLA GA+LMDVKQATTLASVT LVFL+AGGYY+QQIP
Sbjct  460  PSLVTFVLTLLIMLFNVLVSQGIGLALGALLMDVKQATTLASVTMLVFLLAGGYYIQQIP  519

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKG-HYCRVADFPGVKAVGFNHMWVDVS  205
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC +G  +C+V DFP +K +G + +W DV+
Sbjct  520  FFIAWLKYISFSHYCYKLLVGVQYSVNEVYECGQGLLHCKVRDFPAIKCLGLDSLWGDVA  579

Query  204  VMAMMLVGYRFIAYLALH  151
            V+A+ML+GYR +AYLAL 
Sbjct  580  VLAVMLIGYRVVAYLALR  597



>gb|KHN37813.1| ABC transporter G family member 21 [Glycine soja]
Length=666

 Score =   245 bits (626),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER MLIKERSSGMY+LSSY++A+ VGDLP+EL LPT F  I YWMGGLK
Sbjct  464  PLFNAIFAFPLERPMLIKERSSGMYKLSSYYVARMVGDLPMELVLPTIFVTISYWMGGLK  523

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ +GLA GAILMDVKQATTLASVT LVFL+AGGYY+QQ+P
Sbjct  524  PSLVTFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATTLASVTMLVFLLAGGYYIQQMP  583

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNH-MWVDVS  205
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC  G +CRV DFP +K +G +  MW DV+
Sbjct  584  AFIAWLKYISFSHYCYKLLVGVQYSVNEVYECGPGLHCRVRDFPAIKCMGLDDTMWGDVA  643

Query  204  VMAMMLVGYRFIAYLAL  154
             + +ML+GYR +AYLAL
Sbjct  644  ALTVMLIGYRVVAYLAL  660



>ref|XP_006589394.1| PREDICTED: ABC transporter G family member 21-like [Glycine max]
Length=684

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 134/197 (68%), Positives = 164/197 (83%), Gaps = 1/197 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER MLIKERSSGMY+LSSY++A+ VGDLP+EL LPT F  I YWMGGLK
Sbjct  482  PLFNAIFAFPLERPMLIKERSSGMYKLSSYYVARMVGDLPMELVLPTIFVTISYWMGGLK  541

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ +GLA GAILMDVKQATTLASVT LVFL+AGGYY+QQ+P
Sbjct  542  PSLVTFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATTLASVTMLVFLLAGGYYIQQMP  601

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNH-MWVDVS  205
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC  G +CRV DFP +K +G +  MW DV+
Sbjct  602  AFIAWLKYISFSHYCYKLLVGVQYSVNEVYECGPGLHCRVRDFPAIKCMGLDDTMWGDVA  661

Query  204  VMAMMLVGYRFIAYLAL  154
             + +ML+GYR +AYLAL
Sbjct  662  ALTVMLIGYRVVAYLAL  678



>ref|XP_002314895.1| hypothetical protein POPTR_0010s14180g [Populus trichocarpa]
 gb|EEF01066.1| hypothetical protein POPTR_0010s14180g [Populus trichocarpa]
Length=683

 Score =   245 bits (626),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FPQER MLIKERSSGMYRLSSY+ A+  GDLP+EL +PT F  + YWMGGLK
Sbjct  482  PLFNAIFAFPQERPMLIKERSSGMYRLSSYYFARMAGDLPMELVMPTIFVTVTYWMGGLK  541

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+LL++LF+VLVSQ LGLA GAILMDVKQATTLASVT LVFL+AGGYY+Q IP
Sbjct  542  PSLITFVLTLLVILFNVLVSQGLGLALGAILMDVKQATTLASVTMLVFLLAGGYYIQHIP  601

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S YC+KLL+GVQY+  + Y+C    +CRV DFP +K +G ++MW D + 
Sbjct  602  PFIAWLKYISFSHYCYKLLVGVQYSATEVYDCGLQMHCRVMDFPAIKYLGLDNMWWDAAA  661

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLVGYR +AY+AL 
Sbjct  662  LTIMLVGYRLLAYVALR  678



>gb|AIU41651.1| ABC transporter family protein [Hevea brasiliensis]
Length=680

 Score =   244 bits (623),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 163/200 (82%), Gaps = 0/200 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+P++NA+FTFPQER MLIKERSSGMYRLSSY+ A+  GDLP+EL LPT F    YWMG
Sbjct  476  GFFPMFNAIFTFPQERPMLIKERSSGMYRLSSYYFARMAGDLPMELVLPTIFVIFTYWMG  535

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK   +TF L+LLI+LF+VLVSQ LGLA GAILM+ KQATTLASVT LVFL+AGGYY+Q
Sbjct  536  GLKSSVITFVLTLLIILFNVLVSQGLGLALGAILMEAKQATTLASVTMLVFLLAGGYYIQ  595

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IPPFI WLKY+S+S +C+KLL+GVQY+ N+ YEC  G  CRV DFP +K +G ++   D
Sbjct  596  HIPPFIAWLKYISFSHFCYKLLVGVQYSANEVYECELGMDCRVMDFPAIKCLGTDNKGWD  655

Query  210  VSVMAMMLVGYRFIAYLALH  151
            V+ +++MLVGYR +AY+AL 
Sbjct  656  VAALSIMLVGYRLLAYVALR  675



>ref|XP_002443920.1| hypothetical protein SORBIDRAFT_07g004390 [Sorghum bicolor]
 gb|EES13415.1| hypothetical protein SORBIDRAFT_07g004390 [Sorghum bicolor]
Length=749

 Score =   245 bits (625),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 133/203 (66%), Positives = 160/203 (79%), Gaps = 3/203 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVFTFP ER ML+KER SGMYRLSSY  ++   DLP+EL LPTAF  ILYWMGGL 
Sbjct  545  PLYNAVFTFPLERPMLVKERCSGMYRLSSYLASRAATDLPMELGLPTAFVLILYWMGGLD  604

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P P  F LSL +VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+VFLIAGGYYVQ IP
Sbjct  605  PRPAPFLLSLAVVLYSVLVAQSLGLAIGAVLMDVKQGTTLASVITMVFLIAGGYYVQHIP  664

Query  381  PFILWLKYLSYSFYCFKLLLGVQYND---NDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            PF+ WL++L+YSFYC++LLLG+Q+ +           G  C VA+FP +KAVG N+ WVD
Sbjct  665  PFVAWLRWLNYSFYCYRLLLGIQFPNGGGYYDCGDGHGKLCAVAEFPAIKAVGLNNHWVD  724

Query  210  VSVMAMMLVGYRFIAYLALHRVR  142
            V VMA++LVGYR +AY+AL R++
Sbjct  725  VCVMALLLVGYRVVAYIALDRLK  747



>ref|XP_002524381.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF37992.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=709

 Score =   243 bits (621),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 162/197 (82%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FPQER +LIKERSSGMYRLSSY+ A+  GDLP+EL +P  F  + YWMGGLK
Sbjct  508  PLFNAIFAFPQERPILIKERSSGMYRLSSYYFARMAGDLPMELVMPIIFVTVAYWMGGLK  567

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ LGLA GA+LMDVKQ TTLASVT LVFL+AGGYY+Q IP
Sbjct  568  PSLITFVLTLLIILFNVLVSQGLGLALGAVLMDVKQGTTLASVTMLVFLLAGGYYIQHIP  627

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC  G +CRV DFP ++ +G ++MW DV+ 
Sbjct  628  AFIAWLKYISFSHYCYKLLVGVQYSVNEVYECEAGMHCRVMDFPAIRYLGLDNMWWDVAA  687

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLVGYRF+AY+AL 
Sbjct  688  LLIMLVGYRFLAYVALR  704



>ref|XP_004496215.1| PREDICTED: ABC transporter G family member 21-like [Cicer arietinum]
Length=681

 Score =   243 bits (619),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 163/197 (83%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER ML KERSSGMY LSSY++A+ VGDLP+EL LPT F  I YWMGGLK
Sbjct  480  PLFNAIFAFPLERPMLTKERSSGMYHLSSYYVARMVGDLPMELVLPTIFVTITYWMGGLK  539

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ +GLA GAILMDVKQATTLASVT LVFL+AGGYY+Q++P
Sbjct  540  PSLITFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATTLASVTMLVFLLAGGYYIQKMP  599

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY+ ++ YEC +G +CRV DFP +K +  ++MWVDV+ 
Sbjct  600  SFIAWLKYISFSHYCYKLLVGVQYSVSEVYECRQGLHCRVRDFPAIKCLEIDNMWVDVAA  659

Query  201  MAMMLVGYRFIAYLALH  151
            + +M +G+R +AYLAL 
Sbjct  660  LTIMFIGFRVVAYLALR  676



>ref|XP_003520157.2| PREDICTED: ABC transporter G family member 21-like [Glycine max]
Length=680

 Score =   242 bits (618),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 165/197 (84%), Gaps = 1/197 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP +R ML KERSSGMY LSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  478  PLFNAIFAFPLDRPMLTKERSSGMYHLSSYYVARTVGDLPMELVLPTIFVTISYWMGGLK  537

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ +GLA GA+LMDVKQATTLASVT LVFL+AGGYY+QQIP
Sbjct  538  PSLVTFVLTLLIMLFNVLVSQGIGLALGALLMDVKQATTLASVTMLVFLLAGGYYIQQIP  597

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKG-HYCRVADFPGVKAVGFNHMWVDVS  205
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC +G  +C+V DFP +K +G + +W DV+
Sbjct  598  FFIAWLKYISFSHYCYKLLVGVQYSVNEVYECGQGLLHCKVRDFPAIKCLGLDSLWGDVA  657

Query  204  VMAMMLVGYRFIAYLAL  154
            V+A+M +GYR +AYLAL
Sbjct  658  VLAVMFIGYRVVAYLAL  674



>ref|XP_007153314.1| hypothetical protein PHAVU_003G024700g [Phaseolus vulgaris]
 gb|ESW25308.1| hypothetical protein PHAVU_003G024700g [Phaseolus vulgaris]
Length=671

 Score =   242 bits (617),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 163/198 (82%), Gaps = 0/198 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP +R MLIKERSSGMY LSSY++A+TVGDLP+EL LPT F  I YWM GLK
Sbjct  470  PLFNAIFAFPLDRPMLIKERSSGMYHLSSYYVARTVGDLPMELVLPTIFVTISYWMEGLK  529

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF  +LLI+LF+VLVSQ +GLA GAIL+DVKQATTLASVT LVFL+AGGYY+Q+IP
Sbjct  530  PSLVTFVFTLLIMLFNVLVSQGIGLALGAILIDVKQATTLASVTMLVFLLAGGYYIQKIP  589

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL GVQY+ N+ YEC  G +C++ DFP +K +G +++W DV V
Sbjct  590  FFISWLKYISFSHYCYKLLAGVQYSVNEVYECGHGLHCKIRDFPAIKCLGLDNLWKDVVV  649

Query  201  MAMMLVGYRFIAYLALHR  148
            + +ML+GYR +AYLAL +
Sbjct  650  LTIMLIGYRVVAYLALRK  667



>ref|XP_010528033.1| PREDICTED: ABC transporter G family member 21-like [Tarenaya 
hassleriana]
Length=684

 Score =   241 bits (615),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 133/201 (66%), Positives = 163/201 (81%), Gaps = 3/201 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER ML+KERSSGMY+LSSYF+A+TVGDLP+EL LPT F  + YWM GLK
Sbjct  485  PLFNAIFTFPQERPMLLKERSSGMYKLSSYFVARTVGDLPMELILPTVFITVTYWMSGLK  544

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P   TF L+LLIVL++VLV+Q +GLA GAILMDVKQATTL+SVT LVFL+AGGYY+Q IP
Sbjct  545  PSLTTFLLTLLIVLYNVLVAQGVGLAMGAILMDVKQATTLSSVTMLVFLLAGGYYIQHIP  604

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAV--GFNHMWVDV  208
             FI WLKY+S+S YC+KLL+GVQY  N+ YEC  G +CRV D+ G++ +  G N MW DV
Sbjct  605  AFIAWLKYISFSHYCYKLLVGVQYTGNEVYECGLGLHCRVMDYEGIRNLMTGDNMMW-DV  663

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              + +MLVGYR +AYLAL  +
Sbjct  664  VALGIMLVGYRVLAYLALRNL  684



>ref|XP_003591854.1| ABC transporter G family member [Medicago truncatula]
 gb|AES62105.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=665

 Score =   240 bits (613),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 129/198 (65%), Positives = 160/198 (81%), Gaps = 0/198 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP +R ML KERSSGMY LSSY++A+ VGDLP+EL LPT F  I YWMGGLK
Sbjct  463  PLFNAIFAFPLDRPMLTKERSSGMYHLSSYYVARMVGDLPMELVLPTIFVTITYWMGGLK  522

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ +GLA GAILMDVKQATTLASVT LVFL+AGGYY+Q++P
Sbjct  523  PSLVTFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATTLASVTMLVFLLAGGYYIQKMP  582

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY S+S YC+KLL+GVQ++ N+ YEC +G +CR  DFP +K +   +MW DV+ 
Sbjct  583  SFIAWLKYFSFSHYCYKLLVGVQFSVNEVYECREGLHCRARDFPAIKCLELGNMWGDVAA  642

Query  201  MAMMLVGYRFIAYLALHR  148
            + +M VGYR +AYLAL R
Sbjct  643  LTIMFVGYRVVAYLALRR  660



>gb|KHN00888.1| ABC transporter G family member 21 [Glycine soja]
Length=674

 Score =   239 bits (611),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 162/198 (82%), Gaps = 1/198 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER MLIKERSSGMY+LSSY+ A+ VGDLP+EL LPT F  I YWMGGL 
Sbjct  472  PLFNAIFAFPLERPMLIKERSSGMYKLSSYYAARMVGDLPMELVLPTIFVTISYWMGGLN  531

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ +GLA GAILMDVKQAT+LASVT LVFL+AGGYY+QQ+P
Sbjct  532  PSLVTFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATSLASVTMLVFLLAGGYYIQQMP  591

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGF-NHMWVDVS  205
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC +G +CRV DFP +K +   + MW DV+
Sbjct  592  AFIAWLKYISFSHYCYKLLVGVQYSVNEVYECGQGLHCRVRDFPAIKCLELEDTMWGDVA  651

Query  204  VMAMMLVGYRFIAYLALH  151
             + +ML+GYR +AYLAL 
Sbjct  652  ALTVMLIGYRVVAYLALR  669



>ref|XP_003556255.1| PREDICTED: ABC transporter G family member 21-like [Glycine max]
Length=682

 Score =   239 bits (611),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 131/198 (66%), Positives = 162/198 (82%), Gaps = 1/198 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER MLIKERSSGMY+LSSY+ A+ VGDLP+EL LPT F  I YWMGGL 
Sbjct  480  PLFNAIFAFPLERPMLIKERSSGMYKLSSYYAARMVGDLPMELVLPTIFITISYWMGGLN  539

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ +GLA GAILMDVKQAT+LASVT LVFL+AGGYY+QQ+P
Sbjct  540  PSLVTFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATSLASVTMLVFLLAGGYYIQQMP  599

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGF-NHMWVDVS  205
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC +G +CRV DFP +K +   + MW DV+
Sbjct  600  AFIAWLKYISFSHYCYKLLVGVQYSVNEVYECGQGLHCRVRDFPAIKCLELEDTMWGDVA  659

Query  204  VMAMMLVGYRFIAYLALH  151
             + +ML+GYR +AYLAL 
Sbjct  660  ALTVMLIGYRVVAYLALR  677



>ref|XP_011008785.1| PREDICTED: ABC transporter G family member 21 [Populus euphratica]
 ref|XP_011008793.1| PREDICTED: ABC transporter G family member 21 [Populus euphratica]
Length=684

 Score =   239 bits (610),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL NA+F FPQER MLIKERSSGMYRLSSY+ A+  GDLP+EL +PT F  + YWMGGLK
Sbjct  483  PLSNAIFAFPQERPMLIKERSSGMYRLSSYYFARMAGDLPMELVMPTIFVTVAYWMGGLK  542

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ LGLA GAIL+DVKQATTLASV  LVFL+AGGYY+Q IP
Sbjct  543  PSLITFVLTLLIILFNVLVSQGLGLALGAILIDVKQATTLASVIMLVFLLAGGYYIQHIP  602

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S YC+KLL+GVQY+  + Y+C    +CRV DFP +K +G ++MW D + 
Sbjct  603  PFIAWLKYVSFSHYCYKLLVGVQYSATEVYDCGLQMHCRVMDFPDIKYLGLDNMWWDAAA  662

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLVGYR +AY+AL 
Sbjct  663  LTIMLVGYRLLAYVALR  679



>ref|XP_007046353.1| ABC-2 type transporter family protein [Theobroma cacao]
 gb|EOY02185.1| ABC-2 type transporter family protein [Theobroma cacao]
Length=684

 Score =   239 bits (609),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 161/197 (82%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FPQER MLIKER+SGMYRLSSY+ A+T GDLP+EL LPT F  + YWMGGLK
Sbjct  483  PLFNAIFAFPQERPMLIKERASGMYRLSSYYFARTAGDLPMELVLPTIFVTVTYWMGGLK  542

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+LLIVLF+VLVSQ LGLA GAILMDVKQ TTLASVT LVFL+AGGYY+Q IP
Sbjct  543  PSLVTFVLTLLIVLFNVLVSQGLGLALGAILMDVKQGTTLASVTMLVFLLAGGYYIQHIP  602

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S +C+KLL+GVQY+ N+ YEC  G +C++ DFP +K +G ++   DV+ 
Sbjct  603  LFIAWLKYISFSHFCYKLLVGVQYSVNEVYECDIGMHCKIMDFPAIKYLGLDNKLWDVAA  662

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLVGYR +AY+AL 
Sbjct  663  LTIMLVGYRLLAYVALR  679



>ref|XP_006573283.1| PREDICTED: ABC transporter G family member 21-like [Glycine max]
Length=678

 Score =   238 bits (608),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 130/196 (66%), Positives = 163/196 (83%), Gaps = 0/196 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NAVF FP ER ML+KERSSGMY LSSY++A+ VGDLP+E  LPT F  I YWMGGLK
Sbjct  477  PLFNAVFAFPLERPMLMKERSSGMYHLSSYYVARMVGDLPMEFVLPTIFVTISYWMGGLK  536

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ +GLA GAILMDVKQATTLASVT LVFL+AGGYY++ IP
Sbjct  537  PSLVTFVLTLLIMLFNVLVSQGIGLALGAILMDVKQATTLASVTMLVFLLAGGYYIRHIP  596

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY+ N+ Y+C +G + R+ DFP +K +G + +W DV+V
Sbjct  597  FFIAWLKYISFSHYCYKLLVGVQYSVNEVYQCRQGLHYRIRDFPAIKCLGLDSLWGDVAV  656

Query  201  MAMMLVGYRFIAYLAL  154
            +A+ML+GYR +AYLAL
Sbjct  657  LAVMLIGYRVVAYLAL  672



>ref|XP_007143780.1| hypothetical protein PHAVU_007G100900g [Phaseolus vulgaris]
 gb|ESW15774.1| hypothetical protein PHAVU_007G100900g [Phaseolus vulgaris]
Length=681

 Score =   238 bits (607),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 130/198 (66%), Positives = 162/198 (82%), Gaps = 1/198 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER MLIKERSSGMY+LSSY++A+ VGDLP+EL LPT F  I YWMGGLK
Sbjct  479  PLFNAIFAFPLERPMLIKERSSGMYQLSSYYVARMVGDLPMELVLPTIFVTISYWMGGLK  538

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L++LI+LF+VLVSQ +GLA GAILMDVKQATTLASVT LVFL+AGGYY+QQ+P
Sbjct  539  PSLVTFVLTILIMLFNVLVSQGIGLALGAILMDVKQATTLASVTMLVFLLAGGYYIQQMP  598

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGF-NHMWVDVS  205
             FI WLKY+S+S YC+KLL+ VQY  N+ YEC  G +CRV DFP +K +   ++MW +V+
Sbjct  599  AFIAWLKYISFSHYCYKLLVAVQYPINEVYECGPGLHCRVRDFPAIKCLELDDNMWGEVA  658

