BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2724

Length=1129
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009777280.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    251   6e-97   Nicotiana sylvestris
ref|XP_009777281.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    250   1e-96   Nicotiana sylvestris
ref|XP_009777282.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    250   1e-96   Nicotiana sylvestris
ref|XP_006347568.1|  PREDICTED: D-xylose-proton symporter-like 2-...    249   3e-96   Solanum tuberosum [potatoes]
ref|NP_001288106.1|  D-xylose-proton symporter-like 2-like              249   4e-96   Solanum lycopersicum
ref|XP_009613870.1|  PREDICTED: LOW QUALITY PROTEIN: D-xylose-pro...    249   5e-95   Nicotiana tomentosiformis
emb|CDP04938.1|  unnamed protein product                                248   1e-92   Coffea canephora [robusta coffee]
ref|XP_007029560.1|  Major facilitator superfamily protein              238   1e-92   
ref|XP_006443191.1|  hypothetical protein CICLE_v10019791mg             238   3e-91   Citrus clementina [clementine]
ref|XP_008362818.1|  PREDICTED: D-xylose-proton symporter-like 2        232   4e-91   Malus domestica [apple tree]
ref|XP_009351838.1|  PREDICTED: D-xylose-proton symporter-like 2        234   4e-90   Pyrus x bretschneideri [bai li]
ref|XP_010662115.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    236   1e-89   Vitis vinifera
ref|XP_002277076.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    235   2e-89   Vitis vinifera
ref|XP_004137173.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    239   2e-89   Cucumis sativus [cucumbers]
gb|ADP37177.1|  putative vacuolar glucose transporter                   235   2e-89   Vitis vinifera
ref|XP_011653375.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    239   2e-89   Cucumis sativus [cucumbers]
ref|XP_009361176.1|  PREDICTED: D-xylose-proton symporter-like 2        233   7e-89   Pyrus x bretschneideri [bai li]
ref|XP_007219039.1|  hypothetical protein PRUPE_ppa004602mg             233   7e-89   Prunus persica
ref|XP_008234574.1|  PREDICTED: D-xylose-proton symporter-like 2        228   9e-88   Prunus mume [ume]
gb|ABK95072.1|  unknown                                                 233   1e-87   Populus trichocarpa [western balsam poplar]
ref|XP_012090914.1|  PREDICTED: D-xylose-proton symporter-like 2        236   2e-87   Jatropha curcas
ref|XP_008376911.1|  PREDICTED: D-xylose-proton symporter-like 2        227   2e-87   Malus domestica [apple tree]
gb|KJB26764.1|  hypothetical protein B456_004G258400                    229   2e-87   Gossypium raimondii
ref|XP_011008112.1|  PREDICTED: D-xylose-proton symporter-like 2        229   1e-85   Populus euphratica
ref|XP_002520022.1|  sugar transporter, putative                        229   4e-85   
gb|KDO39944.1|  hypothetical protein CISIN_1g0102391mg                  219   4e-85   Citrus sinensis [apfelsine]
gb|KHN46451.1|  D-xylose-proton symporter-like 2                        233   2e-84   Glycine soja [wild soybean]
ref|XP_009382608.1|  PREDICTED: D-xylose-proton symporter-like 2        232   2e-84   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007131530.1|  hypothetical protein PHAVU_011G020700g             236   2e-84   Phaseolus vulgaris [French bean]
ref|XP_010558647.1|  PREDICTED: D-xylose-proton symporter-like 2        226   3e-84   Tarenaya hassleriana [spider flower]
ref|XP_011470132.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    222   5e-84   Fragaria vesca subsp. vesca
ref|XP_004307871.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    222   5e-84   Fragaria vesca subsp. vesca
ref|XP_003537722.1|  PREDICTED: D-xylose-proton symporter-like 2-...    232   5e-84   Glycine max [soybeans]
gb|KHN05527.1|  D-xylose-proton symporter-like 2                        232   5e-84   Glycine soja [wild soybean]
ref|XP_010671130.1|  PREDICTED: D-xylose-proton symporter-like 2        217   6e-84   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003540611.1|  PREDICTED: D-xylose-proton symporter-like 2-...    233   9e-84   Glycine max [soybeans]
ref|XP_006590767.1|  PREDICTED: D-xylose-proton symporter-like 2-...    231   1e-83   
ref|XP_010933396.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    228   1e-83   Elaeis guineensis
ref|XP_008455658.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    224   2e-83   
ref|XP_003607412.1|  D-xylose-proton symporter-like protein             227   3e-83   Medicago truncatula
ref|XP_008455657.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    224   3e-83   Cucumis melo [Oriental melon]
gb|KDO39943.1|  hypothetical protein CISIN_1g0102391mg                  219   3e-83   Citrus sinensis [apfelsine]
ref|XP_010453878.1|  PREDICTED: D-xylose-proton symporter-like 2        229   7e-83   Camelina sativa [gold-of-pleasure]
gb|AFK39030.1|  unknown                                                 225   7e-83   Medicago truncatula
gb|KFK25925.1|  hypothetical protein AALP_AA8G181200                    229   1e-82   Arabis alpina [alpine rockcress]
ref|XP_010420407.1|  PREDICTED: D-xylose-proton symporter-like 2        228   2e-82   Camelina sativa [gold-of-pleasure]
ref|XP_008809219.1|  PREDICTED: LOW QUALITY PROTEIN: D-xylose-pro...    221   2e-82   
ref|XP_002873804.1|  sugar transporter family protein                   228   2e-82   Arabidopsis lyrata subsp. lyrata
ref|XP_006287575.1|  hypothetical protein CARUB_v10000784mg             230   2e-82   
ref|XP_004309072.1|  PREDICTED: D-xylose-proton symporter-like 2        218   9e-82   Fragaria vesca subsp. vesca
emb|CDX92030.1|  BnaC03g33320D                                          239   9e-82   
ref|NP_850835.2|  D-xylose-proton symporter-like 2                      229   2e-81   Arabidopsis thaliana [mouse-ear cress]
gb|KJB26763.1|  hypothetical protein B456_004G258400                    209   5e-81   Gossypium raimondii
ref|XP_010087486.1|  D-xylose-proton symporter-like 2                   213   5e-81   
ref|XP_004505609.1|  PREDICTED: D-xylose-proton symporter-like 2-...    222   7e-81   Cicer arietinum [garbanzo]
ref|XP_008644912.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    224   9e-81   Zea mays [maize]
ref|XP_008644913.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    224   1e-80   Zea mays [maize]
ref|XP_009119042.1|  PREDICTED: D-xylose-proton symporter-like 1        236   1e-80   Brassica rapa
ref|NP_001065505.1|  Os10g0579200                                       227   2e-80   
dbj|BAJ88105.1|  predicted protein                                      224   2e-80   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS55132.1|  D-xylose-proton symporter-like 2                        223   3e-80   Triticum urartu
emb|CDY49922.1|  BnaCnng18320D                                          234   4e-80   Brassica napus [oilseed rape]
ref|XP_006662109.1|  PREDICTED: D-xylose-proton symporter-like 2-...    224   4e-80   Oryza brachyantha
ref|NP_186959.2|  vacuolar glucose transporter 1                        233   4e-80   Arabidopsis thaliana [mouse-ear cress]
emb|CDY28736.1|  BnaCnng06220D                                          235   4e-80   Brassica napus [oilseed rape]
ref|XP_002464862.1|  hypothetical protein SORBIDRAFT_01g027800          223   4e-80   Sorghum bicolor [broomcorn]
emb|CDY43152.1|  BnaA05g32340D                                          236   5e-80   Brassica napus [oilseed rape]
gb|AAF26115.1|AC012328_18  hypothetical protein                         233   5e-80   Arabidopsis thaliana [mouse-ear cress]
emb|CAN72732.1|  hypothetical protein VITISV_037854                     203   6e-80   Vitis vinifera
ref|XP_010463755.1|  PREDICTED: D-xylose-proton symporter-like 1        231   9e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010489652.1|  PREDICTED: D-xylose-proton symporter-like 1        231   9e-80   Camelina sativa [gold-of-pleasure]
emb|CDX74227.1|  BnaA03g28200D                                          233   1e-79   
ref|XP_009134719.1|  PREDICTED: D-xylose-proton symporter-like 1        233   2e-79   Brassica rapa
ref|XP_009130331.1|  PREDICTED: D-xylose-proton symporter-like 1        234   3e-79   Brassica rapa
ref|XP_010506301.1|  PREDICTED: D-xylose-proton symporter-like 1        231   3e-79   Camelina sativa [gold-of-pleasure]
ref|XP_010920045.1|  PREDICTED: D-xylose-proton symporter-like 2        224   7e-79   Elaeis guineensis
ref|XP_008791055.1|  PREDICTED: D-xylose-proton symporter-like 2        226   2e-78   
ref|XP_006400240.1|  hypothetical protein EUTSA_v10013319mg             214   2e-78   Eutrema salsugineum [saltwater cress]
ref|XP_002884358.1|  sugar transporter family protein                   228   4e-78   
ref|XP_006854111.1|  PREDICTED: D-xylose-proton symporter-like 2        214   7e-78   Amborella trichopoda
ref|XP_003574402.1|  PREDICTED: D-xylose-proton symporter-like 2        217   1e-77   Brachypodium distachyon [annual false brome]
ref|XP_009126154.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    212   3e-77   Brassica rapa
ref|XP_009126155.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    213   3e-77   Brassica rapa
emb|CDX85478.1|  BnaA02g03350D                                          212   4e-77   
ref|XP_006408343.1|  hypothetical protein EUTSA_v10020565mg             223   4e-77   Eutrema salsugineum [saltwater cress]
gb|KFK37751.1|  hypothetical protein AALP_AA3G025300                    226   4e-77   Arabis alpina [alpine rockcress]
emb|CDY38076.1|  BnaC02g06970D                                          209   1e-76   Brassica napus [oilseed rape]
gb|EMT10196.1|  D-xylose-proton symporter-like protein 2                208   1e-75   
ref|XP_010063233.1|  PREDICTED: D-xylose-proton symporter-like 2        198   1e-75   Eucalyptus grandis [rose gum]
gb|ABK24923.1|  unknown                                                 204   4e-74   Picea sitchensis
ref|XP_002300123.2|  hypothetical protein POPTR_0001s25100g             203   3e-71   
ref|XP_010443656.1|  PREDICTED: D-xylose-proton symporter-like 3,...    204   9e-71   Camelina sativa [gold-of-pleasure]
ref|XP_006279761.1|  hypothetical protein CARUB_v10027739mg             206   9e-71   Capsella rubella
ref|NP_200733.2|  Major facilitator superfamily protein                 204   1e-70   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98379.1|  D-xylose-H+ symporter - like protein                   204   1e-70   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483521.1|  PREDICTED: D-xylose-proton symporter-like 3,...    204   1e-70   Camelina sativa [gold-of-pleasure]
ref|XP_006297488.1|  hypothetical protein CARUB_v10013506mg             201   2e-70   Capsella rubella
gb|KJB20000.1|  hypothetical protein B456_003G129000                    201   7e-70   Gossypium raimondii
gb|KJB20004.1|  hypothetical protein B456_003G129000                    200   8e-70   Gossypium raimondii
ref|XP_010043498.1|  PREDICTED: D-xylose-proton symporter-like 3,...    197   1e-69   Eucalyptus grandis [rose gum]
ref|XP_004983521.1|  PREDICTED: LOW QUALITY PROTEIN: D-xylose-pro...    194   1e-69   
emb|CDY54245.1|  BnaC09g53840D                                          205   1e-69   Brassica napus [oilseed rape]
ref|XP_011035266.1|  PREDICTED: D-xylose-proton symporter-like 3,...    198   1e-69   Populus euphratica
ref|XP_008777375.1|  PREDICTED: D-xylose-proton symporter-like 3,...    199   2e-69   Phoenix dactylifera
ref|XP_009120413.1|  PREDICTED: D-xylose-proton symporter-like 3,...    205   2e-69   Brassica rapa
emb|CDY33006.1|  BnaA10g12120D                                          205   2e-69   Brassica napus [oilseed rape]
ref|XP_011035268.1|  PREDICTED: D-xylose-proton symporter-like 3,...    198   2e-69   Populus euphratica
ref|XP_009779936.1|  PREDICTED: D-xylose-proton symporter-like 3,...    199   3e-69   Nicotiana sylvestris
ref|XP_010261641.1|  PREDICTED: D-xylose-proton symporter-like 2        235   5e-69   Nelumbo nucifera [Indian lotus]
ref|XP_007016336.1|  Major facilitator superfamily protein isoform 1    199   7e-69   
ref|XP_010256836.1|  PREDICTED: D-xylose-proton symporter-like 3,...    206   7e-69   Nelumbo nucifera [Indian lotus]
emb|CDX92028.1|  BnaC03g33300D                                          236   8e-69   
emb|CDP09100.1|  unnamed protein product                                197   1e-68   Coffea canephora [robusta coffee]
ref|XP_009605730.1|  PREDICTED: D-xylose-proton symporter-like 3,...    199   2e-68   Nicotiana tomentosiformis
gb|KHN32151.1|  D-xylose-proton symporter-like 3, chloroplastic         192   2e-68   Glycine soja [wild soybean]
ref|XP_003539594.1|  PREDICTED: D-xylose-proton symporter-like 3,...    192   2e-68   Glycine max [soybeans]
gb|ABB17074.1|  putative sugar transporter                              199   2e-68   Nicotiana langsdorffii x Nicotiana sanderae
gb|KHN21925.1|  D-xylose-proton symporter-like 3, chloroplastic         192   2e-68   Glycine soja [wild soybean]
ref|XP_008681531.1|  PREDICTED: uncharacterized protein LOC100274...    205   3e-68   
ref|XP_008681530.1|  PREDICTED: uncharacterized protein LOC100274...    205   3e-68   Zea mays [maize]
ref|XP_010907806.1|  PREDICTED: D-xylose-proton symporter-like 3,...    196   3e-68   Elaeis guineensis
ref|XP_009381068.1|  PREDICTED: D-xylose-proton symporter-like 3,...    198   6e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006846330.1|  PREDICTED: D-xylose-proton symporter-like 3,...    193   6e-68   Amborella trichopoda
ref|XP_012066968.1|  PREDICTED: D-xylose-proton symporter-like 3,...    199   1e-67   Jatropha curcas
ref|XP_006651969.1|  PREDICTED: D-xylose-proton symporter-like 3,...    202   1e-67   Oryza brachyantha
gb|EEC76432.1|  hypothetical protein OsI_14118                          203   3e-67   Oryza sativa Indica Group [Indian rice]
ref|XP_003537973.1|  PREDICTED: D-xylose-proton symporter-like 3,...    192   3e-67   Glycine max [soybeans]
gb|AAO18445.1|  putative sugar transporter protein                      203   3e-67   Oryza sativa Japonica Group [Japonica rice]
gb|ABF99614.1|  sugar transporter family protein, putative, expre...    202   3e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004981232.1|  PREDICTED: D-xylose-proton symporter-like 3,...    202   6e-67   Setaria italica
ref|XP_002520519.1|  sugar transporter, putative                        197   2e-66   
dbj|BAJ95036.1|  predicted protein                                      197   1e-65   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001173691.1|  Os03g0823200                                       203   2e-65   
ref|XP_010933397.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    167   3e-65   
ref|XP_004294661.1|  PREDICTED: D-xylose-proton symporter-like 3,...    187   5e-65   Fragaria vesca subsp. vesca
gb|KHG28803.1|  hypothetical protein F383_00413                         182   1e-64   Gossypium arboreum [tree cotton]
gb|EYU43459.1|  hypothetical protein MIMGU_mgv1a004913mg                225   2e-64   Erythranthe guttata [common monkey flower]
ref|XP_003563522.2|  PREDICTED: D-xylose-proton symporter-like 3,...    194   2e-64   Brachypodium distachyon [annual false brome]
ref|XP_006424897.1|  hypothetical protein CICLE_v10028127mg             182   8e-64   Citrus clementina [clementine]
ref|XP_006488378.1|  PREDICTED: D-xylose-proton symporter-like 3,...    182   1e-63   Citrus sinensis [apfelsine]
ref|XP_006488379.1|  PREDICTED: D-xylose-proton symporter-like 3,...    182   1e-63   
ref|XP_008349595.1|  PREDICTED: D-xylose-proton symporter-like 3,...    186   1e-63   
ref|XP_008384924.1|  PREDICTED: D-xylose-proton symporter-like 3,...    186   1e-63   
ref|XP_008222102.1|  PREDICTED: D-xylose-proton symporter-like 3,...    180   2e-63   Prunus mume [ume]
ref|XP_008222111.1|  PREDICTED: D-xylose-proton symporter-like 3,...    181   2e-63   Prunus mume [ume]
ref|XP_007207311.1|  hypothetical protein PRUPE_ppa003611mg             180   2e-63   Prunus persica
gb|AFW67123.1|  hypothetical protein ZEAMMB73_874760                    206   3e-63   
ref|XP_009375941.1|  PREDICTED: D-xylose-proton symporter-like 3,...    185   3e-63   Pyrus x bretschneideri [bai li]
ref|NP_001190323.1|  D-xylose-proton symporter-like 2                   169   4e-63   
ref|XP_008457451.1|  PREDICTED: D-xylose-proton symporter-like 3,...    182   6e-63   Cucumis melo [Oriental melon]
ref|XP_011075803.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    220   1e-62   Sesamum indicum [beniseed]
ref|XP_002280634.1|  PREDICTED: D-xylose-proton symporter-like 3,...    180   1e-62   Vitis vinifera
emb|CBI16087.3|  unnamed protein product                                180   2e-62   Vitis vinifera
ref|XP_002982112.1|  hypothetical protein SELMODRAFT_115745             184   2e-62   
ref|XP_011075802.1|  PREDICTED: D-xylose-proton symporter-like 2 ...    220   2e-62   
ref|XP_002992213.1|  hypothetical protein SELMODRAFT_134982             182   7e-62   
ref|XP_004153144.1|  PREDICTED: D-xylose-proton symporter-like 3,...    180   1e-61   Cucumis sativus [cucumbers]
gb|EPS59382.1|  hypothetical protein M569_15426                         181   2e-61   Genlisea aurea
ref|XP_001773171.1|  predicted protein                                  174   9e-60   
ref|XP_002463619.1|  hypothetical protein SORBIDRAFT_01g003010          205   2e-59   
ref|XP_001760396.1|  predicted protein                                  171   4e-59   
ref|XP_002991559.1|  hypothetical protein SELMODRAFT_133784             171   3e-58   
emb|CAN83894.1|  hypothetical protein VITISV_039113                     165   4e-58   Vitis vinifera
ref|XP_006443190.1|  hypothetical protein CICLE_v10019791mg             126   1e-57   
dbj|BAH19966.1|  AT5G59250                                              204   1e-57   Arabidopsis thaliana [mouse-ear cress]
gb|KDO39945.1|  hypothetical protein CISIN_1g0102391mg                  125   3e-57   Citrus sinensis [apfelsine]
ref|XP_010685696.1|  PREDICTED: D-xylose-proton symporter-like 3,...    207   3e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010454633.1|  PREDICTED: D-xylose-proton symporter-like 3,...    205   1e-56   Camelina sativa [gold-of-pleasure]
gb|EEE60202.1|  hypothetical protein OsJ_13164                          203   2e-56   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002866311.1|  hypothetical protein ARALYDRAFT_919128             204   2e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_010106537.1|  D-xylose-proton symporter-like 3                   202   4e-56   
ref|XP_006401006.1|  hypothetical protein EUTSA_v10013139mg             204   4e-56   Eutrema salsugineum [saltwater cress]
ref|XP_010535452.1|  PREDICTED: D-xylose-proton symporter-like 3,...    203   9e-56   Tarenaya hassleriana [spider flower]
ref|XP_006424895.1|  hypothetical protein CICLE_v10028127mg             155   2e-55   
ref|NP_001287653.1|  D-xylose-proton symporter-like 3, chloroplas...    201   4e-55   Solanum lycopersicum
ref|XP_006342314.1|  PREDICTED: D-xylose-proton symporter-like 3,...    200   6e-55   Solanum tuberosum [potatoes]
ref|XP_007132040.1|  hypothetical protein PHAVU_011G061800g             193   4e-52   Phaseolus vulgaris [French bean]
gb|AFK37407.1|  unknown                                                 192   6e-52   Lotus japonicus
ref|XP_011089518.1|  PREDICTED: D-xylose-proton symporter-like 3,...    191   3e-51   Sesamum indicum [beniseed]
gb|EYU45952.1|  hypothetical protein MIMGU_mgv1a003885mg                188   2e-50   Erythranthe guttata [common monkey flower]
ref|XP_010535453.1|  PREDICTED: D-xylose-proton symporter-like 3,...    184   4e-49   Tarenaya hassleriana [spider flower]
ref|XP_006424896.1|  hypothetical protein CICLE_v10028127mg             182   4e-49   
gb|KDO66622.1|  hypothetical protein CISIN_1g008624mg                   182   5e-49   Citrus sinensis [apfelsine]
gb|KDO66620.1|  hypothetical protein CISIN_1g008624mg                   182   8e-49   Citrus sinensis [apfelsine]
gb|KDO66618.1|  hypothetical protein CISIN_1g008624mg                   182   5e-48   Citrus sinensis [apfelsine]
gb|KDO66619.1|  hypothetical protein CISIN_1g008624mg                   181   6e-48   Citrus sinensis [apfelsine]
ref|XP_010492634.1|  PREDICTED: D-xylose-proton symporter-like 2        162   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_007016337.1|  Major facilitator superfamily protein isoform 2    171   2e-44   
ref|NP_197203.1|  D-xylose-proton symporter-like 2                      105   5e-44   Arabidopsis thaliana [mouse-ear cress]
gb|KJB26762.1|  hypothetical protein B456_004G258400                    121   2e-43   Gossypium raimondii
gb|EPS60345.1|  hypothetical protein M569_14457                         156   2e-42   Genlisea aurea
ref|XP_002325479.2|  hypothetical protein POPTR_0019s08330g             118   6e-42   
ref|NP_001141928.1|  uncharacterized protein LOC100274077               151   2e-40   
gb|KDO39947.1|  hypothetical protein CISIN_1g0102391mg                  125   5e-40   Citrus sinensis [apfelsine]
gb|KDO39946.1|  hypothetical protein CISIN_1g0102391mg                  125   9e-39   Citrus sinensis [apfelsine]
gb|KJB20003.1|  hypothetical protein B456_003G129000                  95.5    3e-38   Gossypium raimondii
gb|KDO66623.1|  hypothetical protein CISIN_1g008624mg                   154   5e-38   Citrus sinensis [apfelsine]
ref|XP_009779937.1|  PREDICTED: D-xylose-proton symporter-like 3,...  95.1    9e-38   Nicotiana sylvestris
ref|XP_005645204.1|  hypothetical protein COCSUDRAFT_67173              122   4e-34   Coccomyxa subellipsoidea C-169
ref|XP_005845570.1|  hypothetical protein CHLNCDRAFT_25635              141   8e-34   Chlorella variabilis
gb|EPS57619.1|  hypothetical protein M569_17198                         101   2e-33   Genlisea aurea
ref|XP_011400947.1|  D-xylose-proton symporter-like 3, chloroplastic    131   2e-31   Auxenochlorella protothecoides
gb|KJB20002.1|  hypothetical protein B456_003G129000                  92.0    3e-28   Gossypium raimondii
gb|EMT28553.1|  D-xylose-proton symporter-like protein 3              85.5    6e-28   
ref|XP_007016338.1|  Major facilitator superfamily protein isoform 3  90.5    4e-27   
ref|XP_001416926.1|  MFS family transporter: sugar (galactose/glu...    110   2e-26   Ostreococcus lucimarinus CCE9901
ref|WP_013644894.1|  major facilitator transporter                      103   2e-25   Methanobacterium lacus
ref|XP_007016339.1|  Major facilitator superfamily protein isoform 4  90.9    9e-25   
ref|XP_003062688.1|  major facilitator superfamily                      111   1e-23   Micromonas pusilla CCMP1545
ref|XP_007510995.1|  predicted protein                                  100   8e-23   Bathycoccus prasinos
gb|EKD53804.1|  hypothetical protein ACD_60C00149G0003                94.0    1e-22   uncultured bacterium
ref|XP_005831465.1|  hypothetical protein GUITHDRAFT_109605             107   1e-22   Guillardia theta CCMP2712
ref|XP_005708849.1|  MFS transporter, SP family, sugar:H+ symporter     108   2e-22   Galdieria sulphuraria
gb|KIZ01781.1|  hypothetical protein MNEG_6180                          107   5e-22   Monoraphidium neglectum
emb|CEF97100.1|  NADH dehydrogenase [ubiquinone] 1 alpha subcompl...    106   6e-22   Ostreococcus tauri
gb|EWM26836.1|  d-xylose-proton symporter-like protein                  102   2e-20   Nannochloropsis gaditana
gb|KEH30181.1|  monosaccharide-H+ symporter                           91.3    3e-19   Medicago truncatula
gb|KDD76485.1|  sugar transporter                                     98.2    6e-19   Helicosporidium sp. ATCC 50920
ref|WP_022247679.1|  sugar transporter                                96.3    1e-18   
emb|CBJ33077.1|  conserved unknown protein                            95.9    3e-18   Ectocarpus siliculosus
ref|XP_009605737.1|  PREDICTED: D-xylose-proton symporter-like 3,...  94.7    6e-18   Nicotiana tomentosiformis
ref|WP_007424295.1|  MULTISPECIES: major facilitator transporter      83.2    1e-17   Acidiphilium
ref|WP_035187416.1|  major facilitator transporter                    83.2    1e-17   Acidiphilium sp. JA12-A1
gb|AES88921.2|  sugar transporter                                     93.6    2e-17   Medicago truncatula
ref|XP_003606724.1|  D-xylose-proton symporter-like protein           93.2    2e-17   
ref|WP_032724722.1|  MFS sugar transporter                            81.6    3e-17   Raoultella ornithinolytica
ref|WP_032717438.1|  MFS sugar transporter                            81.3    4e-17   Raoultella ornithinolytica
ref|WP_006110627.1|  sugar transporter                                80.9    5e-17   Natrialba asiatica
ref|WP_022187653.1|  sugar transporter                                92.0    5e-17   
gb|KIZ46811.1|  MFS sugar transporter                                 81.3    6e-17   Raoultella ornithinolytica
ref|WP_044346672.1|  MFS sugar transporter                            81.3    6e-17   
ref|WP_005772424.1|  major facilitator transporter                    86.3    6e-17   Coxiella burnetii
ref|WP_011997243.1|  major facilitator transporter                    86.3    7e-17   Coxiella burnetii
ref|WP_032138490.1|  major facilitator transporter                    86.3    7e-17   Coxiella burnetii
gb|ACJ18943.1|  D-xylose-proton symporter                             86.3    7e-17   Coxiella burnetii CbuG_Q212
ref|WP_005769170.1|  major facilitator transporter                    85.9    8e-17   Coxiella burnetii
ref|WP_004861850.1|  sugar porter (SP) family MFS transporter         80.5    9e-17   Raoultella ornithinolytica
gb|ACJ19821.1|  D-xylose-proton symporter                             85.9    9e-17   Coxiella burnetii CbuK_Q154
ref|XP_009036253.1|  general sugar transporter                        91.3    1e-16   Aureococcus anophagefferens
ref|WP_034935483.1|  hypothetical protein                             82.8    1e-16   Erwinia mallotivora
ref|WP_025318950.1|  major facilitator transporter                    90.9    1e-16   Granulibacter bethesdensis
ref|WP_006826745.1|  sugar transporter                                80.5    1e-16   Natrialba taiwanensis
gb|KDO66624.1|  hypothetical protein CISIN_1g008624mg                 90.9    1e-16   Citrus sinensis [apfelsine]
ref|WP_015842962.1|  MFS transporter                                  80.1    2e-16   Paenibacillus sp. JDR-2
ref|WP_015584353.1|  sugar transporter                                81.3    2e-16   Raoultella ornithinolytica
ref|XP_005783754.1|  hypothetical protein EMIHUDRAFT_232111           90.5    2e-16   Emiliania huxleyi CCMP1516
ref|WP_006665058.1|  sugar transporter                                78.6    3e-16   Natrialba aegyptia
ref|WP_011631971.1|  major facilitator transporter                    89.4    3e-16   Granulibacter bethesdensis
ref|WP_020694258.1|  hypothetical protein                             76.3    3e-16   Reyranella massiliensis
ref|WP_025286678.1|  major facilitator transporter                    89.4    4e-16   Granulibacter bethesdensis
ref|WP_025320564.1|  major facilitator transporter                    89.4    4e-16   Granulibacter bethesdensis
ref|WP_022196350.1|  putative metabolite transport protein ywtG       89.4    4e-16   
ref|WP_010638886.1|  major facilitator transporter                    88.6    5e-16   
ref|XP_002179486.1|  TRD4                                             88.6    7e-16   Phaeodactylum tricornutum CCAP 1055/1
ref|WP_024895141.1|  major facilitator transporter                    88.6    7e-16   Acidithiobacillus
ref|WP_036719265.1|  MFS transporter                                  88.2    9e-16   
ref|WP_029311639.1|  major facilitator transporter                    88.2    9e-16   Acidiphilium
ref|WP_037344745.1|  major facilitator transporter                    85.5    1e-15   
ref|WP_018699802.1|  hypothetical protein                             84.0    1e-15   Amorphus coralli
ref|WP_022006956.1|  d-xylose-proton symporter                        87.8    1e-15   
ref|WP_033395728.1|  MFS transporter                                  78.2    2e-15   
ref|WP_007429069.1|  MFS transporter                                  87.0    3e-15   Paenibacillus sp. Aloe-11
ref|WP_022021988.1|  sugar transporter                                86.7    3e-15   
ref|WP_026964639.1|  MFS transporter                                  74.3    4e-15   Alicyclobacillus pomorum
ref|WP_025722405.1|  MFS transporter                                  86.3    4e-15   Paenibacillus polymyxa
ref|WP_016821403.1|  MULTISPECIES: MFS transporter                    86.3    4e-15   Paenibacillus
ref|WP_023987284.1|  MFS transporter                                  86.3    4e-15   Paenibacillus
ref|WP_044786399.1|  MFS transporter                                  86.3    5e-15   Paenibacillus
ref|WP_028543212.1|  MFS transporter                                  86.3    5e-15   Paenibacillus
ref|WP_019686308.1|  MFS transporter                                  86.3    5e-15   Paenibacillus polymyxa
ref|WP_022486233.1|  sugar transporter                                85.9    5e-15   
ref|WP_013369675.1|  MFS transporter                                  85.9    5e-15   Paenibacillus
ref|WP_025675784.1|  MFS transporter                                  85.9    5e-15   Paenibacillus
ref|WP_029516079.1|  MFS transporter                                  85.9    5e-15   Paenibacillus polymyxa
ref|WP_024816367.1|  major facilitator transporter                    85.9    6e-15   Methylopila sp. 73B
ref|WP_014280112.1|  MFS transporter                                  85.9    6e-15   Paenibacillus terrae
ref|WP_013879135.1|  major facilitator transporter                    76.6    6e-15   Halopiger xanaduensis
emb|CAD58709.1|  polyol transporter                                   64.7    8e-15   Plantago major [cart-track plant]
ref|WP_022491563.1|  metabolite transport protein                     84.0    1e-14   
ref|WP_006872344.1|  sugar:proton symporter                           67.8    1e-14   
ref|WP_036621919.1|  MFS transporter                                  85.1    1e-14   
ref|XP_010495236.1|  PREDICTED: D-xylose-proton symporter-like 2      82.8    1e-14   
ref|WP_013309023.1|  MFS transporter                                  85.1    1e-14   
ref|WP_018661922.1|  major facilitator transporter                    84.7    1e-14   
ref|WP_012537116.1|  major facilitator transporter                    84.7    1e-14   
ref|XP_011704098.1|  PREDICTED: facilitated trehalose transporter...  84.7    2e-14   
ref|WP_035155729.1|  MFS transporter                                  73.9    2e-14   
ref|XP_001744797.1|  hypothetical protein                             84.3    2e-14   
ref|WP_020429182.1|  hypothetical protein                             81.6    2e-14   
ref|WP_017577029.1|  hypothetical protein                             84.3    2e-14   
ref|XP_011334604.1|  PREDICTED: facilitated trehalose transporter...  84.0    2e-14   
ref|WP_020089467.1|  major facilitator transporter                    84.3    2e-14   
ref|WP_017611217.1|  hypothetical protein                             84.3    2e-14   
gb|EGI63390.1|  Sugar transporter ERD6-like 6                         84.7    2e-14   
ref|XP_011057654.1|  PREDICTED: facilitated trehalose transporter...  84.7    2e-14   
ref|WP_017261050.1|  major facilitator transporter                    84.3    2e-14   
ref|XP_011704096.1|  PREDICTED: facilitated trehalose transporter...  84.3    3e-14   
ref|WP_041339107.1|  major facilitator transporter                    84.0    3e-14   
ref|XP_011057655.1|  PREDICTED: facilitated trehalose transporter...  84.3    3e-14   
gb|KFI68426.1|  MFS, D-xylose:H+ symporter                            84.0    3e-14   
gb|EFN70680.1|  Sugar transporter ERD6-like 6                         84.0    3e-14   
ref|WP_033510598.1|  hypothetical protein                             84.0    3e-14   
ref|XP_011704097.1|  PREDICTED: facilitated trehalose transporter...  84.0    3e-14   
ref|WP_036593689.1|  sugar transporter                                80.1    3e-14   
emb|CDO97075.1|  unnamed protein product                              66.2    4e-14   
gb|ABK29439.1|  sugar transport protein                               66.2    4e-14   
ref|WP_026439736.1|  major facilitator transporter                    83.6    4e-14   
ref|XP_004992344.1|  hypothetical protein PTSG_06943                  83.6    4e-14   
ref|XP_012060269.1|  PREDICTED: facilitated trehalose transporter...  83.6    4e-14   
ref|XP_009611551.1|  PREDICTED: polyol transporter 5-like             72.0    4e-14   
ref|WP_036581666.1|  MFS transporter                                  83.2    5e-14   
ref|WP_021780471.1|  arabinose-proton symporter                       83.2    5e-14   
ref|WP_034640102.1|  major facilitator transporter                    83.2    5e-14   
ref|WP_034711981.1|  major facilitator transporter                    83.2    5e-14   
emb|CDL26356.1|  D-xylose proton-symporter XylE                       73.2    5e-14   
ref|WP_019395380.1|  MULTISPECIES: hypothetical protein               72.4    6e-14   
ref|WP_043236249.1|  sugar transporter                                82.8    6e-14   
gb|EHJ74643.1|  facilitated trehalose transporter Tret1               82.8    7e-14   
ref|WP_008494377.1|  major facilitator transporter                    82.8    7e-14   
ref|XP_012151514.1|  PREDICTED: facilitated trehalose transporter...  82.4    8e-14   
ref|WP_003551797.1|  major facilitator transporter                    82.4    8e-14   
ref|WP_013942808.1|  putative metabolite transport protein ywtG       82.4    9e-14   
gb|EGW78839.1|  arabinose-proton symporter                            72.4    9e-14   
ref|WP_045672444.1|  MFS transporter                                  82.4    1e-13   
ref|WP_004869267.1|  major facilitator transporter                    82.4    1e-13   
gb|EGW79604.1|  arabinose-proton symporter                            72.4    1e-13   
ref|WP_018754345.1|  MFS transporter                                  82.4    1e-13   
ref|WP_024747157.1|  major facilitator transporter                    82.0    1e-13   
gb|EOA08513.1|  MFS transporter, sugar porter (SP) family             80.5    1e-13   
ref|WP_027222610.1|  sugar:proton symporter                           67.0    1e-13   
ref|XP_001959932.1|  GF13115                                          82.0    1e-13   
ref|WP_001467755.1|  MFS transporter, sugar porter family protein     71.2    1e-13   
ref|XP_011642419.1|  PREDICTED: facilitated trehalose transporter...  82.4    1e-13   
ref|WP_032268539.1|  D-xylose transporter XylE                        72.4    1e-13   
ref|WP_001097286.1|  D-xylose transporter                             72.4    1e-13   
gb|KGT18006.1|  D-xylose transporter XylE                             72.4    1e-13   
gb|EZA57001.1|  Facilitated trehalose transporter Tret1               82.4    1e-13   
ref|XP_011334214.1|  PREDICTED: facilitated trehalose transporter...  82.0    1e-13   
ref|WP_039059949.1|  D-xylose transporter XylE                        72.0    1e-13   
ref|WP_001097278.1|  D-xylose transporter                             72.0    1e-13   
ref|WP_035166342.1|  major facilitator transporter                    82.0    1e-13   
ref|WP_003557282.1|  MULTISPECIES: major facilitator transporter      82.0    1e-13   
ref|WP_001508179.1|  MFS transporter, sugar porter family protein     72.0    1e-13   
ref|XP_005730654.1|  PREDICTED: solute carrier family 2, facilita...  82.0    1e-13   
ref|WP_021863576.1|  sugar transporter                                82.0    1e-13   
ref|WP_001472706.1|  MFS transporter, sugar porter family protein     72.0    1e-13   
gb|EJL11115.1|  MFS transporter, sugar porter family protein          72.0    1e-13   
ref|WP_001097267.1|  D-xylose transporter                             72.0    1e-13   
ref|XP_011252868.1|  PREDICTED: facilitated trehalose transporter...  82.0    1e-13   
gb|KGT10376.1|  D-xylose transporter XylE                             72.0    1e-13   
ref|WP_024233906.1|  D-xylose transporter XylE                        72.0    1e-13   
ref|WP_026962475.1|  MFS transporter                                  81.6    1e-13   
ref|XP_005938721.1|  PREDICTED: solute carrier family 2, facilita...  81.6    1e-13   
ref|WP_001097259.1|  D-xylose transporter                             72.0    1e-13   
ref|XP_011642411.1|  PREDICTED: facilitated trehalose transporter...  82.0    1e-13   
ref|XP_004555795.1|  PREDICTED: solute carrier family 2, facilita...  81.6    1e-13   
ref|WP_001715885.1|  MFS transporter, sugar porter family protein     72.0    1e-13   
ref|WP_032345145.1|  D-xylose transporter XylE                        72.0    2e-13   
ref|WP_014106469.1|  D-galactose transporter                          73.6    2e-13   
ref|WP_001474831.1|  MFS transporter, sugar porter family protein     72.0    2e-13   
ref|WP_031572590.1|  major facilitator transporter                    81.6    2e-13   
ref|XP_001600172.1|  PREDICTED: facilitated trehalose transporter...  81.6    2e-13   
ref|XP_011334212.1|  PREDICTED: facilitated trehalose transporter...  82.0    2e-13   
ref|WP_024893136.1|  major facilitator transporter                    81.6    2e-13   
gb|EGW84708.1|  arabinose-proton symporter                            71.6    2e-13   
ref|WP_032359687.1|  D-xylose transporter XylE                        71.6    2e-13   
ref|WP_035714084.1|  sugar transporter                                75.1    2e-13   
ref|XP_011334213.1|  PREDICTED: facilitated trehalose transporter...  82.0    2e-13   
gb|EFZ19814.1|  hypothetical protein SINV_07234                       81.6    2e-13   
ref|WP_001097260.1|  D-xylose transporter                             71.6    2e-13   
ref|WP_001097261.1|  D-xylose transporter                             71.6    2e-13   
ref|WP_010641003.1|  major facilitator transporter                    81.3    2e-13   
ref|WP_040072992.1|  D-xylose transporter XylE                        71.6    2e-13   
ref|WP_035891457.1|  sugar:proton symporter                           67.0    2e-13   
ref|WP_044060402.1|  D-xylose transporter XylE                        71.6    2e-13   
ref|WP_038346854.1|  D-xylose transporter XylE                        71.6    2e-13   
ref|WP_032264295.1|  D-xylose transporter XylE                        71.2    2e-13   
gb|EDV89358.1|  D-xylose-proton symporter                             71.2    2e-13   
ref|WP_001497957.1|  MFS transporter, sugar porter family protein     71.2    2e-13   
ref|WP_001097253.1|  D-xylose transporter                             71.2    2e-13   
ref|WP_001097292.1|  D-xylose transporter                             71.2    2e-13   
ref|WP_001097254.1|  D-xylose transporter                             71.2    2e-13   
gb|AAX92638.1|  glucose transporter 8                                 81.3    2e-13   
ref|WP_024246563.1|  D-xylose transporter XylE                        71.2    2e-13   
ref|WP_001697341.1|  MFS transporter, sugar porter family protein     71.2    2e-13   
ref|WP_001097263.1|  MULTISPECIES: D-xylose transporter               71.2    2e-13   
ref|WP_016244117.1|  D-xylose-proton symporter                        71.2    2e-13   
ref|WP_001465786.1|  MFS transporter, sugar porter family protein     71.2    2e-13   
ref|WP_001612164.1|  D-xylose-proton symporter                        71.2    2e-13   
ref|WP_014866604.1|  major facilitator transporter                    81.3    2e-13   
ref|XP_011861733.1|  PREDICTED: facilitated trehalose transporter...  81.3    2e-13   
ref|WP_039838550.1|  MFS transporter                                  81.3    2e-13   
ref|WP_013924234.1|  major facilitator transporter                    80.9    2e-13   
ref|WP_001097262.1|  D-xylose transporter                             71.2    2e-13   
ref|XP_012151513.1|  PREDICTED: facilitated trehalose transporter...  81.3    3e-13   
ref|WP_024225945.1|  D-xylose transporter XylE                        71.2    3e-13   
ref|WP_001546182.1|  MFS transporter, sugar porter family protein     70.9    3e-13   
ref|WP_001478563.1|  MFS transporter, sugar porter family protein     70.9    3e-13   
gb|KKB74436.1|  major facilitator transporter                         65.9    3e-13   
ref|XP_012151512.1|  PREDICTED: facilitated trehalose transporter...  81.3    3e-13   
ref|WP_009951262.1|  major facilitator transporter                    80.9    3e-13   
gb|AHG00573.1|  major facilitator transporter                         80.9    3e-13   
ref|WP_032202205.1|  D-xylose transporter XylE                        70.9    3e-13   
ref|WP_028551479.1|  MFS transporter                                  80.9    3e-13   
ref|WP_010347529.1|  MFS transporter                                  80.9    3e-13   
ref|WP_032257027.1|  D-xylose transporter XylE                        70.9    3e-13   
ref|XP_011152468.1|  PREDICTED: facilitated trehalose transporter...  80.9    4e-13   
gb|ABS66075.1|  sugar transporter                                     80.5    4e-13   
gb|EFB42172.1|  hypothetical protein pah_c014o100                     80.5    4e-13   
ref|WP_040090505.1|  D-xylose transporter XylE                        70.5    4e-13   
ref|WP_035486767.1|  hypothetical protein                             67.0    4e-13   
ref|WP_036634707.1|  MFS transporter                                  80.5    4e-13   
ref|XP_011152467.1|  PREDICTED: facilitated trehalose transporter...  80.9    4e-13   
ref|WP_001489183.1|  MFS transporter, sugar porter family protein     70.5    4e-13   
ref|WP_006053328.1|  major facilitator transporter                    80.5    4e-13   
ref|WP_044159562.1|  major facilitator transporter                    62.8    4e-13   
ref|WP_001097264.1|  D-xylose transporter                             70.5    4e-13   
gb|KDE57191.1|  major facilitator transporter                         80.5    4e-13   
ref|WP_001097277.1|  D-xylose transporter                             70.5    4e-13   
ref|WP_028555263.1|  MFS transporter                                  80.5    4e-13   
ref|WP_041576361.1|  sugar transporter                                80.5    4e-13   
ref|WP_032206045.1|  D-xylose transporter XylE                        70.5    4e-13   
ref|WP_036745963.1|  major facilitator transporter                    80.1    4e-13   
ref|WP_001494612.1|  MFS transporter, sugar porter family protein     70.5    4e-13   
ref|WP_001097271.1|  D-xylose-proton symporter                        72.4    5e-13   
ref|WP_001388756.1|  MFS transporter, sugar porter family protein     72.0    5e-13   
ref|WP_007980793.1|  major facilitator transporter                    80.1    5e-13   
ref|WP_008841561.1|  sugar transporter                                80.1    5e-13   
gb|ESE05157.1|  MFS transporter, SP family                            72.0    5e-13   
ref|XP_011861732.1|  PREDICTED: facilitated trehalose transporter...  80.5    5e-13   
ref|WP_022743508.1|  D-xylose-proton symporter XylT                   80.1    5e-13   
ref|WP_001097266.1|  D-xylose transporter                             70.1    5e-13   
ref|WP_029557156.1|  sugar transporter                                77.0    5e-13   
ref|WP_014096118.1|  major facilitator transporter                    80.1    5e-13   
ref|WP_026974727.1|  MFS transporter                                  68.2    5e-13   
ref|WP_001395158.1|  MFS transporter, sugar porter family protein     72.0    5e-13   
ref|XP_003444557.1|  PREDICTED: solute carrier family 2, facilita...  80.1    5e-13   
ref|WP_026684983.1|  major facilitator transporter                    80.1    5e-13   
ref|WP_002832561.1|  major facilitator transporter                    80.1    6e-13   
ref|WP_002829469.1|  major facilitator transporter                    80.1    6e-13   
ref|WP_032233957.1|  D-xylose transporter XylE                        72.0    6e-13   
ref|WP_044351036.1|  hypothetical protein                             80.1    6e-13   
ref|XP_011156939.1|  PREDICTED: facilitated trehalose transporter...  80.1    6e-13   
ref|WP_001709463.1|  MFS transporter, sugar porter family protein     72.0    6e-13   
ref|WP_004166330.1|  major facilitator transporter                    79.7    6e-13   
ref|WP_027224240.1|  sugar:proton symporter                           65.9    6e-13   
ref|WP_023163452.1|  sugar transporter                                79.7    6e-13   
ref|WP_033866545.1|  D-xylose transporter XylE                        69.7    6e-13   
gb|KKB72910.1|  major facilitator transporter                         67.0    6e-13   
ref|WP_013238482.1|  major facilitator transporter                    79.7    7e-13   
ref|WP_024176397.1|  D-xylose transporter XylE                        71.6    7e-13   
ref|WP_043707797.1|  major facilitator transporter                    79.7    7e-13   
ref|WP_001097257.1|  D-xylose-proton symporter                        71.6    7e-13   
ref|WP_042046693.1|  D-xylose transporter XylE                        71.6    7e-13   
ref|WP_044724522.1|  D-xylose transporter XylE                        72.0    7e-13   
ref|WP_001339148.1|  D-xylose transporter                             71.6    7e-13   
ref|WP_024256320.1|  D-xylose transporter XylE                        71.6    7e-13   
gb|KDT64056.1|  MFS transporter, sugar porter family protein          71.6    7e-13   
ref|WP_011214682.1|  sugar:proton symporter                           65.1    7e-13   
ref|WP_010374961.1|  major facilitator transporter                    79.7    7e-13   
ref|WP_042346593.1|  D-xylose transporter XylE                        71.6    7e-13   
ref|WP_027264806.1|  sugar:proton symporter                           65.1    7e-13   
ref|WP_006639311.1|  sugar transporter YwtG                           62.8    7e-13   
ref|WP_032181547.1|  D-xylose transporter XylE                        71.6    7e-13   
ref|WP_038700702.1|  MFS transporter                                  79.7    7e-13   
ref|WP_001097265.1|  D-xylose transporter                             69.7    7e-13   
ref|WP_001422709.1|  MFS transporter, sugar porter family protein     69.7    7e-13   
ref|WP_000445063.1|  D-xylose transporter                             71.6    7e-13   
ref|WP_001097268.1|  D-xylose transporter                             71.2    7e-13   
ref|WP_032259642.1|  D-xylose transporter XylE                        71.6    7e-13   
ref|WP_001401433.1|  MFS transporter, sugar porter family protein     71.6    8e-13   
gb|KFI00677.1|  D-xylose transporter XylE                             71.6    8e-13   
ref|WP_044068929.1|  D-xylose transporter XylE                        71.6    8e-13   
ref|WP_001529541.1|  D-xylose-proton symporter                        71.6    8e-13   
ref|WP_032319157.1|  D-xylose-proton symporter                        71.6    8e-13   
ref|WP_001097287.1|  D-xylose transporter                             71.2    8e-13   
ref|WP_014841005.1|  sugar:proton symporter                           65.1    8e-13   
ref|WP_032279264.1|  D-xylose-proton symporter                        71.6    8e-13   
ref|WP_001097250.1|  D-xylose transporter                             71.6    8e-13   
ref|WP_001097289.1|  MULTISPECIES: D-xylose transporter               71.6    8e-13   
ref|WP_001636937.1|  MFS transporter, sugar porter family protein     71.6    8e-13   
ref|WP_024230813.1|  D-xylose transporter XylE                        71.6    8e-13   
ref|XP_008214124.1|  PREDICTED: facilitated trehalose transporter...  79.7    8e-13   
ref|WP_023281605.1|  D-xylose-proton symporter                        71.2    8e-13   
ref|WP_001097281.1|  D-xylose-proton symporter                        71.2    8e-13   
ref|WP_027219158.1|  sugar:proton symporter                           65.1    8e-13   
emb|CAR82417.1|  polyol transporter                                   60.5    8e-13   
ref|WP_016246782.1|  D-xylose-proton symporter                        71.6    8e-13   
gb|KGM76771.1|  D-xylose transporter                                  71.2    8e-13   
ref|WP_001097274.1|  MULTISPECIES: D-xylose-proton symporter          71.2    8e-13   
ref|WP_045177421.1|  D-xylose transporter XylE                        71.6    8e-13   
ref|WP_045806285.1|  major facilitator transporter                    79.3    8e-13   
ref|WP_000107422.1|  D-xylose transporter                             71.6    8e-13   
ref|WP_019390826.1|  major facilitator transporter                    65.1    8e-13   
ref|WP_024123064.1|  major facilitator transporter                    63.2    8e-13   
ref|WP_000107423.1|  D-xylose transporter                             71.2    8e-13   
ref|WP_001097293.1|  D-xylose transporter                             71.2    8e-13   
ref|WP_045806284.1|  major facilitator transporter                    79.3    8e-13   
emb|CDK71018.1|  D-xylose proton-symporter XylE                       71.2    8e-13   
ref|WP_021547240.1|  D-xylose-proton symporter                        71.2    8e-13   