Query  204  VMAMMLVGYRFIAYLALH  151
             + +ML+GYR +AYLAL 
Sbjct  659  ALTVMLIGYRIVAYLALR  676



>ref|XP_004297158.1| PREDICTED: ABC transporter G family member 21 [Fragaria vesca 
subsp. vesca]
Length=694

 Score =   237 bits (605),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 157/197 (80%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER ML KERSSGMYRLSSY+ A+TVGDLP+EL LPT F  + YWMGGLK
Sbjct  493  PLFNAIFAFPMERPMLRKERSSGMYRLSSYYFARTVGDLPMELVLPTVFVTVAYWMGGLK  552

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +T+ L+L IVLF+VLVSQ LGLA GAILMDVKQ TTLASVT LVFL+ GGYY+Q +P
Sbjct  553  PSLVTYGLTLFIVLFNVLVSQGLGLALGAILMDVKQGTTLASVTMLVFLLVGGYYIQHMP  612

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLLLGVQY+  + YEC  G  CRV D+P VK VG + +W DV+ 
Sbjct  613  GFIAWLKYISFSHYCYKLLLGVQYSVKEVYECDLGVRCRVIDYPAVKFVGLDGLWSDVAA  672

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLVGYR +AY+AL 
Sbjct  673  LGVMLVGYRVLAYVALR  689



>ref|XP_010681458.1| PREDICTED: ABC transporter G family member 21 [Beta vulgaris 
subsp. vulgaris]
Length=377

 Score =   229 bits (583),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 157/196 (80%), Gaps = 0/196 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FPQER MLI+ER+SGMY LS+Y+LA+ VGDLP+EL LPT F  I Y+MGGLK
Sbjct  176  PLFNAIFVFPQERPMLIRERASGMYHLSAYYLARMVGDLPMELVLPTIFVSITYYMGGLK  235

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P PLTF L+L IVL++VLVSQ LGLA GA+LMDVKQATTLASV  LVFL+AGGYY+Q IP
Sbjct  236  PSPLTFILTLAIVLYNVLVSQGLGLALGAMLMDVKQATTLASVIMLVFLLAGGYYIQHIP  295

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S YC+KLL+GVQY   + YEC     C+V D+P +K +G +++  DV+ 
Sbjct  296  PFIAWLKYVSFSHYCYKLLIGVQYLGYEVYECGLKMRCKVVDYPTIKHLGIHNLGFDVTA  355

Query  201  MAMMLVGYRFIAYLAL  154
            + +M VGYR +AY AL
Sbjct  356  LTIMFVGYRLLAYAAL  371



>gb|KJB50814.1| hypothetical protein B456_008G188000 [Gossypium raimondii]
Length=690

 Score =   236 bits (602),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 129/199 (65%), Positives = 157/199 (79%), Gaps = 2/199 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FPQER MLIKE SSGMYRLSSY++A+T GDLP+EL LPT F  + YWMGGLK
Sbjct  486  PLFNAIFAFPQERPMLIKEGSSGMYRLSSYYVARTTGDLPMELVLPTIFVTVTYWMGGLK  545

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+LLIV  +VLVSQ LGLA GAILMDVKQATTLASVT LVFL+ GGYY+  +P
Sbjct  546  PSLVTFVLTLLIVHLNVLVSQGLGLALGAILMDVKQATTLASVTMLVFLLVGGYYIHHMP  605

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGF--NHMWVDV  208
             FI WLKY+S+S YC+KLL+GVQY+ N+ YEC  G  C+V DFP +K +G   N+ W DV
Sbjct  606  AFIAWLKYISFSHYCYKLLVGVQYSVNEVYECEIGRRCKVMDFPAIKYLGLDNNNRWWDV  665

Query  207  SVMAMMLVGYRFIAYLALH  151
            + +A+ML GYR +AY+ L 
Sbjct  666  AALAIMLAGYRLLAYVGLR  684



>ref|XP_010648137.1| PREDICTED: ABC transporter G family member 21 [Vitis vinifera]
 emb|CBI27088.3| unnamed protein product [Vitis vinifera]
Length=676

 Score =   235 bits (600),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 128/197 (65%), Positives = 158/197 (80%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLI+ERSSGMYRLSSY+ A+  GDLP+EL LPT F  I YWMGGLK
Sbjct  475  PLFNAIFTFPQERPMLIRERSSGMYRLSSYYFARMAGDLPMELVLPTIFVTIAYWMGGLK  534

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  LTF L+LL++L++VLVSQ LGLA GAI+MDVKQ T LASVT LVFL+AGGYY+Q IP
Sbjct  535  PSLLTFVLTLLVILYNVLVSQGLGLALGAIIMDVKQGTALASVTMLVFLLAGGYYIQHIP  594

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S YC+KLL+GVQY +N+ YEC    +C+V +FP +K +G +H   DV+ 
Sbjct  595  PFIAWLKYISFSHYCYKLLVGVQYAENEVYECGLRMHCKVWEFPAIKYLGIDHWAWDVAA  654

Query  201  MAMMLVGYRFIAYLALH  151
            + +M VGYR +AY AL 
Sbjct  655  LTVMFVGYRALAYAALR  671



>emb|CAN62390.1| hypothetical protein VITISV_039480 [Vitis vinifera]
Length=696

 Score =   235 bits (600),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 158/196 (81%), Gaps = 0/196 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLI+ERSSGMYRLSSY+ A+  GDLP+EL LPT F  I YWMGGLK
Sbjct  495  PLFNAIFTFPQERPMLIRERSSGMYRLSSYYFARMAGDLPMELVLPTIFVTIAYWMGGLK  554

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  LTF L+LL++L++VLVSQ LGLA GAI+MDVKQ T LASVT LVFL+AGGYY+Q IP
Sbjct  555  PSLLTFVLTLLVILYNVLVSQGLGLALGAIIMDVKQGTALASVTMLVFLLAGGYYIQHIP  614

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S YC+KLL+GVQY +N+ YEC    +C+V +FP +K +G +H   DV+ 
Sbjct  615  PFIAWLKYISFSHYCYKLLVGVQYAENEVYECGLRMHCKVWEFPAIKYLGIDHWAWDVAA  674

Query  201  MAMMLVGYRFIAYLAL  154
            + +M VGYR +AY AL
Sbjct  675  LTVMFVGYRALAYAAL  690



>ref|XP_006484387.1| PREDICTED: ABC transporter G family member 21-like [Citrus sinensis]
Length=691

 Score =   234 bits (598),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 160/200 (80%), Gaps = 1/200 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL NA+F FPQER MLIKERSSGMYRLSSY+ A+ VGDLP+EL LPT F  + YWMGGLK
Sbjct  490  PLNNAIFVFPQERAMLIKERSSGMYRLSSYYFARMVGDLPMELVLPTIFITVTYWMGGLK  549

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+L I+LF+VLV+QSLGL  GAI+MDVKQAT LASVT LVFL+AGGYY+Q + 
Sbjct  550  PSLITFLLTLSIILFNVLVAQSLGLLLGAIIMDVKQATALASVTMLVFLMAGGYYIQHMS  609

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S YC+KLL+GVQY+ N+ Y C  G +C V +FP +K +G ++  +DV+ 
Sbjct  610  PFIAWLKYISFSHYCYKLLVGVQYSANEVYACGSGLHCSVMEFPAIKYLGVDNKLIDVAA  669

Query  201  MAMMLVGYRFIAYLALHRVR  142
            + MMLVGYR +AY+ L R+R
Sbjct  670  LTMMLVGYRLLAYVTL-RMR  688



>ref|XP_006437762.1| hypothetical protein CICLE_v10030868mg [Citrus clementina]
 gb|ESR51002.1| hypothetical protein CICLE_v10030868mg [Citrus clementina]
Length=691

 Score =   234 bits (597),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 160/200 (80%), Gaps = 1/200 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL NA+F FPQER MLIKERSSGMYRLSSY+ A+ VGDLP+EL LPT F  + YWMGGLK
Sbjct  490  PLNNAIFVFPQERAMLIKERSSGMYRLSSYYFARMVGDLPMELVLPTIFITVTYWMGGLK  549

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+L I+LF+VLV+QSLGL  GAI+MDVKQAT LASVT LVFL+AGGYY+Q + 
Sbjct  550  PSLITFLLTLSIILFNVLVAQSLGLLLGAIIMDVKQATALASVTMLVFLMAGGYYIQHMS  609

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S YC+KLL+GVQY+ N+ Y C  G +C V +FP +K +G ++  +DV+ 
Sbjct  610  PFIAWLKYISFSHYCYKLLVGVQYSANEVYACGSGLHCSVMEFPAIKYLGVDNKLIDVAA  669

Query  201  MAMMLVGYRFIAYLALHRVR  142
            + MMLVGYR +AY+ L R+R
Sbjct  670  LTMMLVGYRLLAYVTL-RMR  688



>gb|KDO70136.1| hypothetical protein CISIN_1g005545mg [Citrus sinensis]
Length=691

 Score =   234 bits (597),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 128/200 (64%), Positives = 160/200 (80%), Gaps = 1/200 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL NA+F FPQER MLIKERSSGMYRLSSY+ A+ VGDLP+EL LPT F  + YWMGGLK
Sbjct  490  PLNNAIFVFPQERAMLIKERSSGMYRLSSYYFARMVGDLPMELVLPTIFITVAYWMGGLK  549

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+L I+LF+VLV+QSLGL  GAI+MDVKQAT LASVT LVFL+AGGYY+Q + 
Sbjct  550  PSLITFLLTLSIILFNVLVAQSLGLLLGAIIMDVKQATALASVTMLVFLMAGGYYIQHMS  609

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S YC+KLL+GVQY+ N+ Y C  G +C V +FP +K +G ++  +DV+ 
Sbjct  610  PFIAWLKYISFSHYCYKLLVGVQYSANEVYACGSGLHCSVMEFPAIKYLGVDNKLIDVAA  669

Query  201  MAMMLVGYRFIAYLALHRVR  142
            + MMLVGYR +AY+ L R+R
Sbjct  670  LTMMLVGYRLLAYVTL-RMR  688



>ref|XP_010066762.1| PREDICTED: ABC transporter G family member 21 [Eucalyptus grandis]
 gb|KCW64799.1| hypothetical protein EUGRSUZ_G02369 [Eucalyptus grandis]
Length=679

 Score =   234 bits (596),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 127/197 (64%), Positives = 156/197 (79%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NAVF FP ER MLIKERSSGMYRLSSY+ A+  GDLP+EL LPT F  + YWMGGLK
Sbjct  478  PLFNAVFAFPLERPMLIKERSSGMYRLSSYYFARIAGDLPMELVLPTIFVTVTYWMGGLK  537

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P   TF L+LLI+LF+VLVSQ LGLA GA+LMD KQ TTLASVT LVFL+ GGYY+Q IP
Sbjct  538  PSLGTFVLTLLIILFNVLVSQGLGLALGAVLMDAKQGTTLASVTMLVFLLVGGYYIQHIP  597

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC++LL+GVQY+ N+ Y+C  G  CRV DFP +  +G +++  DV+ 
Sbjct  598  SFIAWLKYVSFSHYCYELLVGVQYSVNEVYDCGAGRQCRVMDFPAISCLGLDNLLRDVAA  657

Query  201  MAMMLVGYRFIAYLALH  151
            +A+MLVGYR +AY+AL 
Sbjct  658  LAVMLVGYRLLAYMALR  674



>ref|XP_011077437.1| PREDICTED: ABC transporter G family member 21 [Sesamum indicum]
Length=672

 Score =   231 bits (588),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 125/197 (63%), Positives = 157/197 (80%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL++AVF FPQE  ML +E SSGMYRLSSY+ A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  471  PLFSAVFVFPQEWSMLTRECSSGMYRLSSYYFARTVGDLPMELVLPTIFVTISYWMGGLK  530

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+L I+L +VLV+Q LGLA GA+LM+VKQATTL+SV  LVFL+A GYY+Q IP
Sbjct  531  PSLITFLLTLWIILLNVLVAQGLGLALGAVLMNVKQATTLSSVLMLVFLLASGYYIQHIP  590

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S YC+KLL+GVQY+ N+ Y+C  G+ CR  DFP +K +G +HM +DV  
Sbjct  591  PFIDWLKYISFSHYCYKLLVGVQYSPNEVYDCGLGYVCRAVDFPAIKYLGIDHMGLDVIA  650

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLVGYR +AY+AL 
Sbjct  651  LMLMLVGYRLLAYVALR  667



>emb|CDP00551.1| unnamed protein product [Coffea canephora]
Length=678

 Score =   230 bits (587),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 162/200 (81%), Gaps = 1/200 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            P++NAVF FPQE+ ML +ERSSGMYRLSSY+ A+TVGDLP+EL LPT F  + YWM GLK
Sbjct  477  PMFNAVFAFPQEQPMLTRERSSGMYRLSSYYFARTVGDLPMELVLPTIFVIVTYWMSGLK  536

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+LLI+LF+VLVSQ  GLA GAILMD+KQATTL+SV  LVFL+A GYY++ IP
Sbjct  537  PSLVTFVLTLLIILFNVLVSQGFGLALGAILMDLKQATTLSSVMMLVFLLASGYYIRHIP  596

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S Y +KLLL VQY++N+ Y+C  G +CRV D P +K +G  ++ +DV+ 
Sbjct  597  PFIAWLKYISFSHYSYKLLLAVQYSNNELYQCGVGVHCRVMDNPAIKFLGIENLGMDVAA  656

Query  201  MAMMLVGYRFIAYLALHRVR  142
            +A+ML+GYR +AY+AL R+R
Sbjct  657  LAVMLIGYRLLAYIAL-RLR  675



>ref|XP_006395639.1| hypothetical protein EUTSA_v10003766mg [Eutrema salsugineum]
 gb|ESQ32925.1| hypothetical protein EUTSA_v10003766mg [Eutrema salsugineum]
Length=670

 Score =   228 bits (580),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 158/199 (79%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  472  PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLK  531

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P   TF ++L+IVL++VLV+Q +GLA GAILMD K+A TL+SV  LVFL+AGGYY+Q IP
Sbjct  532  PSLTTFLMTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIP  591

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY  ++ YEC  G +CRV D+ G+K +   +M  DV  
Sbjct  592  GFIAWLKYISFSHYCYKLLVGVQYTWDEVYECGLGLHCRVMDYEGIKNLRIGNMMWDVLA  651

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A+ML+ YR  AYLAL  +
Sbjct  652  LAIMLLLYRVFAYLALRNL  670



>ref|XP_006855537.2| PREDICTED: ABC transporter G family member 14 [Amborella trichopoda]
Length=638

 Score =   227 bits (579),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 158/202 (78%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ ++FTFPQER ML KERSS MYRLS+YF+A+  GDLP+EL LPT+F  I+YWMG
Sbjct  433  GFFPLFQSIFTFPQERLMLHKERSSAMYRLSAYFMARIAGDLPMELLLPTSFVTIIYWMG  492

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+PL F  +L +VL++VL++  LGLA GA++M+++ ATTL SV TL F++ GGY++Q
Sbjct  493  GLKPDPLHFLCTLFVVLYNVLIAGGLGLAIGAMVMNLRNATTLGSVITLTFMLTGGYFIQ  552

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            ++P F+ W++Y+S + Y FKLLLG QY+ ++ YEC  G  CR+ADFP +KA+G +HM   
Sbjct  553  KVPVFMAWIRYISMTHYTFKLLLGSQYSVDEMYECEPGKSCRIADFPMIKAIGLDHMVRS  612

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
              V+ +MLVGYR +AY +L R+
Sbjct  613  ALVLWIMLVGYRLVAYASLTRI  634



>gb|ERN17004.1| hypothetical protein AMTR_s00057p00214480 [Amborella trichopoda]
Length=646

 Score =   227 bits (578),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 158/202 (78%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ ++FTFPQER ML KERSS MYRLS+YF+A+  GDLP+EL LPT+F  I+YWMG
Sbjct  441  GFFPLFQSIFTFPQERLMLHKERSSAMYRLSAYFMARIAGDLPMELLLPTSFVTIIYWMG  500

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+PL F  +L +VL++VL++  LGLA GA++M+++ ATTL SV TL F++ GGY++Q
Sbjct  501  GLKPDPLHFLCTLFVVLYNVLIAGGLGLAIGAMVMNLRNATTLGSVITLTFMLTGGYFIQ  560

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            ++P F+ W++Y+S + Y FKLLLG QY+ ++ YEC  G  CR+ADFP +KA+G +HM   
Sbjct  561  KVPVFMAWIRYISMTHYTFKLLLGSQYSVDEMYECEPGKSCRIADFPMIKAIGLDHMVRS  620

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
              V+ +MLVGYR +AY +L R+
Sbjct  621  ALVLWIMLVGYRLVAYASLTRI  642



>ref|XP_010514180.1| PREDICTED: ABC transporter G family member 21-like [Camelina 
sativa]
Length=673

 Score =   227 bits (578),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 158/199 (79%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  475  PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLK  534

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P   TF ++L+IVL++VLV+Q +GLA GAILMD K+A TL+SV  LVFL+AGGYY+Q IP
Sbjct  535  PSLTTFLMTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIP  594

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY  ++ YEC  G +C V ++ G+K +   +M  DV  
Sbjct  595  GFIAWLKYVSFSHYCYKLLVGVQYTWDEVYECGSGLHCSVMNYEGIKNLRIGNMMWDVLA  654

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A+ML+ YR +AYLAL  +
Sbjct  655  LAIMLLSYRVLAYLALRNL  673



>ref|XP_010425209.1| PREDICTED: ABC transporter G family member 21 isoform X1 [Camelina 
sativa]
Length=672

 Score =   225 bits (574),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 159/199 (80%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  474  PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLK  533

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P   TF L+L+IVL++VLV+Q +GLA GAILMD K+A TL+SV  LVFL+AGGYY+Q IP
Sbjct  534  PSLTTFLLTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIP  593

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY+ ++ YEC  G +C V ++ G+K +   +M  DV  
Sbjct  594  GFIAWLKYVSFSHYCYKLLVGVQYSWDEVYECGSGLHCSVMNYEGIKNLRIGNMMWDVLA  653

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A+ML+ YR +AYLAL  +
Sbjct  654  LAIMLLLYRVLAYLALRNL  672



>ref|XP_002876921.1| hypothetical protein ARALYDRAFT_904727 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53180.1| hypothetical protein ARALYDRAFT_904727 [Arabidopsis lyrata subsp. 
lyrata]
Length=671

 Score =   225 bits (573),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 157/199 (79%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  473  PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLK  532

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P   TF ++L+IVL++VLV+Q +GLA GAILMD K+A TL+SV  LVFL+AGGYY+Q IP
Sbjct  533  PSLTTFIMTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIP  592

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY   + YEC  G +C V D+ G++ +   +M  DV  
Sbjct  593  GFIAWLKYVSFSHYCYKLLVGVQYTWGEVYECGSGLHCSVMDYEGIRNLRIGNMMWDVLA  652

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A+ML+ YR +AYLAL  +
Sbjct  653  LAIMLLLYRVLAYLALRNL  671



>gb|EMT29518.1| hypothetical protein F775_52365 [Aegilops tauschii]
Length=571

 Score =   223 bits (568),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 130/201 (65%), Positives = 153/201 (76%), Gaps = 17/201 (8%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PLYNAVF FP ER ML+KERSSGMYRLSSYF A+T  DLP+EL LPTAF  ILYWMGGL 
Sbjct  385  PLYNAVFVFPLERPMLLKERSSGMYRLSSYFAARTAADLPMELGLPTAFVLILYWMGGLD  444

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P P +F LSLL+VL+SVLV+QSLGLA GA+LMDVKQ TTLASV T+VFLIA         
Sbjct  445  PRPASFLLSLLVVLYSVLVAQSLGLAVGAVLMDVKQGTTLASVVTMVFLIA---------  495

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDND-YYECSKGHYCRVADFPGVKAVGFNHMWVDVS  205
                   +L+YSFYC++LLLG+Q+ D    Y+C  G  C VADFP +KAVG N+ WVDV 
Sbjct  496  -------WLNYSFYCYRLLLGIQFRDGGALYDCGGGALCPVADFPAIKAVGLNNHWVDVC  548

Query  204  VMAMMLVGYRFIAYLALHRVR  142
            VMA++LVGYR +AYLAL R++
Sbjct  549  VMALLLVGYRVVAYLALDRLQ  569



>ref|XP_006290691.1| hypothetical protein CARUB_v10016784mg [Capsella rubella]
 gb|EOA23589.1| hypothetical protein CARUB_v10016784mg [Capsella rubella]
Length=673