>ref|XP_009777280.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Nicotiana 
sylvestris]
Length=555

 Score =   251 bits (640),  Expect(2) = 6e-97, Method: Compositional matrix adjust.
 Identities = 202/229 (88%), Positives = 218/229 (95%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVD+ILSELS LSEEKEATIGEM QGKCLKALTIGAGLILFQQITGQPSVLYYAAKIFQD
Sbjct  327  QVDDILSELSQLSEEKEATIGEMLQGKCLKALTIGAGLILFQQITGQPSVLYYAAKIFQD  386

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+AAADATRAS+FL LLKLIMTGVAVVVVD+LGRRPLLLGGVSGIA++LFLLGSYYT+
Sbjct  387  AGFSAAADATRASVFLALLKLIMTGVAVVVVDKLGRRPLLLGGVSGIAISLFLLGSYYTY  446

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            L NVP VAV ALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSI+VLVNFG NALV F
Sbjct  447  LGNVPAVAVTALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSISVLVNFGANALVAF  506

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP++ L+GAG VFFIFG IAV++++F+FFIIPETKGLTLEEIEAKYL
Sbjct  507  AFSPLQVLLGAGTVFFIFGGIAVLSLLFIFFIIPETKGLTLEEIEAKYL  555


 Score =   132 bits (333),  Expect(2) = 6e-97, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGSL+VE VAGWRYMYGVS P++++MGIGMWWLP+SPRWILLCAIQGKG++ GLRE A+ 
Sbjct  251   VGSLLVETVAGWRYMYGVSAPLAVIMGIGMWWLPSSPRWILLCAIQGKGELQGLREKAIC  310

Query  948   CLCRLRGATIGDSA  907
             CLC+LRGA IGDSA
Sbjct  311   CLCQLRGAAIGDSA  324



>ref|XP_009777281.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Nicotiana 
sylvestris]
Length=508

 Score =   250 bits (639),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 202/229 (88%), Positives = 218/229 (95%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVD+ILSELS LSEEKEATIGEM QGKCLKALTIGAGLILFQQITGQPSVLYYAAKIFQD
Sbjct  280  QVDDILSELSQLSEEKEATIGEMLQGKCLKALTIGAGLILFQQITGQPSVLYYAAKIFQD  339

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+AAADATRAS+FL LLKLIMTGVAVVVVD+LGRRPLLLGGVSGIA++LFLLGSYYT+
Sbjct  340  AGFSAAADATRASVFLALLKLIMTGVAVVVVDKLGRRPLLLGGVSGIAISLFLLGSYYTY  399

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            L NVP VAV ALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSI+VLVNFG NALV F
Sbjct  400  LGNVPAVAVTALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSISVLVNFGANALVAF  459

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP++ L+GAG VFFIFG IAV++++F+FFIIPETKGLTLEEIEAKYL
Sbjct  460  AFSPLQVLLGAGTVFFIFGGIAVLSLLFIFFIIPETKGLTLEEIEAKYL  508


 Score =   132 bits (331),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGSL+VE VAGWRYMYGVS P++++MGIGMWWLP+SPRWILLCAIQGKG++ GLRE A+ 
Sbjct  204   VGSLLVETVAGWRYMYGVSAPLAVIMGIGMWWLPSSPRWILLCAIQGKGELQGLREKAIC  263

Query  948   CLCRLRGATIGDSA  907
             CLC+LRGA IGDSA
Sbjct  264   CLCQLRGAAIGDSA  277



>ref|XP_009777282.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X3 [Nicotiana 
sylvestris]
 ref|XP_009777283.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X3 [Nicotiana 
sylvestris]
Length=498

 Score =   250 bits (638),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 202/229 (88%), Positives = 218/229 (95%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVD+ILSELS LSEEKEATIGEM QGKCLKALTIGAGLILFQQITGQPSVLYYAAKIFQD
Sbjct  270  QVDDILSELSQLSEEKEATIGEMLQGKCLKALTIGAGLILFQQITGQPSVLYYAAKIFQD  329

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+AAADATRAS+FL LLKLIMTGVAVVVVD+LGRRPLLLGGVSGIA++LFLLGSYYT+
Sbjct  330  AGFSAAADATRASVFLALLKLIMTGVAVVVVDKLGRRPLLLGGVSGIAISLFLLGSYYTY  389

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            L NVP VAV ALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSI+VLVNFG NALV F
Sbjct  390  LGNVPAVAVTALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSISVLVNFGANALVAF  449

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP++ L+GAG VFFIFG IAV++++F+FFIIPETKGLTLEEIEAKYL
Sbjct  450  AFSPLQVLLGAGTVFFIFGGIAVLSLLFIFFIIPETKGLTLEEIEAKYL  498


 Score =   132 bits (331),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGSL+VE VAGWRYMYGVS P++++MGIGMWWLP+SPRWILLCAIQGKG++ GLRE A+ 
Sbjct  194   VGSLLVETVAGWRYMYGVSAPLAVIMGIGMWWLPSSPRWILLCAIQGKGELQGLREKAIC  253

Query  948   CLCRLRGATIGDSA  907
             CLC+LRGA IGDSA
Sbjct  254   CLCQLRGAAIGDSA  267



>ref|XP_006347568.1| PREDICTED: D-xylose-proton symporter-like 2-like [Solanum tuberosum]
Length=503

 Score =   249 bits (636),  Expect(2) = 3e-96, Method: Compositional matrix adjust.
 Identities = 200/229 (87%), Positives = 217/229 (95%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVD+ILSELS LSEEKEATIGEM QGKCLKALTIGAGLILFQQITGQPSVLYYAAKIFQD
Sbjct  275  QVDDILSELSQLSEEKEATIGEMLQGKCLKALTIGAGLILFQQITGQPSVLYYAAKIFQD  334

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+AAADATRAS+FL LLKLIMT VAVVV+D+LGRRPLLLGGVSGIA++LFLLGSYYTF
Sbjct  335  AGFSAAADATRASVFLALLKLIMTAVAVVVIDKLGRRPLLLGGVSGIAMSLFLLGSYYTF  394

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            L +VP VAV ALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSI VLVNFG NALV F
Sbjct  395  LGDVPAVAVTALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSITVLVNFGANALVAF  454

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+++L+GAG VFFIFG IAV++++F+FFIIPETKGLTLEEIEAKYL
Sbjct  455  AFSPLQDLLGAGTVFFIFGGIAVLSLVFIFFIIPETKGLTLEEIEAKYL  503


 Score =   132 bits (331),  Expect(2) = 3e-96, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGSL++E VAGWRYMYGVS P++++MGIGMWWLP+SPRWILLCAIQGKG++ GLRE A+ 
Sbjct  199   VGSLLIETVAGWRYMYGVSAPLAVIMGIGMWWLPSSPRWILLCAIQGKGELQGLREKAIC  258

Query  948   CLCRLRGATIGDSAHH  901
             CLC+LRGA IGDSA  
Sbjct  259   CLCQLRGAAIGDSASR  274



>ref|NP_001288106.1| D-xylose-proton symporter-like 2-like [Solanum lycopersicum]
 dbj|BAO96239.1| vacuolar glucose transporter 2 [Solanum lycopersicum]
Length=503

 Score =   249 bits (637),  Expect(2) = 4e-96, Method: Compositional matrix adjust.
 Identities = 201/229 (88%), Positives = 217/229 (95%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVD+ILSELS LSEEKEATIGEM QGKCLKALTIGAGLILFQQITGQPSVLYYAAKIFQD
Sbjct  275  QVDDILSELSQLSEEKEATIGEMLQGKCLKALTIGAGLILFQQITGQPSVLYYAAKIFQD  334

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+AAADATRAS+FL LLKLIMT VAVVVVD+LGRRPLLLGGVSGIA++LFLLGSYYTF
Sbjct  335  AGFSAAADATRASVFLALLKLIMTAVAVVVVDKLGRRPLLLGGVSGIAMSLFLLGSYYTF  394

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            L +VP VAV ALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSI VLVNFG NALV F
Sbjct  395  LGDVPAVAVTALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSITVLVNFGANALVAF  454

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+++L+GAG VFFIFG IAV++++F+FFIIPETKGLTLEEIEAKYL
Sbjct  455  AFSPLQDLLGAGTVFFIFGGIAVLSLVFIFFIIPETKGLTLEEIEAKYL  503


 Score =   130 bits (328),  Expect(2) = 4e-96, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGSL++E VAGWRYMYG+S P++++MGIGMWWLP+SPRWILLCA+QGKG++ GLRE A+ 
Sbjct  199   VGSLLIETVAGWRYMYGISAPLAVIMGIGMWWLPSSPRWILLCAMQGKGELQGLRENAIC  258

Query  948   CLCRLRGATIGDSA  907
             CLC+LRGA IGDSA
Sbjct  259   CLCQLRGAAIGDSA  272



>ref|XP_009613870.1| PREDICTED: LOW QUALITY PROTEIN: D-xylose-proton symporter-like 
2 [Nicotiana tomentosiformis]
Length=462

 Score =   249 bits (637),  Expect(2) = 5e-95, Method: Compositional matrix adjust.
 Identities = 202/229 (88%), Positives = 218/229 (95%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVD+ILSELS LSEEKEATIGEM QGKCLKALTIGAGLILFQQITGQPSVLYYAAKIFQD
Sbjct  234  QVDDILSELSQLSEEKEATIGEMLQGKCLKALTIGAGLILFQQITGQPSVLYYAAKIFQD  293

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+AAADATRASIFL LLKLIMTGVAVVVVD+LGRRPLLLGGVSGIA++LFLLGSYYT+
Sbjct  294  AGFSAAADATRASIFLALLKLIMTGVAVVVVDKLGRRPLLLGGVSGIAISLFLLGSYYTY  353

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            L NVP VAV ALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSI+VLVNFG NALV F
Sbjct  354  LGNVPAVAVSALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSISVLVNFGANALVAF  413

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            +FSP++ L+GAG VFFIFG IAV++++F+FFIIPETKGLTLEEIEAKYL
Sbjct  414  SFSPLQVLLGAGTVFFIFGGIAVLSLLFIFFIIPETKGLTLEEIEAKYL  462


 Score =   127 bits (319),  Expect(2) = 5e-95, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGSL++E VAGWRYMYGVS P++++MGIGMWWLP+SPRWILLCAIQGKG++ GLRE A+ 
Sbjct  158   VGSLLIETVAGWRYMYGVSAPLAVIMGIGMWWLPSSPRWILLCAIQGKGELQGLREKAIC  217

Query  948   CLCRLRGATIGDSA  907
             CL +LRGA IGDSA
Sbjct  218   CLRQLRGAAIGDSA  231



>emb|CDP04938.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   248 bits (633),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 193/229 (84%), Positives = 214/229 (93%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDEILSELS LSEEKEATI EMFQGKCLKAL+IGAGL+LFQQITGQPSVLYYAA IF+ 
Sbjct  286  QVDEILSELSQLSEEKEATIAEMFQGKCLKALSIGAGLVLFQQITGQPSVLYYAATIFET  345

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+AA+DAT ASIFL LLKLIMT VAV+V+DR+GRRPLLLGGVSG+ ++LFLLGSYYTF
Sbjct  346  AGFSAASDATTASIFLALLKLIMTAVAVLVIDRVGRRPLLLGGVSGMVISLFLLGSYYTF  405

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            LD+VP VAV+ LLLYVGCYQLSFGPIGWLMISEIFPLR RGRGLSIAVLVNFG NALVTF
Sbjct  406  LDDVPAVAVVGLLLYVGCYQLSFGPIGWLMISEIFPLRSRGRGLSIAVLVNFGANALVTF  465

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+++LVGAG VFFIFG IAV++VIF+FF++PETKGLTLEEIEAK L
Sbjct  466  AFSPLEDLVGAGVVFFIFGGIAVLSVIFIFFVVPETKGLTLEEIEAKLL  514


 Score =   120 bits (302),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGSL+VE ++GWRYMYGVS P++++M IGMWWLPASPRWILL AIQGKG +  LRE A+S
Sbjct  210   VGSLLVETISGWRYMYGVSTPLALIMAIGMWWLPASPRWILLRAIQGKGKLHDLREIAIS  269

Query  948   CLCRLRGATIGDSAHH  901
              LCRLRG  IGDSA  
Sbjct  270   SLCRLRGRAIGDSASQ  285



>ref|XP_007029560.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY10062.1| Major facilitator superfamily protein [Theobroma cacao]
Length=501

 Score =   238 bits (606),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 188/238 (79%), Positives = 214/238 (90%), Gaps = 0/238 (0%)
 Frame = -3

Query  926  QQLGIRHIIQVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVL  747
            Q +G     QVDEIL+ELS++ EEKEAT+GE+F GKCLKAL IGAGL+LFQQITGQPSVL
Sbjct  264  QSIGDSASEQVDEILTELSYVGEEKEATLGEVFHGKCLKALIIGAGLVLFQQITGQPSVL  323

Query  746  YYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVAL  567
            YYAA IFQ AGF+AA+DATR SI LGLLKLIMTG AVVVVDRLGRRPLLLGGVSG+ V+L
Sbjct  324  YYAASIFQSAGFSAASDATRVSILLGLLKLIMTGAAVVVVDRLGRRPLLLGGVSGMVVSL  383

Query  566  FLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVN  387
            FLLGSYY FLD+VP +AV ALLLYVGCYQLSFGPIGWLMISE+FPLR RGRGLSIAVLVN
Sbjct  384  FLLGSYYLFLDDVPAIAVAALLLYVGCYQLSFGPIGWLMISEVFPLRHRGRGLSIAVLVN  443

Query  386  FGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FG NALVTFAFSP++  +GAG VF++FGVIA+++++F+FFI+PETKGLTLEEIEAK L
Sbjct  444  FGANALVTFAFSPLEAWLGAGIVFYVFGVIAMLSLLFIFFIVPETKGLTLEEIEAKCL  501


 Score =   131 bits (329),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 66/76 (87%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+VE VAGWRYMYG S P++++M IGMWWLPASPRW+LLCAIQGKGDM  LRETA+ 
Sbjct  197   IGSLLVETVAGWRYMYGASTPLAVIMAIGMWWLPASPRWLLLCAIQGKGDMQELRETAIC  256

Query  948   CLCRLRGATIGDSAHH  901
             CLCRLRG +IGDSA  
Sbjct  257   CLCRLRGQSIGDSASE  272



>ref|XP_006443191.1| hypothetical protein CICLE_v10019791mg [Citrus clementina]
 ref|XP_006478911.1| PREDICTED: D-xylose-proton symporter-like 2-like [Citrus sinensis]
 gb|ESR56431.1| hypothetical protein CICLE_v10019791mg [Citrus clementina]
Length=506

 Score =   238 bits (606),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 181/238 (76%), Positives = 213/238 (89%), Gaps = 0/238 (0%)
 Frame = -3

Query  926  QQLGIRHIIQVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVL  747
            Q +G     +VDEIL+ELS++ E+KE ++ E+F GKCLKAL IGAGL+LFQQITGQPSVL
Sbjct  269  QSIGDSAPTEVDEILTELSYVGEDKEVSLREVFHGKCLKALIIGAGLVLFQQITGQPSVL  328

Query  746  YYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVAL  567
            YYAA I Q AGF+AA+DATR SI LGL KLIMTG+AV+VV+RLGRRPLLLGGVSGI ++L
Sbjct  329  YYAASILQSAGFSAASDATRVSILLGLFKLIMTGLAVLVVERLGRRPLLLGGVSGIVISL  388

Query  566  FLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVN  387
            FLLGSYY FLD+VP VAV+ALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRGLS+AVLVN
Sbjct  389  FLLGSYYLFLDDVPAVAVVALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRGLSVAVLVN  448

Query  386  FGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FG NALVTFAFSP+K+L+GAG +F+ FGVIAV+++ F+FFI+PETKGLTLEEIEAK L
Sbjct  449  FGANALVTFAFSPLKDLLGAGILFYAFGVIAVLSLAFIFFIVPETKGLTLEEIEAKCL  506


 Score =   126 bits (317),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V++VAGWRYMYG S P++++MGIGMWWLPASPRW+LLCA++ KGDM  LRE+A+S
Sbjct  202   IGSLLVDLVAGWRYMYGASTPLAVIMGIGMWWLPASPRWLLLCAMKRKGDMQDLRESAIS  261

Query  948   CLCRLRGATIGDSA  907
             CLCRLRG +IGDSA
Sbjct  262   CLCRLRGQSIGDSA  275



>ref|XP_008362818.1| PREDICTED: D-xylose-proton symporter-like 2 [Malus domestica]
Length=501

 Score =   232 bits (592),  Expect(2) = 4e-91, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 203/229 (89%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDE+L+EL+++ EEKEAT+GEMF GKCLKAL IG GL+LFQQITGQPSVLYYAA IFQ 
Sbjct  273  QVDEMLAELAYVGEEKEATLGEMFHGKCLKALVIGGGLVLFQQITGQPSVLYYAASIFQS  332

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ A+DATR SI LG  KLIMTG AV++VDRLGRRPLLLGGV+G+ ++LFLLGSYY F
Sbjct  333  AGFSEASDATRVSILLGAFKLIMTGAAVLLVDRLGRRPLLLGGVTGMVISLFLLGSYYLF  392

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
             DN P  AV+ALLLYVGCYQ+SFGPIGWLMISEIFPLR+RGRGLSIAVLVNF  NALVTF
Sbjct  393  FDNAPVAAVVALLLYVGCYQISFGPIGWLMISEIFPLRLRGRGLSIAVLVNFAANALVTF  452

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+K L+GAG +F+ FG IAV +++F+FFI+PETKGLTLEEIEAK L
Sbjct  453  AFSPLKALLGAGILFYGFGAIAVASLVFIFFIVPETKGLTLEEIEAKCL  501


 Score =   131 bits (330),  Expect(2) = 4e-91, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V++VAGWRYMYGVS P++I+MGIGMWWLPASPRWILLCAIQG+G M  L+ETA+S
Sbjct  197   IGSLLVDIVAGWRYMYGVSAPLAIIMGIGMWWLPASPRWILLCAIQGRGSMHELKETAIS  256

Query  948   CLCRLRGATIGDSA  907
             CLCRLRG  IGDSA
Sbjct  257   CLCRLRGRAIGDSA  270



>ref|XP_009351838.1| PREDICTED: D-xylose-proton symporter-like 2 [Pyrus x bretschneideri]
Length=501

 Score =   234 bits (597),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 205/229 (90%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDE+L+EL+++ +EKEAT+GEMF GKCLKAL IGAGL+LFQQITGQPSVLYYAA IFQ 
Sbjct  273  QVDEMLAELAYVGDEKEATLGEMFHGKCLKALVIGAGLVLFQQITGQPSVLYYAASIFQS  332

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ A+DATR SI LG  KLIMTG AV+VVDRLGRRPLLLGGV+G+ ++LFLLGSYY F
Sbjct  333  AGFSEASDATRVSILLGAFKLIMTGAAVLVVDRLGRRPLLLGGVTGMVISLFLLGSYYLF  392

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
             DN P  AV+ALLLYVGCYQ+SFGPIGWLMISEIFPLR+RGRGLSIAVLVNF  NALVTF
Sbjct  393  FDNAPVAAVVALLLYVGCYQISFGPIGWLMISEIFPLRLRGRGLSIAVLVNFAANALVTF  452

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+K L+GAG +F++FG IAV +++F+FFI+PETKGLTLEEIEAK L
Sbjct  453  AFSPLKALLGAGILFYVFGAIAVASLVFIFFIVPETKGLTLEEIEAKCL  501


 Score =   126 bits (317),  Expect(2) = 4e-90, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V++VAGWRYMYGVS P++I+MGIGMWWLPASPRWILL AIQG+G+M  L+ETA+S
Sbjct  197   IGSLLVDIVAGWRYMYGVSAPLAIIMGIGMWWLPASPRWILLRAIQGRGNMHELKETAIS  256

Query  948   CLCRLRGATIGDSA  907
             CLC+LRG  IGDSA
Sbjct  257   CLCQLRGRAIGDSA  270



>ref|XP_010662115.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Vitis 
vinifera]
Length=493

 Score =   236 bits (601),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 203/229 (89%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVD IL ELS   E KEA++GEMF GKCLKALTIG GL+LFQQITGQPSVLYYAA I + 
Sbjct  265  QVDGILDELSSSEETKEASLGEMFHGKCLKALTIGGGLVLFQQITGQPSVLYYAASILES  324

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ A+DATR SI +GLLKLIMT VAV+VVD++GRRPLLLGGVSGI ++LFLLGSYY +
Sbjct  325  AGFSGASDATRVSILVGLLKLIMTAVAVLVVDKVGRRPLLLGGVSGIVISLFLLGSYYIY  384

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            L + P VAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFG NA+VTF
Sbjct  385  LGDAPAVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGANAIVTF  444

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            +FSP+K L+GAG +F+ FGVIAV++++F+FF IPETKGL+LEEIEAK L
Sbjct  445  SFSPLKALLGAGVLFYGFGVIAVLSLLFIFFFIPETKGLSLEEIEAKLL  493


 Score =   123 bits (308),  Expect(2) = 1e-89, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGSL+V++V+GWRYMYGVS P+S++MGIGMWWLPASPRW+LL AIQGKG+M  L+E A+ 
Sbjct  189   VGSLLVDMVSGWRYMYGVSSPLSVIMGIGMWWLPASPRWLLLRAIQGKGNMQDLKENAIF  248

Query  948   CLCRLRGATIGDSA  907
             CLCRLRG  IGDSA
Sbjct  249   CLCRLRGPAIGDSA  262



>ref|XP_002277076.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Vitis 
vinifera]
 emb|CBI26530.3| unnamed protein product [Vitis vinifera]
Length=500

 Score =   235 bits (600),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 203/229 (89%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVD IL ELS   E KEA++GEMF GKCLKALTIG GL+LFQQITGQPSVLYYAA I + 
Sbjct  272  QVDGILDELSSSEETKEASLGEMFHGKCLKALTIGGGLVLFQQITGQPSVLYYAASILES  331

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ A+DATR SI +GLLKLIMT VAV+VVD++GRRPLLLGGVSGI ++LFLLGSYY +
Sbjct  332  AGFSGASDATRVSILVGLLKLIMTAVAVLVVDKVGRRPLLLGGVSGIVISLFLLGSYYIY  391

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            L + P VAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFG NA+VTF
Sbjct  392  LGDAPAVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGANAIVTF  451

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            +FSP+K L+GAG +F+ FGVIAV++++F+FF IPETKGL+LEEIEAK L
Sbjct  452  SFSPLKALLGAGVLFYGFGVIAVLSLLFIFFFIPETKGLSLEEIEAKLL  500


 Score =   123 bits (308),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGSL+V++V+GWRYMYGVS P+S++MGIGMWWLPASPRW+LL AIQGKG+M  L+E A+ 
Sbjct  196   VGSLLVDMVSGWRYMYGVSSPLSVIMGIGMWWLPASPRWLLLRAIQGKGNMQDLKENAIF  255

Query  948   CLCRLRGATIGDSA  907
             CLCRLRG  IGDSA
Sbjct  256   CLCRLRGPAIGDSA  269



>ref|XP_004137173.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Cucumis 
sativus]
 gb|KGN53693.1| hypothetical protein Csa_4G106860 [Cucumis sativus]
Length=502

 Score =   239 bits (610),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            A+IGE+FQGKCLKAL IGAGL+LFQQITGQPSVLYYA  IFQ AGF+AAADATR SI LG
Sbjct  291  ASIGEIFQGKCLKALIIGAGLVLFQQITGQPSVLYYAPSIFQSAGFSAAADATRVSILLG  350

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKLIMTG AV+VVDRLGRRPLLLGGVSGI ++LFLLGSYY FL NVP VAV+ALLLYVG
Sbjct  351  LLKLIMTGAAVLVVDRLGRRPLLLGGVSGITISLFLLGSYYLFLGNVPAVAVVALLLYVG  410

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
             YQLSFGPIGWLMISE+FPLR+RGRGLSIAVLVNFG NALVTFAFSP+KEL+GAG +FFI
Sbjct  411  SYQLSFGPIGWLMISEVFPLRLRGRGLSIAVLVNFGANALVTFAFSPLKELLGAGILFFI  470

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGV+A+++++F+FFI+PETKGLTLEEIEA+ L
Sbjct  471  FGVVAILSLVFIFFIVPETKGLTLEEIEARCL  502


 Score =   119 bits (298),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+VEVVAGWRY+Y  + PI++VMG+GMWWLP+SPRW+LLCAIQ KG+M  L+E A+S
Sbjct  198   IGSLLVEVVAGWRYIYAANTPIALVMGVGMWWLPSSPRWLLLCAIQRKGNMADLKERAIS  257

Query  948   CLCRLRGATIGDSAHH  901
             CL RLRGA IG++A  
Sbjct  258   CLHRLRGAVIGETASE  273



>gb|ADP37177.1| putative vacuolar glucose transporter [Vitis vinifera]
Length=453

 Score =   235 bits (600),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 203/229 (89%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVD IL ELS   E KEA++GEMF GKCLKALTIG GL+LFQQITGQPSVLYYAA I + 
Sbjct  225  QVDGILDELSSSEETKEASLGEMFHGKCLKALTIGGGLVLFQQITGQPSVLYYAASILES  284

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ A+DATR SI +GLLKLIMT VAV+VVD++GRRPLLLGGVSGI ++LFLLGSYY +
Sbjct  285  AGFSGASDATRVSILVGLLKLIMTAVAVLVVDKVGRRPLLLGGVSGIVISLFLLGSYYIY  344

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            L + P VAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFG NA+VTF
Sbjct  345  LGDAPAVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGANAIVTF  404

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            +FSP+K L+GAG +F+ FGVIAV++++F+FF IPETKGL+LEEIEAK L
Sbjct  405  SFSPLKALLGAGVLFYGFGVIAVLSLLFIFFFIPETKGLSLEEIEAKLL  453


 Score =   123 bits (308),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGSL+V++V+GWRYMYGVS P+S++MGIGMWWLPASPRW+LL AIQGKG+M  L+E A+ 
Sbjct  149   VGSLLVDMVSGWRYMYGVSSPLSVIMGIGMWWLPASPRWLLLRAIQGKGNMQDLKENAIF  208

Query  948   CLCRLRGATIGDSA  907
             CLCRLRG  IGDSA
Sbjct  209   CLCRLRGPAIGDSA  222



>ref|XP_011653375.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Cucumis 
sativus]
Length=408

 Score =   239 bits (610),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 175/212 (83%), Positives = 197/212 (93%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            A+IGE+FQGKCLKAL IGAGL+LFQQITGQPSVLYYA  IFQ AGF+AAADATR SI LG
Sbjct  197  ASIGEIFQGKCLKALIIGAGLVLFQQITGQPSVLYYAPSIFQSAGFSAAADATRVSILLG  256

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKLIMTG AV+VVDRLGRRPLLLGGVSGI ++LFLLGSYY FL NVP VAV+ALLLYVG
Sbjct  257  LLKLIMTGAAVLVVDRLGRRPLLLGGVSGIVISLFLLGSYYLFLGNVPAVAVVALLLYVG  316

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
             YQLSFGPIGWLMISE+FPLR+RGRGLSIAVLVNFG NALVTFAFSP+KEL+GAG +FFI
Sbjct  317  SYQLSFGPIGWLMISEVFPLRLRGRGLSIAVLVNFGANALVTFAFSPLKELLGAGILFFI  376

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGV+A+++++F+FFI+PETKGLTLEEIEA+ L
Sbjct  377  FGVVAILSLVFIFFIVPETKGLTLEEIEARCL  408


 Score =   119 bits (297),  Expect(2) = 2e-89, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+VEVVAGWRY+Y  + PI++VMG+GMWWLP+SPRW+LLCAIQ KG+M  L+E A+S
Sbjct  104   IGSLLVEVVAGWRYIYAANTPIALVMGVGMWWLPSSPRWLLLCAIQRKGNMADLKERAIS  163

Query  948   CLCRLRGATIGDSAHH  901
             CL RLRGA IG++A  
Sbjct  164   CLHRLRGAVIGETASE  179



>ref|XP_009361176.1| PREDICTED: D-xylose-proton symporter-like 2 [Pyrus x bretschneideri]
Length=501

 Score =   233 bits (594),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 176/229 (77%), Positives = 206/229 (90%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDE+L EL+++ +EKEAT+GEMF GKCLKAL IGAGL+LFQQITGQPSVLYYAA IFQ 
Sbjct  273  QVDEMLVELAYVGDEKEATLGEMFHGKCLKALVIGAGLVLFQQITGQPSVLYYAASIFQS  332

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ A+DATR SI LG+ KLIMTG AV+VVDRLGRRPLLLGGV+G+ ++LFLLGSYY F
Sbjct  333  AGFSEASDATRVSILLGVFKLIMTGAAVLVVDRLGRRPLLLGGVTGMVISLFLLGSYYLF  392

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
             D+ P  AV+AL+LYVGCYQ+SFGPIGWLMISEIFPLR+RGRGLSIAVLVNF  NALVTF
Sbjct  393  FDDAPVAAVVALMLYVGCYQISFGPIGWLMISEIFPLRLRGRGLSIAVLVNFAANALVTF  452

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+K L+GAG +F++FGVIAV +++F+FFI+PETKGLTLEEIEAK L
Sbjct  453  AFSPLKALLGAGILFYVFGVIAVASLLFIFFIVPETKGLTLEEIEAKCL  501


 Score =   123 bits (309),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V+ VAGWRYMYG++ P++I+MGIGMWWLPASPRWILL AIQG+G+M  L+ TA+S
Sbjct  197   IGSLLVDTVAGWRYMYGITAPLAIIMGIGMWWLPASPRWILLRAIQGRGNMDELKLTAIS  256

Query  948   CLCRLRGATIGDSA  907
             CLCRLRG+ IGDSA
Sbjct  257   CLCRLRGSAIGDSA  270



>ref|XP_007219039.1| hypothetical protein PRUPE_ppa004602mg [Prunus persica]
 gb|EMJ20238.1| hypothetical protein PRUPE_ppa004602mg [Prunus persica]
Length=500

 Score =   233 bits (593),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDE+L+ELS++ EEKEA++GEMF GKC KAL IGAGL+LFQQITGQPSVLYYAA IFQ 
Sbjct  272  QVDEMLAELSYMGEEKEASLGEMFHGKCAKALVIGAGLVLFQQITGQPSVLYYAASIFQS  331

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ A+DATR SI LG+ KLIMTG AV+VVDRLGRRPLLLGGVSG+ ++LFLLGSYY F
Sbjct  332  AGFSEASDATRVSILLGVFKLIMTGAAVLVVDRLGRRPLLLGGVSGMVISLFLLGSYYLF  391

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
             DN P  AV+ALLLYVGCYQLSFGPIGWLMISEIFPLR+RGRGLSIAVLVNF  NALVTF
Sbjct  392  FDNAPIAAVVALLLYVGCYQLSFGPIGWLMISEIFPLRLRGRGLSIAVLVNFAANALVTF  451

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+K L+GAG +F+ FG IAV +++F+FFI+PETKGLTLEEIEAK L
Sbjct  452  AFSPLKVLLGAGILFYAFGAIAVASLVFIFFIVPETKGLTLEEIEAKCL  500


 Score =   124 bits (310),  Expect(2) = 7e-89, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V+ VAGWRYMY  ++P++++MGIGMWWLPASPRWILL AIQG+G+M  L+ETA+S
Sbjct  196   IGSLLVDTVAGWRYMYAAAIPLAVIMGIGMWWLPASPRWILLRAIQGRGNMHELKETAIS  255

Query  948   CLCRLRGATIGDSA  907
             CLCRLRG  IGDSA
Sbjct  256   CLCRLRGTAIGDSA  269



>ref|XP_008234574.1| PREDICTED: D-xylose-proton symporter-like 2 [Prunus mume]
Length=500

 Score =   228 bits (581),  Expect(2) = 9e-88, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDE+L+ELS++ EEKEA++GEMF GK  KAL IGAGL+LFQQITGQPSVLYYAA IFQ 
Sbjct  272  QVDEMLAELSYVGEEKEASLGEMFHGKSAKALVIGAGLVLFQQITGQPSVLYYAASIFQS  331

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ A+DATR SI LG+ KLIMTG AV+VVDRLGRRPLLLGGVSG+ ++LFLLGSYY F
Sbjct  332  AGFSEASDATRVSILLGVFKLIMTGAAVLVVDRLGRRPLLLGGVSGMVISLFLLGSYYLF  391

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
             DN P  AV+ALLLYVGCYQLSFGPIGWLMISEIFPLR+RGRGLSIAVLVNF  NALVTF
Sbjct  392  FDNAPVAAVVALLLYVGCYQLSFGPIGWLMISEIFPLRLRGRGLSIAVLVNFAANALVTF  451

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+K L+GAG +F++FG IAV +++F+FFI+PETKGLTLEEIEAK L
Sbjct  452  AFSPLKVLLGAGILFYVFGAIAVASLVFIFFIVPETKGLTLEEIEAKCL  500


 Score =   124 bits (311),  Expect(2) = 9e-88, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V+ VAGWRYMY  ++P++++MGIGMWWLPASPRWILL AIQG+G+M  L+ETA+S
Sbjct  196   IGSLLVDTVAGWRYMYAAAIPLAVIMGIGMWWLPASPRWILLRAIQGRGNMHELKETAIS  255

Query  948   CLCRLRGATIGDSA  907
             CLCRLRG +IGDSA
Sbjct  256   CLCRLRGTSIGDSA  269



>gb|ABK95072.1| unknown [Populus trichocarpa]
Length=502

 Score =   233 bits (594),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 171/211 (81%), Positives = 191/211 (91%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
            T+ E+F+GKCLKALTIGAGL+LFQQITGQPSVLYYAA I Q AGF+AA+DATR SI LGL
Sbjct  292  TLAEVFRGKCLKALTIGAGLVLFQQITGQPSVLYYAASILQSAGFSAASDATRVSILLGL  351

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             KLIMTG AV+VVDRLGRRPLLLGGVSG+ ++LFLLGSYY FLDN P VAV ALLLYVGC
Sbjct  352  FKLIMTGTAVLVVDRLGRRPLLLGGVSGMVISLFLLGSYYIFLDNAPVVAVAALLLYVGC  411

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQLSFGPIGWLMISEIFPLR+RGRGL IAVLVNFG NALVTF FSP+K L+GAG +F+ F
Sbjct  412  YQLSFGPIGWLMISEIFPLRLRGRGLGIAVLVNFGANALVTFTFSPLKALLGAGILFYAF  471

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            GVIAVV+++F+FFI+PETKGLTLEEIEAK L
Sbjct  472  GVIAVVSLLFIFFIVPETKGLTLEEIEAKCL  502


 Score =   119 bits (298),  Expect(2) = 1e-87, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V+ VAGWRYMY  S P++++MGIGMWWLPASPRW+LL AIQGKG M  LRETA+ 
Sbjct  198   IGSLLVDTVAGWRYMYVASTPLAVIMGIGMWWLPASPRWLLLRAIQGKGSMQELRETAIC  257

Query  948   CLCRLRGATIGDSA  907
             CLCRLRG  IGD+A
Sbjct  258   CLCRLRGEAIGDTA  271



>ref|XP_012090914.1| PREDICTED: D-xylose-proton symporter-like 2 [Jatropha curcas]
 ref|XP_012090915.1| PREDICTED: D-xylose-proton symporter-like 2 [Jatropha curcas]
 gb|KDP21779.1| hypothetical protein JCGZ_00566 [Jatropha curcas]
Length=501

 Score =   236 bits (603),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 171/212 (81%), Positives = 195/212 (92%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            A++GEMF+GKCLKAL IGAGL+LFQQITGQPSVLYYAA IFQ AGF+AA+DATR SI LG
Sbjct  290  ASLGEMFRGKCLKALIIGAGLVLFQQITGQPSVLYYAASIFQSAGFSAASDATRVSILLG  349

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKLIMTG+AV+VVDRLGRRPLLLGGVSG+ ++LFLLGSYY FLDN P VAV ALLLYVG
Sbjct  350  LLKLIMTGIAVLVVDRLGRRPLLLGGVSGMVISLFLLGSYYLFLDNAPFVAVAALLLYVG  409

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISE+FPLR+RGRGLSIAVLVNFG NALVTFAFSP+K  +GAG +F+ 
Sbjct  410  CYQLSFGPIGWLMISEVFPLRLRGRGLSIAVLVNFGANALVTFAFSPLKAWLGAGILFYA  469

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVI +++++F+FFI+PETKGLTLEEIEAK L
Sbjct  470  FGVIGILSLLFIFFIVPETKGLTLEEIEAKCL  501


 Score =   115 bits (287),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 48/74 (65%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V+ + GWRYMY  S P++++MG+GM WLP+SPRW+LLCAIQGKG+M  L+ETA+ 
Sbjct  197   IGSLLVDTIDGWRYMYVASTPLALIMGVGMCWLPSSPRWLLLCAIQGKGNMQDLKETAIF  256

Query  948   CLCRLRGATIGDSA  907
             CLCRLRG  IGD+A
Sbjct  257   CLCRLRGEAIGDTA  270



>ref|XP_008376911.1| PREDICTED: D-xylose-proton symporter-like 2 [Malus domestica]
Length=501

 Score =   227 bits (578),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 175/229 (76%), Positives = 202/229 (88%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDEIL+EL+++ EEKEAT+GEMF GKCLKAL IG GL+LFQQITGQPSVLYYAA IFQ 
Sbjct  273  QVDEILAELAYVGEEKEATLGEMFHGKCLKALVIGVGLVLFQQITGQPSVLYYAASIFQS  332

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ A+DATR SI LG+ KLIMTG AV+VVDRLGRRPLLLGGV+G+ ++LFLLGSYY F
Sbjct  333  AGFSEASDATRVSILLGVFKLIMTGAAVLVVDRLGRRPLLLGGVTGMVISLFLLGSYYLF  392

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
             D+ P  AV+ALLLYVGCYQ+SFGPIGWLMISE+FPLR+RGRGL IAVLVNF  NALVTF
Sbjct  393  FDDAPVAAVVALLLYVGCYQISFGPIGWLMISEVFPLRLRGRGLGIAVLVNFAANALVTF  452

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+K L+GAG +F+ FGVIAV ++ F+FFI+PETKGLTLEEIEA  L
Sbjct  453  AFSPLKALLGAGILFYAFGVIAVASLFFIFFIVPETKGLTLEEIEANCL  501


 Score =   124 bits (312),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 56/74 (76%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V+ VAGWRYMYG+S P++I+MGIGMWWLPASPRWILL AIQGKG M  L+ TA+S
Sbjct  197   IGSLLVDTVAGWRYMYGISAPLAIIMGIGMWWLPASPRWILLRAIQGKGSMDELKVTAIS  256

Query  948   CLCRLRGATIGDSA  907
             CLCRLRG+ IGDSA
Sbjct  257   CLCRLRGSAIGDSA  270



>gb|KJB26764.1| hypothetical protein B456_004G258400 [Gossypium raimondii]
Length=501

 Score =   229 bits (585),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 182/238 (76%), Positives = 212/238 (89%), Gaps = 0/238 (0%)
 Frame = -3

Query  926  QQLGIRHIIQVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVL  747
            Q +G      VDEIL+ELS++ EEKE T+GE+F GKCLKA+ IGAGL+LFQQITGQPSVL
Sbjct  264  QSIGDSASQHVDEILTELSYVGEEKEVTLGEIFHGKCLKAMIIGAGLVLFQQITGQPSVL  323

Query  746  YYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVAL  567
            YYAA I Q AGF+AA+DATR SI LGLLKLIMTGVAVVVVDRLGRRPLLLGGVSG+ ++L
Sbjct  324  YYAASILQSAGFSAASDATRVSILLGLLKLIMTGVAVVVVDRLGRRPLLLGGVSGMVISL  383

Query  566  FLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVN  387
            FLLGSYY FLD++  +AV+ALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRGLS+AVLVN
Sbjct  384  FLLGSYYLFLDDLAAIAVVALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRGLSVAVLVN  443

Query  386  FGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FG NALVTFAFSP+K  +GAG VF++FGVIAV++++F+FFI+PETKGLTLEEIE K L
Sbjct  444  FGANALVTFAFSPLKAWLGAGIVFYVFGVIAVLSLVFIFFIVPETKGLTLEEIEVKCL  501


 Score =   122 bits (305),  Expect(2) = 2e-87, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+VE V+GWRYMYG S P++++MGIGM WLPASPRW+LL AIQGKG+M  LRETAV 
Sbjct  197   IGSLLVETVSGWRYMYGASTPLAVIMGIGMCWLPASPRWLLLRAIQGKGNMQELRETAVC  256

Query  948   CLCRLRGATIGDSAHH  901
             CLCRLRG +IGDSA  
Sbjct  257   CLCRLRGQSIGDSASQ  272



>ref|XP_011008112.1| PREDICTED: D-xylose-proton symporter-like 2 [Populus euphratica]
Length=502

 Score =   229 bits (585),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 189/208 (91%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+F+GKCLKALTIGAGL+LFQQITGQPSVLYYAA I Q AGF+AA+DATR SI +GL KL
Sbjct  295  EVFRGKCLKALTIGAGLVLFQQITGQPSVLYYAASILQSAGFSAASDATRVSILIGLFKL  354

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            IMTG+AV+VVDRLGRRPLLLGGVSG+ ++LFLLGSYY FLD+ P VAV ALLLYVGCYQL
Sbjct  355  IMTGIAVLVVDRLGRRPLLLGGVSGMVISLFLLGSYYIFLDDAPVVAVAALLLYVGCYQL  414

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPIGWLMISEIFPLR+RGRGL IAVLVNFG NALVTF FSP+K L+GAG +F++F  I
Sbjct  415  SFGPIGWLMISEIFPLRLRGRGLGIAVLVNFGANALVTFTFSPLKALLGAGILFYVFAAI  474

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            AVV+++F+FFI+PETKGLTLEEIEAK L
Sbjct  475  AVVSLLFIFFIVPETKGLTLEEIEAKCL  502


 Score =   116 bits (290),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 67/83 (81%), Gaps = 2/83 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V+ VAGW YMY  S P++++MGIGMWWLPASPRW+LL AIQGKG M  L+ETA+ 
Sbjct  198   IGSLLVDTVAGWHYMYVASTPLAVIMGIGMWWLPASPRWLLLRAIQGKGSMQELKETAIC  257

Query  948   CLCRLRGATIGDSAHHPSR*NSV  880
             CLCRLRG  IGD+A  P++ + +
Sbjct  258   CLCRLRGEAIGDTA--PAKVDEI  278



>ref|XP_002520022.1| sugar transporter, putative [Ricinus communis]
 gb|EEF42346.1| sugar transporter, putative [Ricinus communis]
Length=502

 Score =   229 bits (585),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 164/211 (78%), Positives = 192/211 (91%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
            ++ ++F+GKCLKALTIGAGL++FQQITGQPSVLYYA  IFQ AGF+AA+DATR SI LGL
Sbjct  292  SLRDLFKGKCLKALTIGAGLVIFQQITGQPSVLYYAGSIFQSAGFSAASDATRVSILLGL  351

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
            LKLIMTG AVV VDRLGRRPLLL GVSG+A++LFLLGSYY FL++VP VAV+ALLLYVGC
Sbjct  352  LKLIMTGGAVVAVDRLGRRPLLLTGVSGMAISLFLLGSYYRFLNDVPAVAVVALLLYVGC  411

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ SFGPIGWLMISEIFPLR+RGR L IAVLVNFG NA+VTFAFSP+K L+GAG +F+ F
Sbjct  412  YQFSFGPIGWLMISEIFPLRLRGRALGIAVLVNFGANAIVTFAFSPLKALIGAGILFYGF  471

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            GVI+VV+++F+FF++PETKGLTLEEIEAK L
Sbjct  472  GVISVVSLLFIFFVVPETKGLTLEEIEAKCL  502


 Score =   114 bits (285),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 49/74 (66%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGSL+V++V GWRYMY  S P++++MG+GMW LP SPRWILLCA+QGKG+M  L+ETA+ 
Sbjct  198   VGSLLVDIVRGWRYMYVASAPLAVIMGVGMWCLPQSPRWILLCAMQGKGNMQDLKETAIC  257

Query  948   CLCRLRGATIGDSA  907
             CLC+LRG  IGD+A
Sbjct  258   CLCKLRGGAIGDAA  271



>gb|KDO39944.1| hypothetical protein CISIN_1g0102391mg, partial [Citrus sinensis]
Length=487

 Score =   219 bits (557),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = -3

Query  926  QQLGIRHIIQVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVL  747
            Q +G     +VDEIL+ELS++ E+KE ++ E+F GKCLKAL IGAGL+LFQQITGQPSVL
Sbjct  269  QSIGDSAPTEVDEILTELSYVGEDKEVSLREVFHGKCLKALIIGAGLVLFQQITGQPSVL  328

Query  746  YYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVAL  567
            YYAA I Q AGF+AA+DATR SI LGL KLIMTG+AV+VV+RLGRRPLLLGGVSGI ++L
Sbjct  329  YYAASILQSAGFSAASDATRVSILLGLFKLIMTGLAVLVVERLGRRPLLLGGVSGIVISL  388

Query  566  FLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVN  387
            FLLGSYY FLD+VP VAV+ALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRGLS+AVLVN
Sbjct  389  FLLGSYYLFLDDVPAVAVVALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRGLSVAVLVN  448

Query  386  FGTNALVTFAFSPMKELVGAG  324
            FG NALVTFAFSP+K+L+GAG
Sbjct  449  FGANALVTFAFSPLKDLLGAG  469


 Score =   125 bits (314),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V++VAGWRYMYG S P++++MG+GMWWLPASPRW+LLCA++ KGDM  LRE+A+S
Sbjct  202   IGSLLVDLVAGWRYMYGASTPLAVIMGMGMWWLPASPRWLLLCAMKRKGDMQDLRESAIS  261

Query  948   CLCRLRGATIGDSA  907
             CLCRLRG +IGDSA
Sbjct  262   CLCRLRGQSIGDSA  275



>gb|KHN46451.1| D-xylose-proton symporter-like 2 [Glycine soja]
Length=497

 Score =   233 bits (593),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 181/229 (79%), Positives = 205/229 (90%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDEIL+ELS+L EEKEAT GE+FQGKCLKAL IGAGL+LFQQITGQPSVLYYA  IFQ 
Sbjct  269  QVDEILAELSYLGEEKEATFGELFQGKCLKALWIGAGLVLFQQITGQPSVLYYAGSIFQS  328

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ A+DATR SI LG+ KLIMTGVAVVVVD+LGRRPLLLGGVSGI ++LF LGSYY F
Sbjct  329  AGFSGASDATRVSILLGVFKLIMTGVAVVVVDKLGRRPLLLGGVSGIVISLFFLGSYYIF  388

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            LDN P VAV+ LLLYVG YQ+SFGPIGWLMI+EIFPLR+RGRGLSIAVLVNFG NALVTF
Sbjct  389  LDNTPVVAVVGLLLYVGSYQISFGPIGWLMIAEIFPLRLRGRGLSIAVLVNFGANALVTF  448

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+K L+GAG +F+ FGVIAV +++F++ +IPETKGLTLEEIEAK L
Sbjct  449  AFSPLKALLGAGILFYTFGVIAVTSLVFIYLVIPETKGLTLEEIEAKCL  497


 Score =   108 bits (271),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL VE VAGWRYMYGVS P++I+MG+GMWWLPASPRW+LL AIQGKGD+   ++ A+ 
Sbjct  193   IGSLFVETVAGWRYMYGVSSPVAIIMGLGMWWLPASPRWLLLRAIQGKGDVQNSKDIAIR  252

Query  948   CLCRLRGATIGDS  910
              LC+L+G    DS
Sbjct  253   SLCQLQGQAFNDS  265



>ref|XP_009382608.1| PREDICTED: D-xylose-proton symporter-like 2 [Musa acuminata subsp. 
malaccensis]
Length=498

 Score =   232 bits (591),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 205/229 (90%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVD IL ELS++ +EK+A   E+F+GKCLKAL IGAGL+ FQQ+TGQPSVLYYAA I Q 
Sbjct  270  QVDLILDELSYVDQEKQAAFSEIFRGKCLKALIIGAGLVFFQQVTGQPSVLYYAATILQS  329

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+AA+DATR SI LGLLKLIMTGVAV+VVDRLGRRPLL+GGVSGIA++LFLL SYYT 
Sbjct  330  AGFSAASDATRVSILLGLLKLIMTGVAVLVVDRLGRRPLLIGGVSGIAISLFLLSSYYTL  389

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            L+++P VAVIALLLYVGCYQLSFGPIGWLMISEIFPLR+RGRGLSIAVLVNF +NALVTF
Sbjct  390  LNSLPSVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRLRGRGLSIAVLVNFASNALVTF  449

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP++ LVG G +F  FGVIA+ +++F+FFI+PETKGLTLEEIEAK L
Sbjct  450  AFSPLETLVGTGVLFAGFGVIAISSLLFIFFIVPETKGLTLEEIEAKIL  498


 Score =   109 bits (273),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = -2

Query  1125  GSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSC  946
             GS+ V+++ GWRYMY  S PI ++MGIGMWWLP SPRW+LLCAIQGKG +P  +E  ++C
Sbjct  195   GSIYVDLIGGWRYMYATSAPICLIMGIGMWWLPPSPRWLLLCAIQGKGSLPHAKEVGITC  254

Query  945   LCRLRGATIGDSAHH  901
             LCRLRG     SA  
Sbjct  255   LCRLRGVAFSSSASE  269



>ref|XP_007131530.1| hypothetical protein PHAVU_011G020700g [Phaseolus vulgaris]
 gb|ESW03524.1| hypothetical protein PHAVU_011G020700g [Phaseolus vulgaris]
Length=498

 Score =   236 bits (602),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 181/229 (79%), Positives = 205/229 (90%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDEIL+ELS+L EEKE T GE+FQGKCLKAL IGAGL+LFQQITGQPSVLYYAA IFQ 
Sbjct  270  QVDEILAELSYLGEEKEVTFGEIFQGKCLKALWIGAGLVLFQQITGQPSVLYYAASIFQS  329

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ A+DATR SI LG  KLIMTGVAVVVVD+LGRRPLLLGGVSG+ ++LFLLGSYY F
Sbjct  330  AGFSGASDATRVSILLGAFKLIMTGVAVVVVDKLGRRPLLLGGVSGMVISLFLLGSYYVF  389

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            LDN P VAV+ LLLYVGCYQ+SFGPIGWLMI+EIFPLR+RGRGL IAVLVNFG NALVTF
Sbjct  390  LDNAPVVAVVGLLLYVGCYQISFGPIGWLMIAEIFPLRLRGRGLGIAVLVNFGANALVTF  449

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+KEL+GAG +F+IF VIAV ++ F++ ++PETKGLTLEEIEAK L
Sbjct  450  AFSPLKELLGAGILFYIFCVIAVASLAFIYLVVPETKGLTLEEIEAKCL  498


 Score =   105 bits (261),  Expect(2) = 2e-84, Method: Compositional matrix adjust.
 Identities = 47/75 (63%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -2

Query  1125  GSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSC  946
             GSL V+  AGWRYM+GVS P++I+MG+GMWWLPASPRW+LL AIQGKGD+   +E A+  
Sbjct  195   GSLFVDTEAGWRYMFGVSSPVAIIMGVGMWWLPASPRWLLLRAIQGKGDVQDSKEIAIRS  254

Query  945   LCRLRGATIGDSAHH  901
             L +LRG   GDSA  
Sbjct  255   LRQLRGQASGDSAQQ  269



>ref|XP_010558647.1| PREDICTED: D-xylose-proton symporter-like 2 [Tarenaya hassleriana]
 ref|XP_010558648.1| PREDICTED: D-xylose-proton symporter-like 2 [Tarenaya hassleriana]
Length=501

 Score =   226 bits (575),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 165/212 (78%), Positives = 192/212 (91%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            A++GE+FQGKCLKAL IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADAT AS+ LG
Sbjct  290  ASLGELFQGKCLKALFIGGGLVLFQQITGQPSVLYYAPSILQTAGFSAAADATSASVLLG  349

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            +LKLIMTGVAVVV+D+LGRRPLLLGGVSG+ V+LFLLGSYY F  +   VAV+ALLLYVG
Sbjct  350  ILKLIMTGVAVVVIDKLGRRPLLLGGVSGMGVSLFLLGSYYIFFGDASSVAVVALLLYVG  409

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISEIFPL++RGRGLSIAVLVNFG NALVTFAFSP+KE++GAG +F+ 
Sbjct  410  CYQLSFGPIGWLMISEIFPLKLRGRGLSIAVLVNFGANALVTFAFSPLKEMLGAGILFYG  469

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVI +++++F+FFI+PETKGLTLEEIEAK L
Sbjct  470  FGVICLLSLLFIFFIVPETKGLTLEEIEAKCL  501


 Score =   115 bits (288),  Expect(2) = 3e-84, Method: Compositional matrix adjust.
 Identities = 51/83 (61%), Positives = 66/83 (80%), Gaps = 2/83 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GS++V + +GWRYMY   VP+S++MG+GMWWLPASPRW+LLCAIQG+G+M  LRE A+S
Sbjct  197   IGSILVNIGSGWRYMYAAIVPVSVIMGVGMWWLPASPRWLLLCAIQGRGEMEDLREAAIS  256

Query  948   CLCRLRGATIGDSAHHPSR*NSV  880
              L RLRG  IGDSA  P + N +
Sbjct  257   SLSRLRGPAIGDSA--PEQVNEI  277



>ref|XP_011470132.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=495

 Score =   222 bits (566),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT  EMF GKC KAL IGAGL+LFQQITGQPSVLYYAA IFQ AGF+AA+DATR SI LG
Sbjct  284  ATFLEMFHGKCKKALVIGAGLVLFQQITGQPSVLYYAASIFQSAGFSAASDATRVSIVLG  343

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            L KL+MTGVAV+VVDRLGRRPLLL GVSG+ ++LFLLGSYY F D+ P VAVIALL YVG
Sbjct  344  LFKLVMTGVAVLVVDRLGRRPLLLTGVSGMVISLFLLGSYYLFFDDTPAVAVIALLAYVG  403

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQ SFGPIGWLMISEIFPLR+RGRGLSIAVLVNF  NALVTF+FSP++  +GAG VF+I
Sbjct  404  CYQFSFGPIGWLMISEIFPLRLRGRGLSIAVLVNFAANALVTFSFSPLEAWLGAGIVFYI  463

Query  308  fgviavvavifvffiIPETKGLTLEEIEAK  219
            FG IAV +++F+FFI+PETKGLTLEEIE K
Sbjct  464  FGAIAVASLVFIFFIVPETKGLTLEEIETK  493


 Score =   118 bits (295),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V +V GWRYMYG SVP++++MGIGMWWLP SPRWILL AIQGKG+M  L++ A+S
Sbjct  191   IGSLLVSIVGGWRYMYGASVPLAVIMGIGMWWLPESPRWILLRAIQGKGNMNDLKQNAIS  250

Query  948   CLCRLRGATIGDSA  907
             CL RLRG  IGDSA
Sbjct  251   CLFRLRGTIIGDSA  264



>ref|XP_004307871.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=497

 Score =   222 bits (566),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 164/210 (78%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT  EMF GKC KAL IGAGL+LFQQITGQPSVLYYAA IFQ AGF+AA+DATR SI LG
Sbjct  286  ATFLEMFHGKCKKALVIGAGLVLFQQITGQPSVLYYAASIFQSAGFSAASDATRVSIVLG  345

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            L KL+MTGVAV+VVDRLGRRPLLL GVSG+ ++LFLLGSYY F D+ P VAVIALL YVG
Sbjct  346  LFKLVMTGVAVLVVDRLGRRPLLLTGVSGMVISLFLLGSYYLFFDDTPAVAVIALLAYVG  405

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQ SFGPIGWLMISEIFPLR+RGRGLSIAVLVNF  NALVTF+FSP++  +GAG VF+I
Sbjct  406  CYQFSFGPIGWLMISEIFPLRLRGRGLSIAVLVNFAANALVTFSFSPLEAWLGAGIVFYI  465

Query  308  fgviavvavifvffiIPETKGLTLEEIEAK  219
            FG IAV +++F+FFI+PETKGLTLEEIE K
Sbjct  466  FGAIAVASLVFIFFIVPETKGLTLEEIETK  495


 Score =   118 bits (295),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 52/74 (70%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V +V GWRYMYG SVP++++MGIGMWWLP SPRWILL AIQGKG+M  L++ A+S
Sbjct  193   IGSLLVSIVGGWRYMYGASVPLAVIMGIGMWWLPESPRWILLRAIQGKGNMNDLKQNAIS  252

Query  948   CLCRLRGATIGDSA  907
             CL RLRG  IGDSA
Sbjct  253   CLFRLRGTIIGDSA  266



>ref|XP_003537722.1| PREDICTED: D-xylose-proton symporter-like 2-like isoform X1 [Glycine 
max]
Length=501

 Score =   232 bits (591),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 181/229 (79%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDEIL+ELS+L EEKEAT GE+FQGKCLKAL IG+GL+LFQQITGQPSVLYYA  IFQ 
Sbjct  273  QVDEILAELSYLGEEKEATFGELFQGKCLKALWIGSGLVLFQQITGQPSVLYYAGSIFQS  332

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ A+DATR SI LG  KLIMTGVAVVVVD+LGRRPLLLGGVSGI ++LF LGSYY F
Sbjct  333  AGFSGASDATRVSILLGFFKLIMTGVAVVVVDKLGRRPLLLGGVSGIVISLFFLGSYYIF  392

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            LDN P VAVI LLLYVG YQ+SFGPIGWLMI+EIFPLR+RGRGLSIAVLVNFG NALVTF
Sbjct  393  LDNSPVVAVIGLLLYVGSYQISFGPIGWLMIAEIFPLRLRGRGLSIAVLVNFGANALVTF  452

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+K L+GAG +F+ F VIAV +++F++F+IPETKGLTLEEIEAK L
Sbjct  453  AFSPLKALLGAGILFYTFCVIAVASLVFIYFVIPETKGLTLEEIEAKCL  501


 Score =   108 bits (270),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL VE V+GWRYMYGVS P++I+MG+GMWWLPASPRW+LL AIQGKGD+   ++ A+ 
Sbjct  197   IGSLFVETVSGWRYMYGVSSPVAIIMGVGMWWLPASPRWLLLRAIQGKGDVQNSKDIAIR  256

Query  948   CLCRLRGATIGDS  910
              LC+LRG    DS
Sbjct  257   SLCQLRGQAFYDS  269



>gb|KHN05527.1| D-xylose-proton symporter-like 2 [Glycine soja]
Length=501

 Score =   232 bits (591),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 181/229 (79%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDEIL+ELS+L EEKEAT GE+FQGKCLKAL IG+GL+LFQQITGQPSVLYYA  IFQ 
Sbjct  273  QVDEILAELSYLGEEKEATFGELFQGKCLKALWIGSGLVLFQQITGQPSVLYYAGSIFQS  332

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ A+DATR SI LG  KLIMTGVAVVVVD+LGRRPLLLGGVSGI ++LF LGSYY F
Sbjct  333  AGFSGASDATRVSILLGFFKLIMTGVAVVVVDKLGRRPLLLGGVSGIVISLFFLGSYYIF  392

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            LDN P VAVI LLLYVG YQ+SFGPIGWLMI+EIFPLR+RGRGLSIAVLVNFG NALVTF
Sbjct  393  LDNSPVVAVIGLLLYVGSYQISFGPIGWLMIAEIFPLRLRGRGLSIAVLVNFGANALVTF  452

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+K L+GAG +F+ F VIAV +++F++F+IPETKGLTLEEIEAK L
Sbjct  453  AFSPLKALLGAGILFYTFCVIAVASLVFIYFVIPETKGLTLEEIEAKCL  501


 Score =   108 bits (270),  Expect(2) = 5e-84, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL VE V+GWRYMYGVS P++I+MG+GMWWLPASPRW+LL AIQGKGD+   ++ A+ 
Sbjct  197   IGSLFVETVSGWRYMYGVSSPVAIIMGVGMWWLPASPRWLLLRAIQGKGDVQNSKDIAIR  256

Query  948   CLCRLRGATIGDS  910
              LC+LRG    DS
Sbjct  257   SLCQLRGQAFYDS  269



>ref|XP_010671130.1| PREDICTED: D-xylose-proton symporter-like 2 [Beta vulgaris subsp. 
vulgaris]
Length=502

 Score =   217 bits (552),  Expect(2) = 6e-84, Method: Compositional matrix adjust.
 Identities = 166/226 (73%), Positives = 197/226 (87%), Gaps = 0/226 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDEI++ELS   E    +  EMF+GK LKAL IG GL+LFQQITGQPSVLYYAA I + 
Sbjct  275  QVDEIMAELSLAGELNNVSTTEMFRGKYLKALVIGCGLVLFQQITGQPSVLYYAASILKS  334

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+AA+DATR SI LG  KLIMTGVAV+VVD+LGRRPLLLGGVSG+ ++L  LG+YYTF
Sbjct  335  AGFSAASDATRVSILLGFFKLIMTGVAVLVVDKLGRRPLLLGGVSGMVISLLFLGAYYTF  394

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            L + P +AV+ LLLYVGCYQLS+GPIGWLMISEIFPLR+RGRG+S+AVL+NFG NALVTF
Sbjct  395  LGDAPAIAVVGLLLYVGCYQLSYGPIGWLMISEIFPLRMRGRGISLAVLMNFGANALVTF  454

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEA  222
            AFSP+K+L+GAG VFF+FG IAV++++F+FFIIPETKGLTLEEIEA
Sbjct  455  AFSPLKDLIGAGAVFFMFGGIAVLSLVFIFFIIPETKGLTLEEIEA  500


 Score =   123 bits (308),  Expect(2) = 6e-84, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GS +V V+AGWRYMYG+S P+S++M IGMWWLP SPRW+LLCAIQGKG++P LRE A+S
Sbjct  199   IGSFLVNVIAGWRYMYGLSSPLSVIMAIGMWWLPDSPRWLLLCAIQGKGNVPDLRENAIS  258

Query  948   CLCRLRGATIGDSAHH  901
             C+CRLRG  + D+A  
Sbjct  259   CMCRLRGRAVSDTASQ  274



>ref|XP_003540611.1| PREDICTED: D-xylose-proton symporter-like 2-like [Glycine max]
Length=497

 Score =   233 bits (594),  Expect(2) = 9e-84, Method: Compositional matrix adjust.
 Identities = 181/229 (79%), Positives = 205/229 (90%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDEIL+ELS+L EEKEAT GE+FQGKCLKAL IGAGL+LFQQITGQPSVLYYA  IFQ 
Sbjct  269  QVDEILAELSYLGEEKEATFGELFQGKCLKALWIGAGLVLFQQITGQPSVLYYAGSIFQS  328

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ A+DATR SI LG+ KLIMTGVAVVVVD+LGRRPLLLGGVSGI ++LF LGSYY F
Sbjct  329  AGFSGASDATRVSILLGVFKLIMTGVAVVVVDKLGRRPLLLGGVSGIVISLFFLGSYYIF  388

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            LDN P VAV+ LLLYVG YQ+SFGPIGWLMI+EIFPLR+RGRGLSIAVLVNFG NALVTF
Sbjct  389  LDNTPVVAVVGLLLYVGSYQISFGPIGWLMIAEIFPLRLRGRGLSIAVLVNFGANALVTF  448

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+K L+GAG +F+ FGVIAV +++F++ +IPETKGLTLEEIEAK L
Sbjct  449  AFSPLKALLGAGILFYTFGVIAVTSLVFIYLVIPETKGLTLEEIEAKCL  497


 Score =   106 bits (264),  Expect(2) = 9e-84, Method: Compositional matrix adjust.
 Identities = 46/73 (63%), Positives = 58/73 (79%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL VE VAGWRYMYGVS P++I+MG+GMWWLPASPRW+LL AIQGKGD+   ++  + 
Sbjct  193   IGSLFVETVAGWRYMYGVSSPMAIIMGLGMWWLPASPRWLLLRAIQGKGDVQNSKDIVIR  252

Query  948   CLCRLRGATIGDS  910
              LC+L+G    DS
Sbjct  253   SLCQLQGQAFNDS  265



>ref|XP_006590767.1| PREDICTED: D-xylose-proton symporter-like 2-like isoform X2 [Glycine 
max]
Length=435

 Score =   231 bits (589),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 181/229 (79%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDEIL+ELS+L EEKEAT GE+FQGKCLKAL IG+GL+LFQQITGQPSVLYYA  IFQ 
Sbjct  207  QVDEILAELSYLGEEKEATFGELFQGKCLKALWIGSGLVLFQQITGQPSVLYYAGSIFQS  266

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ A+DATR SI LG  KLIMTGVAVVVVD+LGRRPLLLGGVSGI ++LF LGSYY F
Sbjct  267  AGFSGASDATRVSILLGFFKLIMTGVAVVVVDKLGRRPLLLGGVSGIVISLFFLGSYYIF  326

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            LDN P VAVI LLLYVG YQ+SFGPIGWLMI+EIFPLR+RGRGLSIAVLVNFG NALVTF
Sbjct  327  LDNSPVVAVIGLLLYVGSYQISFGPIGWLMIAEIFPLRLRGRGLSIAVLVNFGANALVTF  386

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+K L+GAG +F+ F VIAV +++F++F+IPETKGLTLEEIEAK L
Sbjct  387  AFSPLKALLGAGILFYTFCVIAVASLVFIYFVIPETKGLTLEEIEAKCL  435