 Score =   224 bits (572),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 157/199 (79%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  475  PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLK  534

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P   TF ++L+IVL++VLV+Q +GLA GAILMD K+A TL+SV  LVFL+AGGYY+Q IP
Sbjct  535  PSLTTFLMTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIP  594

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY  ++ YEC  G  C V ++ G+K +   +M  DV  
Sbjct  595  SFISWLKYVSFSHYCYKLLVGVQYTWDEVYECGSGLQCSVMNYEGIKNLKIGNMMWDVLA  654

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A+ML+ YR +AYLAL  +
Sbjct  655  LAIMLLLYRVLAYLALRNL  673



>ref|XP_010502439.1| PREDICTED: ABC transporter G family member 21-like isoform X1 
[Camelina sativa]
Length=672

 Score =   224 bits (572),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 158/199 (79%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  474  PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLK  533

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P   TF ++L+IVL++VLV+Q +GLA GAILMD K+A TL+SV  LVFL+AGGYY+Q IP
Sbjct  534  PSLTTFLMTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIP  593

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY  ++ YEC  G +C V ++ G+K +   +M  DV  
Sbjct  594  GFIAWLKYVSFSHYCYKLLVGVQYTWDEVYECGSGLHCSVMNYEGIKNLMIGNMMWDVLA  653

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A+ML+ YR +AYLAL  +
Sbjct  654  LAIMLLLYRVLAYLALRNL  672



>ref|XP_009586692.1| PREDICTED: ABC transporter G family member 21-like [Nicotiana 
tomentosiformis]
Length=675

 Score =   223 bits (569),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FPQER MLI+ERSSGMYRLSSY+ A+TVGDLP+EL LPT F  + YWMGGLK
Sbjct  475  PLFNAIFAFPQERPMLIRERSSGMYRLSSYYFARTVGDLPMELVLPTIFVTVTYWMGGLK  534

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  LTF L+LLI+L +VLVSQ LGLA GAILMDVKQATTL+SV  LVFL+A GYY+Q IP
Sbjct  535  PSFLTFMLTLLIILLNVLVSQGLGLALGAILMDVKQATTLSSVLMLVFLLASGYYIQHIP  594

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLLLGVQY+ N+ YEC  G YC V +FP +K +G +++ +DV  
Sbjct  595  IFINWLKYISFSHYCYKLLLGVQYSKNELYECGIGKYCEVMEFPAIKVLGIDNLVLDVVA  654

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLV YR +AY+AL 
Sbjct  655  LVVMLVVYRLLAYVALR  671



>ref|XP_006878615.1| PREDICTED: ABC transporter G family member 14 [Amborella trichopoda]
 gb|ERM94760.1| hypothetical protein AMTR_s00011p00258490 [Amborella trichopoda]
Length=648

 Score =   223 bits (568),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 157/204 (77%), Gaps = 2/204 (1%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKE-RSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWM  574
            GF+PL++AVF FPQER +L+KE R+S  YRLSSYF A+T+GDLP ELALPT F  + Y+ 
Sbjct  444  GFFPLFHAVFAFPQERAILMKEQRTSSYYRLSSYFTARTLGDLPTELALPTLFVLLSYFT  503

Query  573  GGLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYV  394
            GGLKP    FTL+LL++L +VLVSQ LGLA GA+LMDVK+ TTLASV TLVFL+AGGYYV
Sbjct  504  GGLKPTFTNFTLTLLVILLNVLVSQGLGLALGAVLMDVKKGTTLASVITLVFLLAGGYYV  563

Query  393  QQIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWV  214
            Q++P FI WLKY+S+S+YC+KLLLGVQY + D Y C  G  CRV D P V  VG  +   
Sbjct  564  QRVPSFIAWLKYVSFSYYCYKLLLGVQYGEGDVYGCGTG-LCRVVDLPAVANVGVGNKGR  622

Query  213  DVSVMAMMLVGYRFIAYLALHRVR  142
            DV  + +M+VGYR IAY AL R++
Sbjct  623  DVGALVVMMVGYRLIAYAALRRLK  646



>emb|CDY46506.1| BnaA02g27560D [Brassica napus]
Length=668

 Score =   223 bits (567),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 159/202 (79%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMG
Sbjct  467  GFLPLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMG  526

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK    TF ++L+IVL+SVLVSQ +GLA GAILMD K+A TL+SV  LVFL+AGGYY+Q
Sbjct  527  GLKSSLTTFIMTLMIVLYSVLVSQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQ  586

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IP FI WLKY+S+S YC+KLL+GVQY  ++ YEC  G +C V D+ G+K +   +M  D
Sbjct  587  HIPGFIAWLKYISFSHYCYKLLVGVQYTWDEVYECGPGLHCSVMDYEGIKNLRLGNMMWD  646

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V  + +ML+ YRF+AY+AL  +
Sbjct  647  VLALTLMLLLYRFLAYVALRNL  668



>emb|CAN62144.1| hypothetical protein VITISV_007841 [Vitis vinifera]
Length=603

 Score =   221 bits (564),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQER ML KERSSGMYRLSSYF+++T+GDLP+EL LPT F  I YWM 
Sbjct  395  GFFPLFQAIFTFPQERMMLEKERSSGMYRLSSYFMSRTIGDLPMELVLPTIFVIITYWMA  454

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP  + F  +L  +LFSVLVSQSLGLA GA +MD K AT L SV  L FL+AGGYYVQ
Sbjct  455  GLKPNAINFLHTLFALLFSVLVSQSLGLALGAAVMDQKSATILGSVIMLSFLLAGGYYVQ  514

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S S Y +KLLLG QY   D Y CS    C V DFP V+ VG +   + 
Sbjct  515  NVPHFIAWIKYVSISHYTYKLLLGSQYKPGDIYPCSAKTTCLVGDFPAVQLVGLDKQILA  574

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               +A+MLVGYR IAY+AL R+
Sbjct  575  AVALAIMLVGYRLIAYIALMRI  596



>ref|XP_009129040.1| PREDICTED: ABC transporter G family member 21-like [Brassica 
rapa]
Length=669

 Score =   223 bits (567),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 159/202 (79%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMG
Sbjct  468  GFLPLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMG  527

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK    TF ++L+IVL+SVLVSQ +GLA GAILMD K+A TL+SV  LVFL+AGGYY+Q
Sbjct  528  GLKSSLTTFIMTLMIVLYSVLVSQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQ  587

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IP FI WLKY+S+S YC+KLL+GVQY  ++ YEC  G +C V D+ G+K +   +M  D
Sbjct  588  HIPGFIAWLKYISFSHYCYKLLVGVQYTWDEVYECGPGLHCSVMDYEGIKNLRLGNMMWD  647

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V  + +ML+ YRF+AY+AL  +
Sbjct  648  VLALTLMLLLYRFLAYVALRNL  669



>ref|XP_009768130.1| PREDICTED: ABC transporter G family member 21-like [Nicotiana 
sylvestris]
Length=674

 Score =   222 bits (566),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 129/197 (65%), Positives = 159/197 (81%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FPQER MLI+ERSSGMYRLSSY+ A+TVGDLP+EL LPT F  + YWMGGLK
Sbjct  474  PLFNAIFAFPQERPMLIRERSSGMYRLSSYYFARTVGDLPMELVLPTIFVTVTYWMGGLK  533

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  LTF L+LLI+L +VLVSQ LGLA GAILMDVKQATTL+SV  LVFL+A GYY+Q IP
Sbjct  534  PSFLTFMLTLLIILLNVLVSQGLGLALGAILMDVKQATTLSSVLMLVFLLASGYYIQHIP  593

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLLLGVQY+ N+ Y+C  G YC V +FP +K +G +++ +DV  
Sbjct  594  IFINWLKYISFSHYCYKLLLGVQYSRNEVYQCGIGKYCEVVEFPAIKVLGIDNLVLDVVA  653

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLV YR +AY+AL 
Sbjct  654  LVVMLVVYRLLAYVALR  670



>ref|XP_002281949.1| PREDICTED: ABC transporter G family member 9 [Vitis vinifera]
Length=623

 Score =   221 bits (562),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQER ML KERSSGMYRLSSYF+++T+GDLP+EL LPT F  I YWM 
Sbjct  415  GFFPLFQAIFTFPQERMMLEKERSSGMYRLSSYFMSRTIGDLPMELVLPTIFVIITYWMA  474

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP  + F  +L  +LFSVLVSQSLGLA GA +MD K AT L SV  L FL+AGGYYVQ
Sbjct  475  GLKPNAINFLHTLFALLFSVLVSQSLGLALGAAVMDQKSATILGSVIMLSFLLAGGYYVQ  534

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S S Y +KLLLG QY   D Y CS    C V DFP V+ VG +   + 
Sbjct  535  NVPHFIAWIKYVSISHYTYKLLLGSQYKPGDIYPCSAKTTCLVGDFPAVQLVGLDKQILA  594

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               +A+MLVGYR IAY+AL R+
Sbjct  595  AVALAIMLVGYRLIAYIALMRI  616



>emb|CDY48079.1| BnaA06g33490D [Brassica napus]
Length=665

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 155/199 (78%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NAVFTFPQER MLIKERSSG+YRLSSY++A+ VGDLP+EL LPT F  I YWMGGLK
Sbjct  467  PLFNAVFTFPQERPMLIKERSSGIYRLSSYYIARIVGDLPMELILPTIFVTITYWMGGLK  526

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P   TF L+L+IVL++VLV+Q +GLA GAILMD K+A T +SV  LVFL+AGGYY+Q IP
Sbjct  527  PSLTTFLLTLMIVLYNVLVAQGVGLALGAILMDAKKAATFSSVLMLVFLLAGGYYIQHIP  586

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY  ++ YEC  G +C V D+ G+K +   +M  DV  
Sbjct  587  GFIAWLKYISFSHYCYKLLVGVQYTWDEVYECGPGLHCSVMDYEGIKNLRIGYMMWDVLA  646

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A+ML  YR +AYLAL  +
Sbjct  647  LALMLFLYRVLAYLALRNL  665



>gb|AFK38841.1| unknown [Lotus japonicus]
Length=145

 Score =   207 bits (527),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 135/145 (93%), Gaps = 0/145 (0%)
 Frame = -3

Query  576  MGGLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYY  397
            MGGLKP+P+TF LSL++VL+SV+VSQSLGLAFGAILM+VKQATTLASVTTLVFLIAGGYY
Sbjct  1    MGGLKPDPMTFILSLVVVLYSVVVSQSLGLAFGAILMEVKQATTLASVTTLVFLIAGGYY  60

Query  396  VQQIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMW  217
            +QQIPPFI+WLKYLSYSFYC+KLLLGVQYN+NDYYECS+G +C+  DFP +K++G +H+W
Sbjct  61   IQQIPPFIVWLKYLSYSFYCYKLLLGVQYNENDYYECSEGKFCKAVDFPPIKSMGLDHLW  120

Query  216  VDVSVMAMMLVGYRFIAYLALHRVR  142
            VDV +MA+MLVGYR +AY ALH VR
Sbjct  121  VDVFIMALMLVGYRLLAYFALHGVR  145



>gb|KFK39853.1| hypothetical protein AALP_AA3G297000 [Arabis alpina]
Length=672

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 121/199 (61%), Positives = 158/199 (79%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  474  PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLK  533

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P   TF ++L+IVL++VLV+Q +GLA GAILM+ K+A TL+SV  LVFL+AGGYY+Q IP
Sbjct  534  PSLATFLMTLMIVLYNVLVAQGVGLAIGAILMEAKKAATLSSVLMLVFLLAGGYYIQHIP  593

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY+ ++ Y+C  G +C V D+ G+K +   +M  DV  
Sbjct  594  GFIAWLKYISFSHYCYKLLVGVQYSWDEVYDCGLGLHCSVMDYEGIKNLKIGNMMWDVLA  653

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A ML+ YR ++YLAL  +
Sbjct  654  LAFMLIFYRVLSYLALRNL  672



>ref|XP_009152126.1| PREDICTED: ABC transporter G family member 21 [Brassica rapa]
Length=666

 Score =   221 bits (564),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 155/199 (78%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+ VGDLP+EL LPT F  I YWMGGLK
Sbjct  468  PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARIVGDLPMELILPTIFVTITYWMGGLK  527

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P   TF L+L+IVL++VLV+Q +GLA GAILMD K+A T +SV  LVFL+AGGYY+Q IP
Sbjct  528  PSLTTFLLTLMIVLYNVLVAQGVGLALGAILMDAKKAATFSSVLMLVFLLAGGYYIQHIP  587

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY  ++ YEC  G +C V D+ G+K +   +M  DV  
Sbjct  588  GFIAWLKYISFSHYCYKLLVGVQYTWDEVYECGPGLHCSVMDYEGIKNLRIGYMMWDVLA  647

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A+ML  YR +AYLAL  +
Sbjct  648  LALMLFLYRVLAYLALRNL  666



>ref|XP_009793168.1| PREDICTED: ABC transporter G family member 21-like [Nicotiana 
sylvestris]
Length=644

 Score =   221 bits (562),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 119/197 (60%), Positives = 154/197 (78%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL++A+F FPQER  LI+ERSSGMYRLSSY+ A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  444  PLFSAIFAFPQERPKLIRERSSGMYRLSSYYFARTVGDLPMELILPTIFVTITYWMGGLK  503

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  + F L+LLI+L +VLV+Q LGLA GAILMDVKQATTL+SV  LVFL+A GYY+Q IP
Sbjct  504  PSIIAFLLTLLIILLNVLVAQGLGLALGAILMDVKQATTLSSVLMLVFLLASGYYIQHIP  563

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             F+ WLKY+S+S YC+KLL+GVQY+  + YEC     C+V DFP +K +G +++ +D+  
Sbjct  564  SFVTWLKYVSFSHYCYKLLVGVQYSRFEVYECGIDEECKVMDFPAIKCLGIDNLALDLVA  623

Query  201  MAMMLVGYRFIAYLALH  151
            + +M V +R +AY+AL 
Sbjct  624  LVVMFVIFRVLAYVALR  640



>emb|CDX99764.1| BnaC02g35560D [Brassica napus]
Length=685

 Score =   221 bits (564),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 158/202 (78%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF PL+NA+FTFPQER MLIKERSSG+YRLSSY+ A+TVGDLP+EL LPT F  I YWMG
Sbjct  484  GFLPLFNAIFTFPQERPMLIKERSSGIYRLSSYYTARTVGDLPMELILPTIFVTITYWMG  543

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK    TF ++L+IVL++VLVSQ +GLA GAILMD K+A TL+SV  LVFL+AGGYY+Q
Sbjct  544  GLKSSLTTFIMTLMIVLYNVLVSQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQ  603

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             IP FI WLKY+S+S YC+KLL+GVQY  ++ YEC  G +C V D+ G+K +   +M  D
Sbjct  604  HIPGFIAWLKYISFSHYCYKLLVGVQYTWDEVYECGPGLHCGVMDYEGIKNLSLGNMMWD  663

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V  + +ML+ YRF+AY+AL  +
Sbjct  664  VLALTLMLLLYRFLAYVALRNL  685



>emb|CDY51602.1| BnaCnng21050D [Brassica napus]
Length=666

 Score =   220 bits (561),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 123/199 (62%), Positives = 155/199 (78%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+ VGDLP+EL LPT F  I YWMGGLK
Sbjct  468  PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARIVGDLPMELILPTIFVTITYWMGGLK  527

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P   TF L+L+IVL++VLV+Q +GLA GAILMD K+A TL+SV  LVFL+AGGYY+Q IP
Sbjct  528  PSLSTFLLTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIP  587

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+ VQY  ++ YEC  G +C V D+ G+K +   +M  DV  
Sbjct  588  GFIAWLKYISFSHYCYKLLVEVQYTWDEVYECGPGLHCSVMDYEGIKNLRIGNMMWDVLA  647

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A+ML  YR +AYLAL  +
Sbjct  648  LALMLFLYRVLAYLALRNL  666



>gb|EYU28941.1| hypothetical protein MIMGU_mgv1a002356mg [Erythranthe guttata]
Length=684

 Score =   220 bits (561),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 123/196 (63%), Positives = 157/196 (80%), Gaps = 0/196 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FPQE+ ML +E SSGMYRLSSY+ A+ VGDLP+EL LPT F  I YWMGGLK
Sbjct  482  PLFNAIFVFPQEKPMLARETSSGMYRLSSYYTARIVGDLPMELVLPTLFVTITYWMGGLK  541

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+L IVL +VLV+Q LGLA GA+LMDVKQATTL+SV  LVFL+  GYY+Q IP
Sbjct  542  PSLITFLLTLSIVLLNVLVAQGLGLALGAVLMDVKQATTLSSVLMLVFLLVSGYYIQHIP  601

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
            PFI WLKY+S+S +C++LL+GVQY++N+ YEC  G  CRV D P +K +G +++  DV+ 
Sbjct  602  PFIDWLKYVSFSQFCYRLLVGVQYSENEVYECGLGSVCRVVDSPAIKYLGIHNLAADVAA  661

Query  201  MAMMLVGYRFIAYLAL  154
            +A+MLVGYR +AY+AL
Sbjct  662  LAVMLVGYRVLAYVAL  677



>ref|XP_012084971.1| PREDICTED: ABC transporter G family member 9-like [Jatropha curcas]
 gb|KDP27016.1| hypothetical protein JCGZ_20951 [Jatropha curcas]
Length=621

 Score =   219 bits (558),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 147/202 (73%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQERRML KERSSG YRLSSYF+++ V DLP+EL LPT F  I YWM 
Sbjct  414  GFFPLFEAIFTFPQERRMLAKERSSGTYRLSSYFMSRLVSDLPMELVLPTVFITITYWMA  473

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP P  F  +L ++L+SVLVSQ LGLA GA +MD K+ATTL SV  L FL+AGGYYVQ
Sbjct  474  GLKPTPQNFFYTLFVLLYSVLVSQGLGLALGAAVMDQKKATTLGSVIMLSFLLAGGYYVQ  533

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KYLS S Y +KLL+G QY  N+ Y C +   C V DFP VK VG +   V 
Sbjct  534  HVPSFIAWIKYLSISQYTYKLLVGSQYKANETYPCGE-SVCLVGDFPLVKTVGLDGQIVS  592

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               + +ML+GYR IAYLAL RV
Sbjct  593  AVALGIMLLGYRLIAYLALMRV  614



>ref|XP_006366061.1| PREDICTED: ABC transporter G family member 21-like [Solanum tuberosum]
Length=675

 Score =   219 bits (559),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 128/196 (65%), Positives = 160/196 (82%), Gaps = 0/196 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL++A+F FPQER MLI+ERSSGMYRLSSY+ A+TVGDLP+EL LPT F  + YWMGGLK
Sbjct  475  PLFSAIFAFPQERPMLIRERSSGMYRLSSYYFARTVGDLPMELVLPTIFVTVTYWMGGLK  534

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P+ +TF L+LLI+L +VLVSQ LGLA GAILMDVKQATTL+SV  LVFL+A GYY+Q IP
Sbjct  535  PKFVTFILTLLIILLNVLVSQGLGLALGAILMDVKQATTLSSVLMLVFLLASGYYIQHIP  594

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLLLGVQY+ N+ YEC  G YC V +FP +K +G +++ +DV  
Sbjct  595  IFINWLKYISFSHYCYKLLLGVQYSRNEVYECGIGKYCEVLEFPPIKYLGIDNLVLDVVA  654

Query  201  MAMMLVGYRFIAYLAL  154
            + +MLV YR +AY+AL
Sbjct  655  LVVMLVVYRLLAYVAL  670



>ref|XP_004236984.1| PREDICTED: ABC transporter G family member 21 [Solanum lycopersicum]
Length=675

 Score =   219 bits (559),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 127/196 (65%), Positives = 160/196 (82%), Gaps = 0/196 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL++A+F FPQER MLI+ERSSGMYRLSSY+ A++VGDLP+EL LPT F  + YWMGGLK
Sbjct  475  PLFSAIFAFPQERPMLIRERSSGMYRLSSYYFARSVGDLPMELVLPTIFVTVTYWMGGLK  534

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P+ LTF L+LLI+L +VLVSQ +GLA GAILMDVKQATTL+SV  LVFL+A GYY+Q IP
Sbjct  535  PKFLTFILTLLIILLNVLVSQGIGLALGAILMDVKQATTLSSVLMLVFLLASGYYIQHIP  594