 Score =   107 bits (268),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 47/73 (64%), Positives = 59/73 (81%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL VE V+GWRYMYGVS P++I+MG+GMWWLPASPRW+LL AIQGKGD+   ++ A+ 
Sbjct  131   IGSLFVETVSGWRYMYGVSSPVAIIMGVGMWWLPASPRWLLLRAIQGKGDVQNSKDIAIR  190

Query  948   CLCRLRGATIGDS  910
              LC+LRG    DS
Sbjct  191   SLCQLRGQAFYDS  203



>ref|XP_010933396.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Elaeis 
guineensis]
Length=501

 Score =   228 bits (582),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 202/229 (88%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVD IL ELS+  +EK+ TI E+F+GKCLKAL IGAGL+ FQQ+TGQPSVLYYAA I Q 
Sbjct  273  QVDSILDELSYADQEKQVTISEIFKGKCLKALIIGAGLVFFQQVTGQPSVLYYAATILQT  332

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+AA+DATR S+ LGLLKL+MTG+AV+VVDR+GRRPLL+GGVSGI ++LFLL SYYT 
Sbjct  333  AGFSAASDATRVSVLLGLLKLVMTGIAVLVVDRVGRRPLLIGGVSGIVISLFLLSSYYTL  392

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            L + P VAVIALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRGLSIAVLVNF +NALVTF
Sbjct  393  LKDSPFVAVIALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRGLSIAVLVNFASNALVTF  452

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP++ LVG G +F  FGVIAV +++F+FF++PETKGLTLEEIEAK L
Sbjct  453  AFSPLEALVGTGILFAGFGVIAVASLLFIFFVVPETKGLTLEEIEAKIL  501


 Score =   110 bits (275),  Expect(2) = 1e-83, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -2

Query  1125  GSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSC  946
             GSL V++VAGWRYMY  S P+S++MGIG+WWLP SPRW+LLCAIQGK +M   +E AV C
Sbjct  198   GSLFVDLVAGWRYMYATSAPVSLIMGIGIWWLPPSPRWLLLCAIQGKRNMLDAKEFAVCC  257

Query  945   LCRLRGATIGDSAHH  901
             LCRLRG  I  SA  
Sbjct  258   LCRLRGQAIDSSASE  272



>ref|XP_008455658.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Cucumis 
melo]
Length=408

 Score =   224 bits (571),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            A+IGE+FQGKCLKAL IGAGL+LFQQITGQPSVLYYA  IFQ AGF+AAADATR SI LG
Sbjct  197  ASIGEIFQGKCLKALIIGAGLVLFQQITGQPSVLYYAPSIFQSAGFSAAADATRVSILLG  256

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKL+MTG AV+VVDRLGRRPLLLGGV GI ++LFLLGSYY FL NVP VAV+ALLLYVG
Sbjct  257  LLKLLMTGAAVLVVDRLGRRPLLLGGVFGIVISLFLLGSYYLFLGNVPAVAVVALLLYVG  316

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
             YQLSFGPIGWLMISE+FPLR+RGRGLSIAVLVNFG NALVTFAFSP+KEL+GAG +FFI
Sbjct  317  SYQLSFGPIGWLMISEVFPLRLRGRGLSIAVLVNFGANALVTFAFSPLKELLGAGILFFI  376

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGV+A+++++F+FFI+PETKGLTLEEIEA+ L
Sbjct  377  FGVVAILSLVFIFFIVPETKGLTLEEIEARCL  408


 Score =   114 bits (284),  Expect(2) = 2e-83, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+VEVVAGWRY+Y  +  I+ VMG+GMWWLP+SPRW+LLCAIQ KG+M  L+E A+S
Sbjct  104   IGSLLVEVVAGWRYIYAANTAIASVMGVGMWWLPSSPRWLLLCAIQRKGNMAELKEQAIS  163

Query  948   CLCRLRGATIGDSAHH  901
             CL RLRGA IG+ A  
Sbjct  164   CLHRLRGAVIGEKASE  179



>ref|XP_003607412.1| D-xylose-proton symporter-like protein [Medicago truncatula]
 ref|XP_003607415.1| D-xylose-proton symporter-like protein [Medicago truncatula]
 gb|AES89609.1| sugar porter (SP) family MFS transporter [Medicago truncatula]
Length=501

 Score =   227 bits (578),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 173/229 (76%), Positives = 202/229 (88%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDEI++E S+L EE + T+GEMF+GKC KAL I AGL+LFQQITGQPSVLYYAA I Q 
Sbjct  273  QVDEIMAEFSYLGEENDVTLGEMFRGKCRKALVISAGLVLFQQITGQPSVLYYAASILQS  332

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ AADATR SI LG+ KLIMTGVAVVVVDRLGRRPLLLGGVSGI ++LFLLGSYY F
Sbjct  333  AGFSLAADATRVSILLGVFKLIMTGVAVVVVDRLGRRPLLLGGVSGIVISLFLLGSYYIF  392

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            LDN   +AV+ LLLYVGCYQ+SFGP+GWLMI+EIFPLR+RG+GLSIAVLVNF  NALVTF
Sbjct  393  LDNAAVLAVVGLLLYVGCYQISFGPMGWLMIAEIFPLRLRGKGLSIAVLVNFAANALVTF  452

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+K+L+GAG +F+IF  IAV +++F++FI+PETKGLTLEEIEAK L
Sbjct  453  AFSPLKDLLGAGILFYIFSAIAVASLVFIYFIVPETKGLTLEEIEAKCL  501


 Score =   110 bits (276),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V+ VAGWRYM+G+S P++++MG GMWWLPASPRWILL AIQ KGD+  L++TA+ 
Sbjct  197   LGSLLVDTVAGWRYMFGISSPVAVIMGFGMWWLPASPRWILLRAIQKKGDLQTLKDTAIR  256

Query  948   CLCRLRGATIGDSA  907
              LC+L+G T  DSA
Sbjct  257   SLCQLQGRTFHDSA  270



>ref|XP_008455657.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Cucumis 
melo]
Length=502

 Score =   224 bits (570),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 173/212 (82%), Positives = 196/212 (92%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            A+IGE+FQGKCLKAL IGAGL+LFQQITGQPSVLYYA  IFQ AGF+AAADATR SI LG
Sbjct  291  ASIGEIFQGKCLKALIIGAGLVLFQQITGQPSVLYYAPSIFQSAGFSAAADATRVSILLG  350

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKL+MTG AV+VVDRLGRRPLLLGGV GI ++LFLLGSYY FL NVP VAV+ALLLYVG
Sbjct  351  LLKLLMTGAAVLVVDRLGRRPLLLGGVFGIVISLFLLGSYYLFLGNVPAVAVVALLLYVG  410

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
             YQLSFGPIGWLMISE+FPLR+RGRGLSIAVLVNFG NALVTFAFSP+KEL+GAG +FFI
Sbjct  411  SYQLSFGPIGWLMISEVFPLRLRGRGLSIAVLVNFGANALVTFAFSPLKELLGAGILFFI  470

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGV+A+++++F+FFI+PETKGLTLEEIEA+ L
Sbjct  471  FGVVAILSLVFIFFIVPETKGLTLEEIEARCL  502


 Score =   114 bits (284),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+VEVVAGWRY+Y  +  I+ VMG+GMWWLP+SPRW+LLCAIQ KG+M  L+E A+S
Sbjct  198   IGSLLVEVVAGWRYIYAANTAIASVMGVGMWWLPSSPRWLLLCAIQRKGNMAELKEQAIS  257

Query  948   CLCRLRGATIGDSAHH  901
             CL RLRGA IG+ A  
Sbjct  258   CLHRLRGAVIGEKASE  273



>gb|KDO39943.1| hypothetical protein CISIN_1g0102391mg, partial [Citrus sinensis]
Length=453

 Score =   219 bits (557),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 180/201 (90%), Gaps = 0/201 (0%)
 Frame = -3

Query  926  QQLGIRHIIQVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVL  747
            Q +G     +VDEIL+ELS++ E+KE ++ E+F GKCLKAL IGAGL+LFQQITGQPSVL
Sbjct  235  QSIGDSAPTEVDEILTELSYVGEDKEVSLREVFHGKCLKALIIGAGLVLFQQITGQPSVL  294

Query  746  YYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVAL  567
            YYAA I Q AGF+AA+DATR SI LGL KLIMTG+AV+VV+RLGRRPLLLGGVSGI ++L
Sbjct  295  YYAASILQSAGFSAASDATRVSILLGLFKLIMTGLAVLVVERLGRRPLLLGGVSGIVISL  354

Query  566  FLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVN  387
            FLLGSYY FLD+VP VAV+ALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRGLS+AVLVN
Sbjct  355  FLLGSYYLFLDDVPAVAVVALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRGLSVAVLVN  414

Query  386  FGTNALVTFAFSPMKELVGAG  324
            FG NALVTFAFSP+K+L+GAG
Sbjct  415  FGANALVTFAFSPLKDLLGAG  435


 Score =   119 bits (297),  Expect(2) = 3e-83, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = -2

Query  1113  VEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSCLCRL  934
             V++VAGWRYMYG S P++++MG+GMWWLPASPRW+LLCA++ KGDM  LRE+A+SCLCRL
Sbjct  173   VDLVAGWRYMYGASTPLAVIMGMGMWWLPASPRWLLLCAMKRKGDMQDLRESAISCLCRL  232

Query  933   RGATIGDSA  907
             RG +IGDSA
Sbjct  233   RGQSIGDSA  241



>ref|XP_010453878.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010453879.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010453880.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010453881.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
Length=502

 Score =   229 bits (585),  Expect(2) = 7e-83, Method: Compositional matrix adjust.
 Identities = 167/211 (79%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
            T GE+FQGKCLKAL IG GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LGL
Sbjct  292  TFGELFQGKCLKALIIGGGLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLGL  351

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
            LKLIMTGVAVVV+DRLGRRPLLLGGV G+ V+LFLLGSYY F    P VAV+ALLLYVGC
Sbjct  352  LKLIMTGVAVVVIDRLGRRPLLLGGVGGMVVSLFLLGSYYLFFSASPVVAVVALLLYVGC  411

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQLSFGPIGWLMISEIFPL++RGRGLS+AVLVNFG NA+VTFAFSP+KEL+GAG +F  F
Sbjct  412  YQLSFGPIGWLMISEIFPLKLRGRGLSLAVLVNFGANAIVTFAFSPLKELLGAGILFCAF  471

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            GVI V++++F+FFI+PETKGLTLEEIEAK L
Sbjct  472  GVICVLSLVFIFFIVPETKGLTLEEIEAKCL  502


 Score =   107 bits (266),  Expect(2) = 7e-83, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V +++GWRYMY  SVP++++MGIGMWWLPASPRW+LL  IQGKG++   RE A+ 
Sbjct  198   IGSLTVNILSGWRYMYATSVPLAVIMGIGMWWLPASPRWLLLRVIQGKGNVENQREAAIK  257

Query  948   CLCRLRGATIGDSAHH  901
              LCRLRG    DSA  
Sbjct  258   SLCRLRGPAFVDSAAE  273



>gb|AFK39030.1| unknown [Medicago truncatula]
Length=501

 Score =   225 bits (574),  Expect(2) = 7e-83, Method: Compositional matrix adjust.
 Identities = 172/229 (75%), Positives = 201/229 (88%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDEI++E S+L EE + T+GEMF+GKC KAL I AGL+LFQQITGQPSVLYYAA I Q 
Sbjct  273  QVDEIMAEFSYLGEENDVTLGEMFRGKCRKALVISAGLVLFQQITGQPSVLYYAASILQS  332

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ AADATR SI LG+ KLIMTGVAVVVVDRLGRRPLLLGGVSGI ++LFLLGSYY F
Sbjct  333  AGFSLAADATRVSILLGVFKLIMTGVAVVVVDRLGRRPLLLGGVSGIVISLFLLGSYYIF  392

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            LDN   +AV+ LLLYVGCYQ+SFGP+GWLMI+EIFPLR+RG+GLSIAV VNF  NALVTF
Sbjct  393  LDNAAVLAVVGLLLYVGCYQISFGPMGWLMIAEIFPLRLRGKGLSIAVFVNFAANALVTF  452

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+K+L+GAG +F+IF  IAV +++F++FI+PETKGLTLEEIEAK L
Sbjct  453  AFSPLKDLLGAGILFYIFSAIAVASLVFIYFIVPETKGLTLEEIEAKCL  501


 Score =   110 bits (276),  Expect(2) = 7e-83, Method: Compositional matrix adjust.
 Identities = 47/74 (64%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V+ VAGWRYM+G+S P++++MG GMWWLPASPRWILL AIQ KGD+  L++TA+ 
Sbjct  197   LGSLLVDTVAGWRYMFGISSPVAVIMGFGMWWLPASPRWILLRAIQKKGDLQTLKDTAIR  256

Query  948   CLCRLRGATIGDSA  907
              LC+L+G T  DSA
Sbjct  257   SLCQLQGRTFHDSA  270



>gb|KFK25925.1| hypothetical protein AALP_AA8G181200 [Arabis alpina]
Length=504

 Score =   229 bits (585),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 203/229 (89%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDEIL+ELS + E+KEAT GE+FQGKC KAL IG GL+LFQQITGQPSVLYYA  I Q 
Sbjct  276  QVDEILAELSFVGEDKEATFGELFQGKCSKALIIGGGLVLFQQITGQPSVLYYAPSILQT  335

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+AA DATR SI LGLLKLIMTG+AVVV+DRLGRRPLLLGGV G+ V+LFLLGSYY F
Sbjct  336  AGFSAAGDATRVSILLGLLKLIMTGIAVVVIDRLGRRPLLLGGVGGMVVSLFLLGSYYIF  395

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
                P VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRGLSIAVLVNFG NA+VTF
Sbjct  396  FSASPVVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRGLSIAVLVNFGANAIVTF  455

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            +FSP+KEL+GAG +FF FGVI V++++F+FFI+PETKGLTLEEIEAK L
Sbjct  456  SFSPLKELLGAGILFFGFGVICVLSLVFIFFIVPETKGLTLEEIEAKCL  504


 Score =   106 bits (264),  Expect(2) = 1e-82, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V +++GWRYMY  SVP+++VMGIGMWWLPASPRW+LL  IQGKG++   +E A+ 
Sbjct  200   IGSLTVNILSGWRYMYATSVPLAVVMGIGMWWLPASPRWLLLRVIQGKGNVENQKEAAIK  259

Query  948   CLCRLRGATIGDSA  907
              LCRLRG    DSA
Sbjct  260   SLCRLRGPAFVDSA  273



>ref|XP_010420407.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010420408.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010420410.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
 ref|XP_010420411.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
Length=502

 Score =   228 bits (582),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 167/211 (79%), Positives = 186/211 (88%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
            T GE+FQGKCLKAL IG GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LGL
Sbjct  292  TFGELFQGKCLKALIIGGGLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLGL  351

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
            LKLIMTGVAVVV+DRLGRRPLLLGGV G+ V+LFLLGSYY F    P VAV+ALLLYVGC
Sbjct  352  LKLIMTGVAVVVIDRLGRRPLLLGGVGGMVVSLFLLGSYYLFFSASPVVAVVALLLYVGC  411

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQLSFGPIGWL+ISEIFPL++RGRGLS+AVLVNFG NALVTFAFSP+KEL+GAG +F  F
Sbjct  412  YQLSFGPIGWLIISEIFPLKLRGRGLSLAVLVNFGANALVTFAFSPLKELLGAGILFCAF  471

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            GVI V+++ F+FFI+PETKGLTLEEIEAK L
Sbjct  472  GVICVLSLFFIFFIVPETKGLTLEEIEAKCL  502


 Score =   107 bits (266),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V +++GWRYMY  SVP++++MGIGMWWLPASPRW+LL  IQGKG++   RE A+ 
Sbjct  198   IGSLTVNILSGWRYMYATSVPLAVIMGIGMWWLPASPRWLLLRVIQGKGNVENQREAAIK  257

Query  948   CLCRLRGATIGDSAHH  901
              LCRLRG    DSA  
Sbjct  258   SLCRLRGPAFVDSAAE  273



>ref|XP_008809219.1| PREDICTED: LOW QUALITY PROTEIN: D-xylose-proton symporter-like 
2 [Phoenix dactylifera]
Length=502

 Score =   221 bits (563),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 168/229 (73%), Positives = 199/229 (87%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVD IL ELS+  +EK+ T+ E+FQGKCLKAL IGAGL+ FQQ+TGQPSVLYYAA I Q 
Sbjct  274  QVDSILDELSYSDQEKQVTLSEIFQGKCLKALIIGAGLVFFQQVTGQPSVLYYAATILQS  333

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+AA+DATR S+ LGLLKL+MTG+AV+VVDR+GRRPLL+GGVSGI ++LFLL SYYT 
Sbjct  334  AGFSAASDATRVSVLLGLLKLVMTGIAVLVVDRVGRRPLLIGGVSGIVISLFLLSSYYTL  393

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
              +   VAVIALLLYVGCYQLSFGPIGWLMISEIFPLR+RGRGLSIAVLVNF +NALVTF
Sbjct  394  FKDSAFVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRLRGRGLSIAVLVNFASNALVTF  453

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            +FSP++ LVG G +F  FGVIAV +++F+FF++PETKGLTLE+IE K L
Sbjct  454  SFSPLEALVGTGILFAGFGVIAVASLVFIFFVVPETKGLTLEDIETKIL  502


 Score =   114 bits (285),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 50/75 (67%), Positives = 59/75 (79%), Gaps = 0/75 (0%)
 Frame = -2

Query  1125  GSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSC  946
             GSL V++VAGWRYMY  S P+S++MGIGMWWLP SPRW+LLCAIQGK +MP  +E AV C
Sbjct  199   GSLFVDLVAGWRYMYATSAPVSLIMGIGMWWLPPSPRWLLLCAIQGKRNMPEAKEFAVCC  258

Query  945   LCRLRGATIGDSAHH  901
             LC+LRG  I  SA  
Sbjct  259   LCQLRGQAIDSSASE  273



>ref|XP_002873804.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50063.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=502

 Score =   228 bits (582),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
            T GE+F GKCLKAL IG GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LGL
Sbjct  292  TFGELFHGKCLKALIIGGGLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLGL  351

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
            LKLIMTGVAVVV+DRLGRRPLLLGGVSG+ V+LFLLGSYY F    P VAV+ALLLYVGC
Sbjct  352  LKLIMTGVAVVVIDRLGRRPLLLGGVSGMVVSLFLLGSYYLFFSASPVVAVVALLLYVGC  411

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQLSFGPIGWLMISEIFPL++RGRGLS+AVLVNFG NALVTFAFSP+KEL+GAG +F  F
Sbjct  412  YQLSFGPIGWLMISEIFPLKLRGRGLSLAVLVNFGANALVTFAFSPLKELLGAGILFCGF  471

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            GVI V++++F+FFI+PETKGLTLEEIEAK L
Sbjct  472  GVICVLSLVFIFFIVPETKGLTLEEIEAKCL  502


 Score =   106 bits (264),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V + +GWRYMY  SVP++++MGIGMWWLPASPRW+LL  IQGKG++   RE+A+ 
Sbjct  198   IGSLTVNIHSGWRYMYATSVPLAVIMGIGMWWLPASPRWLLLRVIQGKGNVENQRESAIK  257

Query  948   CLCRLRGATIGDSA  907
              LCRLRG    DSA
Sbjct  258   SLCRLRGPAFVDSA  271



>ref|XP_006287575.1| hypothetical protein CARUB_v10000784mg [Capsella rubella]
 gb|EOA20473.1| hypothetical protein CARUB_v10000784mg [Capsella rubella]
Length=502

 Score =   230 bits (586),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 179/229 (78%), Positives = 202/229 (88%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDEIL+ELS + E+KE T GE+F+GKCLKAL IG GL+LFQQITGQPSVLYYA  I Q 
Sbjct  274  QVDEILAELSFVGEDKEVTFGELFEGKCLKALIIGGGLVLFQQITGQPSVLYYAPSILQT  333

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+AA DATR SI LGLLKLIMTGVAVVV+DRLGRRPLLLGGV G+ V+LFLLGSYY F
Sbjct  334  AGFSAAGDATRVSILLGLLKLIMTGVAVVVIDRLGRRPLLLGGVGGMVVSLFLLGSYYLF  393

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
                P VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRGLS+AVLVNFG NALVTF
Sbjct  394  FSASPVVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRGLSLAVLVNFGANALVTF  453

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+KEL+GAG +F  FGVI V++++F+FFI+PETKGLTLEEIEAK L
Sbjct  454  AFSPLKELLGAGILFCAFGVICVLSLLFIFFIVPETKGLTLEEIEAKCL  502


 Score =   104 bits (260),  Expect(2) = 2e-82, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V +++GWRYMY  SVP++++MGIGMWWLPASPRW+LL  IQGKG++   +E A+ 
Sbjct  198   IGSLTVNILSGWRYMYATSVPLAVIMGIGMWWLPASPRWLLLRVIQGKGNVENQKEAAIK  257

Query  948   CLCRLRGATIGDSAHH  901
              +CRLRG    DSA  
Sbjct  258   SICRLRGPAFVDSAAE  273



>ref|XP_004309072.1| PREDICTED: D-xylose-proton symporter-like 2 [Fragaria vesca subsp. 
vesca]
Length=498

 Score =   218 bits (554),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 182/212 (86%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT+GEMF GKC KAL IGAGL+LFQQITGQPSVLYYAA I Q AGF+AAADATR SI LG
Sbjct  287  ATLGEMFHGKCKKALVIGAGLVLFQQITGQPSVLYYAASILQSAGFSAAADATRVSILLG  346

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            L KL+MTG AV+VVDR GRRPLLLGGVSG+ ++LF+LGSYY FL+  P VA IALLLYVG
Sbjct  347  LFKLVMTGSAVLVVDRFGRRPLLLGGVSGMVISLFMLGSYYLFLNEAPAVAAIALLLYVG  406

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISEIFPLR RG+GLSI VLVNF  NALVT AFSP+K  +GAG +F++
Sbjct  407  CYQLSFGPIGWLMISEIFPLRFRGQGLSIGVLVNFAANALVTLAFSPLKAWLGAGLLFYV  466

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FG IAV ++ F+FFI+PETKGL+LEEIE + L
Sbjct  467  FGAIAVASLAFIFFIVPETKGLSLEEIEEQCL  498


 Score =   115 bits (287),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 50/74 (68%), Positives = 62/74 (84%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS +V++  GWRYMYG S+P++++MGIGMW LP SPRWILLCAIQGKG+M  L+E+A+ 
Sbjct  194   VGSALVDIFGGWRYMYGASIPLAVIMGIGMWCLPESPRWILLCAIQGKGNMHDLKESAIR  253

Query  948   CLCRLRGATIGDSA  907
             CL RLRG  IGDSA
Sbjct  254   CLYRLRGKAIGDSA  267



>emb|CDX92030.1| BnaC03g33320D [Brassica napus]
Length=502

 Score =   239 bits (611),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 205/229 (90%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDEIL+ELS + E+KEATIGE+FQGKCLKALTI  GL+LFQQITGQPSVLYYA  I Q 
Sbjct  274  QVDEILAELSSVGEDKEATIGELFQGKCLKALTIAGGLVLFQQITGQPSVLYYAPSILQT  333

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+AA DATR SI LG+LKL+MTGVA+VV+D+LGRRPLLLGGVSG+ ++LFLLGSYY F
Sbjct  334  AGFSAATDATRISILLGILKLVMTGVAIVVIDKLGRRPLLLGGVSGMVISLFLLGSYYIF  393

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
             +NVP VAV ALLLYVGCYQLSFGPI WLM+SEIFPL++RGRG+SIAVLVNFGTNALVTF
Sbjct  394  YNNVPAVAVAALLLYVGCYQLSFGPISWLMMSEIFPLKLRGRGISIAVLVNFGTNALVTF  453

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSPMKEL+GAG +F  FG I V+++ F++FI+PETKGLTLEEIEAK L
Sbjct  454  AFSPMKELLGAGVLFCGFGAICVLSLFFIYFIVPETKGLTLEEIEAKCL  502


 Score = 93.2 bits (230),  Expect(2) = 9e-82, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 56/74 (76%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V V++GWRYMY   +P+ I+M IGM WLPASPRW+LL ++QGKGD   L++ A+ 
Sbjct  198   IGSLWVTVISGWRYMYATVIPVPIIMAIGMCWLPASPRWLLLRSLQGKGDAESLQDEAIK  257

Query  948   CLCRLRGATIGDSA  907
              L RLRG+ + DSA
Sbjct  258   SLRRLRGSVVVDSA  271



>ref|NP_850835.2| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 ref|NP_850836.2| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 sp|Q6AWX0.1|XYLL2_ARATH RecName: Full=D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 gb|AAT85724.1| At5g17010 [Arabidopsis thaliana]
 dbj|BAF00329.1| sugar transporter like protein [Arabidopsis thaliana]
 gb|AED92369.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 gb|AED92370.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
Length=503

 Score =   229 bits (585),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 168/211 (80%), Positives = 187/211 (89%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
            T GE+FQGKCLKAL IG GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LGL
Sbjct  293  TFGELFQGKCLKALIIGGGLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLGL  352

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
            LKLIMTGVAVVV+DRLGRRPLLLGGV G+ V+LFLLGSYY F    P VAV+ALLLYVGC
Sbjct  353  LKLIMTGVAVVVIDRLGRRPLLLGGVGGMVVSLFLLGSYYLFFSASPVVAVVALLLYVGC  412

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQLSFGPIGWLMISEIFPL++RGRGLS+AVLVNFG NALVTFAFSP+KEL+GAG +F  F
Sbjct  413  YQLSFGPIGWLMISEIFPLKLRGRGLSLAVLVNFGANALVTFAFSPLKELLGAGILFCGF  472

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            GVI V++++F+FFI+PETKGLTLEEIEAK L
Sbjct  473  GVICVLSLVFIFFIVPETKGLTLEEIEAKCL  503


 Score =   101 bits (252),  Expect(2) = 2e-81, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V V +GWRYMY  SVP++++MGIGMWWLPASPRW+LL  IQGKG++   RE A+ 
Sbjct  199   IGSLTVNVHSGWRYMYATSVPLAVIMGIGMWWLPASPRWLLLRVIQGKGNVENQREAAIK  258

Query  948   CLCRLRGATIGDSAHH  901
              LC LRG    DSA  
Sbjct  259   SLCCLRGPAFVDSAAE  274



>gb|KJB26763.1| hypothetical protein B456_004G258400 [Gossypium raimondii]
Length=460

 Score =   209 bits (531),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 154/197 (78%), Positives = 175/197 (89%), Gaps = 0/197 (0%)
 Frame = -3

Query  926  QQLGIRHIIQVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVL  747
            Q +G      VDEIL+ELS++ EEKE T+GE+F GKCLKA+ IGAGL+LFQQITGQPSVL
Sbjct  264  QSIGDSASQHVDEILTELSYVGEEKEVTLGEIFHGKCLKAMIIGAGLVLFQQITGQPSVL  323

Query  746  YYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVAL  567
            YYAA I Q AGF+AA+DATR SI LGLLKLIMTGVAVVVVDRLGRRPLLLGGVSG+ ++L
Sbjct  324  YYAASILQSAGFSAASDATRVSILLGLLKLIMTGVAVVVVDRLGRRPLLLGGVSGMVISL  383

Query  566  FLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVN  387
            FLLGSYY FLD++  +AV+ALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRGLS+AVLVN
Sbjct  384  FLLGSYYLFLDDLAAIAVVALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRGLSVAVLVN  443

Query  386  FGTNALVTFAFSPMKEL  336
            FG NALVTFAFSP+K L
Sbjct  444  FGANALVTFAFSPLKVL  460


 Score =   121 bits (304),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+VE V+GWRYMYG S P++++MGIGM WLPASPRW+LL AIQGKG+M  LRETAV 
Sbjct  197   IGSLLVETVSGWRYMYGASTPLAVIMGIGMCWLPASPRWLLLRAIQGKGNMQELRETAVC  256

Query  948   CLCRLRGATIGDSAHH  901
             CLCRLRG +IGDSA  
Sbjct  257   CLCRLRGQSIGDSASQ  272



>ref|XP_010087486.1| D-xylose-proton symporter-like 2 [Morus notabilis]
 gb|EXB29167.1| D-xylose-proton symporter-like 2 [Morus notabilis]
Length=518

 Score =   213 bits (542),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 182/230 (79%), Positives = 208/230 (90%), Gaps = 0/230 (0%)
 Frame = -3

Query  902  IQVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifq  723
            +QVDEIL+ELS + EEKEAT GEMFQGKC KAL IG GL+LFQQITGQPSVLYYA+ IFQ
Sbjct  289  VQVDEILAELSFVGEEKEATFGEMFQGKCRKALVIGGGLVLFQQITGQPSVLYYASSIFQ  348

Query  722  dagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYT  543
             AGF+AA+DATR SI LGLLKLIMTG AV++VDRLGRRPLLLGGVSG+ ++LFLLGSYY 
Sbjct  349  TAGFSAASDATRVSILLGLLKLIMTGAAVLLVDRLGRRPLLLGGVSGMVISLFLLGSYYL  408

Query  542  FLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVT  363
            FL NV  VAV+ALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRGLSIAVLVNFG NALVT
Sbjct  409  FLGNVWVVAVVALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRGLSIAVLVNFGANALVT  468

Query  362  FAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FAFSP++ L+GAG +F++FGVIAVV++ F+FF++PETKGLTLEEIEA  L
Sbjct  469  FAFSPLEALLGAGILFYVFGVIAVVSLGFIFFVVPETKGLTLEEIEANCL  518


 Score =   117 bits (293),  Expect(2) = 5e-81, Method: Compositional matrix adjust.
 Identities = 51/74 (69%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V+VVAGWRY+Y  S P++I+M IGMWWLPASPRWILLCAIQGKG+M  L+ETA+ 
Sbjct  214   IGSLLVDVVAGWRYIYAASSPLAIIMAIGMWWLPASPRWILLCAIQGKGNMQELKETAIH  273

Query  948   CLCRLRGATIGDSA  907
             C CRLRG    D A
Sbjct  274   CFCRLRGPASRDKA  287



>ref|XP_004505609.1| PREDICTED: D-xylose-proton symporter-like 2-like [Cicer arietinum]
Length=502

 Score =   222 bits (566),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 185/208 (89%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            EMF+GKC KAL I AGL+LFQQITGQPSVLYYAA I Q AGF+ A+DATR SI LG+ KL
Sbjct  295  EMFRGKCRKALVISAGLVLFQQITGQPSVLYYAASILQSAGFSLASDATRVSILLGVFKL  354

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            IMTGVAVVVVDR+GRRPLLLGGVSGI ++LFLLGSYY FLDN   +AV+ LLLYVGCYQ+
Sbjct  355  IMTGVAVVVVDRIGRRPLLLGGVSGIVISLFLLGSYYIFLDNAAVLAVVGLLLYVGCYQI  414

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGP+GWLMI+EIFPLR+RGRGLSIAVLVNF  NALVTFAFSP+K+L+GAG +F+IF  I
Sbjct  415  SFGPMGWLMIAEIFPLRLRGRGLSIAVLVNFTANALVTFAFSPLKDLLGAGILFYIFCAI  474

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            AV +++F++FI+PETKGLTLEEIEAK L
Sbjct  475  AVASLVFIYFIVPETKGLTLEEIEAKCL  502


 Score =   107 bits (267),  Expect(2) = 7e-81, Method: Compositional matrix adjust.
 Identities = 45/74 (61%), Positives = 61/74 (82%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V+ V+GWRYMYG+S P++++MG GMWWLPASPRW+LL AIQ KGD+  L++TA+ 
Sbjct  198   LGSLLVDTVSGWRYMYGISSPVAVIMGFGMWWLPASPRWLLLRAIQRKGDIQNLKDTAIR  257

Query  948   CLCRLRGATIGDSA  907
              LC+L+G    DSA
Sbjct  258   SLCQLQGPAFHDSA  271



>ref|XP_008644912.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Zea mays]
Length=518

 Score =   224 bits (570),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 199/227 (88%), Gaps = 0/227 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            Q+D IL ELS++ +EK+A+ GE+FQGKCLKA+ IG GL+ FQQ+TGQPSVLYYAA IFQ 
Sbjct  291  QIDLILEELSYIDQEKQASFGEIFQGKCLKAMIIGCGLVFFQQVTGQPSVLYYAATIFQS  350

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ A+DATR SI LGLLKLIMTGVAV+VVDRLGRRPLL+GGVSGI VALFLL SYYT 
Sbjct  351  AGFSGASDATRVSILLGLLKLIMTGVAVLVVDRLGRRPLLIGGVSGITVALFLLSSYYTL  410

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            L +   VAVIALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRGL +AVLVNF +NALVTF
Sbjct  411  LKDASYVAVIALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRGLGVAVLVNFASNALVTF  470

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAK  219
            AFSP+++L+G G +F  FGVIAV ++ F+F+I+PETKGLTLEEIEA 
Sbjct  471  AFSPLEDLIGTGALFSGFGVIAVASLAFIFWIVPETKGLTLEEIEAS  517


 Score =   105 bits (263),  Expect(2) = 9e-81, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -2

Query  1125  GSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSC  946
             G+L VEVV+GWRYMY  S P+ ++MG+GM WLP+SPRW+LLCAIQGKG++P  +E A  C
Sbjct  216   GNLYVEVVSGWRYMYASSTPLCLIMGVGMCWLPSSPRWLLLCAIQGKGNLPETKENATRC  275

Query  945   LCRLRGATIGD  913
             LCRLRG    D
Sbjct  276   LCRLRGQASPD  286



>ref|XP_008644913.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Zea mays]
 gb|AFW69044.1| hypothetical protein ZEAMMB73_344214 [Zea mays]
Length=517

 Score =   224 bits (570),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 170/227 (75%), Positives = 199/227 (88%), Gaps = 0/227 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            Q+D IL ELS++ +EK+A+ GE+FQGKCLKA+ IG GL+ FQQ+TGQPSVLYYAA IFQ 
Sbjct  290  QIDLILEELSYIDQEKQASFGEIFQGKCLKAMIIGCGLVFFQQVTGQPSVLYYAATIFQS  349

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ A+DATR SI LGLLKLIMTGVAV+VVDRLGRRPLL+GGVSGI VALFLL SYYT 
Sbjct  350  AGFSGASDATRVSILLGLLKLIMTGVAVLVVDRLGRRPLLIGGVSGITVALFLLSSYYTL  409

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            L +   VAVIALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRGL +AVLVNF +NALVTF
Sbjct  410  LKDASYVAVIALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRGLGVAVLVNFASNALVTF  469

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAK  219
            AFSP+++L+G G +F  FGVIAV ++ F+F+I+PETKGLTLEEIEA 
Sbjct  470  AFSPLEDLIGTGALFSGFGVIAVASLAFIFWIVPETKGLTLEEIEAS  516


 Score =   105 bits (262),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -2

Query  1125  GSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSC  946
             G+L VEVV+GWRYMY  S P+ ++MG+GM WLP+SPRW+LLCAIQGKG++P  +E A  C
Sbjct  215   GNLYVEVVSGWRYMYASSTPLCLIMGVGMCWLPSSPRWLLLCAIQGKGNLPETKENATRC  274

Query  945   LCRLRGATIGD  913
             LCRLRG    D
Sbjct  275   LCRLRGQASPD  285



>ref|XP_009119042.1| PREDICTED: D-xylose-proton symporter-like 1 [Brassica rapa]
 emb|CDY23466.1| BnaC04g49940D [Brassica napus]
Length=503

 Score =   236 bits (602),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 204/229 (89%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDEIL+ELS + E KEAT+GE+FQGKCLKALTI  GL+L QQITGQPSVLYYA  I Q 
Sbjct  275  QVDEILAELSSVGEGKEATLGEIFQGKCLKALTIAGGLVLLQQITGQPSVLYYAPSILQT  334

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+AA DATR SI LGLLKL+MTGVAV+V+D+LGRRPLL GGVSG+ ++LFLLGSYY F
Sbjct  335  AGFSAATDATRISILLGLLKLVMTGVAVIVIDKLGRRPLLFGGVSGMVISLFLLGSYYIF  394

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
             + VP VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG+SIAVLVNFGTNALVTF
Sbjct  395  YNTVPAVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRGISIAVLVNFGTNALVTF  454

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+KEL GAG +FF FGVI V+++ F++FI+PETKGLTLEEIEAK L
Sbjct  455  AFSPLKELFGAGVLFFGFGVICVLSLFFIYFIVPETKGLTLEEIEAKCL  503


 Score = 92.8 bits (229),  Expect(2) = 1e-80, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V V++GWRYMY   +P+ ++MGIGM WLPASPRW+LL ++QGKG++  L++ A+ 
Sbjct  199   IGSLWVTVISGWRYMYATIIPVPVIMGIGMCWLPASPRWLLLRSLQGKGNVESLQQAAIR  258

Query  948   CLCRLRGATIGDSA  907
              L RLRG+ + DSA
Sbjct  259   SLRRLRGSVVVDSA  272



>ref|NP_001065505.1| Os10g0579200 [Oryza sativa Japonica Group]
 gb|AAG46179.1|AC018727_31 putative sugar transporter protein [Oryza sativa Japonica Group]
 gb|AAP55176.1| Sugar transporter family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF27342.1| Os10g0579200 [Oryza sativa Japonica Group]
 dbj|BAG95336.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC67505.1| hypothetical protein OsI_34793 [Oryza sativa Indica Group]
 gb|EEE51468.1| hypothetical protein OsJ_32598 [Oryza sativa Japonica Group]
Length=502

 Score =   227 bits (578),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 171/227 (75%), Positives = 200/227 (88%), Gaps = 0/227 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVD IL ELS++ +E++A   E+FQGKCLKA+ IG GL+ FQQ+TGQPSVLYYAA I Q 
Sbjct  275  QVDLILDELSYVDQERQAGFSEIFQGKCLKAMIIGCGLVFFQQVTGQPSVLYYAATILQS  334

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ A+DATR S+ LGLLKLIMTGVAV+VVDRLGRRPLL+GGVSGIAV+LFLL SYYT 
Sbjct  335  AGFSGASDATRVSVLLGLLKLIMTGVAVLVVDRLGRRPLLIGGVSGIAVSLFLLSSYYTL  394

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            L + P VAVIALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRGLSIAVLVNF +NALVTF
Sbjct  395  LKDAPYVAVIALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRGLSIAVLVNFASNALVTF  454

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAK  219
            AFSP+++L+G G +F  FGVIAV +++F+FFI+PETKGLTLEEIEA 
Sbjct  455  AFSPLEDLIGTGILFSAFGVIAVASLVFIFFIVPETKGLTLEEIEAS  501