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLLLGVQY+ N+ YEC  G YC V +FP +K +G +++ +DV  
Sbjct  595  IFIDWLKYISFSHYCYKLLLGVQYSRNEVYECGIGKYCEVLEFPPIKYLGIDNLVLDVVA  654

Query  201  MAMMLVGYRFIAYLAL  154
            + +MLV YR +AY+AL
Sbjct  655  LVVMLVVYRLLAYVAL  670



>ref|XP_008457190.1| PREDICTED: ABC transporter G family member 21 [Cucumis melo]
 ref|XP_008457191.1| PREDICTED: ABC transporter G family member 21 [Cucumis melo]
Length=673

 Score =   219 bits (557),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 125/200 (63%), Positives = 156/200 (78%), Gaps = 4/200 (2%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER ML KERSSGMYRLSSY++++T GDLP+EL LPT F  + YWMGGL 
Sbjct  468  PLFNAIFAFPLERPMLNKERSSGMYRLSSYYMSRTAGDLPMELVLPTVFVTVTYWMGGLN  527

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  + F L+LL+VL +VLVSQ LGLA GAILM+VKQATTLASVT LVFL+ GGYY++ IP
Sbjct  528  PSMIPFLLTLLVVLLNVLVSQGLGLALGAILMEVKQATTLASVTMLVFLLVGGYYIEHIP  587

Query  381  PFILWLKYLSYSFYCFKLLLGVQYND-NDYYECSKG-HYCRVADFPGVKAVGF-NH-MWV  214
             F+ WLKY+S+S YC+KL++G+QYN  N+ Y C     YC+V DFP VK +G  NH +W 
Sbjct  588  HFMSWLKYVSFSHYCYKLVVGIQYNSLNEAYHCGGSFGYCKVGDFPAVKCLGIGNHSLWW  647

Query  213  DVSVMAMMLVGYRFIAYLAL  154
            DV+ +  MLVGYR +A+LAL
Sbjct  648  DVAALFFMLVGYRILAFLAL  667



>gb|EYU26406.1| hypothetical protein MIMGU_mgv1a004006mg [Erythranthe guttata]
Length=549

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 123/203 (61%), Positives = 145/203 (71%), Gaps = 1/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPL+ A+FTFPQER ML KERSSGMYRLSSYF+A T+GDLP+EL LPT F  I YWM 
Sbjct  342  GFYPLFQAIFTFPQERLMLAKERSSGMYRLSSYFMALTLGDLPMELVLPTVFFTITYWMA  401

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP    F   L ++L+SVL +Q LGLA GA +MD+K AT L SV  L FL+A GYYVQ
Sbjct  402  GLKPAAGPFFSGLFVLLYSVLCAQGLGLAIGAAVMDMKAATVLGSVIMLTFLLASGYYVQ  461

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC-SKGHYCRVADFPGVKAVGFNHMWV  214
             +P FI W+KYLS S Y FKLLLG QY+  + Y C   G  C V DFP VKAVG +   V
Sbjct  462  HVPVFIGWIKYLSISQYAFKLLLGTQYSVGETYPCGGGGRRCLVEDFPAVKAVGLDGQVV  521

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+M+VGYR IAY+AL R+
Sbjct  522  SAVALALMIVGYRLIAYVALMRI  544



>ref|NP_001189973.1| ABC transporter G family member 21 [Arabidopsis thaliana]
 sp|Q7XA72.2|AB21G_ARATH RecName: Full=ABC transporter G family member 21; Short=ABC transporter 
ABCG.21; Short=AtABCG21; AltName: Full=White-brown 
complex homolog protein 21; Short=AtWBC21 [Arabidopsis thaliana]
 dbj|BAB03081.1| ABC transporter-like protein [Arabidopsis thaliana]
 gb|AEE77044.1| ABC transporter G family member 21 [Arabidopsis thaliana]
Length=672

 Score =   218 bits (556),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 158/199 (79%), Gaps = 0/199 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+FTFPQER MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMGGLK
Sbjct  474  PLFNAIFTFPQERPMLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLK  533

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P   TF ++L+IVL++VLV+Q +GLA GAILMD K+A TL+SV  LVFL+AGGYY+Q IP
Sbjct  534  PSLTTFIMTLMIVLYNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIP  593

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             FI WLKY+S+S YC+KLL+GVQY  ++ YEC  G +C V D+ G+K +   +M  DV  
Sbjct  594  GFIAWLKYVSFSHYCYKLLVGVQYTWDEVYECGSGLHCSVMDYEGIKNLRIGNMMWDVLA  653

Query  201  MAMMLVGYRFIAYLALHRV  145
            +A+ML+ YR +AYLAL  +
Sbjct  654  LAVMLLLYRVLAYLALRNL  672



>ref|XP_011649112.1| PREDICTED: ABC transporter G family member 21 [Cucumis sativus]
 gb|KGN61520.1| hypothetical protein Csa_2G153580 [Cucumis sativus]
Length=673

 Score =   216 bits (550),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 155/200 (78%), Gaps = 4/200 (2%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+NA+F FP ER ML KERSSGMYRLSSY++A+T GDLP+EL LPT F  + YWMGGL 
Sbjct  468  PLFNAIFAFPLERPMLNKERSSGMYRLSSYYMARTAGDLPMELVLPTVFVTVTYWMGGLN  527

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  +TF L+LLIVL +VLVSQ LGLA GAILM+VKQATTLASVT LVFL+ GGYY++ IP
Sbjct  528  PSMITFLLTLLIVLLNVLVSQGLGLALGAILMEVKQATTLASVTMLVFLLVGGYYIEHIP  587

Query  381  PFILWLKYLSYSFYCFKLLLGVQYND-NDYYECSKG-HYCRVADFPGVKAVGF-NH-MWV  214
             FI WLKY+S+S YC+KL++  QY+  N+ Y C     YC+V DFP VK +G  NH +W 
Sbjct  588  LFISWLKYVSFSHYCYKLIVETQYHSLNEVYHCGGSFGYCKVGDFPAVKCLGIGNHSLWW  647

Query  213  DVSVMAMMLVGYRFIAYLAL  154
            DV+ +  MLVGYR +A+LAL
Sbjct  648  DVTALFFMLVGYRILAFLAL  667



>ref|XP_009593646.1| PREDICTED: ABC transporter G family member 21 [Nicotiana tomentosiformis]
Length=644

 Score =   215 bits (547),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/197 (61%), Positives = 157/197 (80%), Gaps = 0/197 (0%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL++A+F FPQER MLI+ERSSG+YRLSSY+ A+TVGDLP+EL LPT F  + YWMGGLK
Sbjct  444  PLFSAIFAFPQERPMLIRERSSGIYRLSSYYFARTVGDLPMELILPTIFVTVTYWMGGLK  503

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P  + F L+LLI+L +VLV+Q LGLA GAILMDVKQATTL+SV  LVFL+A GYY+Q IP
Sbjct  504  PSIIAFLLTLLIILLNVLVAQGLGLALGAILMDVKQATTLSSVLMLVFLLASGYYIQHIP  563

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSV  202
             F+ WLKY+S+S YC+KLL+GVQY+  + YEC  G  CRV DFP +K +G +++ +D+  
Sbjct  564  SFVAWLKYVSFSHYCYKLLVGVQYSRFEVYECGIGEECRVMDFPAIKCLGIDNLVLDLVA  623

Query  201  MAMMLVGYRFIAYLALH  151
            + +MLV +R +AY+AL 
Sbjct  624  LVVMLVVFRILAYVALR  640



>ref|XP_010034170.1| PREDICTED: ABC transporter G family member 9 [Eucalyptus grandis]
Length=651

 Score =   215 bits (547),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 114/202 (56%), Positives = 145/202 (72%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPL+NA+FTFP+ER ML KERSSGMYRLSSYF+++ VGDLP+EL LPT F  I YWM 
Sbjct  443  GFYPLFNAIFTFPKERMMLEKERSSGMYRLSSYFMSRIVGDLPMELILPTVFVAITYWMA  502

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            G+KP    F  +L ++L+SVLV+Q LGLA GA++MD + AT L SV  L FL+AGGYYVQ
Sbjct  503  GMKPTAGNFLYTLFVLLYSVLVAQGLGLAIGAVVMDQQSATILGSVLMLTFLLAGGYYVQ  562

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +PPFI W++YLS S Y +KLL+  Q+  +D Y C     C V D+PG+K VG +   V 
Sbjct  563  NVPPFIAWIRYLSISHYTYKLLMTSQFRPDDTYPCGGDSSCLVGDYPGIKEVGLDGQAVS  622

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               + +M V YR IAY+AL R+
Sbjct  623  AVALGIMFVAYRLIAYVALMRI  644



>ref|XP_011098341.1| PREDICTED: ABC transporter G family member 9 [Sesamum indicum]
Length=619

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 119/202 (59%), Positives = 142/202 (70%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPL+ A+FTFPQER ML KERSSGMYRLSSYF+A T+GDLP+EL LPT F  I YWM 
Sbjct  413  GFYPLFQAIFTFPQERMMLAKERSSGMYRLSSYFMALTLGDLPMELVLPTVFFVITYWMA  472

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P  F   L  +L+SVL SQ LGLA GA +M+ K AT L SV  L FL+A GYYVQ
Sbjct  473  GLKPDPRCFFAGLFTLLYSVLCSQGLGLALGAAVMNQKSATILGSVIMLTFLLASGYYVQ  532

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S S Y FKLLLG Q+   + Y C  G  C V DF  +K VG     + 
Sbjct  533  HVPAFISWIKYISISQYTFKLLLGSQFKPGETYPCGNGKTCLVEDFGMIKPVGLGGHAIA  592

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V  +A+MLVGYR +AY+AL R+
Sbjct  593  VIALAVMLVGYRLVAYVALMRI  614



>ref|XP_010502438.1| PREDICTED: ABC transporter G family member 21-like [Camelina 
sativa]
Length=185

 Score =   201 bits (512),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 112/185 (61%), Positives = 145/185 (78%), Gaps = 0/185 (0%)
 Frame = -3

Query  699  MLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLKPEPltftlsllivl  520
            MLIKERSSG+YRLSSY++A+TVGDLP+EL LPT F  I YWMGGLKP   TF ++L+IVL
Sbjct  1    MLIKERSSGIYRLSSYYIARTVGDLPMELILPTIFVTITYWMGGLKPSLTTFLMTLMIVL  60

Query  519  fsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIPPFILWLKYLSYSFY  340
            ++VLV+Q +GLA GAILMD K+A TL+SV  LVFL+AGGYY+Q IP FI WLKY+S+S Y
Sbjct  61   YNVLVAQGVGLALGAILMDAKKAATLSSVLMLVFLLAGGYYIQHIPGFIAWLKYVSFSHY  120

Query  339  CFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDVSVMAMMLVGYRFIAYL  160
            C+KLL+GVQY  ++ YEC  G +C V ++ G+K +   +M  DV  +A+ML+ YR +AYL
Sbjct  121  CYKLLVGVQYTWDEVYECGSGLHCSVMNYEGIKNLMIGNMMWDVLALAIMLLLYRVLAYL  180

Query  159  ALHRV  145
            AL  +
Sbjct  181  ALRNL  185



>ref|XP_009792869.1| PREDICTED: ABC transporter G family member 9-like [Nicotiana 
sylvestris]
Length=616

 Score =   212 bits (540),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 143/202 (71%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPL+ A+FTFPQER ML KERSSGMYRLSSYF+++TVGDLP+EL LPT F  I YW+ 
Sbjct  410  GFYPLFQAIFTFPQERMMLEKERSSGMYRLSSYFMSRTVGDLPMELVLPTIFVIITYWIA  469

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP  L F  +L  +LFSVLVS  LGLA GA++MD K AT L SV  L F +AGGYYV 
Sbjct  470  GLKPFALNFFSTLFTLLFSVLVSHGLGLALGALVMDQKSATILGSVIMLSFTLAGGYYVH  529

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S S Y FKLL+G Q+   + Y C     C V DFP +K+VG     + 
Sbjct  530  HVPSFIAWIKYISISQYTFKLLIGSQFEAGETYTCGINTTCYVEDFPAIKSVGIGDKAIS  589

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V  +A+MLV YR +AY+AL R+
Sbjct  590  VVALAIMLVAYRLLAYVALMRI  611



>ref|XP_010277245.1| PREDICTED: ABC transporter G family member 9-like [Nelumbo nucifera]
Length=981

 Score =   215 bits (547),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 147/202 (73%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL  AVFTFPQER MLIKERSSGMYRLSSYF+++T+GDLP+ELALPTAF  I YWM 
Sbjct  776  GFFPLVQAVFTFPQERMMLIKERSSGMYRLSSYFISRTIGDLPMELALPTAFVAITYWMA  835

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            G KP   +F  +L +VL SV+VSQ LGLA G+I+M+ K AT L SV   +FL+ GGYY+Q
Sbjct  836  GFKPSATSFMETLYVVLLSVMVSQGLGLAIGSIVMNPKAATVLGSVVINIFLLTGGYYIQ  895

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            +IPPF+ W+KY+S S Y +KLLLG QY+ ++ Y C     CRV DFP VK  G +   + 
Sbjct  896  KIPPFMEWIKYISISHYNYKLLLGAQYSADETYPCDFNVTCRVGDFPTVKYAGLDRKAIS  955

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               + +M + YR IAY+AL RV
Sbjct  956  YIALGIMFLAYRLIAYIALMRV  977



>ref|XP_009605775.1| PREDICTED: ABC transporter G family member 9 [Nicotiana tomentosiformis]
Length=616

 Score =   212 bits (539),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 117/202 (58%), Positives = 142/202 (70%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPL+ A+FTFPQER ML KERSSGMYRLSSYF+++TVGDLP+EL LPT F  I YWM 
Sbjct  410  GFYPLFQAIFTFPQERMMLEKERSSGMYRLSSYFMSRTVGDLPMELVLPTIFVIITYWMA  469

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP    F  +L  +LFSVLVSQ LGLA GA++MD K AT L SV  L F +AGGYYV 
Sbjct  470  GLKPFAPNFFSTLFTLLFSVLVSQGLGLALGALVMDQKSATILGSVIMLSFTLAGGYYVH  529

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S S Y FKLL+G Q+   + Y C     C V DFP +K+VG     + 
Sbjct  530  HVPSFIAWIKYISISQYTFKLLIGSQFEPGETYPCGLNATCYVEDFPAIKSVGLGDKAIS  589

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V  + +MLV YR +AY+AL R+
Sbjct  590  VVALGIMLVAYRLLAYVALMRI  611



>emb|CDP05875.1| unnamed protein product [Coffea canephora]
Length=629

 Score =   211 bits (538),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 149/202 (74%), Gaps = 0/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+NA+FTFPQER ML KER+SGMYRLSSYF+A+T+GDLP+EL LP+ F  I YWM 
Sbjct  420  GFFPLFNAIFTFPQERLMLEKERASGMYRLSSYFMARTIGDLPMELVLPSVFITITYWMA  479

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK    +F    L++L++VLV+Q LGLA GA+++D K AT L SV  L F++AGGYYVQ
Sbjct  480  GLKATAASFLGCWLVLLYAVLVAQGLGLAVGALVLDQKNATILGSVIMLSFILAGGYYVQ  539

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S   Y +KL +  QYN  + Y C++   C V DFP +K++G + ++  
Sbjct  540  HVPSFIAWIKYVSIGQYAYKLFIMSQYNPGETYPCAENKTCLVEDFPSIKSIGPHGLFSS  599

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V  MA+MLVGYR +AY+AL R+
Sbjct  600  VVAMAIMLVGYRLVAYIALMRI  621



>gb|KHG01243.1| ABC transporter G family member 9 [Gossypium arboreum]
Length=629

 Score =   211 bits (536),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 144/203 (71%), Gaps = 1/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPL+ A+FTFP+ER ML KERSSG YRLSSYF+++   DLP+EL LPT F  I YWM 
Sbjct  419  GFYPLFQAIFTFPRERMMLEKERSSGTYRLSSYFISRITADLPMELILPTVFLTITYWMA  478

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP    F  +L ++LFSVLVSQ LGLA GA++MD+K AT L SV  L F +AGGYY+Q
Sbjct  479  GLKPTATNFFHTLFVLLFSVLVSQGLGLALGAMVMDLKSATILGSVIMLTFFLAGGYYIQ  538

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSK-GHYCRVADFPGVKAVGFNHMWV  214
             +PPFI W+KY+S S + +KLLLG QY  N+ Y C      C + DF G+K+VG N   V
Sbjct  539  HVPPFIAWIKYMSISHHTYKLLLGSQYKPNETYPCGDHSKTCLIGDFQGIKSVGLNGQVV  598

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+MLV YR IAYLAL R+
Sbjct  599  SAVALAIMLVMYRLIAYLALMRI  621



>ref|XP_009378509.1| PREDICTED: ABC transporter G family member 9 [Pyrus x bretschneideri]
Length=622

 Score =   210 bits (535),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 113/202 (56%), Positives = 145/202 (72%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFP ER+ML KER+SG YRLSSYF+++ V DLP+EL LPT F  I YWM 
Sbjct  414  GFFPLFQAIFTFPPERKMLEKERASGTYRLSSYFMSRIVADLPIELVLPTLFVTITYWMA  473

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP    F  +L  +L SVLV+Q +GLA GA++MD K+AT LASV  L FL+AGGYYVQ
Sbjct  474  GLKPSAGNFFHTLFALLLSVLVAQGMGLALGALVMDQKKATVLASVIMLSFLLAGGYYVQ  533

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S S Y ++LLLG QY  ++ Y C  G  C V DFP +K+ G +     
Sbjct  534  HVPAFISWIKYISLSNYSYRLLLGSQYKKSETYPCD-GRVCSVGDFPTIKSAGLDGQSSA  592

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V  + +M+VGYRFI+YLAL R+
Sbjct  593  VVALVIMVVGYRFISYLALMRI  614



>gb|KJB62742.1| hypothetical protein B456_009G433300 [Gossypium raimondii]
Length=629

 Score =   211 bits (536),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 144/203 (71%), Gaps = 1/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPL+ A+FTFP+ER ML KERSSG YRLSSYF+++   DLP+EL LPT F  I YWM 
Sbjct  419  GFYPLFQAIFTFPRERMMLEKERSSGTYRLSSYFISRITADLPMELILPTVFITITYWMA  478

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP    F  +L ++LFSVLVSQ LGLA GA++MD+K AT L SV  L F +AGGYY+Q
Sbjct  479  GLKPTATNFFHTLFVLLFSVLVSQGLGLALGAMVMDLKSATILGSVIMLTFFLAGGYYIQ  538

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKG-HYCRVADFPGVKAVGFNHMWV  214
             +PPFI W+KY+S S + +KLLLG QY  N+ Y C      C + DF G+K+VG N   V
Sbjct  539  HVPPFIAWIKYMSISHHTYKLLLGSQYKPNETYPCGDHMKTCLIGDFQGIKSVGLNGQVV  598

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+MLV YR IAYLAL R+
Sbjct  599  SAVALAIMLVMYRLIAYLALMRI  621



>ref|XP_006359003.1| PREDICTED: ABC transporter G family member 9-like [Solanum tuberosum]
Length=628

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/201 (57%), Positives = 144/201 (72%), Gaps = 0/201 (0%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL  A+FTFPQER ML KERSSGMYRLS+YF+A+T+GDLP+EL LPT FT I YWM G
Sbjct  423  FFPLLQAIFTFPQERMMLEKERSSGMYRLSAYFMARTIGDLPMELVLPTIFTVITYWMTG  482

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            LKP  L F  +L  +L++VLVSQ LGLA GA++MD + AT L SV  L F +AGGY+VQ 
Sbjct  483  LKPSALNFFSTLFSILYNVLVSQGLGLALGAMIMDQESATVLGSVIILSFTLAGGYFVQH  542

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            +P FI W+KY+S S Y +KLLLG QYN  + Y C     C V DFP +K +G     + +
Sbjct  543  VPWFISWIKYISISQYTYKLLLGSQYNHGETYSCGINATCLVEDFPTIKTIGIGGKGISM  602

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              +A+M  GYRF+AY+AL RV
Sbjct  603  VALAVMFFGYRFLAYVALMRV  623



>ref|XP_010520902.1| PREDICTED: ABC transporter G family member 9-like [Tarenaya hassleriana]
Length=620

 Score =   210 bits (534),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/204 (57%), Positives = 145/204 (71%), Gaps = 2/204 (1%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQERRML KERSSGMY+LSSYF+++ V DLP+EL LPT F  I YWM 
Sbjct  411  GFFPLFQAIFTFPQERRMLEKERSSGMYKLSSYFMSRVVVDLPMELVLPTIFVVITYWMA  470

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GL P P  F L+L  +LF+VLVS  LGLA GA++MD+K ATTL SV  L FL+AGGYYVQ
Sbjct  471  GLNPNPRNFFLTLFGLLFNVLVSGGLGLALGAVVMDLKSATTLGSVIMLAFLLAGGYYVQ  530

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKG--HYCRVADFPGVKAVGFNHMW  217
             +PPF+ W+KY+S   Y +KLL+  QY  +D Y C       C V DF  +K +G +   
Sbjct  531  HVPPFVSWIKYISIGNYAYKLLVLAQYKADDTYPCGADGRSVCYVGDFGAIKNIGLDGEA  590

Query  216  VDVSVMAMMLVGYRFIAYLALHRV  145
            + V  + +MLVGYR IAY+AL RV
Sbjct  591  MSVLALFLMLVGYRLIAYVALMRV  614



>ref|XP_009383080.1| PREDICTED: ABC transporter G family member 9 [Musa acuminata 
subsp. malaccensis]
Length=634

 Score =   209 bits (533),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/201 (58%), Positives = 150/201 (75%), Gaps = 0/201 (0%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            FYP++ A+FTFPQER ML KERSSGMYRLSSYF A+ VGDLP+EL LP  F  I YWMGG
Sbjct  430  FYPVFEAIFTFPQERTMLTKERSSGMYRLSSYFAARLVGDLPMELILPIIFITITYWMGG  489

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            LKP  + F ++L ++L  VLV+Q +GLA GA++MD+K ATTL S+  L F++AGG+YVQ 
Sbjct  490  LKPVAVNFFMNLAVLLLCVLVAQGMGLALGALVMDLKTATTLGSILMLSFMLAGGFYVQN  549

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            IPPFI W+KY+S S+Y FKL +  QY+ ND Y+C+    C++ADFP +K VGF+H  + V
Sbjct  550  IPPFIEWIKYISLSYYTFKLQIASQYSPNDTYQCTPSMRCQIADFPSIKLVGFDHKALAV  609

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              + +MLV YR  AYL L RV
Sbjct  610  FALLLMLVLYRLAAYLGLMRV  630



>ref|XP_008799253.1| PREDICTED: ABC transporter G family member 9-like [Phoenix dactylifera]
Length=627

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 145/201 (72%), Gaps = 0/201 (0%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            FYP++ A+FTFPQER ML KER SGMYRLSSYF A+ VGDLP+EL LP  F  I YW+GG
Sbjct  415  FYPVFEALFTFPQERTMLTKERVSGMYRLSSYFTARMVGDLPMELILPIVFLTITYWLGG  474

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            LK    +F ++L I+L  VL++Q LG A GA++MD+K +TTLASV  L F++AGGYYVQ 
Sbjct  475  LKHSLWSFLITLSIMLLQVLIAQGLGFALGALVMDLKASTTLASVILLSFMLAGGYYVQH  534

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            +PPFI W+KY+SY +Y FK+ +  QY+  D YECS G  C V   P +  VGF+H  + +
Sbjct  535  VPPFIAWIKYISYIYYTFKIQISAQYSSGDTYECSGGQRCPVESVPAIAVVGFSHQSLAI  594

Query  207  SVMAMMLVGYRFIAYLALHRV  145
            + + +M + +R +AY+AL RV
Sbjct  595  AALFIMFIFFRVVAYVALMRV  615



>ref|XP_008775311.1| PREDICTED: ABC transporter G family member 9-like [Phoenix dactylifera]
Length=627

 Score =   209 bits (531),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 145/201 (72%), Gaps = 0/201 (0%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            FYP++ A+FTFPQER ML KER SGMYRLSSYF A+ VGDLP+EL LP  F  I YW+GG
Sbjct  415  FYPVFEALFTFPQERTMLTKERVSGMYRLSSYFTARMVGDLPMELILPIVFLTITYWLGG  474

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            LK    +F ++L ++L  VL++Q LG A GA++MD+K +TTLASV  L F++AGGYYVQ 
Sbjct  475  LKRSLWSFLITLSVMLLQVLIAQGLGFALGALVMDLKASTTLASVILLSFMLAGGYYVQH  534

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            +PPFI W+KY+SY +Y FK+ +  QY+  D YECS G  C V   P +  VGF+H  + +
Sbjct  535  VPPFIAWIKYISYIYYTFKIQISAQYSPGDTYECSSGQRCPVESVPAIAVVGFSHQSLAI  594

Query  207  SVMAMMLVGYRFIAYLALHRV  145
            + + +M + +R +AY+AL RV
Sbjct  595  AALFIMFIFFRVVAYVALMRV  615



>ref|XP_008226675.1| PREDICTED: ABC transporter G family member 9 [Prunus mume]
Length=622

 Score =   208 bits (529),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 144/202 (71%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQER+ML KERSSG YRLSSYF+++ V DLP+EL LP  F  I YWM 
Sbjct  414  GFFPLFQAIFTFPQERKMLEKERSSGTYRLSSYFISRIVADLPMELVLPAVFVTITYWMA  473

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP    F  +LL++L SVLV+Q +GLA GA++MD K+AT LASV  L FL+AGGYYVQ
Sbjct  474  GLKPTAGHFFHTLLVLLLSVLVAQGMGLALGALVMDQKKATVLASVLMLSFLLAGGYYVQ  533

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S S Y +KLLLG  Y+ +D Y C  G  C V +FP +K VG +     
Sbjct  534  HVPAFIGWIKYISISNYSYKLLLGSLYSKSDTYPCDSG-VCLVREFPNIKHVGLDGQISG  592

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               +A MLVGYR I YLAL R+
Sbjct  593  AVALATMLVGYRLIGYLALMRI  614



>ref|XP_007214012.1| hypothetical protein PRUPE_ppa014861mg [Prunus persica]
 gb|EMJ15211.1| hypothetical protein PRUPE_ppa014861mg [Prunus persica]
Length=622

 Score =   208 bits (529),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 116/202 (57%), Positives = 144/202 (71%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQER+ML KERSSG YRLSSYF+++ V DLP+EL LP  F  I YWM 
Sbjct  414  GFFPLFQAIFTFPQERKMLEKERSSGTYRLSSYFISRIVADLPMELVLPAVFVTITYWMA  473

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP    F  +LL++L SVLV+Q +GLA GA++MD K+AT LASV  L FL+AGGYYVQ
Sbjct  474  GLKPTAGHFFHTLLVLLLSVLVAQGMGLALGALVMDQKKATVLASVLMLSFLLAGGYYVQ  533

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S S Y +KLLLG  Y+ +D Y C  G  C V +FP +K VG +     
Sbjct  534  HVPAFIGWIKYISISNYSYKLLLGSLYSKSDTYPCDSG-VCLVREFPNIKHVGLDGQISG  592

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               +A MLVGYR I YLAL R+
Sbjct  593  AVALATMLVGYRLIGYLALMRI  614



>ref|XP_007021331.1| White-brown-complex ABC transporter family [Theobroma cacao]
 gb|EOY12856.1| White-brown-complex ABC transporter family [Theobroma cacao]
Length=626

 Score =   207 bits (528),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 114/200 (57%), Positives = 144/200 (72%), Gaps = 1/200 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            PL+ A+FTFPQER ML KERSSGMYRLSSYF+++T+ DLP+EL LPTAF  I YWM GLK
Sbjct  419  PLFQAIFTFPQERMMLEKERSSGMYRLSSYFMSRTIADLPMELILPTAFVTITYWMAGLK  478

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P    F  +L  +LF VLVSQSLGLA GA++M++K AT L SV  L FL+AGG+Y+Q +P
Sbjct  479  PTAGNFLHTLFALLFCVLVSQSLGLALGALVMELKSATILGSVVILTFLLAGGFYIQHVP  538

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSK-GHYCRVADFPGVKAVGFNHMWVDVS  205
            PFI W+KY+S S + +KL+LG QY  N+ Y C   G  C V DFP +K +  +   +   
Sbjct  539  PFISWIKYISISHHTYKLVLGSQYKPNETYPCDDPGKVCLVGDFPTIKNMNLDGQLLSAV  598

Query  204  VMAMMLVGYRFIAYLALHRV  145
             +A+MLV YR IAYLAL R+
Sbjct  599  ALAIMLVVYRMIAYLALMRI  618



>ref|XP_008386302.1| PREDICTED: ABC transporter G family member 9-like [Malus domestica]
Length=622

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 111/202 (55%), Positives = 144/202 (71%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFP ER+ML KER SG YRLSSYF+++ V DLP+EL LPT F  I YWM 
Sbjct  414  GFFPLFQAIFTFPPERKMLEKERXSGTYRLSSYFMSRIVADLPMELVLPTLFVTITYWMA  473

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP    F  +L  +L SVLV+Q +GLA GA++MD K+AT LASV  L FL+AGGYYVQ
Sbjct  474  GLKPSAANFFHTLFALLLSVLVAQGMGLALGALVMDQKKATVLASVIMLSFLLAGGYYVQ  533

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S S Y ++LLLG QY  ++ Y C  G  C V +FP +K+ G +     
Sbjct  534  HVPAFISWIKYISLSNYSYRLLLGSQYKKSETYPCD-GRVCSVGEFPTIKSAGLDGQSSA  592

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V  + +M++GYRFI+YLAL R+
Sbjct  593  VVALVIMVMGYRFISYLALMRI  614



>ref|XP_009607601.1| PREDICTED: ABC transporter G family member 9-like [Nicotiana 
tomentosiformis]
Length=631

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 145/201 (72%), Gaps = 0/201 (0%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            FYP++ A+FTFPQER ML KERSSGMYRLS+YF+A+TVGDLP+EL LPT F  I Y+M G
Sbjct  426  FYPMFQAIFTFPQERMMLEKERSSGMYRLSAYFIARTVGDLPMELVLPTIFVVITYFMAG  485

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            LK     F  +L  +L++VLVSQ LGLA GA++MD K AT L SV  L F +AGGY+VQ 
Sbjct  486  LKLSAGHFFSTLFALLYNVLVSQGLGLAIGAMVMDQKSATILGSVIMLSFTLAGGYFVQH  545

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            +P FI W+KY+S S Y +KLLLG QY+  + Y C+    C V DFP +K +G     + V
Sbjct  546  VPSFIAWIKYVSISQYAYKLLLGSQYSPGETYTCAINATCLVEDFPSIKTIGLGGKGISV  605

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              +A+ML+GYRF+AY+AL R+
Sbjct  606  VALAIMLLGYRFLAYVALMRI  626



>ref|XP_001780064.1| ATP-binding cassette transporter, subfamily G, member 3, group 
WBC protein PpABCG3 [Physcomitrella patens]
 gb|EDQ55167.1| ATP-binding cassette transporter, subfamily G, member 3, group 
WBC protein PpABCG3 [Physcomitrella patens]
Length=584

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 149/202 (74%), Gaps = 2/202 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            P+++A+FTFPQER MLIKER+SGMYRLS+YF+A+ +GD+PLEL LPT F  I+YWM GLK
Sbjct  379  PVFSAIFTFPQERAMLIKERASGMYRLSAYFMARVIGDMPLELVLPTIFITIVYWMAGLK  438

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
               L F L+LL++L++VLVSQ LGL  GA LMDVK+ATTLASV  L  L+AGGYY+Q  P
Sbjct  439  QTFLAFILTLLVILYTVLVSQGLGLTLGAALMDVKKATTLASVIMLTLLLAGGYYIQNTP  498

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWVDV  208
             +I W+KYLS S++ +KL L  QY+ +  Y CS G    CR+AD+P V  VG + + +  
Sbjct  499  KWIAWIKYLSVSYWSYKLQLAAQYSPDQTYACSTGSSGRCRIADYPAVANVGLDQLGIAA  558

Query  207  SVMAMMLVGYRFIAYLALHRVR  142
              MA+MLVGYR  AY  L R++
Sbjct  559  MAMAIMLVGYRLSAYFFLSRIK  580



>ref|XP_003541854.2| PREDICTED: ABC transporter G family member 9-like [Glycine max]
Length=627

 Score =   206 bits (525),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 118/207 (57%), Positives = 150/207 (72%), Gaps = 7/207 (3%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQE  ML KERSSGMYRLSSYF+++ V DLP+EL+LPT F  I YWM 
Sbjct  418  GFFPLFQAIFTFPQELLMLEKERSSGMYRLSSYFMSRVVADLPMELSLPTIFILITYWMA  477

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK + L F  +LL +L  VLVSQ LGLA GA +MD K ATTLASV  L FL+AGG+YVQ
Sbjct  478  GLKGKLLNFLYTLLTLLLHVLVSQGLGLALGATVMDQKAATTLASVLMLCFLLAGGFYVQ  537

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S ++Y ++L +  QY+D + Y CS G  CRVA+FP +K  GF H  + 
Sbjct  538  HVPVFISWVKYISINYYNYQLFIASQYSDGETYPCSTGQ-CRVAEFPSIKQTGF-HFNLQ  595

Query  210  VSVMA-----MMLVGYRFIAYLALHRV  145
              VMA     +M++GYR IAY+AL R+
Sbjct  596  EQVMAASALVIMMIGYRLIAYVALMRI  622



>ref|XP_004252105.1| PREDICTED: ABC transporter G family member 9-like [Solanum lycopersicum]
Length=628

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 144/201 (72%), Gaps = 0/201 (0%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL  A+FTFPQER ML KERSSGMYRLS+YF+A+T+GDLP+EL LPT FT I YWM G
Sbjct  423  FFPLLQAIFTFPQERMMLEKERSSGMYRLSAYFIARTIGDLPMELVLPTIFTVITYWMTG  482

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            LKP    F  +L  +L++VLVSQSLGLA GA++MD + AT L SV  L F +AGGY+VQ 
Sbjct  483  LKPSAFNFFSTLFTILYNVLVSQSLGLALGAMIMDQESATVLGSVIILSFTLAGGYFVQH  542

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            +P FI W+KY+S S Y +KLLLG QY+  + Y C     C V DFP +K++G     + +
Sbjct  543  VPWFISWIKYISISQYTYKLLLGSQYSRGETYSCGINATCLVEDFPTIKSIGLGGKGISM  602

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              +A+M  GYR +AY+AL RV
Sbjct  603  VALAVMFFGYRLLAYVALMRV  623



>ref|XP_009766511.1| PREDICTED: ABC transporter G family member 9-like [Nicotiana 
sylvestris]
Length=637

 Score =   206 bits (524),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 113/201 (56%), Positives = 144/201 (72%), Gaps = 0/201 (0%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            FYP++ A+FTFPQER ML KERSSGMYRLS+YF+A+TVGDLP+EL LPT F  I Y+M G
Sbjct  432  FYPMFQAIFTFPQERMMLEKERSSGMYRLSAYFMARTVGDLPMELVLPTIFVVITYFMAG  491

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            LK     F  +L  +L++VLVSQ LGLA GA++MD K AT L SV  L F +AGGY+VQ 
Sbjct  492  LKLSAGHFFSTLFALLYNVLVSQGLGLAIGAMVMDQKSATILGSVIMLSFTLAGGYFVQH  551

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            +P FI W+KY+S S Y +KLLLG QY+  + Y C     C V DFP +K +G     + V
Sbjct  552  VPSFIAWIKYVSISQYAYKLLLGSQYSPGETYACGINTTCLVEDFPSIKTIGLGGKGISV  611

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              +A+ML+GYRF+AY+AL R+
Sbjct  612  LALAIMLLGYRFLAYVALMRI  632



>ref|XP_011042498.1| PREDICTED: ABC transporter G family member 9-like [Populus euphratica]
Length=619

 Score =   205 bits (522),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 143/203 (70%), Gaps = 1/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G +PL+ A+FTFPQERRML KERSSGMYRLSSYF+++ V DLP+EL LPT F  I YWM 
Sbjct  412  GIFPLFQAIFTFPQERRMLEKERSSGMYRLSSYFMSRIVSDLPMELVLPTIFVTITYWMA  471

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK  P  F L+L ++L+SVLV+  LGLA GA++++ + AT   SV  L FL+AGGYYV 
Sbjct  472  GLKGSPGNFFLTLSVLLYSVLVAGGLGLAIGALVLNRRSATITGSVIMLSFLLAGGYYVT  531

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC-SKGHYCRVADFPGVKAVGFNHMWV  214
             +P FI W+KY+S S Y +KLLLG QY   D Y C   G  C V D+P +K VG +   +
Sbjct  532  HVPAFISWVKYISISQYTYKLLLGSQYKPGDTYTCVGAGGVCLVGDYPAIKKVGLDGQVL  591

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
             V  + +MLVGYR IAYLAL R+
Sbjct  592  GVVALGIMLVGYRLIAYLALMRI  614



>gb|KHN36795.1| ABC transporter G family member 9 [Glycine soja]
Length=555

 Score =   204 bits (519),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 117/207 (57%), Positives = 150/207 (72%), Gaps = 7/207 (3%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQE  ML KERSSGMYRLSSYF+++ V DLP+EL+LPT F  I YWM 
Sbjct  346  GFFPLFQAIFTFPQELLMLEKERSSGMYRLSSYFMSRVVADLPMELSLPTIFILITYWMA  405

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK + L F  +LL +L  VLVSQ LGLA GA +MD K ATTLASV  L FL+AGG+YVQ
Sbjct  406  GLKGKLLNFLYTLLTLLLHVLVSQGLGLALGATVMDQKAATTLASVLMLCFLLAGGFYVQ  465

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S ++Y ++L +  QY+D + Y CS G  C+VA+FP +K  GF H  + 
Sbjct  466  HVPVFISWVKYISINYYNYQLFIASQYSDGEAYPCSTGQ-CQVAEFPSIKQTGF-HFNLQ  523

Query  210  VSVMA-----MMLVGYRFIAYLALHRV  145
              VMA     +M++GYR IAY+AL R+
Sbjct  524  EQVMAASALVIMMIGYRLIAYVALMRI  550



>ref|XP_010921129.1| PREDICTED: ABC transporter G family member 9 [Elaeis guineensis]
Length=619

 Score =   205 bits (522),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 147/201 (73%), Gaps = 0/201 (0%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            FYP Y A+FTFPQER ML KER SGMYRLSSY++A+ VGDLP+EL LP  F  I YW+GG
Sbjct  415  FYPAYQAIFTFPQERTMLTKERVSGMYRLSSYYVARMVGDLPMELILPIVFITITYWLGG  474

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            LK    +F ++L ++L  VL++Q LG A GA++MD+K +TTLASV  L F++AGG++VQ 
Sbjct  475  LKRTASSFFITLFVMLLEVLIAQGLGFALGALVMDLKASTTLASVILLSFMLAGGFFVQH  534

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            +P FI W+KY+SY +Y FK+ +  Q++  + Y+CS GH C + D P + AVG +H  + V
Sbjct  535  VPRFIAWIKYISYIYYTFKVQISSQFSPGETYQCSGGHRCPIEDVPMISAVGLDHRSLAV  594

Query  207  SVMAMMLVGYRFIAYLALHRV  145
            + + MML+ +R +AY+AL R+
Sbjct  595  AALFMMLIFFRVVAYVALMRI  615



>ref|XP_008237669.1| PREDICTED: ABC transporter G family member 9-like [Prunus mume]
Length=614

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 143/202 (71%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL  A+FTFPQER ML KERSSG Y LSSYF+++ V DLP+ELALPT F  I YWM 
Sbjct  412  GFFPLLQAIFTFPQERMMLEKERSSGTYMLSSYFISRIVADLPMELALPTLFVTITYWMA  471

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP    F  +LL++L SVLV+Q +GLA GA++MD K+A  LASV  + F +AGG++VQ
Sbjct  472  GLKPTAGHFFHTLLVLLLSVLVAQGMGLALGALVMDQKKAAVLASVLMVSFQLAGGFFVQ  531

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S   Y +KLLLG QYN+ND Y C  G  C V DFP +K VG +     
Sbjct  532  HVPAFIAWIKYISIINYSYKLLLGSQYNENDTYLCDSG-LCLVRDFPSIKHVGLSGQIGA  590