 Score =   101 bits (252),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 46/71 (65%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -2

Query  1125  GSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSC  946
             GSL VEVV+GWRYMY  S P+ ++MGIGM WLPASPRW+LLCAIQGK ++   +E A  C
Sbjct  200   GSLFVEVVSGWRYMYATSTPLCLIMGIGMCWLPASPRWLLLCAIQGKRNIMESKENATRC  259

Query  945   LCRLRGATIGD  913
             LCRLRG    D
Sbjct  260   LCRLRGQASPD  270



>dbj|BAJ88105.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=495

 Score =   224 bits (570),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            A   E+FQGKCLKA+ IG GL+ FQQ+TGQPSVLYYAA IFQ AGF+ A+DATR SI LG
Sbjct  285  AGFSEIFQGKCLKAMIIGCGLVFFQQVTGQPSVLYYAATIFQSAGFSGASDATRVSILLG  344

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKLIMTGVAV+VVD+LGRRPLL+GGVSGIAV+LFLL SYYT     P VAVIALLLYVG
Sbjct  345  LLKLIMTGVAVLVVDKLGRRPLLIGGVSGIAVSLFLLSSYYTLFTGAPYVAVIALLLYVG  404

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISE+FPL++RGRGLS+AVLVNF +NALVTFAFSP+++L+G G +F  
Sbjct  405  CYQLSFGPIGWLMISEVFPLKLRGRGLSVAVLVNFASNALVTFAFSPLEDLIGTGVLFAS  464

Query  308  fgviavvavifvffiIPETKGLTLEEIEAK  219
            FGVIAV ++ F+F I+PETKGLTLEEIEAK
Sbjct  465  FGVIAVASLAFIFCIVPETKGLTLEEIEAK  494


 Score =   104 bits (260),  Expect(2) = 2e-80, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VG+L VEV++GWRYMY  S PI ++MGIGM WLP SPRW+LLCA QGKGD+   +E A  
Sbjct  192   VGNLFVEVISGWRYMYAASAPICVIMGIGMCWLPCSPRWLLLCATQGKGDLRETKENATR  251

Query  948   CLCRLRGATIGD  913
             CLCRLRG    D
Sbjct  252   CLCRLRGQASPD  263



>gb|EMS55132.1| D-xylose-proton symporter-like 2 [Triticum urartu]
Length=495

 Score =   223 bits (568),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 160/210 (76%), Positives = 184/210 (88%), Gaps = 0/210 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            A   E+FQGKCLKA+ IG GL+ FQQ+TGQPSVLYYAA IFQ AGF+ A+DATR SI LG
Sbjct  285  AGFSEIFQGKCLKAMIIGCGLVFFQQVTGQPSVLYYAATIFQSAGFSGASDATRVSILLG  344

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKLIMTGVAV+VVD+LGRRPLL+GGVSGIAV+LFLL SYYT     P VAVIALLLYVG
Sbjct  345  LLKLIMTGVAVLVVDKLGRRPLLIGGVSGIAVSLFLLSSYYTLFTGAPYVAVIALLLYVG  404

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISE+FPL++RGRGLS+AVLVNF +NALVTFAFSP+++L+G G +F  
Sbjct  405  CYQLSFGPIGWLMISEVFPLKLRGRGLSVAVLVNFASNALVTFAFSPLEDLIGTGVLFAS  464

Query  308  fgviavvavifvffiIPETKGLTLEEIEAK  219
            FGVIAV ++ F+F I+PETKGLTLEEIEAK
Sbjct  465  FGVIAVASLAFIFCIVPETKGLTLEEIEAK  494


 Score =   104 bits (259),  Expect(2) = 3e-80, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VG+L VEV++GWRYMY  S PI ++MGIGM WLP SPRW+LLCA QGKGD+   +E A  
Sbjct  192   VGNLFVEVISGWRYMYATSAPICVIMGIGMCWLPCSPRWLLLCATQGKGDLRETKENATR  251

Query  948   CLCRLRGATIGD  913
             CLCRLRG    D
Sbjct  252   CLCRLRGQASPD  263



>emb|CDY49922.1| BnaCnng18320D [Brassica napus]
Length=503

 Score =   234 bits (598),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 177/229 (77%), Positives = 203/229 (89%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVDEIL+ELS + E KEAT+GE+FQGKCLKALTI  GL+L QQITGQPSVLYYA  I Q 
Sbjct  275  QVDEILAELSSVGEGKEATLGEIFQGKCLKALTIAGGLVLLQQITGQPSVLYYAPSILQT  334

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+AA DATR SI LGLLKL+MTG AV+V+D+LGRRPLL GGVSG+ ++LFLLGSYY F
Sbjct  335  AGFSAATDATRISILLGLLKLVMTGAAVIVIDKLGRRPLLFGGVSGMVISLFLLGSYYIF  394

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
             + VP VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRG+SIAVLVNFGTNALVTF
Sbjct  395  YNTVPAVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRGISIAVLVNFGTNALVTF  454

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+KEL GAG +FF FGVI V+++ F++FI+PETKGLTLEEIEAK L
Sbjct  455  AFSPLKELFGAGVLFFGFGVICVLSLFFIYFIVPETKGLTLEEIEAKCL  503


 Score = 93.2 bits (230),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 58/74 (78%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V V++GWRYMY   +P+ ++MGIGM WLPASPRW+LL ++QGKG++  L++ A+ 
Sbjct  199   IGSLWVTVISGWRYMYATIIPVPVIMGIGMCWLPASPRWLLLRSLQGKGNVESLQQAAIR  258

Query  948   CLCRLRGATIGDSA  907
              L RLRG+ + DSA
Sbjct  259   SLRRLRGSVVVDSA  272



>ref|XP_006662109.1| PREDICTED: D-xylose-proton symporter-like 2-like [Oryza brachyantha]
Length=500

 Score =   224 bits (572),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 162/210 (77%), Positives = 185/210 (88%), Gaps = 0/210 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            A   E+FQGKCLKA+ IG GL+ FQQ+TGQPSVLYYAA I Q AGF+ A+DATR SI LG
Sbjct  290  AGFSEIFQGKCLKAMIIGCGLVFFQQVTGQPSVLYYAATILQSAGFSGASDATRVSILLG  349

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKLIMTGVAV+VVDRLGRRPLL+GGVSGIAV+LFLL SYYT L + P VAVIALLLYVG
Sbjct  350  LLKLIMTGVAVLVVDRLGRRPLLIGGVSGIAVSLFLLSSYYTLLKDAPYVAVIALLLYVG  409

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISE+FPLR+RGRGLSIAVLVNF +NALVTFAFSP+++L+G G +F  
Sbjct  410  CYQLSFGPIGWLMISEVFPLRLRGRGLSIAVLVNFASNALVTFAFSPLEDLIGTGILFCG  469

Query  308  fgviavvavifvffiIPETKGLTLEEIEAK  219
            FGVIAV +++F+F I+PETKGLTLEEIEA 
Sbjct  470  FGVIAVASLVFIFCIVPETKGLTLEEIEAS  499


 Score =   102 bits (254),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -2

Query  1125  GSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSC  946
             GSL VEVV+GWRYMY  S P+ ++MGIGM WLP SPRW+LLCAIQGKG++   ++ A  C
Sbjct  198   GSLFVEVVSGWRYMYATSTPLCLIMGIGMCWLPCSPRWLLLCAIQGKGNLTESKKNATHC  257

Query  945   LCRLRGATIGD  913
             LCRLRG    D
Sbjct  258   LCRLRGQASPD  268



>ref|NP_186959.2| vacuolar glucose transporter 1 [Arabidopsis thaliana]
 sp|Q8L6Z8.1|XYLL1_ARATH RecName: Full=D-xylose-proton symporter-like 1 [Arabidopsis thaliana]
 gb|AAM98195.1| unknown protein [Arabidopsis thaliana]
 gb|AAQ56818.1| At3g03090 [Arabidopsis thaliana]
 gb|AEE73900.1| vacuolar glucose transporter 1 [Arabidopsis thaliana]
Length=503

 Score =   233 bits (594),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT GE+F+GKCLKALTI  GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR SI LG
Sbjct  292  ATFGELFRGKCLKALTIAGGLVLFQQITGQPSVLYYAPSILQTAGFSAAADATRISILLG  351

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKL+MTGV+V+V+DR+GRRPLLL GVSG+ ++LFLLGSYY F  NVP VAV ALLLYVG
Sbjct  352  LLKLVMTGVSVIVIDRVGRRPLLLCGVSGMVISLFLLGSYYMFYKNVPAVAVAALLLYVG  411

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISEIFPL++RGRG+S+AVLVNFG NALVTFAFSP+KEL+GAG +F  
Sbjct  412  CYQLSFGPIGWLMISEIFPLKLRGRGISLAVLVNFGANALVTFAFSPLKELLGAGILFCA  471

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVI VV++ F+++I+PETKGLTLEEIEAK L
Sbjct  472  FGVICVVSLFFIYYIVPETKGLTLEEIEAKCL  503


 Score = 94.4 bits (233),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL + V++GWRYMY   +P  ++MG GM WLPASPRW+LL A+QG+G+   L++ A+ 
Sbjct  199   IGSLWITVISGWRYMYATILPFPVIMGTGMCWLPASPRWLLLRALQGQGNGENLQQAAIR  258

Query  948   CLCRLRGATIGDSAHH  901
              LCRLRG+ I DSA  
Sbjct  259   SLCRLRGSVIADSAAE  274



>emb|CDY28736.1| BnaCnng06220D [Brassica napus]
Length=503

 Score =   235 bits (599),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT+GE+FQGKCLKALTI  GL+L QQITGQPSVLYYA  I Q AGF+AA DATR SI LG
Sbjct  292  ATLGELFQGKCLKALTIAGGLVLLQQITGQPSVLYYAPSILQTAGFSAATDATRISILLG  351

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKL+MTGVAV+V+DRLGRRPLLLGGVSG+ ++LFLLGSYY F   VP VAV+ALLLYVG
Sbjct  352  LLKLVMTGVAVIVIDRLGRRPLLLGGVSGMMISLFLLGSYYIFYTTVPAVAVVALLLYVG  411

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISEIFPL++RGRG+SIAVLVNFGTNALVTFAFSP+KEL+GAG +F  
Sbjct  412  CYQLSFGPIGWLMISEIFPLKLRGRGISIAVLVNFGTNALVTFAFSPLKELLGAGVLFCG  471

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVI VV++ F++FI+PETKGLTLEEIEAK L
Sbjct  472  FGVICVVSLFFIYFIVPETKGLTLEEIEAKCL  503


 Score = 92.4 bits (228),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V V +GWRYMY   +P++++MGIGM WLPASPRW+LL ++QGKG++  L++ A+ 
Sbjct  199   IGSLWVTVTSGWRYMYATIIPLAVIMGIGMCWLPASPRWLLLRSLQGKGNVERLQQAAIK  258

Query  948   CLCRLRGATIGDSAHH  901
              L RLRG+ + DSA  
Sbjct  259   SLRRLRGSVVVDSAAE  274



>ref|XP_002464862.1| hypothetical protein SORBIDRAFT_01g027800 [Sorghum bicolor]
 gb|EER91860.1| hypothetical protein SORBIDRAFT_01g027800 [Sorghum bicolor]
Length=511

 Score =   223 bits (567),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 169/227 (74%), Positives = 199/227 (88%), Gaps = 0/227 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            Q+D IL ELS++ +EK+A+ GE+FQGKCLKA+ IG GL+ FQQ+TGQPSVLYYAA IFQ 
Sbjct  284  QIDLILEELSYIDQEKQASFGEIFQGKCLKAMIIGCGLVFFQQVTGQPSVLYYAATIFQS  343

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+ A+DATR SI LG+LKLIMTGVAV+VVDRLGRRPLL+GGVSGI VALFLL SYYT 
Sbjct  344  AGFSGASDATRVSILLGVLKLIMTGVAVLVVDRLGRRPLLIGGVSGITVALFLLSSYYTL  403

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            L +   VAVIALLLYVGCYQLSFGPIGWLMISE+FPLR+RGRGL +AVLVNF +NALVTF
Sbjct  404  LKDASYVAVIALLLYVGCYQLSFGPIGWLMISEVFPLRLRGRGLGVAVLVNFASNALVTF  463

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAK  219
            AFSP+++L+G G +F  FGVIAV ++ F+F+I+PETKGLTLEEIEA 
Sbjct  464  AFSPLEDLIGTGALFSGFGVIAVASLAFIFWIVPETKGLTLEEIEAS  510


 Score =   104 bits (259),  Expect(2) = 4e-80, Method: Compositional matrix adjust.
 Identities = 45/71 (63%), Positives = 56/71 (79%), Gaps = 0/71 (0%)
 Frame = -2

Query  1125  GSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSC  946
             G+L VEVV+GWRYMY  S P+ ++MG+GM WLP+SPRW+LLCAIQGKG++P  +E A  C
Sbjct  209   GNLYVEVVSGWRYMYVSSTPLCLIMGVGMCWLPSSPRWLLLCAIQGKGNLPDTKENATRC  268

Query  945   LCRLRGATIGD  913
             LCRLRG    D
Sbjct  269   LCRLRGQASPD  279



>emb|CDY43152.1| BnaA05g32340D [Brassica napus]
Length=504

 Score =   236 bits (602),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT+GE+FQGKCLKALTI  GL+L QQITGQPSVLYYA  I Q AGF+AA DATR SI LG
Sbjct  293  ATLGELFQGKCLKALTIAGGLVLLQQITGQPSVLYYAPSILQTAGFSAATDATRISILLG  352

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKL+MTGVAV+V+DRLGRRPLLLGGVSG+ ++LFLLGSYY F + VP VAV+ALLLYVG
Sbjct  353  LLKLVMTGVAVIVIDRLGRRPLLLGGVSGMMISLFLLGSYYIFYNTVPAVAVVALLLYVG  412

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISEIFPL++RGRG+SIAVLVNFGTNALVTFAFSP+KEL+GAG +F  
Sbjct  413  CYQLSFGPIGWLMISEIFPLKLRGRGISIAVLVNFGTNALVTFAFSPLKELLGAGVLFCG  472

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVI VV++ F++FI+PETKGLTLEEIEAK L
Sbjct  473  FGVICVVSLFFIYFIVPETKGLTLEEIEAKCL  504


 Score = 90.9 bits (224),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V V +GWRYMY   +P+ +VMGIGM WLP SPRW+LL ++QGKG++  L++ A+ 
Sbjct  200   IGSLWVTVTSGWRYMYATIIPLPVVMGIGMCWLPESPRWLLLRSLQGKGNVESLQQAAIK  259

Query  948   CLCRLRGATIGDSAHH  901
              L RLRG+ + DSA  
Sbjct  260   SLRRLRGSVVVDSAAE  275



>gb|AAF26115.1|AC012328_18 hypothetical protein [Arabidopsis thaliana]
Length=342

 Score =   233 bits (593),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT GE+F+GKCLKALTI  GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR SI LG
Sbjct  131  ATFGELFRGKCLKALTIAGGLVLFQQITGQPSVLYYAPSILQTAGFSAAADATRISILLG  190

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKL+MTGV+V+V+DR+GRRPLLL GVSG+ ++LFLLGSYY F  NVP VAV ALLLYVG
Sbjct  191  LLKLVMTGVSVIVIDRVGRRPLLLCGVSGMVISLFLLGSYYMFYKNVPAVAVAALLLYVG  250

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISEIFPL++RGRG+S+AVLVNFG NALVTFAFSP+KEL+GAG +F  
Sbjct  251  CYQLSFGPIGWLMISEIFPLKLRGRGISLAVLVNFGANALVTFAFSPLKELLGAGILFCA  310

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVI VV++ F+++I+PETKGLTLEEIEAK L
Sbjct  311  FGVICVVSLFFIYYIVPETKGLTLEEIEAKCL  342


 Score = 94.0 bits (232),  Expect(2) = 5e-80, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL + V++GWRYMY   +P  ++MG GM WLPASPRW+LL A+QG+G+   L++ A+ 
Sbjct  38    IGSLWITVISGWRYMYATILPFPVIMGTGMCWLPASPRWLLLRALQGQGNGENLQQAAIR  97

Query  948   CLCRLRGATIGDSAHH  901
              LCRLRG+ I DSA  
Sbjct  98    SLCRLRGSVIADSAAE  113



>emb|CAN72732.1| hypothetical protein VITISV_037854 [Vitis vinifera]
Length=458

 Score =   203 bits (517),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 161/229 (70%), Positives = 184/229 (80%), Gaps = 11/229 (5%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVD IL ELS   E KEA++GEMF GKCLKALTIG GL+LFQQITGQPSVLYYAA I +D
Sbjct  241  QVDGILDELSSSEETKEASLGEMFHGKCLKALTIGGGLVLFQQITGQPSVLYYAASILED  300

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            +              +GLLKLIMT VAV+VVD++GRRPLLLGGVSGI ++LFLLGSYY +
Sbjct  301  SQEHLMQHVY--RYLVGLLKLIMTAVAVLVVDKVGRRPLLLGGVSGIVISLFLLGSYYIY  358

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            L + P VAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFG NA+   
Sbjct  359  LGDAPAVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGANAIA--  416

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
                   L+GAG +F+ FGVIAV++++F+FF IPETKGL+LEEIEAK L
Sbjct  417  -------LLGAGVLFYGFGVIAVLSLLFIFFFIPETKGLSLEEIEAKLL  458


 Score =   123 bits (308),  Expect(2) = 6e-80, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGSL+V++V+GWRYMYGVS P+S++MGIGMWWLPASPRW+LL AIQGKG+M  L+E A+ 
Sbjct  165   VGSLLVDMVSGWRYMYGVSSPLSVIMGIGMWWLPASPRWLLLRAIQGKGNMQDLKENAIF  224

Query  948   CLCRLRGATIGDSA  907
             CLCRLRG  IGDSA
Sbjct  225   CLCRLRGPAIGDSA  238



>ref|XP_010463755.1| PREDICTED: D-xylose-proton symporter-like 1 [Camelina sativa]
Length=498

 Score =   231 bits (589),  Expect(2) = 9e-80, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT GE+F+GKCLKALTI  GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR SI LG
Sbjct  287  ATFGELFRGKCLKALTIAGGLVLFQQITGQPSVLYYAPSILQTAGFSAAADATRISILLG  346

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKL+MTGV+V+V+DRLGRRPLLLGGVSG+ ++LFLLGSYY F +NVP VAV ALLLYVG
Sbjct  347  LLKLVMTGVSVIVIDRLGRRPLLLGGVSGMVISLFLLGSYYIFYNNVPAVAVAALLLYVG  406

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISEIFPL++RGRG+S+AVL+NFG NALVTFAFSP+K+L+GAG +F  
Sbjct  407  CYQLSFGPIGWLMISEIFPLKLRGRGISLAVLINFGANALVTFAFSPLKDLLGAGVLFCG  466

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVI V+++ F++FI+PETKGLTLEEIEAK L
Sbjct  467  FGVICVLSLFFIYFIVPETKGLTLEEIEAKCL  498


 Score = 95.1 bits (235),  Expect(2) = 9e-80, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V V++GWRYMY   +P+ ++MGIGM+WLPASPRW+LL A+QGK ++  L++ A+ 
Sbjct  194   IGSLWVTVISGWRYMYATILPVPVIMGIGMFWLPASPRWLLLRALQGKSNVENLQQAAIR  253

Query  948   CLCRLRGATIGDSAHH  901
              L RLRG  I DSA  
Sbjct  254   SLRRLRGPAIADSAAE  269



>ref|XP_010489652.1| PREDICTED: D-xylose-proton symporter-like 1, partial [Camelina 
sativa]
Length=469

 Score =   231 bits (590),  Expect(2) = 9e-80, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT GE+F+GKCLKALTI  GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR SI LG
Sbjct  258  ATFGELFRGKCLKALTIAGGLVLFQQITGQPSVLYYAPSILQTAGFSAAADATRISILLG  317

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKL+MTGV+V+V+DRLGRRPLLLGGVSG+ ++LFLLGSYY F +NVP VAV ALLLYVG
Sbjct  318  LLKLVMTGVSVIVIDRLGRRPLLLGGVSGMVISLFLLGSYYIFYNNVPAVAVAALLLYVG  377

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISEIFPL++RGRG+S+AVL+NFG NALVTFAFSP+K+L+GAG +F  
Sbjct  378  CYQLSFGPIGWLMISEIFPLKLRGRGISLAVLINFGANALVTFAFSPLKDLLGAGVLFCG  437

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVI V+++ F++FI+PETKGLTLEEIEAK L
Sbjct  438  FGVICVLSLFFIYFIVPETKGLTLEEIEAKCL  469


 Score = 94.7 bits (234),  Expect(2) = 9e-80, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V V++GWRYMY   +P+ ++MGIGM WLPASPRW+LL AIQGK ++  L++ A+ 
Sbjct  165   IGSLWVTVISGWRYMYATILPVPVIMGIGMCWLPASPRWLLLRAIQGKSNVENLQQAAIR  224

Query  948   CLCRLRGATIGDSAHH  901
              L RLRG  I DSA  
Sbjct  225   SLLRLRGPAIADSAAE  240



>emb|CDX74227.1| BnaA03g28200D [Brassica napus]
Length=483

 Score =   233 bits (595),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 177/233 (76%), Positives = 206/233 (88%), Gaps = 0/233 (0%)
 Frame = -3

Query  911  RHIIQVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaak  732
            R   QVDEIL+ELS + E+KEATI E+FQGKCLKALTI  GL+LFQQITGQPSVLYYA  
Sbjct  251  RAAEQVDEILAELSSVGEDKEATICELFQGKCLKALTIAGGLVLFQQITGQPSVLYYAPS  310

Query  731  ifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGS  552
            I Q AGF+AA DATR SI LGLLKL MTGVA++V+D+LGRRPLLLGGVSG+ ++LFL+GS
Sbjct  311  ILQTAGFSAATDATRISILLGLLKLAMTGVAIIVIDKLGRRPLLLGGVSGMVLSLFLMGS  370

Query  551  YYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNA  372
            YY F +NVP VAV ALLLYVGCYQLSFGPI WLM+SEIFPL++RGRG+SIAVLVNFGTNA
Sbjct  371  YYIFYNNVPAVAVAALLLYVGCYQLSFGPISWLMMSEIFPLKLRGRGISIAVLVNFGTNA  430

Query  371  LVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            LVTFAFSP+KEL+GAG +F +FGVI V+++ F++FI+PETKGLTLEEIEAK L
Sbjct  431  LVTFAFSPLKELLGAGILFCVFGVICVLSLFFIYFIVPETKGLTLEEIEAKCL  483


 Score = 92.0 bits (227),  Expect(2) = 1e-79, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V V++GWRYMY   +PI ++M IGM WLPASPRW+LL  +QGKGD+   +E A+ 
Sbjct  179   IGSLWVTVISGWRYMYATVIPIPVIMAIGMCWLPASPRWLLLRTLQGKGDVESFQEEAIK  238

Query  948   CLCRLRGATIGDSAHH  901
              L RLRG+ + D A  
Sbjct  239   SLRRLRGSVVVDRAAE  254



>ref|XP_009134719.1| PREDICTED: D-xylose-proton symporter-like 1 [Brassica rapa]
Length=502

 Score =   233 bits (595),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 177/233 (76%), Positives = 206/233 (88%), Gaps = 0/233 (0%)
 Frame = -3

Query  911  RHIIQVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaak  732
            R   QVDEIL+ELS + E+KEATI E+FQGKCLKALTI  GL+LFQQITGQPSVLYYA  
Sbjct  270  RAAEQVDEILAELSSVGEDKEATICELFQGKCLKALTIAGGLVLFQQITGQPSVLYYAPS  329

Query  731  ifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGS  552
            I Q AGF+AA DATR SI LGLLKL MTGVA++V+D+LGRRPLLLGGVSG+ ++LFL+GS
Sbjct  330  ILQTAGFSAATDATRISILLGLLKLAMTGVAIIVIDKLGRRPLLLGGVSGMVLSLFLMGS  389

Query  551  YYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNA  372
            YY F +NVP VAV ALLLYVGCYQLSFGPI WLM+SEIFPL++RGRG+SIAVLVNFGTNA
Sbjct  390  YYIFYNNVPAVAVAALLLYVGCYQLSFGPISWLMMSEIFPLKLRGRGISIAVLVNFGTNA  449

Query  371  LVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            LVTFAFSP+KEL+GAG +F +FGVI V+++ F++FI+PETKGLTLEEIEAK L
Sbjct  450  LVTFAFSPLKELLGAGILFCVFGVICVLSLFFIYFIVPETKGLTLEEIEAKCL  502


 Score = 92.0 bits (227),  Expect(2) = 2e-79, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V V++GWRYMY   +PI ++M IGM WLPASPRW+LL  +QGKGD+   +E A+ 
Sbjct  198   IGSLWVTVISGWRYMYATVIPIPVIMAIGMCWLPASPRWLLLRTLQGKGDVESFQEEAIK  257

Query  948   CLCRLRGATIGDSAHH  901
              L RLRG+ + D A  
Sbjct  258   SLRRLRGSVVVDRAAE  273



>ref|XP_009130331.1| PREDICTED: D-xylose-proton symporter-like 1 [Brassica rapa]
Length=504

 Score =   234 bits (598),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT+GE+FQGKCLKALTI  GL+L QQITGQPSVLYYA  I Q AGF+AA DATR SI LG
Sbjct  293  ATLGELFQGKCLKALTIAGGLVLLQQITGQPSVLYYAPSILQTAGFSAATDATRISILLG  352

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKL+MTGVAV+V+DRLGRRPLLLGGVSG+ ++LFLLGSYY F + VP VAV+ALLLYVG
Sbjct  353  LLKLVMTGVAVIVIDRLGRRPLLLGGVSGMMISLFLLGSYYIFYNTVPAVAVVALLLYVG  412

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISEIFPL++RGRG+SIAVLVNFGTNALVTFAFSP+KEL+GAG +F  
Sbjct  413  CYQLSFGPIGWLMISEIFPLKLRGRGISIAVLVNFGTNALVTFAFSPLKELLGAGVLFCG  472

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVI VV++ F++FI+PETKGLTLEEIE+K L
Sbjct  473  FGVICVVSLFFIYFIVPETKGLTLEEIESKCL  504


 Score = 90.1 bits (222),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V V +GWRYMY   +P+ ++MG+GM WLP SPRW+LL ++QGKG++  L++ A+ 
Sbjct  200   IGSLWVTVTSGWRYMYATIIPLPVIMGVGMCWLPESPRWLLLRSLQGKGNVESLQQAAIK  259

Query  948   CLCRLRGATIGDSAHH  901
              L RLRG+ + DSA  
Sbjct  260   SLRRLRGSVVVDSAAE  275



>ref|XP_010506301.1| PREDICTED: D-xylose-proton symporter-like 1 [Camelina sativa]
Length=502

 Score =   231 bits (589),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT GE+F+GKCLKALTI  GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR SI LG
Sbjct  291  ATFGELFRGKCLKALTIAGGLVLFQQITGQPSVLYYAPSILQTAGFSAAADATRISILLG  350

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKL+MTGV+V+V+DRLGRRPLLLGGVSG+ ++LFLLGSYY F +NVP VAV ALLLYVG
Sbjct  351  LLKLVMTGVSVIVIDRLGRRPLLLGGVSGMVISLFLLGSYYIFYNNVPAVAVAALLLYVG  410

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISEIFPL++RGRG+S+AVL+NFG NALVTFAFSP+K+L+GAG +F  
Sbjct  411  CYQLSFGPIGWLMISEIFPLKLRGRGISLAVLINFGANALVTFAFSPLKDLLGAGVLFCG  470

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVI V+++ F++FI+PETKGLTLEEIEAK L
Sbjct  471  FGVICVLSLFFIYFIVPETKGLTLEEIEAKCL  502


 Score = 93.2 bits (230),  Expect(2) = 3e-79, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V V++GWRYMY   +P+ I+MGIGM WLPASPRW+LL A+QGK ++  L++ A+ 
Sbjct  198   IGSLWVTVISGWRYMYATILPVPIIMGIGMCWLPASPRWLLLRALQGKSNVENLQQAAIR  257

Query  948   CLCRLRGATIGDSAHH  901
              L RLRG  I DSA  
Sbjct  258   SLRRLRGPAIADSAAE  273



>ref|XP_010920045.1| PREDICTED: D-xylose-proton symporter-like 2 [Elaeis guineensis]
Length=501

 Score =   224 bits (572),  Expect(2) = 7e-79, Method: Compositional matrix adjust.
 Identities = 168/229 (73%), Positives = 201/229 (88%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            Q+D IL+ELS++ ++K+AT+ E+FQGKCLKAL IGAGL+ FQQ+TGQPSVLYYAA I Q 
Sbjct  273  QIDAILNELSYVDQDKQATLREIFQGKCLKALVIGAGLVFFQQVTGQPSVLYYAATILQS  332

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+AA+DA R SI LGLLK++M G AV V+DRLGRRPLL+GGVS I ++LFLL SYYT 
Sbjct  333  AGFSAASDAIRVSILLGLLKVVMAGTAVPVIDRLGRRPLLIGGVSWIVISLFLLSSYYTL  392

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            L++ P VAVIALLLYVGCYQLSFGPIGWL+ISE+FPLR+RGRGLSIAVLVNF +NALVTF
Sbjct  393  LNDSPFVAVIALLLYVGCYQLSFGPIGWLLISEVFPLRLRGRGLSIAVLVNFASNALVTF  452

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP++ LVG G +F  FG+IAV A++F+FF+IPETKGLTLEEIEAK L
Sbjct  453  AFSPLEALVGTGILFAGFGIIAVAALLFIFFVIPETKGLTLEEIEAKIL  501


 Score = 99.0 bits (245),  Expect(2) = 7e-79, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = -2

Query  1125  GSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSC  946
             GS +V +VAGWRY+Y  S P+ ++MGIGMWWLP SPRW+LLCAIQG+ +M   +E A+ C
Sbjct  198   GSFVVGLVAGWRYIYVTSSPVCLIMGIGMWWLPPSPRWLLLCAIQGERNMSDAKEFAICC  257

Query  945   LCRLRGATIGDSAHH  901
             LC+LRG ++  SA  
Sbjct  258   LCQLRGQSVDGSASK  272



>ref|XP_008791055.1| PREDICTED: D-xylose-proton symporter-like 2 [Phoenix dactylifera]
Length=475

 Score =   226 bits (575),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 185/212 (87%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT+ E+FQGKCLKAL IGAGL+ FQQ+TGQPSVLYYAA I Q AGF+AA+DA   SI LG
Sbjct  264  ATLCEIFQGKCLKALVIGAGLVFFQQVTGQPSVLYYAATILQSAGFSAASDAIHVSILLG  323

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKL+M G AVV VDRLGRRPLL+GGVS IA++LFLL SYYT L++ P VAVIALLLYVG
Sbjct  324  LLKLVMAGTAVVAVDRLGRRPLLIGGVSWIAISLFLLSSYYTLLNDSPFVAVIALLLYVG  383

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWL+ISE+FPLR+RGR LSIAVLVNF +NALVTFAFSP++ LVG G +F  
Sbjct  384  CYQLSFGPIGWLLISEVFPLRLRGRALSIAVLVNFASNALVTFAFSPLEALVGTGILFAG  443

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVIAV A++F+FF+IPETKGLTLEEIEAK L
Sbjct  444  FGVIAVGALLFIFFVIPETKGLTLEEIEAKIL  475


 Score = 95.9 bits (237),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 43/75 (57%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = -2

Query  1125  GSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSC  946
             GS +V +VAGWRY+Y  S  + ++MGIGMWWLP SPRW+LLCAIQG+ +M   +E A+ C
Sbjct  172   GSFVVGLVAGWRYIYAASSLVCLIMGIGMWWLPPSPRWLLLCAIQGERNMLDAKEFAMFC  231

Query  945   LCRLRGATIGDSAHH  901
             LCRLRG  +  SA  
Sbjct  232   LCRLRGQAVDGSASK  246



>ref|XP_006400240.1| hypothetical protein EUTSA_v10013319mg [Eutrema salsugineum]
 gb|ESQ41693.1| hypothetical protein EUTSA_v10013319mg [Eutrema salsugineum]
Length=502

 Score =   214 bits (546),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 168/212 (79%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT GE+FQGKCLKAL IG GL+LFQQITGQPSVLYYA  I Q AGF+AA DAT+ SI LG
Sbjct  291  ATFGELFQGKCLKALIIGGGLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATKVSILLG  350

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKLIMTGVAVVV+D+LGRRPLLLGGV G+ V+LFLLGSYY F    P VAV+ALLLYVG
Sbjct  351  LLKLIMTGVAVVVIDKLGRRPLLLGGVGGMVVSLFLLGSYYIFFSAAPVVAVVALLLYVG  410

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISEIFPL++RGRGLSIAVLVNFG NALVTFAFSP++EL+GAG +FF 
Sbjct  411  CYQLSFGPIGWLMISEIFPLKLRGRGLSIAVLVNFGANALVTFAFSPLEELLGAGILFFG  470

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVI V++++F+FFI+PETKGLTLEEIEAK L
Sbjct  471  FGVICVLSLLFIFFIVPETKGLTLEEIEAKCL  502


 Score =   107 bits (266),  Expect(2) = 2e-78, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V +++GWRYMY  SVP++++MGIGMWWLPASPRW+LL  IQGKG++   RE A+ 
Sbjct  198   IGSLTVNILSGWRYMYATSVPLAVIMGIGMWWLPASPRWLLLRVIQGKGNVENQREAAIK  257

Query  948   CLCRLRGATIGDSAHH  901
              LCRLRG    DSA  
Sbjct  258   SLCRLRGPAFVDSAAE  273



>ref|XP_002884358.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60617.1| sugar transporter family protein [Arabidopsis lyrata subsp. lyrata]
Length=501

 Score =   228 bits (582),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 163/212 (77%), Positives = 189/212 (89%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT GE+F+GKCLKALTI  GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR SI LG
Sbjct  290  ATFGELFRGKCLKALTIAGGLVLFQQITGQPSVLYYAPSILQTAGFSAAADATRISILLG  349

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKL+MTG++V+V+DR+GRRPLLLGGVSG+ ++LFLLGSYY F   VP VAV ALLLYVG
Sbjct  350  LLKLVMTGLSVIVIDRVGRRPLLLGGVSGMVISLFLLGSYYMFYKTVPAVAVAALLLYVG  409

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISEIFPL++RGRG+S+AVLVNFG NALVTFAFSP+KEL+GAG +F  
Sbjct  410  CYQLSFGPIGWLMISEIFPLKLRGRGISLAVLVNFGANALVTFAFSPLKELLGAGILFCA  469

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVI VV++ F+++I+PETKGLTLEEIEAK L
Sbjct  470  FGVICVVSLFFIYYIVPETKGLTLEEIEAKCL  501


 Score = 92.0 bits (227),  Expect(2) = 4e-78, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V V++GWRYMY   +P+ ++MGIGM WLPASPRW+LL A+Q KG++  L++ A+ 
Sbjct  197   IGSLWVTVISGWRYMYATILPLPVIMGIGMCWLPASPRWLLLRALQRKGNVENLQQAAIR  256

Query  948   CLCRLRGATIGDSAHH  901
              L RLRG+ I DSA  
Sbjct  257   SLRRLRGSAIADSAAE  272



>ref|XP_006854111.1| PREDICTED: D-xylose-proton symporter-like 2 [Amborella trichopoda]
 gb|ERN15578.1| hypothetical protein AMTR_s00048p00147550 [Amborella trichopoda]
Length=505

 Score =   214 bits (544),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            A+IGE+FQGKCLKAL IGAGL+  QQITGQPSVLYYAA IFQ  GF+AA+DATR SI LG
Sbjct  294  ASIGEIFQGKCLKALVIGAGLVFLQQITGQPSVLYYAATIFQSVGFSAASDATRVSILLG  353

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            +LKLI TGVAV+VVDR+GRRPLLLGGVSGI +ALFLL +YYTFL ++P VAV+ALLLYVG
Sbjct  354  ILKLITTGVAVIVVDRVGRRPLLLGGVSGIVIALFLLAAYYTFLSSLPVVAVVALLLYVG  413

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISEIFPLR RG+GLSIAVLVNF +NALV FAFSP+K L+GAG +F  
Sbjct  414  CYQLSFGPIGWLMISEIFPLRFRGKGLSIAVLVNFASNALVAFAFSPLKALLGAGLLFAA  473

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVIA++A++F+FF +PETKGL+LEEIE+K L
Sbjct  474  FGVIAILALLFIFFYVPETKGLSLEEIESKIL  505


 Score =   106 bits (264),  Expect(2) = 7e-78, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGSL V++V+GWRYMYG S PISI+MG+GMWWLP SPRW+LLCA+QG+G    ++E A  
Sbjct  201   VGSLEVDIVSGWRYMYGTSCPISIIMGVGMWWLPPSPRWLLLCAVQGRGSFQDIKERATY  260

Query  948   CLCRLRGATIGDSAHH  901
              LCRLRG    +S   
Sbjct  261   ALCRLRGRIDDNSTSE  276



>ref|XP_003574402.1| PREDICTED: D-xylose-proton symporter-like 2 [Brachypodium distachyon]
Length=503

 Score =   217 bits (552),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 158/210 (75%), Positives = 181/210 (86%), Gaps = 0/210 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            A   E+FQGKCLKA+ IG GL+ FQQ+TGQPSVLYYAA IFQ AGF+ A+DATR SI LG
Sbjct  293  AGFSEVFQGKCLKAMIIGCGLVFFQQVTGQPSVLYYAATIFQTAGFSGASDATRVSILLG  352

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKLIMTGVAV+VVDRLGRRPLL+GGVSGIAVALFLL SYYT       VAVIALLLYVG
Sbjct  353  LLKLIMTGVAVLVVDRLGRRPLLIGGVSGIAVALFLLSSYYTLFKGASYVAVIALLLYVG  412

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
             YQLSFGPIGWLMISE+FPL++RGRGLS+AVLVNF +NALVTFAFSP+++L+G G +F  
Sbjct  413  SYQLSFGPIGWLMISEVFPLKLRGRGLSVAVLVNFASNALVTFAFSPLEDLIGTGVLFAS  472

Query  308  fgviavvavifvffiIPETKGLTLEEIEAK  219
            FGVIA+ ++ F+  I+PETKGLTLEEIEAK
Sbjct  473  FGVIALASLGFILCIVPETKGLTLEEIEAK  502