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               +A+MLVGYR IAY+AL R 
Sbjct  591  AVALAIMLVGYRLIAYIALMRT  612



>ref|XP_006370303.1| hypothetical protein POPTR_0001s41450g [Populus trichocarpa]
 gb|ERP66872.1| hypothetical protein POPTR_0001s41450g [Populus trichocarpa]
Length=619

 Score =   204 bits (519),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 143/203 (70%), Gaps = 1/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G +PL+ A+FTFPQERRML KERSSGMYRLSSYF+++ V DLP+EL LPT F  I YWM 
Sbjct  412  GIFPLFQAIFTFPQERRMLEKERSSGMYRLSSYFMSRIVSDLPMELVLPTIFLTITYWMA  471

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK  P  F L+L ++L+SVLV+  LGLA GA++++ + AT   SV  L FL+AGGYYV 
Sbjct  472  GLKGSPGNFFLTLFVLLYSVLVAGGLGLAIGALVLNQRSATITGSVIMLSFLLAGGYYVT  531

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC-SKGHYCRVADFPGVKAVGFNHMWV  214
             +P FI W+KY+S S Y +KLLLG QY  +D Y C   G  C V D+P +K VG +   +
Sbjct  532  HVPAFISWVKYISISQYTYKLLLGSQYKPSDTYTCGGAGGVCLVGDYPAIKKVGLDDQVL  591

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                + +MLVGYR IAYLAL R+
Sbjct  592  GAVALGIMLVGYRLIAYLALMRI  614



>ref|XP_007199008.1| hypothetical protein PRUPE_ppa017466mg [Prunus persica]
 gb|EMJ00207.1| hypothetical protein PRUPE_ppa017466mg [Prunus persica]
Length=614

 Score =   203 bits (517),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/202 (57%), Positives = 143/202 (71%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL  A+FTFPQER+ML KERSSG Y LSSYF+++ V DLP+ELALPT F  I YWM 
Sbjct  412  GFFPLLQAIFTFPQERKMLEKERSSGTYMLSSYFISRIVADLPMELALPTLFVTITYWMA  471

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP    F  +LL++L SVLV+Q +GLA GA++MD K+A  LASV  + F +AGG++VQ
Sbjct  472  GLKPTAGHFFHTLLVLLLSVLVAQGMGLALGALVMDQKKAAVLASVLMVSFQLAGGFFVQ  531

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S   Y +KLLLG QYN+ND Y C  G  C V DFP +K VG +     
Sbjct  532  HVPAFIAWIKYISIINYSYKLLLGSQYNENDTYLCDSG-VCLVRDFPSIKHVGLSGQIGA  590

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               +A+MLVG R IAYLAL R 
Sbjct  591  AVALAIMLVGCRLIAYLALMRT  612



>ref|XP_009143407.1| PREDICTED: ABC transporter G family member 9 [Brassica rapa]
 emb|CDX89252.1| BnaA01g16410D [Brassica napus]
Length=638

 Score =   203 bits (517),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 148/203 (73%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFP+ERRML KERSSGMYRLSSYF+++ VGDLP+EL LPT F  I YWM G
Sbjct  430  FFPLFQQIFTFPEERRMLEKERSSGMYRLSSYFMSRIVGDLPMELILPTIFLIITYWMAG  489

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            L P+P  F L+LL++L  VLVS  LGLA GA++MD K ATTL SV  L FL+AGGYYV+ 
Sbjct  490  LNPKPANFLLTLLVLLAHVLVSGGLGLALGALVMDQKTATTLGSVMMLTFLLAGGYYVRH  549

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSK--GHYCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S S+Y +KLL+  QY +N++Y C +     C V DF G+K +GF+    
Sbjct  550  VPVFIAWIKYVSISYYTYKLLILGQYTENEWYPCGENGNSKCHVGDFEGIKLIGFHSGLA  609

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A MLVGYR +AY+AL R+
Sbjct  610  SSFALAAMLVGYRVVAYIALMRI  632



>gb|KDP27020.1| hypothetical protein JCGZ_20955 [Jatropha curcas]
Length=568

 Score =   202 bits (514),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 143/202 (71%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF PLY A+FTFP ERRML KERSSG YRLSSYF+++  GDLP+EL LPT F  I YWM 
Sbjct  363  GFIPLYQAIFTFPTERRMLAKERSSGTYRLSSYFISRMAGDLPMELLLPTIFVTITYWMA  422

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP P  F  +L ++LF+VL+ QSLGLA GA++M+ K AT L S+  L F +AGGY+++
Sbjct  423  GLKPTPQNFLHTLFVLLFNVLLWQSLGLALGALIMNQKSATILGSIINLSFQLAGGYFIR  482

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            Q+P FI W+KY+S S Y +KLLLG QY  ++ Y C  G  C + ++P +K VG +   + 
Sbjct  483  QVPFFIAWIKYISISRYTYKLLLGSQYKPSETYPCGDG-VCSIRNYPSIKIVGLDGQLLS  541

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               + +M +GYR IAYLAL R+
Sbjct  542  AFALGIMFLGYRLIAYLALMRI  563



>ref|XP_012084914.1| PREDICTED: ABC transporter G family member 9-like [Jatropha curcas]
Length=621

 Score =   202 bits (514),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/202 (54%), Positives = 143/202 (71%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF PLY A+FTFP ERRML KERSSG YRLSSYF+++  GDLP+EL LPT F  I YWM 
Sbjct  416  GFIPLYQAIFTFPTERRMLAKERSSGTYRLSSYFISRMAGDLPMELLLPTIFVTITYWMA  475

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP P  F  +L ++LF+VL+ QSLGLA GA++M+ K AT L S+  L F +AGGY+++
Sbjct  476  GLKPTPQNFLHTLFVLLFNVLLWQSLGLALGALIMNQKSATILGSIINLSFQLAGGYFIR  535

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
            Q+P FI W+KY+S S Y +KLLLG QY  ++ Y C  G  C + ++P +K VG +   + 
Sbjct  536  QVPFFIAWIKYISISRYTYKLLLGSQYKPSETYPCGDG-VCSIRNYPSIKIVGLDGQLLS  594

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               + +M +GYR IAYLAL R+
Sbjct  595  AFALGIMFLGYRLIAYLALMRI  616



>emb|CDY29304.1| BnaC01g19560D [Brassica napus]
Length=638

 Score =   201 bits (511),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 149/203 (73%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFP+ERRML KERSSGMYRLSSYF+++ VGDLP+EL LPT F  I YWM G
Sbjct  430  FFPLFQQIFTFPEERRMLEKERSSGMYRLSSYFMSRIVGDLPMELILPTIFLIITYWMAG  489

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            L P+P+ F L+LL++L  VLVS  LGLA GA++MD K ATTL SV  L FL+AGGYYV+ 
Sbjct  490  LNPKPVNFLLTLLVLLAHVLVSGGLGLALGALVMDQKTATTLGSVIMLTFLLAGGYYVRH  549

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSK--GHYCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S S+Y +KLL+  QY ++++Y C +     C V DF G+K +GF+    
Sbjct  550  VPVFIAWIKYVSISYYTYKLLILGQYTESEWYPCGEIGNSKCHVGDFEGIKLIGFHSGLA  609

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A MLVGYR +AY+AL R+
Sbjct  610  SSFALAAMLVGYRVVAYIALMRI  632



>ref|XP_010675645.1| PREDICTED: ABC transporter G family member 9 [Beta vulgaris subsp. 
vulgaris]
Length=636

 Score =   200 bits (508),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 140/203 (69%), Gaps = 1/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL++A+F FP ER +L KERSSGMYRLSSYF A+ V DLP+EL LPT +  I Y+MG
Sbjct  416  GFFPLFDAIFAFPPERMVLAKERSSGMYRLSSYFFARMVSDLPVELILPTVYVIITYFMG  475

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK    +F   L  +L S++VSQ LGLA GA++MD+K ATTL SV  L FL+AGG+YVQ
Sbjct  476  GLKRNAASFLYYLFSLLLSIMVSQGLGLALGALVMDLKAATTLGSVLMLTFLLAGGFYVQ  535

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECS-KGHYCRVADFPGVKAVGFNHMWV  214
             IP FI W+KYLS   Y FKLLLG Q+   D Y C      C V DFP +++VG    +V
Sbjct  536  NIPAFIKWIKYLSILNYNFKLLLGSQFKPGDTYPCDGDTKVCLVEDFPSIRSVGIRGQFV  595

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
               V+ +M VGYR IAY AL R+
Sbjct  596  SAIVLVIMFVGYRLIAYFALTRI  618



>ref|XP_011095242.1| PREDICTED: ABC transporter G family member 9-like isoform X2 
[Sesamum indicum]
Length=618

 Score =   199 bits (506),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 141/201 (70%), Gaps = 2/201 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            ++P + A+FT PQER ML KERSSGMYRLSS+F+A T+GDLP++L LPT +  + YWM G
Sbjct  413  YFPAFEAIFTIPQERMMLEKERSSGMYRLSSFFMALTLGDLPMQLVLPTIYYTLTYWMAG  472

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            LKP+P  F     I L++V+ SQ LGLA GA++MD+K AT L ++ +LVF +AGGY+VQ 
Sbjct  473  LKPKPGYFLAGFFITLYNVVCSQGLGLAIGAVVMDMKAATVLGAIISLVFQLAGGYFVQN  532

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            IP F+ WLKYLS   + FKLLLG QY   + Y C+    C V DFP +KA+G       +
Sbjct  533  IPTFMKWLKYLSLIRHTFKLLLGSQYRPGETYPCADNKTCLVEDFPPIKAIGGQA--ASI  590

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              MA+M VGYR IAYLAL R+
Sbjct  591  IAMAIMFVGYRLIAYLALMRI  611



>ref|XP_006413078.1| hypothetical protein EUTSA_v10024656mg [Eutrema salsugineum]
 gb|ESQ54531.1| hypothetical protein EUTSA_v10024656mg [Eutrema salsugineum]
Length=640

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 147/203 (72%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQER+ML KERSSGMYRLSSYF+++ VGDLP+EL LPT F  I YWM G
Sbjct  432  FFPLFQQIFTFPQERKMLEKERSSGMYRLSSYFMSRIVGDLPMELILPTIFLIITYWMAG  491

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            L P P+ F L+LL++L  VLVS  LGLA GA++MD K ATTL SV  L FL+AGGYYV+ 
Sbjct  492  LNPNPVNFFLTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLAFLLAGGYYVRH  551

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWV  214
            +P FI W++YLS  +Y +KLL+  QY +N +Y C +     C V DF G+K +GF+    
Sbjct  552  VPVFISWIQYLSIGYYTYKLLILGQYTENQWYPCGENGKLKCYVGDFEGIKHIGFHSGLS  611

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+MLVGYR +AY+AL R+
Sbjct  612  SAFALAVMLVGYRIVAYIALMRI  634



>ref|XP_011095241.1| PREDICTED: ABC transporter G family member 9-like isoform X1 
[Sesamum indicum]
Length=654

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 109/201 (54%), Positives = 141/201 (70%), Gaps = 2/201 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            ++P + A+FT PQER ML KERSSGMYRLSS+F+A T+GDLP++L LPT +  + YWM G
Sbjct  449  YFPAFEAIFTIPQERMMLEKERSSGMYRLSSFFMALTLGDLPMQLVLPTIYYTLTYWMAG  508

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            LKP+P  F     I L++V+ SQ LGLA GA++MD+K AT L ++ +LVF +AGGY+VQ 
Sbjct  509  LKPKPGYFLAGFFITLYNVVCSQGLGLAIGAVVMDMKAATVLGAIISLVFQLAGGYFVQN  568

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            IP F+ WLKYLS   + FKLLLG QY   + Y C+    C V DFP +KA+G       +
Sbjct  569  IPTFMKWLKYLSLIRHTFKLLLGSQYRPGETYPCADNKTCLVEDFPPIKAIGGQA--ASI  626

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              MA+M VGYR IAYLAL R+
Sbjct  627  IAMAIMFVGYRLIAYLALMRI  647



>ref|XP_004244204.1| PREDICTED: ABC transporter G family member 9 [Solanum lycopersicum]
Length=613

 Score =   198 bits (503),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 110/203 (54%), Positives = 140/203 (69%), Gaps = 1/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPL+ A+FTFP ER ML KER+SG YRLSSYF+++ VGDLP+EL LPT F  I YW  
Sbjct  406  GFYPLFQAIFTFPPERMMLEKERASGTYRLSSYFMSRIVGDLPMELVLPTIFVIIAYWTT  465

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK  P+ F  +L  VL+ VLV+Q LGLA GA++MD+K AT LASVT L F +  G++V 
Sbjct  466  GLKQSPVNFFSTLFTVLYGVLVAQGLGLAIGAMIMDLKSATVLASVTMLSFTLVSGFFVH  525

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECS-KGHYCRVADFPGVKAVGFNHMWV  214
             +P FI WLKY+S + Y FKLL+G QY + + Y C      C V DFP +K+VG     +
Sbjct  526  HVPSFISWLKYISLTQYTFKLLVGSQYEEGEMYHCGVVDATCYVHDFPAIKSVGLGGNAI  585

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
             V  + +MLVGYR +AYL L R+
Sbjct  586  SVVALTIMLVGYRVLAYLVLTRI  608



>emb|CDX92829.1| BnaC07g40870D [Brassica napus]
Length=644

 Score =   197 bits (502),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 149/203 (73%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQER+ML KERSSGMYRLSSYF+++ VGDLP+EL LPT F  I YWM G
Sbjct  436  FFPLFQQIFTFPQERKMLEKERSSGMYRLSSYFMSRVVGDLPMELILPTIFLIITYWMAG  495

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            L P+P+ F L+LL +L  VLVS  LGLA GA++MD K ATTL SV  L FL+AGG+YV+ 
Sbjct  496  LNPKPVNFFLTLLTLLLHVLVSGGLGLALGALVMDQKTATTLGSVIMLTFLLAGGFYVRN  555

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S  +Y +KL++  QY ++++Y C +     C V DF G+K +GF+   V
Sbjct  556  VPVFISWIKYVSIGYYTYKLVILGQYTESEWYPCGENGKMKCYVGDFEGIKHIGFHGGLV  615

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+MLVGYR +AY+AL R+
Sbjct  616  SAFALALMLVGYRVVAYIALMRI  638



>emb|CDY29837.1| BnaA03g48580D [Brassica napus]
Length=644

 Score =   197 bits (502),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 150/203 (74%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQER+ML KERSSGMYRLSSYF+++ VGDLP+EL LPT F  I YWM G
Sbjct  436  FFPLFQQIFTFPQERKMLEKERSSGMYRLSSYFMSRVVGDLPMELILPTIFLIITYWMAG  495

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            L P+P+ F L+LLI+L  VLVS  LGLA GA++MD K ATTL SV  L FL+AGG+YV+ 
Sbjct  496  LNPKPVNFFLTLLILLLHVLVSGGLGLALGALVMDQKTATTLGSVIMLTFLLAGGFYVRN  555

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S  +Y +KL++  QY ++++Y C +     C V DF G+K +GF+   V
Sbjct  556  VPVFISWIKYVSIGYYTYKLVILGQYTESEWYPCGENGKLKCYVGDFEGIKHIGFHGGLV  615

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+MLVGYR +AY+AL R+
Sbjct  616  SAFALALMLVGYRVVAYIALMRI  638



>ref|XP_006359002.1| PREDICTED: ABC transporter G family member 9-like [Solanum tuberosum]
Length=629

 Score =   196 bits (499),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 141/201 (70%), Gaps = 0/201 (0%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            FY ++  +FTFPQER ML KERSSGMYRLS+YF+A TVGDLP+EL LPT  T I YWM G
Sbjct  424  FYSVFQGIFTFPQERMMLEKERSSGMYRLSAYFMAMTVGDLPMELVLPTISTVITYWMAG  483

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            LKP    F  +L  +L++VLVSQSLGLA GA++MD K AT LA V  + F +AGG+YVQ 
Sbjct  484  LKPSAGRFFSTLFSLLYNVLVSQSLGLAIGAMVMDEKSATVLALVILISFTLAGGFYVQH  543

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            +P FI W+K++S + Y +KLLLG QY+  + Y C     C V D P +K +G     + +
Sbjct  544  VPRFIAWIKHVSITQYAYKLLLGSQYSPGETYSCGLNATCLVEDSPSIKTIGLGGKGISI  603

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              +A+ML G+RF+AY+AL R+
Sbjct  604  VALAVMLFGFRFLAYVALMRI  624



>ref|XP_009137658.1| PREDICTED: ABC transporter G family member 9-like [Brassica rapa]
Length=644

 Score =   196 bits (499),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 150/203 (74%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQ+R+ML KERSSGMYRLSSYF+++ VGDLP+EL LPT F  I YWM G
Sbjct  436  FFPLFQQIFTFPQQRKMLEKERSSGMYRLSSYFMSRVVGDLPMELILPTIFLIITYWMAG  495

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            L P+P+ F L+LLI+L  VLVS  LGLA GA++MD K ATTL SV  L FL+AGG+YV+ 
Sbjct  496  LNPKPVNFFLTLLILLLHVLVSGGLGLALGALVMDQKTATTLGSVIMLTFLLAGGFYVRN  555

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S  +Y +KL++  QY ++++Y C +     C V DF G+K +GF+   V
Sbjct  556  VPVFISWIKYVSIGYYTYKLVILGQYTESEWYPCGENGKLKCYVGDFEGIKHIGFHGGLV  615

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+MLVGYR +AY+AL R+
Sbjct  616  SAFALALMLVGYRVVAYIALMRI  638



>gb|KEH38788.1| white-brown-complex ABC transporter family protein [Medicago 
truncatula]
Length=597

 Score =   196 bits (497),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/204 (53%), Positives = 147/204 (72%), Gaps = 3/204 (1%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQE  ML KERSSGMYRLS+YF+++ V DLP+EL LPT F  I Y+M 
Sbjct  388  GFFPLFQAIFTFPQELMMLEKERSSGMYRLSAYFISRMVADLPMELVLPTIFLLITYFMA  447

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK   + F  +L  +L +VLVSQ LGLA GA+++D K ATTLASV  L FL+AGG+YVQ
Sbjct  448  GLKATVINFFQTLFSLLLNVLVSQGLGLALGAVVLDQKSATTLASVIMLCFLLAGGFYVQ  507

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI+W+KY+S S+Y ++L +G QY+  D Y CS G  C + +FP +K +G +   + 
Sbjct  508  NVPKFIVWVKYVSVSYYTYQLFIGSQYHSGDTYPCSSGQ-CLIDEFPPIKQIGIDLNGLG  566

Query  210  VSVMAM--MLVGYRFIAYLALHRV  145
             + +A+  ML+GYR IAY AL R+
Sbjct  567  FAALALVIMLIGYRLIAYCALMRI  590



>ref|XP_004293103.1| PREDICTED: ABC transporter G family member 9 [Fragaria vesca 
subsp. vesca]
Length=633

 Score =   196 bits (498),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/204 (51%), Positives = 142/204 (70%), Gaps = 2/204 (1%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFP ER+ML KER+SG YRLSSYF+++ +GDLP+EL LPT F  I+YWM 
Sbjct  425  GFFPLFQAIFTFPPERKMLEKERTSGTYRLSSYFMSRIIGDLPMELVLPTLFITIVYWMA  484

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            G K     F  +L ++L  VLV+Q +GLA GA++MD++ AT L SV  L FL+AGGYYVQ
Sbjct  485  GFKTTAGNFFHTLFVLLLLVLVAQGMGLALGAVVMDLQSATVLGSVLMLSFLLAGGYYVQ  544

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC--SKGHYCRVADFPGVKAVGFNHMW  217
             +P FI W+KY+S S + +KLL+G QY  +D + C       C V DFP +K +G +   
Sbjct  545  HVPRFISWIKYISISNHAYKLLIGSQYKGSDTFPCVNDANRLCLVRDFPNIKTIGLDGQV  604

Query  216  VDVSVMAMMLVGYRFIAYLALHRV  145
              +  +A+MLV YR IAY+AL R+
Sbjct  605  NALVALAIMLVFYRLIAYIALMRI  628



>ref|XP_004252106.1| PREDICTED: ABC transporter G family member 9-like [Solanum lycopersicum]
Length=1013

 Score =   197 bits (502),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 107/201 (53%), Positives = 141/201 (70%), Gaps = 0/201 (0%)
 Frame = -3

Query  747   FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
             FY ++  +FTFPQER ML KERSSGMYRLS+YF+A TVGDLP+EL LPT  T I YWM G
Sbjct  808   FYSVFQGIFTFPQERMMLEKERSSGMYRLSAYFVAMTVGDLPMELVLPTISTLITYWMAG  867

Query  567   LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
             LKP    F  +L  +L++VLVSQSLGLA GA++MD + AT  A V  + F +AGG+YV  
Sbjct  868   LKPSAWRFFSTLFSLLYNVLVSQSLGLAIGAMVMDEQSATVFALVILISFTLAGGFYVHH  927

Query  387   IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
             +P FI W+K++S + Y +KLLLG QY+  + Y C     C V DFP +K +G     + +
Sbjct  928   VPKFIAWIKHVSITQYAYKLLLGSQYSPGETYSCGINATCLVEDFPSIKTIGLGGKVISI  987

Query  207   SVMAMMLVGYRFIAYLALHRV  145
               +A+ML+GYRF+AY+AL R+
Sbjct  988   VALAIMLLGYRFLAYIALKRI  1008



>ref|XP_010433373.1| PREDICTED: ABC transporter G family member 9-like [Camelina sativa]
Length=638

 Score =   194 bits (494),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 112/203 (55%), Positives = 144/203 (71%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQER ML KERSSGMYRLS YF+++ V DLP+EL LP  F  I YWM G
Sbjct  430  FFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFMSRVVADLPMELILPCCFLLITYWMAG  489

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            L   P+ F L+LL++L  VLVS  LGLA GA++MD K ATTL SV  L FL+AGGYYVQ 
Sbjct  490  LNHNPVNFFLTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLTFLLAGGYYVQH  549

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S  +Y +K+L+  QY +N++Y C +     C V DF G+K +GF+   V
Sbjct  550  VPVFISWIKYVSIGYYTYKILILGQYTENEWYPCGENEKLKCHVGDFEGIKHIGFHSGLV  609

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+MLVGYR IAY+AL R+
Sbjct  610  SAVALAVMLVGYRVIAYIALMRI  632



>ref|XP_007149612.1| hypothetical protein PHAVU_005G084300g [Phaseolus vulgaris]
 gb|ESW21606.1| hypothetical protein PHAVU_005G084300g [Phaseolus vulgaris]
Length=624

 Score =   194 bits (493),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 145/207 (70%), Gaps = 7/207 (3%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQE  ML KERSSGMYRLSSYF+++ V DLP+EL LPT F FI YWM 
Sbjct  415  GFFPLFQAIFTFPQELTMLQKERSSGMYRLSSYFMSRVVADLPMELVLPTIFLFITYWMA  474

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK   + F  +LL +L +VL +Q LGLA GA +MD K ATTLASV  L FL+AGG+YVQ
Sbjct  475  GLKANVVNFMYTLLSLLLNVLTAQGLGLALGACVMDQKAATTLASVIMLCFLLAGGFYVQ  534

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY+S S+Y ++L +G QY+  + Y C  G  C + +FP +K +G  H  + 
Sbjct  535  HVPNFIAWIKYISISYYTYQLFIGSQYSYGETYPCLTGQ-CSIVEFPSIKQIGV-HFGLH  592

Query  210  VSVMA-----MMLVGYRFIAYLALHRV  145
              +MA     +ML+ YR IAY+AL R+
Sbjct  593  DQLMAALGLLIMLIVYRLIAYIALMRI  619



>gb|KFK29257.1| hypothetical protein AALP_AA7G109600 [Arabis alpina]
Length=639

 Score =   194 bits (494),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 115/209 (55%), Positives = 149/209 (71%), Gaps = 2/209 (1%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+  +FTFPQER+ML KERSSGMYRLS+YF+++ VGDLP+EL LP  F  I YWM 
Sbjct  430  GFFPLFQQIFTFPQERKMLEKERSSGMYRLSAYFMSRVVGDLPMELILPFLFLAITYWMA  489

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GL P+   F L+LL++L  VLVS  LGLA GA++MD K ATTL SV  L FL+AGGYYV+
Sbjct  490  GLNPKFENFLLTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLAFLLAGGYYVR  549

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMW  217
             +P FI W++Y+S  +Y +KLL+  QY ++++Y C +     C V DF G+K +GF    
Sbjct  550  HVPVFISWIRYVSIGYYTYKLLILGQYTESEWYPCGENGKLKCYVGDFEGIKHIGFGSGL  609

Query  216  VDVSVMAMMLVGYRFIAYLALHRVR*SSS  130
            V    +A MLVGYRF+AYLAL R+  S S
Sbjct  610  VPALALAAMLVGYRFVAYLALMRIGKSKS  638



>ref|XP_009395262.1| PREDICTED: ABC transporter G family member 9-like [Musa acuminata 
subsp. malaccensis]
Length=622

 Score =   194 bits (493),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 103/201 (51%), Positives = 146/201 (73%), Gaps = 0/201 (0%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            +Y  + A+FTFPQER ML KERSSGMYRLSSYF+A+T+GDLP+EL+LP AF  I YW+GG
Sbjct  418  YYASFQAIFTFPQERTMLSKERSSGMYRLSSYFIARTLGDLPMELSLPIAFVTITYWLGG  477

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            LKP   +F + L  +L SV+V+QSLGLA GA + ++K  + L +V  ++F +A G+YVQ 
Sbjct  478  LKPVASSFLICLSALLLSVVVAQSLGLAIGAFVTNLKSGSALLTVLMVIFQLASGFYVQN  537

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVDV  208
            +PPFI W+KY+S+++Y FKL +  QY+  D Y+C++   C V++FP  K +GF+   + V
Sbjct  538  VPPFISWVKYVSFNYYTFKLQIASQYSPTDTYQCTRTTTCPVSEFPSFKLLGFDKRALSV  597

Query  207  SVMAMMLVGYRFIAYLALHRV  145
              + +M+  +RFIAYL L RV
Sbjct  598  IALFLMMFIFRFIAYLGLLRV  618



>ref|XP_010448138.1| PREDICTED: ABC transporter G family member 9 [Camelina sativa]
 ref|XP_010448139.1| PREDICTED: ABC transporter G family member 9 [Camelina sativa]
Length=638

 Score =   194 bits (492),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 145/203 (71%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQER ML KERSSGMYRLS YF+++ VGDLP+EL LP  F  I Y+M G
Sbjct  430  FFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFMSRVVGDLPMELILPCCFLIITYFMAG  489

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            L   P+ F L+LL++L  VLVS  LGLA GA++MD K ATTL SV  L FL+AGGYYVQ 
Sbjct  490  LNHNPVNFFLTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLTFLLAGGYYVQH  549

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S  +Y +KLL+  QY +N++Y C +     C V DF G+K +GF+   V
Sbjct  550  VPVFISWIKYVSIGYYTYKLLILGQYTENEWYPCGENEKLKCHVGDFEGIKHIGFHSGLV  609

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+MLVGYR IAY+AL R+
Sbjct  610  SAVALAVMLVGYRVIAYIALMRI  632



>ref|XP_002533914.1| ATP-binding cassette transporter, putative [Ricinus communis]
 gb|EEF28469.1| ATP-binding cassette transporter, putative [Ricinus communis]
Length=632

 Score =   193 bits (490),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 114/209 (55%), Positives = 144/209 (69%), Gaps = 10/209 (5%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQERRML KERSSGMYRLSSYF+++TV DLP+EL LP  F  I YWM 
Sbjct  422  GFFPLFQAIFTFPQERRMLEKERSSGMYRLSSYFMSRTVSDLPMELVLPAIFVIITYWMA  481

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK   + F  +L +VLF+VLV+Q LGLA GAI++D + ATT+ SV  L F +  GYYVQ
Sbjct  482  GLKSTAVNFLNTLFVVLFNVLVAQGLGLALGAIVLDQRSATTVGSVLMLSFQLVSGYYVQ  541

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC--SKGHYCRVADFPGVKAVGFNHMW  217
             +P FI W+KY+S S Y ++LLLG QY   D Y C  +    C V D+P +K VG     
Sbjct  542  NVPIFIGWIKYISISQYTYRLLLGSQYKQTDTYPCNTTASGVCLVGDYPAIKMVGLG---  598

Query  216  VDVSVMA-----MMLVGYRFIAYLALHRV  145
            VD  ++A     +MLV +R IAYLAL R+
Sbjct  599  VDGQIIAAVALLIMLVLFRVIAYLALTRI  627



>gb|KJB13426.1| hypothetical protein B456_002G073600 [Gossypium raimondii]
Length=627

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 101/203 (50%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G +PLY A+FTFPQER ML KERS+G+YRLSSYF+++ + DLP+EL LP  F  I YWM 
Sbjct  417  GLFPLYQAIFTFPQERLMLEKERSAGLYRLSSYFMSRIISDLPMELTLPIVFITISYWMA  476

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP   +F  +L  ++  VL SQ +GLA GA++M+ K A TL S+  L FL+A GYY+Q
Sbjct  477  GLKPTAGSFLYTLFALILCVLGSQGIGLAIGALVMNTKSAATLGSIIMLTFLLASGYYIQ  536

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSK-GHYCRVADFPGVKAVGFNHMWV  214
            Q P F+ W+KY++ + Y +KLLLG QY  +D Y C++ G  C V DF  +K VG +   +
Sbjct  537  QFPGFMSWIKYIALTHYAYKLLLGSQYQPHDTYPCNEPGKVCLVGDFQPIKTVGLDGQLI  596

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                + +M++ YR +AYLAL R+
Sbjct  597  SAVALILMVLIYRLVAYLALMRI  619



>ref|XP_010438619.1| PREDICTED: ABC transporter G family member 9-like [Camelina sativa]
Length=636

 Score =   192 bits (488),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 143/203 (70%), Gaps = 4/203 (2%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQER ML KERSSGMYRLS YF+++ VGDLP+EL LP  F  I YWM G
Sbjct  430  FFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFMSRVVGDLPMELILPCCFLLITYWMAG  489

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            L   P+   L+LL++L  VLVS  LGLA GA++MD K ATTL SV  L FL+AGGYYVQ 
Sbjct  490  LNHNPVKNFLTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLTFLLAGGYYVQH  549

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKG--HYCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+ Y  Y +KLL+  QY +N++Y C +     C V DF G+K +GF+   V
Sbjct  550  VPVFISWIKYVGY--YTYKLLILGQYTENEWYPCGENLKLKCHVGDFEGIKHIGFHSGLV  607

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+MLVGYR IAY+AL R+
Sbjct  608  SAVALAVMLVGYRVIAYIALMRI  630



>gb|EPS69022.1| hypothetical protein M569_05746, partial [Genlisea aurea]
Length=577

 Score =   191 bits (484),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/202 (54%), Positives = 142/202 (70%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPL+ A+F FP+E+ ML KERSSGMYRLSSYF+A  + DLP++L LPTAF  ++Y+M 
Sbjct  372  GFYPLFQAIFIFPKEKMMLKKERSSGMYRLSSYFMALNLSDLPMQLVLPTAFFAVIYFMS  431

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GL+P P  F  +L ++LFSVLVS SLGLA GA +MD K AT + +V  L FL+AGGYYV+
Sbjct  432  GLRPSPAAFFSALSVLLFSVLVSHSLGLAIGAAVMDEKSATMMGTVIMLGFLLAGGYYVR  491

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +  F+ W+KY+S S Y +KLL+G Q+   + Y+C  G  C V DFP VKAVG       
Sbjct  492  HVAGFVSWIKYVSISHYTYKLLIGAQFEGGERYDCG-GRVCFVRDFPMVKAVGLGGSGWS  550

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
            V  M +MLV Y  +AYLAL R+
Sbjct  551  VGAMVIMLVVYSVVAYLALMRI  572



>ref|XP_006447786.1| hypothetical protein CICLE_v10017645mg [Citrus clementina]
 gb|ESR61026.1| hypothetical protein CICLE_v10017645mg [Citrus clementina]
Length=608

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/200 (53%), Positives = 138/200 (69%), Gaps = 1/200 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            P+   +FT PQE++ML KE SSGMYRLS+YF+++ + DLP++L +PT F  I YWM GLK
Sbjct  406  PMLECIFTLPQEQKMLEKEISSGMYRLSAYFMSRIISDLPIKLVIPTVFVTITYWMAGLK  465

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P    F  +L ++LFSVL SQ LGLA GA++M+ K AT L S+   +F++AGGYYVQ +P
Sbjct  466  PTASNFFETLFVLLFSVLESQGLGLAIGAMVMEQKSATILGSIIMQLFVLAGGYYVQNVP  525

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC-SKGHYCRVADFPGVKAVGFNHMWVDVS  205
             FI WLKYLS   + +KLLLG QYN N+ Y C   G  C V + P +K VG N     V 
Sbjct  526  SFIAWLKYLSIGHHTYKLLLGSQYNYNETYPCGDSGGLCLVGEHPTIKKVGLNRKDYSVI  585

Query  204  VMAMMLVGYRFIAYLALHRV  145
             +A+MLVGYR IAY+AL R+
Sbjct  586  ALAIMLVGYRLIAYIALMRI  605



>ref|XP_006286036.1| hypothetical protein CARUB_v10007565mg [Capsella rubella]
 gb|EOA18934.1| hypothetical protein CARUB_v10007565mg [Capsella rubella]
Length=638

 Score =   191 bits (484),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 141/203 (69%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQER ML KERSSGMYRLS YF+++ VGDLP+EL LP  F  I Y+M G
Sbjct  430  FFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFMSRVVGDLPMELILPCCFVLITYFMAG  489

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            L   P  F L+LL++L  VLVS  LGLA GA++MD K ATTL SV  L FL+AGGYYVQ 
Sbjct  490  LNHHPANFFLTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLTFLLAGGYYVQH  549

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S  +Y +KLL+  QY  N+ Y C       C V DF G+K +GF+   V
Sbjct  550  VPVFISWIKYVSIGYYTYKLLILGQYTANELYPCGDDGKLKCHVGDFEGIKNIGFHSGLV  609

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +A+MLVGYR IAYLAL R+
Sbjct  610  SALALAVMLVGYRVIAYLALMRI  632



>ref|XP_002316916.1| ABC transporter family protein [Populus trichocarpa]
 gb|EEE97528.1| ABC transporter family protein [Populus trichocarpa]
Length=619

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 142/203 (70%), Gaps = 1/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQER ML KERSSGMYRLSSYF+++ V DLP+EL LPT F  I YWM 
Sbjct  412  GFFPLFQAIFTFPQERSMLEKERSSGMYRLSSYFMSRIVSDLPMELVLPTIFVSITYWMA  471

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK  P  F  +L ++L+SVLVS  LGLA GA++++ K AT + SV  L FL+AGGYYV 
Sbjct  472  GLKGTPGNFLHTLFVLLYSVLVSGGLGLALGALVLNQKSATIMGSVIMLSFLLAGGYYVT  531

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC-SKGHYCRVADFPGVKAVGFNHMWV  214
             +P FI W+KY+S S Y +KLLLG Q+   D Y C   G  C V D+P +K VG +   +
Sbjct  532  HVPAFISWVKYISISQYTYKLLLGSQFKPTDTYPCGGAGGVCLVGDYPAIKQVGLDGQVL  591

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
              +V+ +MLV YR IA+ AL R+
Sbjct  592  GAAVLGIMLVVYRLIAFFALMRI  614



>ref|XP_006464709.1| PREDICTED: ABC transporter G family member 9-like [Citrus sinensis]
Length=628

 Score =   189 bits (480),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 105/200 (53%), Positives = 141/200 (71%), Gaps = 1/200 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            P+   +FTFPQE++ML KE SSGMYRLS+YF+++ + DLP++L +PT F  I YWM GLK
Sbjct  424  PMLECIFTFPQEQKMLEKEISSGMYRLSAYFMSRIISDLPIKLVIPTVFVTITYWMAGLK  483

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P    F  +L ++LFSVLVSQ LGLA GA++M+ K AT L S+   +F++AGGYYVQ +P
Sbjct  484  PTASNFFETLFVLLFSVLVSQGLGLAIGAMVMEQKSATILGSIIMQLFVLAGGYYVQNVP  543

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC-SKGHYCRVADFPGVKAVGFNHMWVDVS  205
             FI W++YLS   + +KLLLG QYN N+ Y C   G  C V + P +K VG +  +  V 
Sbjct  544  SFIAWIEYLSIGHHTYKLLLGSQYNYNETYPCGDSGGLCLVGEHPTIKKVGLHRKYYSVI  603

Query  204  VMAMMLVGYRFIAYLALHRV  145
             +A+MLVGYR IAY+AL R+
Sbjct  604  ALAIMLVGYRLIAYIALMRI  623



>ref|NP_194472.3| ABC transporter G family member 9 [Arabidopsis thaliana]
 sp|Q9SZR9.2|AB9G_ARATH RecName: Full=ABC transporter G family member 9; Short=ABC transporter 
ABCG.9; Short=AtABCG9; AltName: Full=Probable white-brown 
complex homolog protein 9; Short=AtWBC9 [Arabidopsis 
thaliana]
 gb|AEE85338.1| ABC transporter G family member 9 [Arabidopsis thaliana]
Length=638

 Score =   189 bits (480),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 138/203 (68%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQER ML KERSSGMYRLS YFL++ VGDLP+EL LPT F  I YWM G
Sbjct  430  FFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFLSRVVGDLPMELILPTCFLVITYWMAG  489

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            L      F ++LL++L  VLVS  LGLA GA++MD K ATTL SV  L FL+AGGYYVQ 
Sbjct  490  LNHNLANFFVTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLTFLLAGGYYVQH  549

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S  +Y +KLL+  QY  N+ Y C       C V DF G+K +GFN   V
Sbjct  550  VPVFISWIKYVSIGYYTYKLLILGQYTANELYPCGDNGKLRCHVGDFEGIKHIGFNSGLV  609

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +  MLV YR IAY+AL R+
Sbjct  610  SALALTAMLVVYRVIAYIALTRI  632



>ref|XP_009416919.1| PREDICTED: ABC transporter G family member 25-like [Musa acuminata 
subsp. malaccensis]
Length=642

 Score =   189 bits (479),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 143/208 (69%), Gaps = 16/208 (8%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G +P +NAVFTF QER + IKERSSGMY LSSYF+A+  GDLP+EL LPT FT ILYWM 
Sbjct  443  GVFPSFNAVFTFAQERAIFIKERSSGMYSLSSYFMARMAGDLPMELILPTVFTLILYWMA  502

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GL+ EP  F L++ ++L  VLV+Q LGLAFGA +MD KQA+T+A+VT L FL+ GG+YVQ
Sbjct  503  GLRAEPAAFLLTVAVLLGYVLVAQGLGLAFGAAIMDAKQASTIATVTMLAFLLTGGFYVQ  562

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQY--NDNDYYECSKGHYCRVADFPGVKAVGFNHMW  217
             IP  + W+KY+S++FY ++LL+ +QY  N+ DYY   KG           +  G     
Sbjct  563  NIPGCLAWMKYVSFTFYGYRLLISIQYRGNEMDYYIHRKGR----------EEEGDLVAQ  612

Query  216  VDVSV----MAMMLVGYRFIAYLALHRV  145
            VD SV    +  MLVGYR +AY+AL R 
Sbjct  613  VDASVCIVALIAMLVGYRVLAYIALRRT  640



>ref|XP_010256405.1| PREDICTED: ABC transporter G family member 25 [Nelumbo nucifera]
Length=663

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/208 (51%), Positives = 144/208 (69%), Gaps = 5/208 (2%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G  P +NAVFTFPQER + IKER+SGMY LSSYF+A+ VGDLP+EL LPT F+ + YWM 
Sbjct  455  GVMPSFNAVFTFPQERAVFIKERASGMYTLSSYFMARIVGDLPMELILPTVFSTVAYWMT  514

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GL+P+P  F L++L++L  VLV+Q LGLA GAI+MD KQA+T+ ++T L F++ GG+YV 
Sbjct  515  GLRPDPGAFLLTILVLLGYVLVAQGLGLALGAIIMDAKQASTVVTITMLAFVLTGGFYVH  574