 Score =   102 bits (253),  Expect(2) = 1e-77, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 53/67 (79%), Gaps = 0/67 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VG+  VEV++GWRYMY  S P+ ++MGIGM WLPASPRW+LLCA QGKG++   +E A  
Sbjct  200   VGNFFVEVLSGWRYMYATSTPVCVIMGIGMCWLPASPRWLLLCATQGKGNLLETKENATR  259

Query  948   CLCRLRG  928
             CLCRLRG
Sbjct  260   CLCRLRG  266



>ref|XP_009126154.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Brassica 
rapa]
Length=505

 Score =   212 bits (540),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 186/212 (88%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT GE+FQGKC KAL IG GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LG
Sbjct  294  ATFGELFQGKCKKALIIGGGLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLG  353

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKLIMTGVAVVV+DRLGRRPLLLGGV G+ V+LFLLGSYY F    P VAV+ALLLYVG
Sbjct  354  LLKLIMTGVAVVVIDRLGRRPLLLGGVGGMVVSLFLLGSYYIFFSAAPVVAVVALLLYVG  413

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISEIFPL++RGRGLS+AVLVNFG NALVTFAFSP+KEL GAG +F  
Sbjct  414  CYQLSFGPIGWLMISEIFPLKLRGRGLSLAVLVNFGANALVTFAFSPLKELFGAGILFMG  473

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVI V++++F++FI+PETKGLTLEEIEAK L
Sbjct  474  FGVICVLSLLFIYFIVPETKGLTLEEIEAKCL  505


 Score =   105 bits (261),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V  ++GWRYMY  SVP++++MGIGMWWLPASPRW+LL  IQGKG++   +E A+ 
Sbjct  201   IGSLTVNTLSGWRYMYATSVPLAVIMGIGMWWLPASPRWLLLRVIQGKGNVENQKEAAIK  260

Query  948   CLCRLRGATIGDSAHH  901
              LCRLRG    DSA  
Sbjct  261   SLCRLRGPAFVDSAAE  276



>ref|XP_009126155.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Brassica 
rapa]
Length=502

 Score =   213 bits (541),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 186/212 (88%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT GE+FQGKC KAL IG GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LG
Sbjct  291  ATFGELFQGKCKKALIIGGGLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLG  350

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKLIMTGVAVVV+DRLGRRPLLLGGV G+ V+LFLLGSYY F    P VAV+ALLLYVG
Sbjct  351  LLKLIMTGVAVVVIDRLGRRPLLLGGVGGMVVSLFLLGSYYIFFSAAPVVAVVALLLYVG  410

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISEIFPL++RGRGLS+AVLVNFG NALVTFAFSP+KEL GAG +F  
Sbjct  411  CYQLSFGPIGWLMISEIFPLKLRGRGLSLAVLVNFGANALVTFAFSPLKELFGAGILFMG  470

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVI V++++F++FI+PETKGLTLEEIEAK L
Sbjct  471  FGVICVLSLLFIYFIVPETKGLTLEEIEAKCL  502


 Score =   105 bits (261),  Expect(2) = 3e-77, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V  ++GWRYMY  SVP++++MGIGMWWLPASPRW+LL  IQGKG++   +E A+ 
Sbjct  198   IGSLTVNTLSGWRYMYATSVPLAVIMGIGMWWLPASPRWLLLRVIQGKGNVENQKEAAIK  257

Query  948   CLCRLRGATIGDSAHH  901
              LCRLRG    DSA  
Sbjct  258   SLCRLRGPAFVDSAAE  273



>emb|CDX85478.1| BnaA02g03350D [Brassica napus]
Length=505

 Score =   212 bits (540),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 186/212 (88%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT GE+FQGKC KAL IG GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LG
Sbjct  294  ATFGELFQGKCKKALIIGGGLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLG  353

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKLIMTGVAVVV+DRLGRRPLLLGGV G+ V+LFLLGSYY F    P VAV+ALLLYVG
Sbjct  354  LLKLIMTGVAVVVIDRLGRRPLLLGGVGGMVVSLFLLGSYYIFFSAAPVVAVVALLLYVG  413

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISEIFPL++RGRGLS+AVLVNFG NALVTFAFSP+KEL GAG +F  
Sbjct  414  CYQLSFGPIGWLMISEIFPLKLRGRGLSLAVLVNFGANALVTFAFSPLKELFGAGILFMG  473

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVI V++++F++FI+PETKGLTLEEIEAK L
Sbjct  474  FGVICVLSLLFIYFIVPETKGLTLEEIEAKCL  505


 Score =   105 bits (261),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V  ++GWRYMY  SVP++++MGIGMWWLPASPRW+LL  IQGKG++   +E A+ 
Sbjct  201   IGSLTVNTLSGWRYMYATSVPLAVIMGIGMWWLPASPRWLLLRVIQGKGNVENQKEAAIK  260

Query  948   CLCRLRGATIGDSAHH  901
              LCRLRG    DSA  
Sbjct  261   SLCRLRGPAFVDSAAE  276



>ref|XP_006408343.1| hypothetical protein EUTSA_v10020565mg [Eutrema salsugineum]
 gb|ESQ49796.1| hypothetical protein EUTSA_v10020565mg [Eutrema salsugineum]
Length=502

 Score =   223 bits (568),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 191/212 (90%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT+GE+FQGKCLKALTI  GL+L QQITGQPSVLYYA  I Q AGF+AA DATR SI LG
Sbjct  291  ATLGELFQGKCLKALTIAGGLVLLQQITGQPSVLYYAPSILQTAGFSAATDATRISILLG  350

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKL+MTGVAV+V+D+LGRRPLLLGGVSG+ V+LFLLGSYY F + VP VAV+ALLLYVG
Sbjct  351  LLKLLMTGVAVIVIDKLGRRPLLLGGVSGMVVSLFLLGSYYIFYNTVPAVAVVALLLYVG  410

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISEIFPL++RGRG+SIAVLVNFGTNALVTFAFSP+KEL+GAG +F  
Sbjct  411  CYQLSFGPIGWLMISEIFPLKLRGRGISIAVLVNFGTNALVTFAFSPLKELLGAGVLFSG  470

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVI V+++ F++FI+PETKGLTLEEIEAK L
Sbjct  471  FGVICVLSLFFIYFIVPETKGLTLEEIEAKCL  502


 Score = 94.4 bits (233),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V V++GWRYMY   VP+ ++MGIGM WLPASPRW+LL ++QGKG++  L++ A+ 
Sbjct  198   IGSLWVTVISGWRYMYATIVPLPVIMGIGMCWLPASPRWLLLRSLQGKGNVENLQQAAIR  257

Query  948   CLCRLRGATIGDSAHH  901
              L RLRG+ I DSA  
Sbjct  258   SLRRLRGSVIVDSAAE  273



>gb|KFK37751.1| hypothetical protein AALP_AA3G025300 [Arabis alpina]
Length=503

 Score =   226 bits (577),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 165/212 (78%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT  E+FQGKCLKALTI  GL+LFQQITGQPSVLYYA  I Q AGF AAADATR SI LG
Sbjct  292  ATFCELFQGKCLKALTIAGGLVLFQQITGQPSVLYYAPSILQTAGFDAAADATRISILLG  351

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            +LKL MTGVAVVV+D+LGRRPLLLGGVSG+ +ALFLLGSYY F   VP VAV ALLLYVG
Sbjct  352  VLKLAMTGVAVVVIDKLGRRPLLLGGVSGMVIALFLLGSYYIFYHTVPAVAVGALLLYVG  411

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQ+SFGPI WLM+SEIFPLR+RGRG+S+AVLVNFGTNALVTFAFSP+KEL+GAG +F +
Sbjct  412  CYQISFGPISWLMLSEIFPLRLRGRGISLAVLVNFGTNALVTFAFSPLKELLGAGVLFCV  471

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVI V+++ F++FI+PETKGLTLEEIEAK L
Sbjct  472  FGVICVLSLFFIYFIVPETKGLTLEEIEAKCL  503


 Score = 90.5 bits (223),  Expect(2) = 4e-77, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 55/74 (74%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V V +GWRYMY   +P+ ++M IGM WLPASPRW+LL A+Q KG++  L++ A+ 
Sbjct  199   IGSLWVTVTSGWRYMYATIIPVPVIMAIGMCWLPASPRWLLLRALQSKGNVENLQQAAIK  258

Query  948   CLCRLRGATIGDSA  907
              L RLRG+ I DSA
Sbjct  259   SLRRLRGSVIVDSA  272



>emb|CDY38076.1| BnaC02g06970D [Brassica napus]
Length=502

 Score =   209 bits (532),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 165/212 (78%), Positives = 185/212 (87%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT GE+FQGKC KAL IG GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LG
Sbjct  291  ATFGELFQGKCKKALIIGGGLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLG  350

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKLIMTGVAVVV+DRLGRRPLLLGGV G+ V+LFLLGSYY F    P VAV+ALLLYVG
Sbjct  351  LLKLIMTGVAVVVIDRLGRRPLLLGGVGGMVVSLFLLGSYYIFFSAAPVVAVVALLLYVG  410

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISEIFPL++RGRGLS+AVL+NF  NALVTFAFSP+KEL GAG +F  
Sbjct  411  CYQLSFGPIGWLMISEIFPLKLRGRGLSLAVLLNFSANALVTFAFSPLKELFGAGILFMG  470

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVI V++++F++FI+PETKGLTLEEIEAK L
Sbjct  471  FGVICVLSLLFIYFIVPETKGLTLEEIEAKCL  502


 Score =   106 bits (265),  Expect(2) = 1e-76, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V  ++GWRYMY  SVP+++VMGIGMWWLPASPRW+LL  IQGKG++   +E A+ 
Sbjct  198   IGSLTVNTLSGWRYMYATSVPLAVVMGIGMWWLPASPRWLLLRVIQGKGNVENQKEAAIK  257

Query  948   CLCRLRGATIGDSAHH  901
              LCRLRG+   DSA  
Sbjct  258   SLCRLRGSAFVDSAAE  273



>gb|EMT10196.1| D-xylose-proton symporter-like protein 2 [Aegilops tauschii]
Length=524

 Score =   208 bits (529),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 157/239 (66%), Positives = 180/239 (75%), Gaps = 29/239 (12%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaa------------  705
            A   E+FQGKCLKA+ IG GL+ FQQ+TGQPSVLYYAA IFQ                  
Sbjct  285  AGFSEIFQGKCLKAMIIGCGLVFFQQVTGQPSVLYYAATIFQVLILLHMKLFNSSMPLSG  344

Query  704  -----------------aadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIA  576
                             A+DATR SI LGLLKLIMTGVAV+VVD+LGRRPLL+GGVSGIA
Sbjct  345  VKVAISSIRVGSAGFSGASDATRVSILLGLLKLIMTGVAVLVVDKLGRRPLLIGGVSGIA  404

Query  575  VALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAV  396
            V+LFLL SYYT     P VAVIALLLYVGCYQLSFGPIGWLMISE+FPL++RGRGLS+AV
Sbjct  405  VSLFLLSSYYTLFTGAPYVAVIALLLYVGCYQLSFGPIGWLMISEVFPLKLRGRGLSVAV  464

Query  395  LVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAK  219
            LVNF +NALVTFAFSP+++L+G G +F  FGVIAV ++ F+F I+PETKGLTLEEIEAK
Sbjct  465  LVNFASNALVTFAFSPLEDLIGTGVLFASFGVIAVASLAFIFCIVPETKGLTLEEIEAK  523


 Score =   104 bits (259),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 46/72 (64%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VG+L VEV++GWRYMY  S PI ++MGIGM WLP SPRW+LLCA QGKGD+   +E A  
Sbjct  192   VGNLFVEVISGWRYMYAASAPICVIMGIGMCWLPCSPRWLLLCATQGKGDLRETKENATR  251

Query  948   CLCRLRGATIGD  913
             CLCRLRG    D
Sbjct  252   CLCRLRGQASPD  263



>ref|XP_010063233.1| PREDICTED: D-xylose-proton symporter-like 2 [Eucalyptus grandis]
 gb|KCW90943.1| hypothetical protein EUGRSUZ_A02968 [Eucalyptus grandis]
Length=503

 Score =   198 bits (504),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQGKCLKAL +G G++LFQQITGQPSVLYYAA I Q AGF+AA+DATR SI LGLLKL
Sbjct  296  EIFQGKCLKALIVGGGVVLFQQITGQPSVLYYAATILQSAGFSAASDATRVSILLGLLKL  355

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            IMTGVAV+VVDR+GRRPLLLGGVSG+ V+L LLGSYY FLD+VP  AV+ LLLYVGCYQ+
Sbjct  356  IMTGVAVLVVDRVGRRPLLLGGVSGMFVSLLLLGSYYLFLDDVPAAAVVGLLLYVGCYQV  415

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPIGWL+ISEIFPLR+RGRGLS+AVLVNFG NALVT AFSP+ +L+G+G +F+ FGVI
Sbjct  416  SFGPIGWLLISEIFPLRLRGRGLSMAVLVNFGANALVTLAFSPLVDLLGSGLLFYGFGVI  475

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
             +VA++F+FFI+PETKGLTLEEIEAK L
Sbjct  476  TLVALLFIFFIVPETKGLTLEEIEAKCL  503


 Score =   114 bits (284),  Expect(2) = 1e-75, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V++VAGWRYMYG S+P+++VMGIGMWWLP+SPRW+LL AIQG+G+M  L++ A+ 
Sbjct  199   IGSLLVDIVAGWRYMYGASMPLAVVMGIGMWWLPSSPRWLLLRAIQGRGNMQELKDNAIY  258

Query  948   CLCRLRGATIGDSAHH  901
             CL R+RG  IGDSA  
Sbjct  259   CLYRIRGPIIGDSAPE  274



>gb|ABK24923.1| unknown [Picea sitchensis]
Length=521

 Score =   204 bits (520),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 180/208 (87%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQGK LKA  IG GL+LFQQITGQPSVLYYAA I Q AGF+AA+DATR S+ LG+ KL
Sbjct  313  EIFQGKSLKAFIIGGGLVLFQQITGQPSVLYYAATILQSAGFSAASDATRVSVILGVFKL  372

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MTG+AV+ VD+LGRRPLL+GGVSGI ++LFLL +YY+FL+  P VAV+ALL YV CYQ+
Sbjct  373  LMTGIAVLKVDQLGRRPLLIGGVSGIVLSLFLLAAYYSFLNGTPIVAVLALLFYVSCYQV  432

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVLVNF +NALVTF+FSP++EL+GA  +F  FGVI
Sbjct  433  SFGPISWLMVSEIFPLRTRGRGISVAVLVNFASNALVTFSFSPLQELLGASMLFVTFGVI  492

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++FV F +PETKGL+LEEIE+K L
Sbjct  493  ALLSLLFVIFYVPETKGLSLEEIESKIL  520


 Score =   102 bits (255),  Expect(2) = 4e-74, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +G+L ++V+ GWRYMYG+S PI++++GIGMWWLP SPRW+LL A++GKG++  L+E A+ 
Sbjct  213   MGNLEIDVIGGWRYMYGLSTPIAVILGIGMWWLPPSPRWLLLQAVRGKGNLEELKERAIF  272

Query  948   CLCRLRGATIGDSAHH  901
              L RLRG  +GD+A  
Sbjct  273   ALSRLRGRPMGDTASD  288



>ref|XP_002300123.2| hypothetical protein POPTR_0001s25100g [Populus trichocarpa]
 gb|EEE84928.2| hypothetical protein POPTR_0001s25100g [Populus trichocarpa]
Length=559

 Score =   203 bits (517),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 176/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL
Sbjct  351  EVFQGPSLKAFVIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGLFKL  410

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
             MT +AV+ VD LGRRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  411  AMTWIAVLKVDDLGRRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVAALLLYVGCYQI  470

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+SIAVL NFG+NA+VTFAFSP+KEL+GA N+F +FG I
Sbjct  471  SFGPISWLMVSEIFPLRTRGRGISIAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGAI  530

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++FV  I+PETKGL+LEEIE+K L
Sbjct  531  ALLSLLFVVVIVPETKGLSLEEIESKIL  558


 Score = 94.0 bits (232),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS+ +  V GWRYMYG  VPIS++MG+GMW LP SPRW+LL A+QGKG     +E A+S
Sbjct  251   VGSIQINAVGGWRYMYGFGVPISLLMGLGMWSLPPSPRWLLLRAVQGKGSFQEYKEKAIS  310

Query  948   CLCRLRGATIGDS  910
              L +LRG   GD 
Sbjct  311   ALSKLRGRPPGDK  323



>ref|XP_010443656.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Camelina 
sativa]
Length=559

 Score =   204 bits (520),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKALTIG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  350  EVFQGPNLKALTIGGGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKL  409

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT VAV  VD LGRRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  410  LMTWVAVAKVDDLGRRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQI  469

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG I
Sbjct  470  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGGI  529

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+V+++FV  ++PETKGL+LEEIE+K L
Sbjct  530  ALVSLLFVILVVPETKGLSLEEIESKIL  557


 Score = 91.7 bits (226),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++VV GWRYMYG   P++I+MG+GMW LPASPRW+LL A+QGKG +   +E A+ 
Sbjct  250   VGSFQIDVVGGWRYMYGFGTPVAILMGLGMWSLPASPRWLLLRAVQGKGPLQEYKEKAML  309

Query  948   CLCRLRGATIGD  913
              L +LRG   GD
Sbjct  310   ALSKLRGRPPGD  321



>ref|XP_006279761.1| hypothetical protein CARUB_v10027739mg [Capsella rubella]
 gb|EOA12659.1| hypothetical protein CARUB_v10027739mg [Capsella rubella]
Length=559

 Score =   206 bits (523),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKALTIG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  350  EVFQGPNLKALTIGGGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKL  409

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT VAV  VD LGRRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  410  LMTWVAVAKVDDLGRRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQI  469

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG I
Sbjct  470  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGGI  529

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+V+++FV  ++PETKGL+LEEIE+K L
Sbjct  530  ALVSLLFVILVVPETKGLSLEEIESKIL  557


 Score = 90.5 bits (223),  Expect(2) = 9e-71, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++VV GWRYMYG   P++++MG+GMW LPASPRW+LL A+QGKG +   +E A+ 
Sbjct  250   VGSFQIDVVGGWRYMYGFGTPVAMLMGLGMWSLPASPRWLLLRAVQGKGPLQEYKEKAML  309

Query  948   CLCRLRGATIGD  913
              L +LRG   GD
Sbjct  310   ALSKLRGRPPGD  321



>ref|NP_200733.2| Major facilitator superfamily protein [Arabidopsis thaliana]
 sp|Q0WWW9.2|XYLL3_ARATH RecName: Full=D-xylose-proton symporter-like 3, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09770.1| sugar transporter-like protein [Arabidopsis thaliana]
 gb|AAU05477.1| At5g59250 [Arabidopsis thaliana]
 gb|AAV85693.1| At5g59250 [Arabidopsis thaliana]
 gb|AED97162.1| Major facilitator superfamily protein [Arabidopsis thaliana]
Length=558

 Score =   204 bits (520),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKALTIG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  350  EVFQGPNLKALTIGGGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKL  409

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT VAV  VD LGRRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  410  LMTWVAVAKVDDLGRRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQI  469

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG I
Sbjct  470  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGGI  529

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+V+++FV  ++PETKGL+LEEIE+K L
Sbjct  530  ALVSLLFVILVVPETKGLSLEEIESKIL  557


 Score = 91.3 bits (225),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++VV GWRYMYG   P++++MG+GMW LPASPRW+LL A+QGKG +   +E A+ 
Sbjct  250   VGSFQIDVVGGWRYMYGFGTPVALLMGLGMWSLPASPRWLLLRAVQGKGQLQEYKEKAML  309

Query  948   CLCRLRGATIGDS  910
              L +LRG   GD 
Sbjct  310   ALSKLRGRPPGDK  322



>dbj|BAE98379.1| D-xylose-H+ symporter - like protein [Arabidopsis thaliana]
Length=558

 Score =   204 bits (520),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKALTIG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  350  EVFQGPNLKALTIGGGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKL  409

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT VAV  VD LGRRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  410  LMTWVAVAKVDDLGRRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQI  469

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG I
Sbjct  470  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGGI  529

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+V+++FV  ++PETKGL+LEEIE+K L
Sbjct  530  ALVSLLFVILVVPETKGLSLEEIESKIL  557


 Score = 91.3 bits (225),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++VV GWRYMYG   P++++MG+GMW LPASPRW+LL A+QGKG +   +E A+ 
Sbjct  250   VGSFQIDVVGGWRYMYGFGTPVALLMGLGMWSLPASPRWLLLRAVQGKGQLQEYKEKAML  309

Query  948   CLCRLRGATIGDS  910
              L +LRG   GD 
Sbjct  310   ALSKLRGRPPGDK  322



>ref|XP_010483521.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Camelina 
sativa]
Length=560

 Score =   204 bits (519),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKALTIG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  351  EVFQGPNLKALTIGGGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKL  410

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT VAV  VD LGRRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  411  LMTWVAVAKVDDLGRRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQI  470

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG I
Sbjct  471  SFGPISWLMVSEIFPLRTRGRGISLAVLANFGSNAIVTFAFSPLKEFLGAENLFLLFGGI  530

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++FV  ++PETKGL+LEEIE+K L
Sbjct  531  ALISLLFVILVVPETKGLSLEEIESKIL  558


 Score = 91.7 bits (226),  Expect(2) = 1e-70, Method: Compositional matrix adjust.
 Identities = 41/73 (56%), Positives = 53/73 (73%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++VV GWRYMYG   P++I+MG+GMW LPASPRW+LL A+QGKG +   +E A+ 
Sbjct  251   VGSFQIDVVGGWRYMYGFGTPVAILMGLGMWSLPASPRWLLLRAVQGKGPLQEYKEKAML  310

Query  948   CLCRLRGATIGDS  910
              L +LRG   GD 
Sbjct  311   ALSKLRGRPPGDK  323



>ref|XP_006297488.1| hypothetical protein CARUB_v10013506mg [Capsella rubella]
 gb|EOA30386.1| hypothetical protein CARUB_v10013506mg [Capsella rubella]
Length=502

 Score =   201 bits (512),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 159/212 (75%), Positives = 188/212 (89%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT  ++F+GKCLKALTI  GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR SI LG
Sbjct  291  ATFADLFRGKCLKALTIAGGLVLFQQITGQPSVLYYAPSILQTAGFSAAADATRISILLG  350

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            +LKL+MTGV+V+V+DRLGRRPLLLGGVSG+ V+LFLLGSYY F +  P VAV ALLLYVG
Sbjct  351  VLKLVMTGVSVIVIDRLGRRPLLLGGVSGMVVSLFLLGSYYIFYNTAPAVAVAALLLYVG  410

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISEIFPL++RGRG+S+AVL+NFG NALVTFAFSP+K+L+GAG +F  
Sbjct  411  CYQLSFGPIGWLMISEIFPLKLRGRGISLAVLINFGANALVTFAFSPLKDLLGAGVLFCG  470

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVI ++++ F++FI+PETKGLTLEEIEAK L
Sbjct  471  FGVICLLSLFFIYFIVPETKGLTLEEIEAKCL  502


 Score = 93.6 bits (231),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V V++GWRYMY   +P+ ++MGIGM WLPASPRW+LL A+QGKG+   L++ A+ 
Sbjct  198   IGSLWVTVISGWRYMYATILPVPVIMGIGMCWLPASPRWLLLRALQGKGNGENLQQAAIK  257

Query  948   CLCRLRGATIGDSAHH  901
              L RLRG  I DSA  
Sbjct  258   SLRRLRGPAIADSAAE  273



>gb|KJB20000.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
 gb|KJB20001.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
Length=561

 Score =   201 bits (510),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 175/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL
Sbjct  353  EVFQGPSLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRLSVVVGLFKL  412

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV  VD LGRRPLL+GGV GIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  413  LMTWIAVAKVDDLGRRPLLIGGVGGIALSLFLLCAYYKFLGEFPYVAVAALLLYVGCYQI  472

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FGVI
Sbjct  473  SFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGVI  532

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++FV   +PETKGL+LEEIE+K L
Sbjct  533  ALISLLFVALYVPETKGLSLEEIESKLL  560


 Score = 92.4 bits (228),  Expect(2) = 7e-70, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG S P++++MG+GMW LP SPRW++L A+QGKG +  L+E A+ 
Sbjct  253   VGSFQINAVGGWRYMYGCSAPVALLMGLGMWSLPPSPRWLILRAVQGKGSLQELKEKAIL  312

Query  948   CLCRLRGATIGDSAHH  901
              L +LRG   GD A  
Sbjct  313   ALSKLRGRAPGDEASE  328



>gb|KJB20004.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
Length=541

 Score =   200 bits (509),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 175/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL
Sbjct  333  EVFQGPSLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRLSVVVGLFKL  392

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV  VD LGRRPLL+GGV GIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  393  LMTWIAVAKVDDLGRRPLLIGGVGGIALSLFLLCAYYKFLGEFPYVAVAALLLYVGCYQI  452

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FGVI
Sbjct  453  SFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGVI  512

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++FV   +PETKGL+LEEIE+K L
Sbjct  513  ALISLLFVALYVPETKGLSLEEIESKLL  540


 Score = 92.4 bits (228),  Expect(2) = 8e-70, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG S P++++MG+GMW LP SPRW++L A+QGKG +  L+E A+ 
Sbjct  233   VGSFQINAVGGWRYMYGCSAPVALLMGLGMWSLPPSPRWLILRAVQGKGSLQELKEKAIL  292

Query  948   CLCRLRGATIGDSAHH  901
              L +LRG   GD A  
Sbjct  293   ALSKLRGRAPGDEASE  308



>ref|XP_010043498.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Eucalyptus 
grandis]
 gb|KCW85511.1| hypothetical protein EUGRSUZ_B02309 [Eucalyptus grandis]
Length=570

 Score =   197 bits (500),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  I  GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL
Sbjct  362  EVFQGPSLKAFIIAGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGLFKL  421

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT VAV+ VD LGRRPLL+GGV+GI ++L  L SYY FL   P VAV ALLLYVGCYQ+
Sbjct  422  LMTSVAVLKVDDLGRRPLLIGGVAGIVISLLFLSSYYKFLGEFPLVAVAALLLYVGCYQI  481

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+ EL+GA NVF +FGVI
Sbjct  482  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLTELLGAENVFLLFGVI  541

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++FV  ++PETKGL+LEEIE+K L
Sbjct  542  ALLSLLFVVLLVPETKGLSLEEIESKIL  569


 Score = 95.9 bits (237),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 43/73 (59%), Positives = 54/73 (74%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VG+L ++ V GWRYMYGV  PI++VMG+GMW LP SPRW+LL A+QGKG +   +E AV+
Sbjct  262   VGNLQIDAVGGWRYMYGVGAPIALVMGLGMWSLPPSPRWLLLRAVQGKGPLQDYKEKAVA  321

Query  948   CLCRLRGATIGDS  910
              L RLRG   GD 
Sbjct  322   ALSRLRGRPAGDK  334



>ref|XP_004983521.1| PREDICTED: LOW QUALITY PROTEIN: D-xylose-proton symporter-like 
2-like [Setaria italica]
Length=515

 Score =   194 bits (493),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 154/210 (73%), Positives = 179/210 (85%), Gaps = 2/210 (1%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            A   E+FQGKCLKA+ IG GL+ FQQ+TGQPSVLYYAA IFQ AGF+ A+DATR SI LG
Sbjct  307  AGFSEIFQGKCLKAMIIGCGLVFFQQVTGQPSVLYYAATIFQSAGFSGASDATRVSILLG  366

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKLIMTGVAV+VVDRLGRRPLL+GGVSGI   LFLL S     ++   VAV ALLLYVG
Sbjct  367  LLKLIMTGVAVLVVDRLGRRPLLIGGVSGITF-LFLL-SLLHITEDASYVAVXALLLYVG  424

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISE+FPL++RGRGLS+AVLVNF +NALVTFAFSP+++L+G G +F  
Sbjct  425  CYQLSFGPIGWLMISEVFPLKLRGRGLSVAVLVNFASNALVTFAFSPLEDLIGTGLLFCG  484

Query  308  fgviavvavifvffiIPETKGLTLEEIEAK  219
            FGVIAV +++F+F+IIPETKGLTLEEIEA 
Sbjct  485  FGVIAVASLVFIFWIIPETKGLTLEEIEAS  514


 Score = 98.2 bits (243),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 43/71 (61%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = -2

Query  1125  GSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSC  946
             G+L VEVV+GWRYMY  S P+ ++MG+GM WLP+SPRW+LLCAIQGK ++   +E A  C
Sbjct  215   GNLYVEVVSGWRYMYATSTPLCLIMGVGMCWLPSSPRWLLLCAIQGKRNLQETKEIATLC  274

Query  945   LCRLRGATIGD  913
             LCRLRG    D
Sbjct  275   LCRLRGQASPD  285



>emb|CDY54245.1| BnaC09g53840D [Brassica napus]
Length=559

 Score =   205 bits (521),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKALTIG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  351  EVFQGPNLKALTIGGGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKL  410

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT VAV  VD LGRRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  411  LMTWVAVAKVDDLGRRPLLIGGVSGIAISLFLLSAYYKFLGGFPLVAVGALLLYVGCYQI  470

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG I
Sbjct  471  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKEYLGAENLFLLFGAI  530

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+V+++FV  ++PETKGL+LEEIE+K L
Sbjct  531  ALVSLLFVVLVVPETKGLSLEEIESKIL  558


 Score = 87.0 bits (214),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 38/72 (53%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++VV GWRYMYG   P++++MG+GMW LP SPRW+LL A+QGKG +   ++ A+ 
Sbjct  250   VGSFEIDVVGGWRYMYGFGTPVALLMGLGMWSLPPSPRWLLLRAVQGKGALQEYKDKAMV  309

Query  948   CLCRLRGATIGD  913
              L +LRG   GD
Sbjct  310   ALSKLRGRPPGD  321



>ref|XP_011035266.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Populus euphratica]
Length=557

 Score =   198 bits (504),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+ QG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL
Sbjct  349  EVLQGPSLKAFVIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGLFKL  408

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
             MT +AV+ VD LGRRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  409  AMTWIAVLKVDDLGRRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVAALLLYVGCYQI  468

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+G  N+F +FG I
Sbjct  469  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGVENLFLLFGAI  528

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++FV  I+PETKGL+LEEIE+K L
Sbjct  529  ALLSLLFVVVIVPETKGLSLEEIESKIL  556


 Score = 94.0 bits (232),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS+ +  V GWRYMYG  VPIS++MG+GMW LP SPRW+LL A+QGKG     +E A+S
Sbjct  249   VGSIQINAVGGWRYMYGFGVPISLLMGLGMWSLPPSPRWLLLRAVQGKGSFQEYKEKAIS  308

Query  948   CLCRLRGATIGDS  910
              L +LRG   GD 
Sbjct  309   SLSKLRGRPPGDK  321



>ref|XP_008777375.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Phoenix 
dactylifera]
 ref|XP_008777383.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Phoenix 
dactylifera]
Length=564

 Score =   199 bits (505),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 144/212 (68%), Positives = 176/212 (83%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            A+  EMF+G  LKA  IG GL+LFQQITGQPSVLYYAA I Q AGF+AA+DA R S+ +G
Sbjct  352  ASFWEMFEGASLKAFIIGGGLVLFQQITGQPSVLYYAASILQSAGFSAASDAARVSVVIG  411

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            + KL+MTG+AV+ VD LGRRPLL+GGVSGI ++LFLL +YY FL   P VAV ALLLYVG
Sbjct  412  IFKLLMTGIAVLKVDNLGRRPLLIGGVSGIVLSLFLLAAYYKFLGGFPLVAVGALLLYVG  471

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
             YQ+SFGPI WL++SEIFPLR RGRG+S+AVL NFG+NA VTFAFSP+KEL+G  N+F I
Sbjct  472  SYQVSFGPISWLVVSEIFPLRTRGRGISLAVLTNFGSNAFVTFAFSPLKELLGPDNLFLI  531

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FG +A+++++FV F +PETKGL+LEEIEAK L
Sbjct  532  FGAVALLSLLFVLFYVPETKGLSLEEIEAKIL  563


 Score = 93.2 bits (230),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS+ +  V GWRYMYG S PI+++MGIGMW LP SPRW+LL A+QGKG +   RE A+ 
Sbjct  256   VGSVEISAVGGWRYMYGFSAPIAVLMGIGMWSLPPSPRWLLLRAVQGKGSLEEYREKAIH  315

Query  948   CLCRLRGATIGDS  910
              L +LRG   GD 
Sbjct  316   ALGKLRGRPAGDE  328



>ref|XP_009120413.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Brassica 
rapa]
Length=555

 Score =   205 bits (521),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKALTIG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  347  EVFQGPNLKALTIGGGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKL  406

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT VAV  VD LGRRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  407  LMTWVAVAKVDDLGRRPLLIGGVSGIAISLFLLSAYYKFLGGFPLVAVGALLLYVGCYQI  466

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG I
Sbjct  467  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKEYLGAENLFLLFGAI  526

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+V+++FV  ++PETKGL+LEEIE+K L
Sbjct  527  ALVSLLFVVLVVPETKGLSLEEIESKIL  554


 Score = 87.0 bits (214),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++VV GWRYMYG   P++++MG+GMW LP SPRW+LL A+QGKG +   ++ A+ 
Sbjct  246   VGSFEIDVVGGWRYMYGFGTPVALLMGLGMWSLPPSPRWLLLRAVQGKGALQEYKDKAMV  305

Query  948   CLCRLRGATIGDS  910
              L +LRG   GD 
Sbjct  306   ALSKLRGRPPGDK  318



>emb|CDY33006.1| BnaA10g12120D [Brassica napus]
Length=555

 Score =   205 bits (521),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKALTIG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  347  EVFQGPNLKALTIGGGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKL  406

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT VAV  VD LGRRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  407  LMTWVAVAKVDDLGRRPLLIGGVSGIAISLFLLSAYYKFLGGFPLVAVGALLLYVGCYQI  466

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG I
Sbjct  467  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKEYLGAENLFLLFGAI  526

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+V+++FV  ++PETKGL+LEEIE+K L
Sbjct  527  ALVSLLFVVLVVPETKGLSLEEIESKIL  554


 Score = 87.0 bits (214),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 38/73 (52%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++VV GWRYMYG   P++++MG+GMW LP SPRW+LL A+QGKG +   ++ A+ 
Sbjct  246   VGSFEIDVVGGWRYMYGFGTPVALLMGLGMWSLPPSPRWLLLRAVQGKGALQEYKDKAMV  305

Query  948   CLCRLRGATIGDS  910
              L +LRG   GD 
Sbjct  306   ALSKLRGRPPGDK  318



>ref|XP_011035268.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Populus euphratica]
Length=555

 Score =   198 bits (503),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+ QG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL
Sbjct  347  EVLQGPSLKAFVIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGLFKL  406

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
             MT +AV+ VD LGRRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  407  AMTWIAVLKVDDLGRRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVAALLLYVGCYQI  466

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+G  N+F +FG I
Sbjct  467  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGVENLFLLFGAI  526

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++FV  I+PETKGL+LEEIE+K L
Sbjct  527  ALLSLLFVVVIVPETKGLSLEEIESKIL  554


 Score = 93.6 bits (231),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 42/73 (58%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS+ +  V GWRYMYG  VPIS++MG+GMW LP SPRW+LL A+QGKG     +E A+S
Sbjct  247   VGSIQINAVGGWRYMYGFGVPISLLMGLGMWSLPPSPRWLLLRAVQGKGSFQEYKEKAIS  306

Query  948   CLCRLRGATIGDS  910
              L +LRG   GD 
Sbjct  307   SLSKLRGRPPGDK  319



>ref|XP_009779936.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Nicotiana sylvestris]
Length=552

 Score =   199 bits (507),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADA R S+ +G+ K 
Sbjct  344  EVFQGPSLKAFIIGGGLVLFQQITGQPSVLYYAGSILQSAGFSAAADAARVSVVIGIFKS  403

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT VAV+  D LGRRPLL+GGVSGIA++LFLL +YY FL + P VAV ALLLYVGCYQ+
Sbjct  404  LMTAVAVLKADDLGRRPLLIGGVSGIALSLFLLSAYYKFLGSFPFVAVAALLLYVGCYQI  463

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG I
Sbjct  464  SFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGAI  523

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++FV   +PETKGL+LEEIE+K L
Sbjct  524  ALLSLLFVVTSVPETKGLSLEEIESKIL  551


 Score = 91.3 bits (225),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYM+G+S PI+++MG+GMW LP SPRW+LL AIQ KG + G +E A+ 
Sbjct  244   VGSYEINAVGGWRYMFGLSAPIALLMGLGMWSLPPSPRWLLLRAIQSKGPLQGYKEKAIG  303

Query  948   CLCRLRGATIGDSAHH  901
              L +LRG   GD    
Sbjct  304   ALSKLRGRPAGDKVSE  319



>ref|XP_010261641.1| PREDICTED: D-xylose-proton symporter-like 2, partial [Nelumbo 
nucifera]
Length=429

 Score =   235 bits (599),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 179/238 (75%), Positives = 213/238 (89%), Gaps = 0/238 (0%)
 Frame = -3

Query  926  QQLGIRHIIQVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVL  747
            Q +G     QVDEIL ELS+  +EKE+++ E+FQGKCLKAL IGAGL+LFQQITGQPSVL
Sbjct  192  QAIGNSAPEQVDEILVELSYNDQEKESSLMEIFQGKCLKALIIGAGLVLFQQITGQPSVL  251

Query  746  YYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVAL  567
            YYAA I + AGF+AA+DATR SI LGLLKLIMTG+AV+VVD+LGRRPLLLGGVSGI ++L
Sbjct  252  YYAATILKSAGFSAASDATRVSILLGLLKLIMTGIAVLVVDKLGRRPLLLGGVSGIVISL  311

Query  566  FLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVN  387
            FLL +YYTFL+N P VAV+ALLLYVGCYQLSFGPIGWLMISEIFPLR+RGRGLSIAVLVN
Sbjct  312  FLLAAYYTFLNNAPFVAVVALLLYVGCYQLSFGPIGWLMISEIFPLRLRGRGLSIAVLVN  371

Query  386  FGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            F +NALVTFAFSP++ L+GAG +F +FGVI+V++++F+FFI+PETKGL+LEEIEAK L
Sbjct  372  FASNALVTFAFSPLESLIGAGMLFVVFGVISVLSLLFIFFIVPETKGLSLEEIEAKIL  429


 Score =   120 bits (300),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 78/117 (67%), Gaps = 8/117 (7%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VG L +++V GWRYMYG SVP+S++MGIG+WWLP SPRW+LLCAIQGKG+M  L+E A+S
Sbjct  125   VGCLEIDLVGGWRYMYGTSVPLSVIMGIGVWWLPPSPRWLLLCAIQGKGNMQDLKERAIS  184