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYE----CSK-GHYCRVADFPGVKAVGFN  226
            +IP  + W+KYLS++FYC++LL+G+QY D         CS+ G       F      G  
Sbjct  575  KIPHCLAWIKYLSFTFYCYRLLIGIQYGDGKLISSLLGCSRIGSDRTDCGFVEGDVEGQI  634

Query  225  HMWVDVSVMAMMLVGYRFIAYLALHRVR  142
               V + +M +M VGYR IAY AL R++
Sbjct  635  RPVVSIGIMFLMFVGYRLIAYAALRRIK  662



>emb|CAB43874.1| putative protei [Arabidopsis thaliana]
 emb|CAB81392.1| putative protein [Arabidopsis thaliana]
Length=635

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 113/203 (56%), Positives = 138/203 (68%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQER ML KERSSGMYRLS YFL++ VGDLP+EL LPT F  I YWM G
Sbjct  427  FFPLFQQIFTFPQERAMLQKERSSGMYRLSPYFLSRVVGDLPMELILPTCFLVITYWMAG  486

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            L      F ++LL++L  VLVS  LGLA GA++MD K ATTL SV  L FL+AGGYYVQ 
Sbjct  487  LNHNLANFFVTLLVLLVHVLVSGGLGLALGALVMDQKSATTLGSVIMLTFLLAGGYYVQH  546

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S  +Y +KLL+  QY  N+ Y C       C V DF G+K +GFN   V
Sbjct  547  VPVFISWIKYVSIGYYTYKLLILGQYTANELYPCGDNGKLRCHVGDFEGIKHIGFNSGLV  606

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +  MLV YR IAY+AL R+
Sbjct  607  SALALTAMLVVYRVIAYIALTRI  629



>ref|XP_011029437.1| PREDICTED: ABC transporter G family member 9-like [Populus euphratica]
Length=619

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/203 (53%), Positives = 140/203 (69%), Gaps = 1/203 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQER ML KERSSGMYRLSSYF+++ V DLP+EL LPT F  I YWM 
Sbjct  412  GFFPLFEAIFTFPQERSMLEKERSSGMYRLSSYFMSRIVSDLPMELVLPTIFVSITYWMA  471

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK  P  F  +L ++L+SV+VS  LGLA GA++++ K AT + SV  L FL+AGGYYV 
Sbjct  472  GLKGTPRNFLHTLFVLLYSVVVSGGLGLALGALVLNQKSATIMGSVIMLSFLLAGGYYVT  531

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC-SKGHYCRVADFPGVKAVGFNHMWV  214
             +P FI W+KY+S S Y +KLLLG Q+   D Y C   G  C + D+P +K VG +   +
Sbjct  532  HVPAFISWVKYISISQYTYKLLLGSQFKPTDTYPCGGAGGVCFIGDYPAIKQVGLDGQVL  591

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                + +MLV YR IA+ AL R+
Sbjct  592  GAVALGIMLVVYRLIAFFALMRI  614



>ref|XP_008781545.1| PREDICTED: LOW QUALITY PROTEIN: ABC transporter G family member 
25 [Phoenix dactylifera]
Length=650

 Score =   188 bits (477),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/205 (50%), Positives = 147/205 (72%), Gaps = 3/205 (1%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G +P +NAVFTFPQER + IKERSSGMY LSSYF+A+  GDLP+EL LPT F  ILYWM 
Sbjct  446  GVFPSFNAVFTFPQERAIFIKERSSGMYTLSSYFMARMAGDLPMELILPTVFALILYWMA  505

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GL+PEP  F L+L+++L  VLV+Q LGLA GA +MD K+A+T+ +VT L FL+ GG+YVQ
Sbjct  506  GLRPEPEAFMLTLVVLLGYVLVAQGLGLALGAAIMDAKKASTVITVTMLAFLLTGGFYVQ  565

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P  ++W+KY S++FYC++LL+ +QY +++        + R       + +G   +  +
Sbjct  566  HVPSCVIWMKYTSFTFYCYRLLINLQYKESELATFLGLSHHRNGREAVEQELG-GQLSTE  624

Query  210  VSVMAM--MLVGYRFIAYLALHRVR  142
            + ++A+  M VGYRF+AYLAL R++
Sbjct  625  MCIVALVAMFVGYRFLAYLALRRIK  649



>gb|KDP27018.1| hypothetical protein JCGZ_20953 [Jatropha curcas]
Length=338

 Score =   182 bits (462),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 103/202 (51%), Positives = 133/202 (66%), Gaps = 1/202 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
             F PL  A FTFP+ER+ML KE SSG YR SSYF+++ + DLP+ELALPT F  I YWMG
Sbjct  133  AFVPLNQATFTFPKERKMLTKELSSGTYRPSSYFMSRMISDLPMELALPTVFVTITYWMG  192

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP P  F  SL ++LF+VLVSQ +GLA GA +MD K A  L  V  L F ++ G+++Q
Sbjct  193  GLKPAPKNFLPSLFVILFNVLVSQGMGLALGATIMDQKSAAVLGQVIMLSFQLSAGFFIQ  252

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P FI W+KY S  F   KLLLG QY  +D Y C +G  C V DF  +K  G +     
Sbjct  253  HVPSFIGWIKYFSICFNALKLLLGSQYKPSDTYPCGEG-VCSVGDFHMIKTAGLDGQVQS  311

Query  210  VSVMAMMLVGYRFIAYLALHRV  145
               +A++LVG+R +AYLA+ R+
Sbjct  312  AITLAVLLVGFRLLAYLAIIRI  333



>ref|XP_009406087.1| PREDICTED: ABC transporter G family member 25-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=645

 Score =   187 bits (476),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 110/206 (53%), Positives = 142/206 (69%), Gaps = 6/206 (3%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G +  +NAVFTFPQER + IKERSSGMY LSSYF+A+  GDLP+EL LPT FT ILYWM 
Sbjct  442  GVFASFNAVFTFPQERAIFIKERSSGMYNLSSYFMARMAGDLPMELILPTVFTLILYWMA  501

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GL+ EP  F L+L ++L  VLV+Q LGL  GA +MD KQA+T+A+VT L FL+ GG+YVQ
Sbjct  502  GLRTEPGAFLLTLAVLLGYVLVAQGLGLVLGAAIMDAKQASTIATVTMLAFLLTGGFYVQ  561

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDN--DYYECSKGHYC-RVADFPGVKAVGFNHM  220
             IP  + WLKY+S++FYC++LL+ +QY     DY   S  H   R AD   V  V  +  
Sbjct  562  NIPSCLAWLKYISFTFYCYRLLIIIQYGGGQMDYLLASSHHRNKRDADGELVAQVSTS--  619

Query  219  WVDVSVMAMMLVGYRFIAYLALHRVR  142
             V ++ +  M VGYR +AY+AL R +
Sbjct  620  -VCIAALLAMFVGYRVLAYMALRRTK  644



>ref|XP_006451938.1| hypothetical protein CICLE_v10007744mg [Citrus clementina]
 gb|ESR65178.1| hypothetical protein CICLE_v10007744mg [Citrus clementina]
Length=628

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/200 (52%), Positives = 140/200 (70%), Gaps = 1/200 (1%)
 Frame = -3

Query  741  PLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGGLK  562
            P+   +FTFPQE++ML KE  SGMYRLS+YF+++ + DLP++L +PT F  I YWM GLK
Sbjct  424  PMLECIFTFPQEQKMLEKEIPSGMYRLSAYFMSRIISDLPIKLVIPTVFVTITYWMAGLK  483

Query  561  PEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQIP  382
            P    F  +L ++LFSVLVSQ LGLA GA++M+ K AT L S+   +F++AGGYYVQ +P
Sbjct  484  PTASNFFETLFVLLFSVLVSQGLGLAIGAMVMEQKSATILGSIIMQLFVLAGGYYVQNVP  543

Query  381  PFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC-SKGHYCRVADFPGVKAVGFNHMWVDVS  205
             FI W++YLS   + +KLLLG QYN N+ Y C   G  C V + P +K VG +  +  V 
Sbjct  544  SFIAWIEYLSIGHHTYKLLLGSQYNYNETYPCGDSGGLCLVGEHPTIKKVGLHRKYYSVI  603

Query  204  VMAMMLVGYRFIAYLALHRV  145
             +A+MLVGYR IAY+AL R+
Sbjct  604  ALAIMLVGYRLIAYIALMRI  623



>ref|XP_002867504.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43763.1| abc transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=639

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 111/203 (55%), Positives = 140/203 (69%), Gaps = 2/203 (1%)
 Frame = -3

Query  747  FYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMGG  568
            F+PL+  +FTFPQER ML KERSSG+YRLS YF+++ VGDLP+EL LPT F  I YWM G
Sbjct  431  FFPLFQQIFTFPQERAMLQKERSSGVYRLSPYFMSRLVGDLPMELILPTCFLVITYWMAG  490

Query  567  LKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQQ  388
            L      F ++LL++L  VLVS  LGLA GA++MD K ATTL SV  L FL+AGGYYVQ 
Sbjct  491  LNHNLANFFVTLLVLLVHVLVSGGLGLALGALVMDQKTATTLGSVIMLTFLLAGGYYVQH  550

Query  387  IPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGH--YCRVADFPGVKAVGFNHMWV  214
            +P FI W+KY+S  +Y +KLL+  QY  N++Y C +     C V DF G+K +GFN   V
Sbjct  551  VPVFISWIKYVSIGYYTYKLLILGQYTANEWYPCGENGILRCHVGDFEGIKHIGFNSGLV  610

Query  213  DVSVMAMMLVGYRFIAYLALHRV  145
                +  MLV YR IAY+AL R+
Sbjct  611  SALALTAMLVVYRVIAYIALTRI  633



>ref|XP_007133073.1| hypothetical protein PHAVU_011G149300g [Phaseolus vulgaris]
 gb|ESW05067.1| hypothetical protein PHAVU_011G149300g [Phaseolus vulgaris]
Length=627

 Score =   186 bits (472),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 108/204 (53%), Positives = 144/204 (71%), Gaps = 3/204 (1%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G  PLY A+FTFPQE  ML KERSSGMY+LSSYF+++ VGDLP+EL LP+ F  I+YWM 
Sbjct  418  GGMPLYQAIFTFPQELIMLEKERSSGMYKLSSYFMSRMVGDLPMELVLPSIFLTIIYWMI  477

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK   + F  +LL +L  VLVSQ LGLA GAI+MD K ATTLASV  L  ++  GYY+Q
Sbjct  478  GLKNNVVNFLCTLLTILLDVLVSQGLGLAIGAIVMDQKSATTLASVIVLTSVLVTGYYIQ  537

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGFNHMWVD  211
             +P F+ WLKY S ++Y + LL+G QY  +D Y C +G  C VA++P ++ +G +     
Sbjct  538  HVPKFVAWLKYFSINYYIYHLLIGSQYGSSDTYPCHQGQ-CLVAEYPLIEQMGLHLQGKI  596

Query  210  VSVMAM--MLVGYRFIAYLALHRV  145
            +S +A+  ML+GYR +AYLAL ++
Sbjct  597  MSALALFIMLIGYRLVAYLALMKI  620



>ref|XP_010463057.1| PREDICTED: ABC transporter G family member 14-like [Camelina 
sativa]
Length=574

 Score =   185 bits (470),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GFYPLYNAVFTFPQE+RMLIKERSSGMYRLSSYF+A+ VGDLPLELALPTAF FI+YWMG
Sbjct  445  GFYPLYNAVFTFPQEKRMLIKERSSGMYRLSSYFMARNVGDLPLELALPTAFVFIIYWMG  504

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLKP+P TF LSLL+VL+SVLV+Q LGLAFGA+LM++KQATTLASVTTLVFLIAGGYYVQ
Sbjct  505  GLKPDPTTFILSLLVVLYSVLVAQGLGLAFGALLMNIKQATTLASVTTLVFLIAGGYYVQ  564

Query  390  QIP  382
            QIP
Sbjct  565  QIP  567



>ref|XP_004134251.1| PREDICTED: ABC transporter G family member 9 [Cucumis sativus]
 gb|KGN56223.1| hypothetical protein Csa_3G101820 [Cucumis sativus]
Length=617

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 136/206 (66%), Gaps = 4/206 (2%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL  A+ TFP+ER +L KERSSGMYRLSSYF+++T  DLP+EL LPT F  I+Y M 
Sbjct  406  GFFPLLQAIGTFPKERMILEKERSSGMYRLSSYFVSRTTTDLPMELVLPTVFVVIIYVMA  465

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK    +F  +L  +L SVLV+Q  GLA GA+++D   ATT ASV  L FL+  GY+VQ
Sbjct  466  GLKRTVASFFATLFSLLLSVLVAQGFGLAMGALVLDQTSATTFASVIMLCFLLTSGYFVQ  525

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC----SKGHYCRVADFPGVKAVGFNH  223
             +P FI W KY+S   Y +KLLL  QY  +D Y C    + G  C V +FP +K VG + 
Sbjct  526  HVPKFIAWTKYISIGTYSYKLLLISQYKASDTYPCPSNDNGGRACEVGEFPPIKQVGLDG  585

Query  222  MWVDVSVMAMMLVGYRFIAYLALHRV  145
                VS M  MLVGYR +AY+AL R+
Sbjct  586  KLFAVSAMVAMLVGYRLVAYIALMRI  611



>ref|XP_006493205.1| PREDICTED: ABC transporter G family member 9-like [Citrus sinensis]
Length=650

 Score =   186 bits (471),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 109/206 (53%), Positives = 141/206 (68%), Gaps = 4/206 (2%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+ TFP ER ML KERSSGMYRLSSY +AKT GD  +EL LPT F  I YWMG
Sbjct  440  GFFPLFQALHTFPLERMMLEKERSSGMYRLSSYIMAKTAGDFVMELVLPTVFVIITYWMG  499

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK   + F  +L   L++ LV+QSLGLA GA++++ ++A T+A+   L FL+ GG++VQ
Sbjct  500  GLKARVINFLSTLAATLYTALVAQSLGLAVGALVLNQRKAGTIATTLMLTFLLTGGFFVQ  559

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHY----CRVADFPGVKAVGFNH  223
             +P FI WL+YLS++ Y +KLLL  QYN ND Y C+        C V DFP +K VG N+
Sbjct  560  DVPAFISWLEYLSFTHYSYKLLLMSQYNPNDTYICASNSNSNATCLVGDFPRIKFVGLNN  619

Query  222  MWVDVSVMAMMLVGYRFIAYLALHRV  145
              + V +MA M V Y+ I YLAL RV
Sbjct  620  KLLSVVMMAAMFVCYKLITYLALRRV  645



>ref|XP_008452359.1| PREDICTED: ABC transporter G family member 9-like [Cucumis melo]
Length=575

 Score =   184 bits (466),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 107/206 (52%), Positives = 134/206 (65%), Gaps = 4/206 (2%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL  A+ TFP+ER +L KERSSGMYRLSSYF+++T  DLP+EL LPT F  I+Y M 
Sbjct  364  GFFPLLQAINTFPKERMILEKERSSGMYRLSSYFISRTTTDLPMELILPTVFIVIIYAMA  423

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK     F  +L  +L SVLV+Q  GLA GA+++D   ATT ASV  L FL+  GY+VQ
Sbjct  424  GLKRTVANFFATLFSLLLSVLVAQGFGLAMGALVLDQTSATTFASVIMLCFLLTSGYFVQ  483

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYEC----SKGHYCRVADFPGVKAVGFNH  223
             +P FI W KY+S   Y +KLLL  QY  +D Y C    + G  C V +FP +K VG + 
Sbjct  484  HVPKFIAWTKYISIGTYSYKLLLISQYKGSDTYPCPSKDNGGRVCEVGEFPPIKEVGLDG  543

Query  222  MWVDVSVMAMMLVGYRFIAYLALHRV  145
                V  M  MLVGYR IAY+AL R+
Sbjct  544  KLFAVLAMVAMLVGYRLIAYIALMRI  569



>ref|XP_009383524.1| PREDICTED: ABC transporter G family member 25-like [Musa acuminata 
subsp. malaccensis]
Length=639

 Score =   184 bits (468),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 103/204 (50%), Positives = 138/204 (68%), Gaps = 2/204 (1%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            G +  +NAVFTFPQER + +KE+SSGMY LSSYF+A+  GDLP+EL LPT FT ILYWM 
Sbjct  436  GVFASFNAVFTFPQERAIFVKEKSSGMYSLSSYFMARMAGDLPMELILPTVFTLILYWMA  495

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GL+ EP  F ++L ++L  VLV+Q LGL  GA +MD KQA+T+ ++T L FL+ GG+YVQ
Sbjct  496  GLRAEPAAFLITLAVLLGYVLVAQGLGLVVGAAIMDAKQASTVVTITMLAFLLTGGFYVQ  555

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDY-YECSKGHYCRVADFPGVKAVGFNHMWV  214
             IP F+ WLKY+S +FYC++LL+ +QY   +  Y     H     +  G  A G     V
Sbjct  556  NIPSFLAWLKYVSCTFYCYRLLVRIQYRGEEMEYFLGSSHQRSRREAEGEMA-GEVSTLV  614

Query  213  DVSVMAMMLVGYRFIAYLALHRVR  142
             V  +  M VGYR +AY+AL R++
Sbjct  615  SVGALIAMFVGYRILAYVALRRIK  638



>ref|XP_006441201.1| hypothetical protein CICLE_v10023692mg, partial [Citrus clementina]
 gb|ESR54441.1| hypothetical protein CICLE_v10023692mg, partial [Citrus clementina]
Length=607

 Score =   184 bits (466),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 108/206 (52%), Positives = 141/206 (68%), Gaps = 4/206 (2%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+ TFP ER ML KERSSGMYRLSSY +AKT GD  +EL LPT F  I YWMG
Sbjct  397  GFFPLFQALHTFPLERMMLEKERSSGMYRLSSYIMAKTTGDFVMELVLPTVFVIITYWMG  456

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK   + F  +L   L++ LV+QSLGLA GA +++ ++A T+A+   L FL+ GG+++Q
Sbjct  457  GLKARVINFLSTLAATLYTALVAQSLGLAVGAFVLNQRKAGTIATTLMLTFLLTGGFFLQ  516

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHY----CRVADFPGVKAVGFNH  223
             +P FI WL+YLS++ Y +KLLL  QYN ND Y C+        C V DFP +K VG N+
Sbjct  517  DVPAFISWLEYLSFTHYSYKLLLMSQYNPNDTYVCASNSNSNATCLVGDFPRIKFVGLNN  576

Query  222  MWVDVSVMAMMLVGYRFIAYLALHRV  145
              + V +MA+M V Y+ I YLAL RV
Sbjct  577  KLLSVVMMAVMFVCYKLITYLALRRV  602



>ref|XP_004487681.1| PREDICTED: ABC transporter G family member 9-like [Cicer arietinum]
Length=630

 Score =   184 bits (466),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 112/204 (55%), Positives = 146/204 (72%), Gaps = 3/204 (1%)
 Frame = -3

Query  750  GFYPLYNAVFTFPQERRMLIKERSSGMYRLSSYFLAKTVGDLPLELALPTAFTFILYWMG  571
            GF+PL+ A+FTFPQE  ML KERSSGMYRLSSYF+++ V DLP+EL LPT F  I Y+M 
Sbjct  421  GFFPLFQAIFTFPQELMMLEKERSSGMYRLSSYFISRMVADLPMELVLPTIFILITYFMT  480

Query  570  GLKPEPltftlsllivlfsvlvsqslgLAFGAILMDVKQATTLASVTTLVFLIAGGYYVQ  391
            GLK   + F  +L  +L +VLV+Q LGLA GA+++D K ATTLASV  L FL+AGG+YVQ
Sbjct  481  GLKATVINFFQTLFTLLLNVLVAQGLGLALGALVLDQKSATTLASVIMLCFLLAGGFYVQ  540

Query  390  QIPPFILWLKYLSYSFYCFKLLLGVQYNDNDYYECSKGHYCRVADFPGVKAVGF--NHMW  217
             +P FI W+KY+S S+Y ++L LG QY+  D Y CS GH C + +FP +K +GF  N   
Sbjct  541  NVPKFISWVKYISISYYTYQLFLGSQYHSGDTYPCSNGH-CPIEEFPPIKQMGFQLNGEG  599

Query  216  VDVSVMAMMLVGYRFIAYLALHRV  145
            +    + +ML+GYR IAY AL R+
Sbjct  600  LAALALVLMLIGYRLIAYFALMRI  623



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1455524718375