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPNNWCWTNLV  778
             CLCRLRG  IG+SA  P + + +        +  +N +     ++E     C   L+
Sbjct  185   CLCRLRGQAIGNSA--PEQVDEILV------ELSYNDQEKESSLMEIFQGKCLKALI  233



>ref|XP_007016336.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY33955.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=561

 Score =   199 bits (505),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  I  GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL
Sbjct  353  EVFQGPSLKAFIIAGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRLSVLVGLFKL  412

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AVV VD LGRRPLL+GGV GIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  413  LMTWIAVVKVDDLGRRPLLIGGVGGIALSLFLLSAYYKFLGGFPFVAVAALLLYVGCYQI  472

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG I
Sbjct  473  SFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLVFGAI  532

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+ +++FV   +PETKGL+LEEIE+K L
Sbjct  533  ALSSLLFVVLYVPETKGLSLEEIESKIL  560


 Score = 90.9 bits (224),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWR+MYG S PI+++MGIGMW LP SPRW+LL A+QGKG +   +E A+ 
Sbjct  253   VGSFQINAVGGWRFMYGCSAPIALLMGIGMWSLPPSPRWLLLRAVQGKGYLQEYKEKAIL  312

Query  948   CLCRLRGATIGDSAHH  901
              L +LRG   GD A  
Sbjct  313   ALSKLRGRAPGDEASE  328



>ref|XP_010256836.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Nelumbo 
nucifera]
Length=568

 Score =   206 bits (523),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADA R S+ +G  KL
Sbjct  360  EVFQGSSLKAFIIGGGLVLFQQITGQPSVLYYAGSILQSAGFSAAADAARVSVVIGTFKL  419

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MTGVAV+ VD LGRRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  420  LMTGVAVLKVDDLGRRPLLIGGVSGIALSLFLLTAYYKFLGGFPIVAVAALLLYVGCYQI  479

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRGLS+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG I
Sbjct  480  SFGPISWLMVSEIFPLRTRGRGLSLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGGI  539

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++F    +PETKGL+LEEIE+K L
Sbjct  540  ALLSLLFAIVFVPETKGLSLEEIESKIL  567


 Score = 84.0 bits (206),  Expect(2) = 7e-69, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS+ ++ V GWRYMYG+S PI+ +MG+G W LP SPRW+LL A+QGKG +   ++ A+ 
Sbjct  260   VGSVQIDAVGGWRYMYGLSAPIAALMGLGTWSLPPSPRWLLLRAVQGKGSLQEYKDKAIQ  319

Query  948   CLCRLRGATIGD  913
              + +LRG    D
Sbjct  320   AIRKLRGRGADD  331



>emb|CDX92028.1| BnaC03g33300D [Brassica napus]
Length=480

 Score =   236 bits (601),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 167/212 (79%), Positives = 190/212 (90%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            ATIGE+FQGKCLKALTI  GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LG
Sbjct  269  ATIGELFQGKCLKALTIAGGLVLFQQITGQPSVLYYAPSILQTAGFSAATDATRISILLG  328

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            LLKL MTGVAV+V+D+LGRRPLLLGGVSG+ ++LFLLGSYY F +NVP VAV ALLLYVG
Sbjct  329  LLKLAMTGVAVIVIDKLGRRPLLLGGVSGMVLSLFLLGSYYIFYNNVPAVAVAALLLYVG  388

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPI WLM+SEIFPL++RGRG+SIAVLVNFGTNALVTFAFSP+KEL+GAG +F  
Sbjct  389  CYQLSFGPISWLMMSEIFPLKLRGRGISIAVLVNFGTNALVTFAFSPLKELLGAGVLFCG  448

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FGVI V+++ F++FI+PETKGLTLEEIEAK L
Sbjct  449  FGVICVLSLFFIYFIVPETKGLTLEEIEAKCL  480



>emb|CDP09100.1| unnamed protein product [Coffea canephora]
Length=567

 Score =   197 bits (500),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 172/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGFAAA+DATR S+ +G  KL
Sbjct  359  EVFQGPSLKAFIIGGGLVLFQQITGQPSVLYYAGPILQTAGFAAASDATRLSVVIGTFKL  418

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MTG+AV+ VD LGRRPLL+GGV GIA++L LL +YY FL   P VAV ALLLYVG YQ+
Sbjct  419  VMTGIAVLKVDDLGRRPLLIGGVGGIALSLLLLWAYYKFLGGYPLVAVAALLLYVGSYQV  478

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG I
Sbjct  479  SFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAANLFLLFGAI  538

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++F    +PETKGL+LEEIE+K L
Sbjct  539  ALLSLVFAVVYVPETKGLSLEEIESKIL  566


 Score = 92.0 bits (227),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 43/72 (60%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  + VV GWRYMYG+S PI+++MGIGM  LP SPRW+LL A+QGKG +  L+E A  
Sbjct  259   VGSYEINVVGGWRYMYGLSAPIALLMGIGMLSLPPSPRWLLLRAVQGKGPLQELKEKAKH  318

Query  948   CLCRLRGATIGD  913
              L RLRG   GD
Sbjct  319   ALSRLRGRAAGD  330



>ref|XP_009605730.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Nicotiana tomentosiformis]
Length=547

 Score =   199 bits (505),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADA R S+ +G+ K 
Sbjct  339  EVFQGPSLKAFIIGGGLVLFQQITGQPSVLYYAGSILQSAGFSAAADAARVSVVIGVFKS  398

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT VAV+  D LGRRPLL+GGVSGIA++LFLL +YY FL + P VAV ALLLYVGCYQ+
Sbjct  399  LMTAVAVLKADDLGRRPLLIGGVSGIALSLFLLSAYYKFLGSFPFVAVAALLLYVGCYQI  458

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG I
Sbjct  459  SFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGAI  518

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++FV   +PETKGL+LEEIE+K L
Sbjct  519  ALLSLLFVITSVPETKGLSLEEIESKIL  546


 Score = 89.4 bits (220),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  + VV GWRYM+G+S PI+++MG+GMW LP SPRW+LL AIQ KG +   +E A+ 
Sbjct  239   VGSYEINVVGGWRYMFGLSAPIALLMGLGMWSLPPSPRWLLLRAIQSKGPLQEYKEKAIG  298

Query  948   CLCRLRGATIGDSAHH  901
              L +LRG   GD    
Sbjct  299   ALSKLRGRPAGDKVSE  314



>gb|KHN32151.1| D-xylose-proton symporter-like 3, chloroplastic [Glycine soja]
Length=560

 Score =   192 bits (487),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AA+DAT+ S+ +GL KL
Sbjct  352  EVFQGPNLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAASDATKVSVVIGLFKL  411

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV+ VD LGRRPLL+GGVSGIA++L LL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  412  LMTWIAVLKVDDLGRRPLLIGGVSGIALSLVLLSAYYKFLGGFPLVAVGALLLYVGCYQI  471

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SE+FPLR RG+G+S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG I
Sbjct  472  SFGPISWLMVSEVFPLRTRGKGISLAVLTNFASNAVVTFAFSPLKEFLGAENLFLLFGAI  531

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A ++++F+ F +PETKG++LE+IE+K L
Sbjct  532  ATLSLLFIIFSVPETKGMSLEDIESKIL  559


 Score = 96.3 bits (238),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS ++E V GWR+MYG S P++++MG+GMW LP SPRW+LL A+QGKG    L+E A++
Sbjct  252   VGSFLIETVGGWRFMYGFSAPVAVLMGLGMWTLPNSPRWLLLRAVQGKGSFQDLKEQAIA  311

Query  948   CLCRLRGATIGD  913
              L +LRG   GD
Sbjct  312   SLSKLRGRPPGD  323



>ref|XP_003539594.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X1 [Glycine max]
 ref|XP_006592182.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X2 [Glycine max]
Length=560

 Score =   192 bits (487),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 137/208 (66%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AA+DAT+ S+ +GL KL
Sbjct  352  EVFQGPNLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAASDATKVSVVIGLFKL  411

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV+ VD LGRRPLL+GGVSGIA++L LL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  412  LMTWIAVLKVDDLGRRPLLIGGVSGIALSLVLLSAYYKFLGGFPLVAVGALLLYVGCYQI  471

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SE+FPLR RG+G+S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG I
Sbjct  472  SFGPISWLMVSEVFPLRTRGKGISLAVLTNFASNAVVTFAFSPLKEFLGAENLFLLFGAI  531

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A ++++F+ F +PETKG++LE+IE+K L
Sbjct  532  ATLSLLFIIFSVPETKGMSLEDIESKIL  559


 Score = 96.3 bits (238),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 54/72 (75%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS ++E V GWR+MYG S P++++MG+GMW LP SPRW+LL A+QGKG    L+E A++
Sbjct  252   VGSFLIETVGGWRFMYGFSAPVAVLMGLGMWTLPNSPRWLLLRAVQGKGSFQDLKEQAIA  311

Query  948   CLCRLRGATIGD  913
              L +LRG   GD
Sbjct  312   SLSKLRGRPPGD  323



>gb|ABB17074.1| putative sugar transporter [Nicotiana langsdorffii x Nicotiana 
sanderae]
Length=552

 Score =   199 bits (506),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADA R S+ +G+ K 
Sbjct  344  EVFQGPSLKAFIIGGGLVLFQQITGQPSVLYYAGSILQSAGFSAAADAARVSVVIGIFKS  403

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT VAV+  D LGRRPLL+GGVSGIA++LFLL +YY FL + P VAV ALLLYVGCYQ+
Sbjct  404  LMTAVAVLKADDLGRRPLLIGGVSGIALSLFLLSAYYKFLGSFPFVAVAALLLYVGCYQI  463

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG I
Sbjct  464  SFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGAI  523

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++FV   +PETKGL+LEEIE+K L
Sbjct  524  ALLSLLFVVTSVPETKGLSLEEIESKIL  551


 Score = 89.0 bits (219),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  + VV GWRYM+G+S PI+++MG+GMW LP SPRW+LL AIQ KG +   +E A+ 
Sbjct  244   VGSYEINVVGGWRYMFGLSAPIALLMGLGMWSLPPSPRWLLLRAIQSKGPLQEYKEKAMG  303

Query  948   CLCRLRGATIGDSAHH  901
              L +LRG   GD    
Sbjct  304   ALSKLRGRPAGDKVSE  319



>gb|KHN21925.1| D-xylose-proton symporter-like 3, chloroplastic [Glycine soja]
Length=552

 Score =   192 bits (489),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AA+DAT+ S+ +GL KL
Sbjct  344  EVFQGPNLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAASDATKVSVVIGLFKL  403

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV+ VD LGRRPLL+GGVSGIA++L LL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  404  LMTWIAVLKVDDLGRRPLLIGGVSGIALSLVLLSAYYKFLGGFPLVAVGALLLYVGCYQI  463

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SE+FPLR RG+G+S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG I
Sbjct  464  SFGPISWLMVSEVFPLRTRGKGISLAVLTNFASNAVVTFAFSPLKEFLGAENLFLLFGAI  523

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++F+ F +PETKGL+LE+IE+K L
Sbjct  524  AILSLLFIIFSVPETKGLSLEDIESKIL  551


 Score = 95.5 bits (236),  Expect(2) = 2e-68, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 53/72 (74%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS ++E V GWR+MYG S P++++MG+GMW LP SPRW+LL A+QGKG    L+E A+ 
Sbjct  244   VGSFLIETVGGWRFMYGFSAPVAVLMGLGMWTLPNSPRWLLLRAVQGKGSFQDLKEKAIF  303

Query  948   CLCRLRGATIGD  913
              L +LRG   GD
Sbjct  304   SLSKLRGRPPGD  315



>ref|XP_008681531.1| PREDICTED: uncharacterized protein LOC100274077 isoform X2 [Zea 
mays]
Length=559

 Score =   205 bits (522),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
             + ++F+G  LKA TIG GL+LFQQITGQPSVLYYAA I Q AGF+AA+DA + +I +GL
Sbjct  348  NVWDVFEGASLKAFTIGGGLVLFQQITGQPSVLYYAASILQTAGFSAASDAAKVAILIGL  407

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             KL+MTGVAV  VD +GRRPLL+GGV GIA++LFLL +YY  L+N P VAV ALLLYVG 
Sbjct  408  FKLLMTGVAVFKVDDVGRRPLLIGGVGGIALSLFLLAAYYKILNNFPFVAVGALLLYVGA  467

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ+SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NALVTFAFSP+KEL+G  N+FF+F
Sbjct  468  YQVSFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNALVTFAFSPLKELLGPANIFFLF  527

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            GVIAV++++FV  ++PETKGL+LEEIE+K L
Sbjct  528  GVIAVLSLVFVILVVPETKGLSLEEIESKIL  558


 Score = 82.8 bits (203),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGSL ++ V GWRYM+G S P++ +M IGMW LP+SPRW+LL A+QGK  +   ++ A+ 
Sbjct  251   VGSLEIDNVGGWRYMFGFSAPLAAIMAIGMWTLPSSPRWLLLRAVQGKASLEDNKKKAIQ  310

Query  948   CLCRLRGATIGDS  910
              L  LRG T  + 
Sbjct  311   ALRTLRGRTASEK  323



>ref|XP_008681530.1| PREDICTED: uncharacterized protein LOC100274077 isoform X1 [Zea 
mays]
Length=586

 Score =   205 bits (521),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
             + ++F+G  LKA TIG GL+LFQQITGQPSVLYYAA I Q AGF+AA+DA + +I +GL
Sbjct  375  NVWDVFEGASLKAFTIGGGLVLFQQITGQPSVLYYAASILQTAGFSAASDAAKVAILIGL  434

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             KL+MTGVAV  VD +GRRPLL+GGV GIA++LFLL +YY  L+N P VAV ALLLYVG 
Sbjct  435  FKLLMTGVAVFKVDDVGRRPLLIGGVGGIALSLFLLAAYYKILNNFPFVAVGALLLYVGA  494

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ+SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NALVTFAFSP+KEL+G  N+FF+F
Sbjct  495  YQVSFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNALVTFAFSPLKELLGPANIFFLF  554

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            GVIAV++++FV  ++PETKGL+LEEIE+K L
Sbjct  555  GVIAVLSLVFVILVVPETKGLSLEEIESKIL  585


 Score = 82.8 bits (203),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGSL ++ V GWRYM+G S P++ +M IGMW LP+SPRW+LL A+QGK  +   ++ A+ 
Sbjct  278   VGSLEIDNVGGWRYMFGFSAPLAAIMAIGMWTLPSSPRWLLLRAVQGKASLEDNKKKAIQ  337

Query  948   CLCRLRGATIGDS  910
              L  LRG T  + 
Sbjct  338   ALRTLRGRTASEK  350



>ref|XP_010907806.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Elaeis 
guineensis]
 ref|XP_010907807.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Elaeis 
guineensis]
Length=564

 Score =   196 bits (498),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 141/212 (67%), Positives = 175/212 (83%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            A+  +MF+G  LKA  IG GL+LFQQITGQPSVLYYAA I Q AGF+AA+DA R S+ +G
Sbjct  352  ASFWDMFEGASLKAFIIGGGLVLFQQITGQPSVLYYAASILQSAGFSAASDAARVSVVIG  411

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            + KL+MTG+AV+ VD LGRRPLL+GGV GI ++LFLL +YY  L   P VAV ALLLYVG
Sbjct  412  IFKLLMTGIAVLKVDNLGRRPLLIGGVVGIVLSLFLLAAYYKILGGFPLVAVGALLLYVG  471

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
             YQ+SFGPI WL++SEIFPLR RGRG+S+AVL NFG+NALVTFAFSP+KEL+G  N+F +
Sbjct  472  SYQVSFGPISWLVVSEIFPLRTRGRGISLAVLTNFGSNALVTFAFSPLKELLGPDNLFLL  531

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FG IA+++++F+ F +PETKGL+LEEIEAK L
Sbjct  532  FGAIALLSLLFILFYVPETKGLSLEEIEAKIL  563


 Score = 91.7 bits (226),  Expect(2) = 3e-68, Method: Compositional matrix adjust.
 Identities = 40/73 (55%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS+ +  V GWRYMYG S PI+++MGIGMW LP SPRW+LL A+QGKG +   ++ A+ 
Sbjct  256   VGSIQISAVGGWRYMYGFSAPIAVLMGIGMWSLPPSPRWLLLRAVQGKGSLEEYKDKAIH  315

Query  948   CLCRLRGATIGDS  910
              L +LRG   GD 
Sbjct  316   ALGKLRGRPAGDE  328



>ref|XP_009381068.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Musa 
acuminata subsp. malaccensis]
Length=557

 Score =   198 bits (503),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  833  MFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLI  654
            +FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AA+DA R S+ +GL KL+
Sbjct  350  VFQGASLKAFIIGGGLVLFQQITGQPSVLYYATSILQSAGFSAASDAARVSVVIGLFKLL  409

Query  653  MTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLS  474
            MTG+AV+ VD LGRRPLL+GGV GI ++LFLL +YY  L ++P VAV ALLLYVG YQ+S
Sbjct  410  MTGIAVLKVDNLGRRPLLIGGVGGIVLSLFLLAAYYNVLGSLPLVAVGALLLYVGSYQVS  469

Query  473  FGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvia  294
            FGPI WLM+SEIFPLR RGRG+S+AVL NFG+NALVTFAFSP+KEL+G  N+F +FG IA
Sbjct  470  FGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNALVTFAFSPLKELLGPANIFLLFGAIA  529

Query  293  vvavifvffiIPETKGLTLEEIEAKYLT  210
            ++++ FVFF +PETKGL+LEEIEAK L 
Sbjct  530  LLSLAFVFFYVPETKGLSLEEIEAKILN  557


 Score = 88.6 bits (218),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS+ +  V GWRYMYG+S PI++ M +GMW LP SPRW+LL A+QGKG +   +E A++
Sbjct  249   VGSVEITAVGGWRYMYGLSAPIALAMAMGMWTLPPSPRWLLLRAVQGKGALEDYKEKAMN  308

Query  948   CLCRLRGATIGD  913
              L +LRG   GD
Sbjct  309   ALAKLRGRPAGD  320



>ref|XP_006846330.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Amborella 
trichopoda]
 gb|ERN08005.1| hypothetical protein AMTR_s00012p00255880 [Amborella trichopoda]
Length=570

 Score =   193 bits (490),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 134/211 (64%), Positives = 167/211 (79%), Gaps = 1/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
            +I E+F+G  LKA  IG GL+ FQQITGQPSVLYYAA I Q    AA+  A   ++ +G+
Sbjct  360  SIWEVFEGASLKAFIIGGGLVFFQQITGQPSVLYYAATILQCRISAASDAARV-AVIIGI  418

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             KL+MTG+AV  VD LGRRPLL+GGVSGI  +LFLL +YY  L   P  AV+ALLLYV C
Sbjct  419  FKLLMTGIAVAKVDSLGRRPLLIGGVSGIVFSLFLLAAYYKILQGFPVAAVVALLLYVSC  478

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ+SFGPI WLM+SEIFPL  RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F
Sbjct  479  YQISFGPISWLMVSEIFPLHTRGRGISLAVLANFGSNAIVTFAFSPLKELLGAANLFALF  538

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            G IA+++++FV F +PETKGL+LEEIE+K L
Sbjct  539  GGIAMLSLLFVIFYVPETKGLSLEEIESKVL  569


 Score = 93.6 bits (231),  Expect(2) = 6e-68, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS+ + VV GWRYMYG+S  I IVM IGMW LP SPRW+LL A+QGK ++   +E A+S
Sbjct  263   VGSVEINVVGGWRYMYGLSASIGIVMAIGMWILPPSPRWLLLRAVQGKANLGEYKEKAIS  322

Query  948   CLCRLRGATIGDSAHH  901
              L RLRG   GD A  
Sbjct  323   ALSRLRGRPAGDKASE  338



>ref|XP_012066968.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Jatropha 
curcas]
 gb|KDP42213.1| hypothetical protein JCGZ_02943 [Jatropha curcas]
Length=559

 Score =   199 bits (505),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR S+ +GL KL
Sbjct  351  EVFQGPSLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAATDATRVSVIIGLFKL  410

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV+ VD LGRRPLL+GGV GIA++LFLL +YY  L   P VAV+ALLLYVG YQ+
Sbjct  411  VMTWIAVLKVDDLGRRPLLIGGVGGIALSLFLLSAYYKVLGGFPFVAVVALLLYVGSYQI  470

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG I
Sbjct  471  SFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFVLFGAI  530

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++F  F +PETKGL+LEEIE+K+L
Sbjct  531  ALLSLLFTIFFVPETKGLSLEEIESKFL  558


 Score = 86.7 bits (213),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 49/76 (64%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG+ VPI+ +MG+GM  LP SPRW+LL A+QGK  +   +E A+ 
Sbjct  251   VGSFQINAVGGWRYMYGLGVPIAFLMGLGMLSLPPSPRWLLLRAVQGKASLQEYKEKAIF  310

Query  948   CLCRLRGATIGDSAHH  901
              L +LRG   GD    
Sbjct  311   ALSKLRGRPAGDKESE  326



>ref|XP_006651969.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Oryza brachyantha]
Length=473

 Score =   202 bits (515),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
             I  MF+G  LKAL IG GL+LFQQITGQPSVLYYA  I Q AGFAAA+DA + SI +GL
Sbjct  262  NIWRMFEGASLKALIIGGGLVLFQQITGQPSVLYYATYILQTAGFAAASDAAKVSILIGL  321

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             KL+MTGVAV  VD LGRRPLL+GG+ GIAV+LFLL +YY  L++ P VAV ALLLYVG 
Sbjct  322  FKLLMTGVAVFKVDDLGRRPLLIGGIGGIAVSLFLLAAYYKILNSFPFVAVGALLLYVGS  381

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ+SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NALVTFAFSP++E +G  N+F +F
Sbjct  382  YQVSFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNALVTFAFSPLQEFLGPANIFILF  441

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            G I++++++FV   +PETKGLTLEEIE+K L
Sbjct  442  GAISLLSLVFVILKVPETKGLTLEEIESKIL  472


 Score = 82.4 bits (202),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++VV GWRYM+G   P++++M IGMW LP SPRW+LL A+QGKG +   +  A+ 
Sbjct  165   VGSFEIDVVGGWRYMFGFGAPLAVIMAIGMWNLPPSPRWLLLRAVQGKGSVEDNKRKAIQ  224

Query  948   CLCRLRGATIGDS  910
              L  LRG +  D 
Sbjct  225   ALRSLRGHSRSDK  237



>gb|EEC76432.1| hypothetical protein OsI_14118 [Oryza sativa Indica Group]
Length=579

 Score =   203 bits (516),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 174/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
             I +MF+G  LKAL IG GL+LFQQITGQPSVLYYA  I Q AGFAAA+DA + SI +GL
Sbjct  368  NIWKMFEGASLKALIIGGGLVLFQQITGQPSVLYYATSILQTAGFAAASDAAKVSILIGL  427

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             KL+MTGVAV  VD LGRRPLL+GG+ GIAV+LFLL +YY  L++ P VAV ALLLYVG 
Sbjct  428  FKLLMTGVAVFKVDDLGRRPLLIGGIGGIAVSLFLLAAYYKILNSFPFVAVGALLLYVGS  487

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ+SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NALVTFAFSP++E +G  N+F +F
Sbjct  488  YQVSFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNALVTFAFSPLQEFLGPANIFLLF  547

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            G I++++++FV   +PETKGLTLEEIE+K L
Sbjct  548  GAISLLSLVFVILKVPETKGLTLEEIESKLL  578


 Score = 81.3 bits (199),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGSL ++VV GWRYM+G   P++++M IGMW LP SPRW+LL A+QGK  +   ++ A+ 
Sbjct  271   VGSLEIDVVGGWRYMFGFGAPLAVIMAIGMWNLPPSPRWLLLRAVQGKASVEDNKKKAIQ  330

Query  948   CLCRLRGATIGD  913
              L  LRG    D
Sbjct  331   ALRSLRGRFRSD  342



>ref|XP_003537973.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Glycine max]
Length=552

 Score =   192 bits (489),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AA+DAT+ S+ +GL KL
Sbjct  344  EVFQGPNLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAASDATKVSVVIGLFKL  403

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV+ VD LGRRPLL+GGVSGIA++L LL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  404  LMTWIAVLKVDDLGRRPLLIGGVSGIALSLVLLSAYYKFLGGFPLVAVGALLLYVGCYQI  463

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SE+FPLR RG+G+S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG I
Sbjct  464  SFGPISWLMVSEVFPLRTRGKGISLAVLTNFASNAVVTFAFSPLKEFLGAENLFLLFGAI  523

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++F+ F +PETKGL+LE+IE+K L
Sbjct  524  AILSLLFIIFSVPETKGLSLEDIESKIL  551


 Score = 91.7 bits (226),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS ++E V GWR+MYG S P++++MG+GM  LP SPRW+LL A+QGKG    L+E A+ 
Sbjct  244   VGSFLIETVGGWRFMYGFSAPVAVLMGLGMLTLPNSPRWLLLRAVQGKGSFQDLKEKAIF  303

Query  948   CLCRLRGATIGD  913
              L +LRG   GD
Sbjct  304   SLSKLRGRPPGD  315



>gb|AAO18445.1| putative sugar transporter protein [Oryza sativa Japonica Group]
Length=525

 Score =   203 bits (517),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 174/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
             I +MF+G  LKAL IG GL+LFQQITGQPSVLYYA  I Q AGFAAA+DA + SI +GL
Sbjct  314  NIWKMFEGASLKALIIGGGLVLFQQITGQPSVLYYATSILQTAGFAAASDAAKVSILIGL  373

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             KL+MTGVAV  VD LGRRPLL+GG+ GIAV+LFLL +YY  L++ P VAV ALLLYVG 
Sbjct  374  FKLLMTGVAVFKVDDLGRRPLLIGGIGGIAVSLFLLAAYYKILNSFPFVAVGALLLYVGS  433

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ+SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NALVTFAFSP++E +G  N+F +F
Sbjct  434  YQVSFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNALVTFAFSPLQEFLGPANIFLLF  493

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            G I++++++FV   +PETKGLTLEEIE+K L
Sbjct  494  GAISLLSLVFVILKVPETKGLTLEEIESKLL  524


 Score = 80.9 bits (198),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGSL ++VV GWRYM+G   P++++M IGMW LP SPRW+LL A+QGK  +   ++ A+ 
Sbjct  217   VGSLEIDVVGGWRYMFGFGAPLAVIMAIGMWNLPPSPRWLLLRAVQGKASVEDNKKKAIQ  276

Query  948   CLCRLRGATIGD  913
              L  LRG    D
Sbjct  277   ALRSLRGRFRSD  288



>gb|ABF99614.1| sugar transporter family protein, putative, expressed [Oryza 
sativa Japonica Group]
Length=545

 Score =   202 bits (515),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 174/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
             I +MF+G  LKAL IG GL+LFQQITGQPSVLYYA  I Q AGFAAA+DA + SI +GL
Sbjct  334  NIWKMFEGASLKALIIGGGLVLFQQITGQPSVLYYATSILQTAGFAAASDAAKVSILIGL  393

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             KL+MTGVAV  VD LGRRPLL+GG+ GIAV+LFLL +YY  L++ P VAV ALLLYVG 
Sbjct  394  FKLLMTGVAVFKVDDLGRRPLLIGGIGGIAVSLFLLAAYYKILNSFPFVAVGALLLYVGS  453

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ+SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NALVTFAFSP++E +G  N+F +F
Sbjct  454  YQVSFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNALVTFAFSPLQEFLGPANIFLLF  513

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            G I++++++FV   +PETKGLTLEEIE+K L
Sbjct  514  GAISLLSLVFVILKVPETKGLTLEEIESKLL  544


 Score = 81.3 bits (199),  Expect(2) = 3e-67, Method: Compositional matrix adjust.
 Identities = 36/72 (50%), Positives = 49/72 (68%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGSL ++VV GWRYM+G   P++++M IGMW LP SPRW+LL A+QGK  +   ++ A+ 
Sbjct  237   VGSLEIDVVGGWRYMFGFGAPLAVIMAIGMWNLPPSPRWLLLRAVQGKASVEDNKKKAIQ  296

Query  948   CLCRLRGATIGD  913
              L  LRG    D
Sbjct  297   ALRSLRGRFRSD  308



>ref|XP_004981232.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Setaria italica]
Length=563

 Score =   202 bits (515),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 177/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
             I E+F+G  LKA TIG GL+LFQQITGQPSVLYYAA I Q AGF+AA+DA R +I +GL
Sbjct  352  NIWEVFEGASLKAFTIGGGLVLFQQITGQPSVLYYAASILQTAGFSAASDAARVAILIGL  411

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             KL+MTGVAV+ VD LGRRPLL+GGV GIA++LFLL +YY  L+N P VAV ALLLYVG 
Sbjct  412  FKLLMTGVAVLKVDDLGRRPLLIGGVGGIALSLFLLAAYYKILNNSPFVAVGALLLYVGA  471

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ+SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NALVTFAFSP++E +G  N+FF+F
Sbjct  472  YQVSFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNALVTFAFSPLQEFLGPENIFFLF  531

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            G IAV++++FV   +PETKGL+LEEIE+K L
Sbjct  532  GAIAVLSLVFVILNVPETKGLSLEEIESKIL  562


 Score = 80.9 bits (198),  Expect(2) = 6e-67, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGSL ++ V GWRYM+G   P++ +M IGMW LP SP+W+LL A+QGKG M   ++ A+ 
Sbjct  255   VGSLEIDNVGGWRYMFGFGAPLAAIMAIGMWTLPPSPKWLLLRAVQGKGSMEDNKKKAIQ  314

Query  948   CLCRLRGATIGDS  910
              L  LRG +  + 
Sbjct  315   ALRTLRGRSTSEK  327



>ref|XP_002520519.1| sugar transporter, putative [Ricinus communis]
 gb|EEF41932.1| sugar transporter, putative [Ricinus communis]
Length=505

 Score =   197 bits (500),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 174/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
            +I E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL
Sbjct  294  SILEVFQGPSLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVIIGL  353

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             KL+MT +AV+ VD LGRRPLL+GGV GIA++LFLL +YY  L   P VAV ALLLYVG 
Sbjct  354  FKLVMTWIAVLKVDDLGRRPLLIGGVGGIALSLFLLSAYYKVLGGFPVVAVAALLLYVGS  413

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ+SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F
Sbjct  414  YQISFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLF  473

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            G IA++A++F    +PETKGL+LEEIE+K L
Sbjct  474  GAIALLALLFAIVYVPETKGLSLEEIESKIL  504


 Score = 84.7 bits (208),  Expect(2) = 2e-66, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG+  PI+++MG+GM  LP SPRW+LL A+QG+  +   +E AV 
Sbjct  197   VGSFEISAVGGWRYMYGLGAPIALIMGLGMLSLPPSPRWLLLRAVQGRASLQEYKEKAVL  256

Query  948   CLCRLRGATIGDSAHH  901
              L +LRG  +GD    
Sbjct  257   ALSKLRGRPLGDKESE  272



>dbj|BAJ95036.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=521

 Score =   197 bits (501),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 141/211 (67%), Positives = 170/211 (81%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
            +I ++F+G  LKA TIG GL+LFQQITGQPSVLYYA  I Q AGF AA+DA + SI +GL
Sbjct  309  SIFQVFEGASLKAFTIGGGLVLFQQITGQPSVLYYATSILQTAGFTAASDAAKVSILIGL  368

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             K +MTGVAV+ VD LGRRPL++GGVSGI VALFLL +YY  L   P VAV ALLLYVGC
Sbjct  369  FKFVMTGVAVLKVDDLGRRPLMIGGVSGITVALFLLAAYYKALSGFPFVAVGALLLYVGC  428

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQLSFGPI WLM+SEIFPLR RG G+S+AVL NFG+NALVTFAFSP++  +G  NVF +F
Sbjct  429  YQLSFGPISWLMVSEIFPLRTRGCGISLAVLTNFGSNALVTFAFSPLQGYLGPANVFLLF  488

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
              I+++A++FV   +PETKGL+LEEIE+K L
Sbjct  489  AAISLLALLFVILNVPETKGLSLEEIESKIL  519


 Score = 81.6 bits (200),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 52/73 (71%), Gaps = 0/73 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++VV GWRYM+G S P++ +M +GMW LP SPRW+LL A+QGKG +   ++ A++
Sbjct  213   VGSYEIDVVGGWRYMFGFSAPLAAIMAVGMWSLPPSPRWLLLRAVQGKGPVEDNKKKAMN  272

Query  948   CLCRLRGATIGDS  910
              L RL+G +  + 
Sbjct  273   ALRRLKGPSASEK  285



>ref|NP_001173691.1| Os03g0823200 [Oryza sativa Japonica Group]
 dbj|BAH92419.1| Os03g0823200, partial [Oryza sativa Japonica Group]
Length=303

 Score =   203 bits (517),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 174/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
             I +MF+G  LKAL IG GL+LFQQITGQPSVLYYA  I Q AGFAAA+DA + SI +GL
Sbjct  92   NIWKMFEGASLKALIIGGGLVLFQQITGQPSVLYYATSILQTAGFAAASDAAKVSILIGL  151

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             KL+MTGVAV  VD LGRRPLL+GG+ GIAV+LFLL +YY  L++ P VAV ALLLYVG 
Sbjct  152  FKLLMTGVAVFKVDDLGRRPLLIGGIGGIAVSLFLLAAYYKILNSFPFVAVGALLLYVGS  211

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ+SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NALVTFAFSP++E +G  N+F +F
Sbjct  212  YQVSFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNALVTFAFSPLQEFLGPANIFLLF  271

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            G I++++++FV   +PETKGLTLEEIE+K L
Sbjct  272  GAISLLSLVFVILKVPETKGLTLEEIESKLL  302


 Score = 74.7 bits (182),  Expect(2) = 2e-65, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 44/66 (67%), Gaps = 0/66 (0%)
 Frame = -2

Query  1110  EVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSCLCRLR  931
             +VV GWRYM+G   P++++M IGMW LP SPRW+LL A+QGK  +   ++ A+  L  LR
Sbjct  1     DVVGGWRYMFGFGAPLAVIMAIGMWNLPPSPRWLLLRAVQGKASVEDNKKKAIQALRSLR  60

Query  930   GATIGD  913
             G    D
Sbjct  61    GRFRSD  66



>ref|XP_010933397.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Elaeis 
guineensis]
Length=468

 Score =   167 bits (424),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 137/229 (60%), Positives = 163/229 (71%), Gaps = 33/229 (14%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            QVD IL ELS+  +EK+ TI E+F+GKCLKAL IGAGL+ FQQ+TGQPSVLYYAA I Q 
Sbjct  273  QVDSILDELSYADQEKQVTISEIFKGKCLKALIIGAGLVFFQQVTGQPSVLYYAATILQT  332

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+AA+DATR S+ LGLLKL+MTG+AV+V                              
Sbjct  333  AGFSAASDATRVSVLLGLLKLVMTGIAVLV------------------------------  362

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
               V  V    LL+      LSFGPIGWLMISE+FPLR+RGRGLSIAVLVNF +NALVTF
Sbjct  363  ---VDRVGRRPLLIGGVSGILSFGPIGWLMISEVFPLRLRGRGLSIAVLVNFASNALVTF  419

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP++ LVG G +F  FGVIAV +++F+FF++PETKGLTLEEIEAK L
Sbjct  420  AFSPLEALVGTGILFAGFGVIAVASLLFIFFVVPETKGLTLEEIEAKIL  468


 Score =   110 bits (274),  Expect(2) = 3e-65, Method: Compositional matrix adjust.
 Identities = 49/75 (65%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = -2

Query  1125  GSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSC  946
             GSL V++VAGWRYMY  S P+S++MGIG+WWLP SPRW+LLCAIQGK +M   +E AV C
Sbjct  198   GSLFVDLVAGWRYMYATSAPVSLIMGIGIWWLPPSPRWLLLCAIQGKRNMLDAKEFAVCC  257

Query  945   LCRLRGATIGDSAHH  901
             LCRLRG  I  SA  
Sbjct  258   LCRLRGQAIDSSASE  272



>ref|XP_004294661.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=558

 Score =   187 bits (476),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  I  GL+LFQQITGQPSVLYYA  I Q AGF+AAADAT+ S+ +GL K 
Sbjct  350  EIFQGPSLKAFIIAGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATKVSVIIGLFKF  409

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MTGVAV+ VD LGRRPLL+ GVSG+A++LFLL +YY FL   P VAV +LLLYVGCYQ+
Sbjct  410  VMTGVAVLKVDDLGRRPLLILGVSGLALSLFLLSAYYKFLGGFPLVAVASLLLYVGCYQI  469

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NALVTFAFSP+KE +GA N+F +FG I
Sbjct  470  SFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNALVTFAFSPLKEALGADNLFLLFGAI  529

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++FV  I+PETKGL+LEEIE+K L
Sbjct  530  ALISLLFVVLIVPETKGLSLEEIESKLL  557


 Score = 89.4 bits (220),  Expect(2) = 5e-65, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++ + GWRYMYG+S PI+++MGIGMW LP SPRW+LL   QGKG +   +E AV 
Sbjct  250   VGSFQIDAIGGWRYMYGISAPIALLMGIGMWILPPSPRWLLLRPAQGKGSVKEYKEKAVL  309

Query  948   CLCRLRGATIGD  913
              L +LRG   GD
Sbjct  310   ALSKLRGRPPGD  321



>gb|KHG28803.1| hypothetical protein F383_00413 [Gossypium arboreum]
Length=559

 Score =   182 bits (461),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 169/208 (81%), Gaps = 5/208 (2%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL
Sbjct  353  EVFQGPSLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRLSVVVGLFKL  412

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV  VD LGRRPLL+GGV GIA++LFLL +YY FL   P VAV ALLLY+     
Sbjct  413  LMTWIAVAKVDDLGRRPLLIGGVGGIALSLFLLCAYYKFLGEFPYVAVAALLLYI-----  467

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG I
Sbjct  468  SFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGGI  527

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++FV   +PETKGL+LEEIE+K L
Sbjct  528  ALISLLFVALYVPETKGLSLEEIESKIL  555


 Score = 93.6 bits (231),  Expect(2) = 1e-64, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG S P++++MG+GMW LP SPRW++L A+QGKG +  L+E A+ 
Sbjct  253   VGSFQINAVGGWRYMYGCSAPVALLMGLGMWSLPPSPRWLILRAVQGKGSLQELKEKAIL  312

Query  948   CLCRLRGATIGDSAHH  901
              L +LRG   GD+A  
Sbjct  313   ALSKLRGQAPGDAASE  328



>gb|EYU43459.1| hypothetical protein MIMGU_mgv1a004913mg [Erythranthe guttata]
Length=504

 Score =   225 bits (573),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 188/229 (82%), Positives = 215/229 (94%), Gaps = 0/229 (0%)
 Frame = -3

Query  899  QVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqd  720
            +VDE+LSELSH+ EE+EA++ EMFQGKCLKAL IG GL+LFQQITGQPSVLYYAA IFQ 
Sbjct  276  KVDEMLSELSHMREEQEASLAEMFQGKCLKALIIGGGLVLFQQITGQPSVLYYAATIFQS  335

Query  719  agfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTF  540
            AGF+AA+DAT+ SI LGLLKLIMTGVAV+VVDRLGRRPLLLGGVSGIAV+LFLLGSYYT+
Sbjct  336  AGFSAASDATKVSILLGLLKLIMTGVAVLVVDRLGRRPLLLGGVSGIAVSLFLLGSYYTY  395

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            L ++P VAV+ALL+YVGCYQLSFGPIGWLMISEIFPLR+RGRGLSIAVL+NFG NALVTF
Sbjct  396  LGDIPAVAVVALLVYVGCYQLSFGPIGWLMISEIFPLRLRGRGLSIAVLINFGANALVTF  455

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            AFSP+KEL+GAG +FFIFG IA++++IF+FFIIPETKGLTLEEIEAK L
Sbjct  456  AFSPLKELLGAGILFFIFGGIAILSLIFIFFIIPETKGLTLEEIEAKLL  504


 Score =   112 bits (281),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 74/117 (63%), Gaps = 9/117 (8%)
 Frame = -2

Query  1125  GSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSC  946
             GSL+V+ V GWRYMYG+S PIS+VMG GM+WLP+SPRWILL AIQGK D+  LR+ A+ C
Sbjct  200   GSLLVDTVGGWRYMYGLSTPISLVMGFGMYWLPSSPRWILLRAIQGKDDVQSLRKNAIDC  259

Query  945   LCRLRG-ATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPNNWCWTNLV  778
             LCRLRG A I DSA  P + + + +      +  H R      + E     C   L+
Sbjct  260   LCRLRGEAIIADSA--PQKVDEMLS------ELSHMREEQEASLAEMFQGKCLKALI  308



>ref|XP_003563522.2| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Brachypodium 
distachyon]
Length=568

 Score =   194 bits (493),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 139/208 (67%), Positives = 168/208 (81%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+F+G  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AA+DA + SI +GL K 
Sbjct  360  EIFEGASLKAFIIGGGLVLFQQITGQPSVLYYATSILQTAGFSAASDAAKVSILIGLFKF  419

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MTGVAV  VD LGRRPLL+GGVSGI VALFLL +YY  L   P VAV ALLLYVG YQ+
Sbjct  420  VMTGVAVFKVDDLGRRPLLIGGVSGITVALFLLAAYYKILSGFPFVAVGALLLYVGSYQV  479

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NALVTFAFSP++  +G  N+F +FG I
Sbjct  480  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNALVTFAFSPLQGYLGPANIFLLFGAI  539

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            +++A++FV   +PETKGL+LE+IE+K L
Sbjct  540  SLLALVFVILNVPETKGLSLEDIESKIL  567


 Score = 80.9 bits (198),  Expect(2) = 2e-64, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 50/72 (69%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++VV GWRYM+G+S P++ +M +GMW LP SPRW+LL A+QGK  +   ++ A  
Sbjct  260   VGSFEIDVVGGWRYMFGLSAPLAAIMAVGMWSLPPSPRWLLLRAVQGKSPLETNKKKAFL  319

Query  948   CLCRLRGATIGD  913
              L RL+G +  D
Sbjct  320   ALRRLKGVSPSD  331



>ref|XP_006424897.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
 gb|ESR38137.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
Length=553

 Score =   182 bits (463),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  345  ELFQGPNLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKL  404

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV  VD LGRRPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ+
Sbjct  405  VMTWIAVAKVDDLGRRPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVAALLLYVGCYQI  464

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  I
Sbjct  465  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAI  524

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A +AV+F+   +PETKGL+LEEIE+K L
Sbjct  525  AFLAVLFIVRTVPETKGLSLEEIESKIL  552


 Score = 90.1 bits (222),  Expect(2) = 8e-64, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG+S P++++MGIGMW LP SPRW+LL A+QGKG +   +E A+S
Sbjct  245   VGSFQINAVGGWRYMYGLSAPLALLMGIGMWSLPPSPRWLLLRAVQGKGSLQEYKEQAIS  304

Query  948   CLCRLRGATIGD  913
              L +LR    GD
Sbjct  305   ALGKLRRRPPGD  316



>ref|XP_006488378.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=559

 Score =   182 bits (462),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  351  ELFQGPNLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKL  410

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV  VD LGRRPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ+
Sbjct  411  VMTWIAVAKVDDLGRRPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQI  470

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  I
Sbjct  471  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAI  530

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A +AV+F+   +PETKGL+LEEIE+K L
Sbjct  531  AFLAVLFIVRTVPETKGLSLEEIESKIL  558


 Score = 90.1 bits (222),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG+S P++++MGIGMW LP SPRW+LL A+QGKG +   +E A+S
Sbjct  251   VGSFQINAVGGWRYMYGLSAPLALLMGIGMWSLPPSPRWLLLRAVQGKGSLQEYKEQAIS  310

Query  948   CLCRLRGATIGD  913
              L +LR    GD
Sbjct  311   ALGKLRRRPPGD  322



>ref|XP_006488379.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=553

 Score =   182 bits (462),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  345  ELFQGPNLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKL  404

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV  VD LGRRPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ+
Sbjct  405  VMTWIAVAKVDDLGRRPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQI  464

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  I
Sbjct  465  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAI  524

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A +AV+F+   +PETKGL+LEEIE+K L
Sbjct  525  AFLAVLFIVRTVPETKGLSLEEIESKIL  552


 Score = 90.1 bits (222),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG+S P++++MGIGMW LP SPRW+LL A+QGKG +   +E A+S
Sbjct  245   VGSFQINAVGGWRYMYGLSAPLALLMGIGMWSLPPSPRWLLLRAVQGKGSLQEYKEQAIS  304

Query  948   CLCRLRGATIGD  913
              L +LR    GD
Sbjct  305   ALGKLRRRPPGD  316



>ref|XP_008349595.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Malus 
domestica]
Length=563

 Score =   186 bits (473),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 173/206 (84%), Gaps = 0/206 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AA+DATR S+ +GL K 
Sbjct  355  EVFQGTSLKAFIIGGGLVLFQQITGQPSVLYYAGPILQTAGFSAASDATRVSVVIGLFKF  414

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MTGVAV+ VD LGRRPLL+ GVSG+A++LFLL +YY FL   P +AV +LLLYVGCYQ+
Sbjct  415  LMTGVAVLKVDDLGRRPLLIVGVSGLALSLFLLSAYYKFLGGFPLIAVASLLLYVGCYQI  474

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG I
Sbjct  475  SFGPISWLMVSEIFPLRTRGKGISLAVLTNFASNAIVTFAFSPLKEALGADNLFILFGAI  534

Query  296  avvavifvffiIPETKGLTLEEIEAK  219
            A++++IFV  I+PETKGLTLEEIE+K
Sbjct  535  ALLSLIFVVLIVPETKGLTLEEIESK  560


 Score = 85.9 bits (211),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG+S  ++++MGIGMW LP SPRW+LL A QGKG +   +E A+ 
Sbjct  255   VGSFEINAVGGWRYMYGISASVALLMGIGMWVLPPSPRWLLLRAAQGKGPVQEYKEKAIV  314

Query  948   CLCRLRGATIGDSAHH  901
              L +LRG   GD    
Sbjct  315   ALSKLRGRPPGDKVSE  330



>ref|XP_008384924.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Malus 
domestica]
Length=563

 Score =   186 bits (472),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 173/206 (84%), Gaps = 0/206 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AA+DATR S+ +GL K 
Sbjct  355  EVFQGTSLKAFIIGGGLVLFQQITGQPSVLYYAGPILQTAGFSAASDATRVSVVIGLFKF  414

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MTGVAV+ VD LGRRPLL+ GVSG+A++LFLL +YY FL   P +AV +LLLYVGCYQ+
Sbjct  415  LMTGVAVLKVDDLGRRPLLIVGVSGLALSLFLLSAYYKFLGGFPLIAVASLLLYVGCYQI  474

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG I
Sbjct  475  SFGPISWLMVSEIFPLRTRGKGISLAVLTNFASNAIVTFAFSPLKEALGADNLFILFGAI  534

Query  296  avvavifvffiIPETKGLTLEEIEAK  219
            A++++IFV  I+PETKGLTLEEIE+K
Sbjct  535  ALLSLIFVVLIVPETKGLTLEEIESK  560


 Score = 85.9 bits (211),  Expect(2) = 1e-63, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG+S  ++++MGIGMW LP SPRW+LL A QGKG +   +E A+ 
Sbjct  255   VGSFEINAVGGWRYMYGISASVALLMGIGMWVLPPSPRWLLLRAAQGKGPVQEYKEKAIV  314

Query  948   CLCRLRGATIGDSAHH  901
              L +LRG   GD    
Sbjct  315   ALSKLRGRPPGDKVSE  330



>ref|XP_008222102.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Prunus mume]
Length=562

 Score =   180 bits (457),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 173/206 (84%), Gaps = 0/206 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  I  GL+LFQQITGQPSVLYYA  I Q AGF+AA+DATR S+ +GL K 
Sbjct  354  EVFQGPNLKAFIIAVGLVLFQQITGQPSVLYYAGPILQTAGFSAASDATRVSVVIGLFKF  413

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MTG+AV+ VD LGRRPLL+ GVSG+A++LFLL +Y+ FL   P VAV +LLLYVGCYQ+
Sbjct  414  VMTGIAVLKVDDLGRRPLLIVGVSGLALSLFLLSAYFKFLGGFPLVAVASLLLYVGCYQI  473

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NF +NA+VTFAFSP+KE +GA N+F +FGVI
Sbjct  474  SFGPISWLMVSEIFPLRTRGKGISLAVLANFASNAIVTFAFSPLKEALGAENLFILFGVI  533

Query  296  avvavifvffiIPETKGLTLEEIEAK  219
            A+++++FV  ++PETKGL+LEEIE+K
Sbjct  534  ALLSLLFVVLLVPETKGLSLEEIESK  559


 Score = 91.3 bits (225),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  + GWRYMYG+S PI+++MGIGMW LP SPRW+LL A QGKG +   +E AV 
Sbjct  254   VGSFEINAIGGWRYMYGISAPIALLMGIGMWLLPPSPRWLLLRAAQGKGSVKEYKEKAVL  313

Query  948   CLCRLRGATIGD  913
              L +LRG   GD
Sbjct  314   ALSKLRGRPPGD  325



>ref|XP_008222111.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Prunus mume]
Length=521

 Score =   181 bits (458),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 173/206 (84%), Gaps = 0/206 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  I  GL+LFQQITGQPSVLYYA  I Q AGF+AA+DATR S+ +GL K 
Sbjct  313  EVFQGPNLKAFIIAVGLVLFQQITGQPSVLYYAGPILQTAGFSAASDATRVSVVIGLFKF  372

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MTG+AV+ VD LGRRPLL+ GVSG+A++LFLL +Y+ FL   P VAV +LLLYVGCYQ+
Sbjct  373  VMTGIAVLKVDDLGRRPLLIVGVSGLALSLFLLSAYFKFLGGFPLVAVASLLLYVGCYQI  432

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NF +NA+VTFAFSP+KE +GA N+F +FGVI
Sbjct  433  SFGPISWLMVSEIFPLRTRGKGISLAVLANFASNAIVTFAFSPLKEALGAENLFILFGVI  492

Query  296  avvavifvffiIPETKGLTLEEIEAK  219
            A+++++FV  ++PETKGL+LEEIE+K
Sbjct  493  ALLSLLFVVLLVPETKGLSLEEIESK  518


 Score = 91.3 bits (225),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  + GWRYMYG+S PI+++MGIGMW LP SPRW+LL A QGKG +   +E AV 
Sbjct  213   VGSFEINAIGGWRYMYGISAPIALLMGIGMWLLPPSPRWLLLRAAQGKGSVKEYKEKAVL  272

Query  948   CLCRLRGATIGD  913
              L +LRG   GD
Sbjct  273   ALSKLRGRPPGD  284



>ref|XP_007207311.1| hypothetical protein PRUPE_ppa003611mg [Prunus persica]
 gb|EMJ08510.1| hypothetical protein PRUPE_ppa003611mg [Prunus persica]
Length=562

 Score =   180 bits (457),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 137/206 (67%), Positives = 173/206 (84%), Gaps = 0/206 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  I  GL+LFQQITGQPSVLYYA  I Q AGF+AA+DATR S+ +GL K 
Sbjct  354  EVFQGPNLKAFIIAVGLVLFQQITGQPSVLYYAGPILQTAGFSAASDATRVSVVIGLFKF  413

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MTG+AV+ VD LGRRPLL+ GVSG+A++LFLL +Y+ FL   P VAV +LLLYVGCYQ+
Sbjct  414  VMTGIAVLKVDELGRRPLLIVGVSGLALSLFLLSAYFKFLGGFPLVAVASLLLYVGCYQV  473

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NF +NA+VTFAFSP+KE +GA N+F +FGVI
Sbjct  474  SFGPISWLMVSEIFPLRTRGKGISLAVLANFASNAIVTFAFSPLKEALGAENLFILFGVI  533

Query  296  avvavifvffiIPETKGLTLEEIEAK  219
            A+++++FV  ++PETKGL+LEEIE+K
Sbjct  534  ALLSLLFVVLLVPETKGLSLEEIESK  559


 Score = 91.3 bits (225),  Expect(2) = 2e-63, Method: Compositional matrix adjust.
 Identities = 41/72 (57%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  + GWRYMYG+S PI+++MGIGMW LP SPRW+LL A QGKG +   +E AV 
Sbjct  254   VGSFEINAIGGWRYMYGISAPIALLMGIGMWLLPPSPRWLLLRAAQGKGSVKEYKEKAVL  313

Query  948   CLCRLRGATIGD  913
              L +LRG   GD
Sbjct  314   ALSKLRGRPPGD  325



>gb|AFW67123.1| hypothetical protein ZEAMMB73_874760 [Zea mays]
Length=295

 Score =   206 bits (524),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 179/211 (85%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
             + ++F+G  LKA TIG GL+LFQQITGQPSVLYYAA I Q AGF+AA+DA + +I +GL
Sbjct  84   NVWDVFEGASLKAFTIGGGLVLFQQITGQPSVLYYAASILQTAGFSAASDAAKVAILIGL  143

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             KL+MTGVAV  VD +GRRPLL+GGV GIA++LFLL +YY  L+N P VAV ALLLYVG 
Sbjct  144  FKLLMTGVAVFKVDDVGRRPLLIGGVGGIALSLFLLAAYYKILNNFPFVAVGALLLYVGA  203

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ+SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NALVTFAFSP+KEL+G  N+FF+F
Sbjct  204  YQVSFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNALVTFAFSPLKELLGPANIFFLF  263

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            GVIAV++++FV  ++PETKGL+LEEIE+K L
Sbjct  264  GVIAVLSLVFVILVVPETKGLSLEEIESKIL  294


 Score = 65.1 bits (157),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 27/59 (46%), Positives = 39/59 (66%), Gaps = 0/59 (0%)
 Frame = -2

Query  1086  MYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSCLCRLRGATIGDS  910
             M+G S P++ +M IGMW LP+SPRW+LL A+QGK  +   ++ A+  L  LRG T  + 
Sbjct  1     MFGFSAPLAAIMAIGMWTLPSSPRWLLLRAVQGKASLEDNKKKAIQALRTLRGRTASEK  59



>ref|XP_009375941.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Pyrus 
x bretschneideri]
Length=563

 Score =   185 bits (469),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 173/206 (84%), Gaps = 0/206 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AA+DATR S+ +GL K 
Sbjct  355  EVFQGTSLKAFIIGGGLVLFQQITGQPSVLYYAGPILQTAGFSAASDATRVSVVIGLFKF  414

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MTGVAV+ VD LGRRPLL+ GVSG+A++LFLL +YY FL   P +AV +LLLYVGCYQ+
Sbjct  415  LMTGVAVLKVDDLGRRPLLIVGVSGLALSLFLLSAYYKFLGGFPLIAVASLLLYVGCYQI  474

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NF +NA+VTFAFSP+KE +GA N+F +FG I
Sbjct  475  SFGPISWLMVSEIFPLRTRGKGISLAVLTNFASNAIVTFAFSPLKEALGADNLFILFGAI  534

Query  296  avvavifvffiIPETKGLTLEEIEAK  219
            A++++IFV  I+PETKGL+LEEIE+K
Sbjct  535  ALLSLIFVVLIVPETKGLSLEEIESK  560


 Score = 85.9 bits (211),  Expect(2) = 3e-63, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG+S  +++VMGIGMW LP SPRW+LL A QGKG +   +E A+ 
Sbjct  255   VGSFEINAVGGWRYMYGISAFVALVMGIGMWVLPPSPRWLLLRAAQGKGAVQEYKEKAIV  314

Query  948   CLCRLRGATIGDSAHH  901
              L +LRG   GD    
Sbjct  315   ALSKLRGRPPGDKVSE  330



>ref|NP_001190323.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 gb|AED92372.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
Length=470

 Score =   169 bits (427),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 150/211 (71%), Gaps = 33/211 (16%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
            T GE+FQGKCLKAL IG GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR SI LGL
Sbjct  293  TFGELFQGKCLKALIIGGGLVLFQQITGQPSVLYYAPSILQTAGFSAAGDATRVSILLGL  352

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
            LKLIMTGVA                     V +  LG          P+ +  +   +  
Sbjct  353  LKLIMTGVA--------------------VVVIDRLGRR--------PLLLGGVGGML--  382

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
               SFGPIGWLMISEIFPL++RGRGLS+AVLVNFG NALVTFAFSP+KEL+GAG +F  F
Sbjct  383  ---SFGPIGWLMISEIFPLKLRGRGLSLAVLVNFGANALVTFAFSPLKELLGAGILFCGF  439

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            GVI V++++F+FFI+PETKGLTLEEIEAK L
Sbjct  440  GVICVLSLVFIFFIVPETKGLTLEEIEAKCL  470


 Score =   101 bits (252),  Expect(2) = 4e-63, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V V +GWRYMY  SVP++++MGIGMWWLPASPRW+LL  IQGKG++   RE A+ 
Sbjct  199   IGSLTVNVHSGWRYMYATSVPLAVIMGIGMWWLPASPRWLLLRVIQGKGNVENQREAAIK  258

Query  948   CLCRLRGATIGDSAHH  901
              LC LRG    DSA  
Sbjct  259   SLCCLRGPAFVDSAAE  274



>ref|XP_008457451.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Cucumis 
melo]
Length=585

 Score =   182 bits (463),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 177/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
            +I E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q+AGFAAA DATR S+ +G+
Sbjct  374  SIWEVFQGPSLKAFIIGGGLVLFQQITGQPSVLYYAGPILQNAGFAAATDATRVSVVIGV  433

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             KL+MT VAV+ VD LGRRPLL+GGVSGIA++L LL +YY FL   P VAV ALLLYVGC
Sbjct  434  FKLLMTWVAVLKVDDLGRRPLLIGGVSGIALSLLLLSAYYKFLGGFPIVAVGALLLYVGC  493

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ+SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F
Sbjct  494  YQISFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLF  553

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            G IA+++++FV   +PETKGL+LE+IE+K L
Sbjct  554  GAIALLSLLFVVLQVPETKGLSLEDIESKIL  584


 Score = 87.4 bits (215),  Expect(2) = 6e-63, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 50/76 (66%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGSL +  V GWRYMYG+S P++ +MG+GMW LP SPRW+LL A+QGK      +E A+ 
Sbjct  277   VGSLQINAVGGWRYMYGLSAPVAFMMGLGMWLLPPSPRWLLLRAVQGKAPSQDSKEEAIV  336

Query  948   CLCRLRGATIGDSAHH  901
              L +LRG   GD    
Sbjct  337   ALSKLRGRPPGDKVSE  352



>ref|XP_011075803.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X2 [Sesamum 
indicum]
Length=502

 Score =   220 bits (560),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            ATI EMFQGKCLKAL IG GL+LFQQITGQPSVLYYAA IFQ AGF+AA+DAT+ SI LG
Sbjct  291  ATIAEMFQGKCLKALIIGGGLVLFQQITGQPSVLYYAATIFQSAGFSAASDATKVSILLG  350

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            L KLIMTGVAV+ VDRLGRRPLLLGGVSGI ++LFLLGSYYT+L ++P VAV+ALL+YVG
Sbjct  351  LWKLIMTGVAVLAVDRLGRRPLLLGGVSGIVISLFLLGSYYTYLGDIPAVAVVALLVYVG  410

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISE+FPLR+RGRGLSIAVLVNF  NALVTFAFSP++EL+GAG +FF 
Sbjct  411  CYQLSFGPIGWLMISEVFPLRLRGRGLSIAVLVNFAANALVTFAFSPLRELLGAGILFFS  470

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FG IAV+++IF+FFIIPETKGLTLEEIEAK L
Sbjct  471  FGGIAVLSLIFIFFIIPETKGLTLEEIEAKLL  502


 Score =   122 bits (307),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 77/116 (66%), Gaps = 8/116 (7%)
 Frame = -2

Query  1125  GSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSC  946
             GSL+VE VAGWRYMYGVS P++++MG GMWWLPASPRWILL AIQGKG++  LR+TA+ C
Sbjct  199   GSLLVETVAGWRYMYGVSSPLAVIMGSGMWWLPASPRWILLRAIQGKGEVLALRDTAIYC  258

Query  945   LCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPNNWCWTNLV  778
             LCRLRG  IGDSA  P + + + +      +  H R      + E     C   L+
Sbjct  259   LCRLRGGAIGDSA--PQKVDEILS------ELSHLREEEEATIAEMFQGKCLKALI  306



>ref|XP_002280634.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Vitis 
vinifera]
 gb|ADP37178.1| putative vacuolar glucose transporter [Vitis vinifera]
Length=561

 Score =   180 bits (456),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+L QQITGQPSVLY+A  I Q AGF+AA+DATR S+ +G  KL
Sbjct  353  EVFQGPSLKAFIIGGGLVLSQQITGQPSVLYFAGSILQTAGFSAASDATRVSVLIGFFKL  412

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MTG+AV+ VD +GRRPLL+GGV G+A++L LL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  413  LMTGIAVLKVDDIGRRPLLIGGVGGLALSLLLLSAYYKFLGGFPVVAVAALLLYVGCYQI  472

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP++EL+GA N+F +FG+I
Sbjct  473  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLEELLGAENLFLLFGII  532

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++FV   +PETKGL+LEEIE+K L
Sbjct  533  ALLSLLFVIVYVPETKGLSLEEIESKIL  560


 Score = 89.0 bits (219),  Expect(2) = 1e-62, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG+S PI+ +MG+G+W LP SPRW+LL A+QGKG +   +E A+ 
Sbjct  253   VGSFEINEVGGWRYMYGLSAPIASLMGLGLWTLPPSPRWLLLRAVQGKGSLQENKEKAIH  312

Query  948   CLCRLRGATIGD  913
              L +LRG   GD
Sbjct  313   ALSKLRGRPAGD  324



>emb|CBI16087.3| unnamed protein product [Vitis vinifera]
Length=507

 Score =   180 bits (456),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+L QQITGQPSVLY+A  I Q AGF+AA+DATR S+ +G  KL
Sbjct  299  EVFQGPSLKAFIIGGGLVLSQQITGQPSVLYFAGSILQTAGFSAASDATRVSVLIGFFKL  358

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MTG+AV+ VD +GRRPLL+GGV G+A++L LL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  359  LMTGIAVLKVDDIGRRPLLIGGVGGLALSLLLLSAYYKFLGGFPVVAVAALLLYVGCYQI  418

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP++EL+GA N+F +FG+I
Sbjct  419  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLEELLGAENLFLLFGII  478

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++FV   +PETKGL+LEEIE+K L
Sbjct  479  ALLSLLFVIVYVPETKGLSLEEIESKIL  506


 Score = 88.2 bits (217),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG+S PI+ +MG+G+W LP SPRW+LL A+QGKG +   +E A+ 
Sbjct  199   VGSFEINEVGGWRYMYGLSAPIASLMGLGLWTLPPSPRWLLLRAVQGKGSLQENKEKAIH  258

Query  948   CLCRLRGATIGD  913
              L +LRG   GD
Sbjct  259   ALSKLRGRPAGD  270



>ref|XP_002982112.1| hypothetical protein SELMODRAFT_115745 [Selaginella moellendorffii]
 gb|EFJ16780.1| hypothetical protein SELMODRAFT_115745 [Selaginella moellendorffii]
Length=470

 Score =   184 bits (467),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 139/209 (67%), Positives = 168/209 (80%), Gaps = 0/209 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
            ++ E+F+G  LK LTIG GL+ FQQ+TGQPSVLYYAA I Q AGFAAA DATR S+ LG+
Sbjct  256  SVWELFRGGNLKTLTIGTGLVFFQQVTGQPSVLYYAATILQSAGFAAATDATRVSVLLGV  315

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             KLIMTGVAV  VD+LGRRPLL+GGVSGI V+LF+L S++ F   +  +AVIALLLYVGC
Sbjct  316  FKLIMTGVAVFNVDKLGRRPLLIGGVSGIVVSLFMLASFFVFGKGLSFLAVIALLLYVGC  375

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ+SFGPI WLMISEIFPLR RGR LSI+ LVNF  NALV  A+SP++EL+GA   F  F
Sbjct  376  YQISFGPISWLMISEIFPLRTRGRALSISTLVNFAANALVALAYSPLQELLGAPLTFVGF  435

Query  305  gviavvavifvffiIPETKGLTLEEIEAK  219
            GVI +VA++F+   +PETKGL+LEEIE +
Sbjct  436  GVIGIVALVFIVSTVPETKGLSLEEIEQQ  464


 Score = 84.0 bits (206),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = -2

Query  1125  GSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSC  946
             GS+ +  V GWR+MY  + PI+I+MGIGMWWLP SPRW+LL A+QGKGDM  L   A   
Sbjct  157   GSVEISTVGGWRWMYAFAAPIAIIMGIGMWWLPPSPRWLLLRAVQGKGDMSELTRQACEA  216

Query  945   LCRLRGAT  922
               RL G +
Sbjct  217   FKRLGGGS  224



>ref|XP_011075802.1| PREDICTED: D-xylose-proton symporter-like 2 isoform X1 [Sesamum 
indicum]
Length=524

 Score =   220 bits (560),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 172/212 (81%), Positives = 194/212 (92%), Gaps = 0/212 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            ATI EMFQGKCLKAL IG GL+LFQQITGQPSVLYYAA IFQ AGF+AA+DAT+ SI LG
Sbjct  313  ATIAEMFQGKCLKALIIGGGLVLFQQITGQPSVLYYAATIFQSAGFSAASDATKVSILLG  372

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            L KLIMTGVAV+ VDRLGRRPLLLGGVSGI ++LFLLGSYYT+L ++P VAV+ALL+YVG
Sbjct  373  LWKLIMTGVAVLAVDRLGRRPLLLGGVSGIVISLFLLGSYYTYLGDIPAVAVVALLVYVG  432

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPIGWLMISE+FPLR+RGRGLSIAVLVNF  NALVTFAFSP++EL+GAG +FF 
Sbjct  433  CYQLSFGPIGWLMISEVFPLRLRGRGLSIAVLVNFAANALVTFAFSPLRELLGAGILFFS  492

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            FG IAV+++IF+FFIIPETKGLTLEEIEAK L
Sbjct  493  FGGIAVLSLIFIFFIIPETKGLTLEEIEAKLL  524


 Score =   122 bits (305),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 77/116 (66%), Gaps = 8/116 (7%)
 Frame = -2

Query  1125  GSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSC  946
             GSL+VE VAGWRYMYGVS P++++MG GMWWLPASPRWILL AIQGKG++  LR+TA+ C
Sbjct  221   GSLLVETVAGWRYMYGVSSPLAVIMGSGMWWLPASPRWILLRAIQGKGEVLALRDTAIYC  280

Query  945   LCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPNNWCWTNLV  778
             LCRLRG  IGDSA  P + + + +      +  H R      + E     C   L+
Sbjct  281   LCRLRGGAIGDSA--PQKVDEILS------ELSHLREEEEATIAEMFQGKCLKALI  328



>ref|XP_002992213.1| hypothetical protein SELMODRAFT_134982 [Selaginella moellendorffii]
 gb|EFJ06710.1| hypothetical protein SELMODRAFT_134982 [Selaginella moellendorffii]
Length=470

 Score =   182 bits (462),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 168/209 (80%), Gaps = 0/209 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
            ++ E+F+G  LK LTIG GL+ FQQ+TGQPSVLYYAA I Q AGFAAA DATR S+ LG+
Sbjct  256  SVWELFRGGNLKTLTIGTGLVFFQQVTGQPSVLYYAATILQSAGFAAATDATRVSVLLGV  315

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             KL+MTGVAV  VD+LGRRPLL+GGVSGI V+LF+L +++ F   +  +AVIALLLYVGC
Sbjct  316  FKLVMTGVAVFNVDKLGRRPLLIGGVSGIVVSLFMLAAFFVFGKGLSFLAVIALLLYVGC  375

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ+SFGPI WLMISEIFPLR RGR LSI+ LVNF  NALV  A+SP++EL+GA   F  F
Sbjct  376  YQISFGPISWLMISEIFPLRTRGRALSISTLVNFAANALVALAYSPLQELLGAPLTFVGF  435

Query  305  gviavvavifvffiIPETKGLTLEEIEAK  219
            GVI +VA++F+   +PETKGL+LEEIE +
Sbjct  436  GVIGIVALVFIVSTVPETKGLSLEEIEQQ  464


 Score = 84.0 bits (206),  Expect(2) = 7e-62, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = -2

Query  1125  GSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSC  946
             GS+ +  V GWR+MY  + PI+I+MGIGMWWLP SPRW+LL A+QGKGDM  L   A   
Sbjct  157   GSVEISTVGGWRWMYAFAAPIAIIMGIGMWWLPPSPRWLLLRAVQGKGDMSELTRQACEA  216

Query  945   LCRLRGAT  922
               RL G +
Sbjct  217   FKRLGGGS  224



>ref|XP_004153144.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Cucumis 
sativus]
 gb|KGN65747.1| hypothetical protein Csa_1G524690 [Cucumis sativus]
Length=585

 Score =   180 bits (456),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 176/211 (83%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
            +I E+ QG  LKA  IG GL+LFQQITGQPSVLYYA  I Q+AGFAAA DATR S+ +G+
Sbjct  374  SIWEVLQGPSLKAFIIGGGLVLFQQITGQPSVLYYAGPILQNAGFAAATDATRVSVVIGV  433

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             KL+MT VAV+ VD LGRRPLL+GGVSGIA++L LL +YY FL   P VAV ALLLYVGC
Sbjct  434  FKLLMTWVAVLKVDDLGRRPLLIGGVSGIALSLLLLSAYYKFLGGFPIVAVGALLLYVGC  493

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ+SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F
Sbjct  494  YQISFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLF  553

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            G IA+++++FV   +PETKGL+LE+IE+K L
Sbjct  554  GAIALLSLLFVVLKVPETKGLSLEDIESKIL  584


 Score = 85.9 bits (211),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 38/75 (51%), Positives = 49/75 (65%), Gaps = 0/75 (0%)
 Frame = -2

Query  1125  GSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSC  946
             GSL +  V GWRYMYG+S P++ +MG+GMW LP SPRW+LL A QGK      +E A++ 
Sbjct  278   GSLQINAVGGWRYMYGLSAPVAFMMGLGMWLLPPSPRWLLLRAAQGKAPSQDSKEEAIAA  337

Query  945   LCRLRGATIGDSAHH  901
             L +LRG   GD    
Sbjct  338   LSKLRGRPPGDKVSE  352



>gb|EPS59382.1| hypothetical protein M569_15426, partial [Genlisea aurea]
Length=411

 Score =   181 bits (458),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 136/208 (65%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            ++ +G  LKA  IG GL+LFQQITGQPSVLYYAA I Q AGF+AAADAT+ S+ +G+ KL
Sbjct  203  DVLRGPSLKAFVIGGGLVLFQQITGQPSVLYYAAPILQTAGFSAAADATKLSVVVGVFKL  262

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            IMTG+AV+ VD LGRRPLL+ GVSG+A +L LL +YY FL   P VAV ALLLYVG YQ+
Sbjct  263  IMTGIAVLKVDDLGRRPLLIIGVSGLAFSLLLLSAYYKFLGAFPFVAVAALLLYVGSYQI  322

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NF +NA+VTF+FSP+KEL+GA N+F +FG I
Sbjct  323  SFGPISWLMVSEIFPLRTRGKGISLAVLTNFASNAVVTFSFSPLKELLGAENLFLLFGGI  382

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            ++++++FV   +PETKGL+LEEIE+K+L
Sbjct  383  SLLSLVFVVLFVPETKGLSLEEIESKFL  410


 Score = 84.3 bits (207),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             V S+ + V+ GWRYMYG S PI+++MG+GMW LPASPRW+LL AIQ K  +   +E A+ 
Sbjct  103   VSSIEINVLGGWRYMYGFSAPIALLMGLGMWSLPASPRWLLLRAIQLKAPLQDYKEKAIV  162

Query  948   CLCRLRGATIGDSAHH  901
              L +LRG    D+A  
Sbjct  163   ALRKLRGGYGDDNAAE  178



>ref|XP_001773171.1| predicted protein [Physcomitrella patens]
 gb|EDQ62024.1| predicted protein, partial [Physcomitrella patens]
Length=464

 Score =   174 bits (441),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 124/206 (60%), Positives = 168/206 (82%), Gaps = 0/206 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            ++FQG  LKAL++G GL+ FQQ TGQPSVLYYAA I Q AGF+ A+DAT+ ++ LG+ KL
Sbjct  258  DLFQGVNLKALSVGGGLVFFQQFTGQPSVLYYAATILQTAGFSVASDATKLAVLLGIFKL  317

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            IMT +AV+ VD+LGRRPLLLGGV+GI ++L  L +Y++FL + P +AV +LLLYVGCYQ+
Sbjct  318  IMTALAVLNVDKLGRRPLLLGGVTGITLSLVTLAAYFSFLKDYPYLAVGSLLLYVGCYQI  377

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WL++SE+FPLR RGR LS+  L+NFG+NA+V  AF+P+++LVG    F IFG++
Sbjct  378  SFGPISWLVVSEVFPLRTRGRALSMTTLINFGSNAVVALAFAPLQDLVGESYTFVIFGIV  437

Query  296  avvavifvffiIPETKGLTLEEIEAK  219
            ++ A++F+F  +PETKGLTLE+I AK
Sbjct  438  SLFALVFIFTSVPETKGLTLEQITAK  463


 Score = 85.1 bits (209),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VG+  V+ V GWR MYG + PI ++MGIGMWWLP SPRW+LL A+QGKG+   L++ A  
Sbjct  158   VGNNQVDAVGGWRVMYGFASPIGLLMGIGMWWLPPSPRWLLLQAVQGKGNERTLKQDAAC  217

Query  948   CLCRLRG  928
              L RLRG
Sbjct  218   ALQRLRG  224



>ref|XP_002463619.1| hypothetical protein SORBIDRAFT_01g003010 [Sorghum bicolor]
 gb|EER90617.1| hypothetical protein SORBIDRAFT_01g003010 [Sorghum bicolor]
Length=259

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 177/211 (84%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
             + E+F+G  LKA TIG GL+LFQQITGQPSVLYYAA I Q AG++AA+DA + +I +GL
Sbjct  48   NVWEVFEGASLKAFTIGGGLVLFQQITGQPSVLYYAASILQTAGYSAASDAAKVAILIGL  107

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             KL+MTGVAV  VD +GRRPLL+GGV GIA++LFLL +YY  LD  P VAV ALLLYVG 
Sbjct  108  FKLLMTGVAVFKVDDVGRRPLLIGGVGGIALSLFLLAAYYKILDGFPFVAVGALLLYVGA  167

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ+SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NALVTFAFSP+KE +G  N+FF+F
Sbjct  168  YQVSFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNALVTFAFSPLKEFLGPANIFFLF  227

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            GVIAV++++FV  ++PETKGL+LEEIE+K L
Sbjct  228  GVIAVLSLVFVILVVPETKGLSLEEIESKIL  258



>ref|XP_001760396.1| predicted protein [Physcomitrella patens]
 gb|EDQ74787.1| predicted protein [Physcomitrella patens]
Length=584

 Score =   171 bits (433),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 129/209 (62%), Positives = 163/209 (78%), Gaps = 0/209 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
            +  E+FQG   KAL +G GL+ FQQ TGQPSVLYYAA I Q AGFAAA+DATR ++ LG 
Sbjct  372  SFSELFQGSNAKALFVGTGLVAFQQFTGQPSVLYYAAPILQSAGFAAASDATRLAVLLGF  431

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             KLIMT VAV+ VD+LGRRPLLLGGV+GI ++L  L +Y++FL + P +AV +LLLYVG 
Sbjct  432  FKLIMTAVAVLNVDKLGRRPLLLGGVAGITISLATLAAYFSFLQDYPYLAVGSLLLYVGS  491

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ+SFGPI WLM+SEIFPLR RGR L +  LVNFG+NALV  AF+P+++LVG    F IF
Sbjct  492  YQISFGPISWLMVSEIFPLRTRGRALGVTTLVNFGSNALVALAFAPLQDLVGESYTFVIF  551

Query  305  gviavvavifvffiIPETKGLTLEEIEAK  219
            G+I  +A+ F++  +PETKGL+LE+I AK
Sbjct  552  GIIGTLALTFIYTSVPETKGLSLEQISAK  580


 Score = 86.3 bits (212),  Expect(2) = 4e-59, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 49/67 (73%), Gaps = 0/67 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VG+  V+ + GWR M+G   PI+ +MG GMWWLP SPRW+LL A+QGKG++  L++ A S
Sbjct  275   VGNNQVDAIGGWRVMFGFGAPIAALMGAGMWWLPPSPRWLLLRAVQGKGNVKALKQEATS  334

Query  948   CLCRLRG  928
              L RLRG
Sbjct  335   VLQRLRG  341



>ref|XP_002991559.1| hypothetical protein SELMODRAFT_133784, partial [Selaginella 
moellendorffii]
 gb|EFJ07313.1| hypothetical protein SELMODRAFT_133784, partial [Selaginella 
moellendorffii]
Length=378

 Score =   171 bits (432),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 164/209 (78%), Gaps = 3/209 (1%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
            ++ E+F+G  LK LTIG GL+ FQQ+TG   VLYYAA I Q AGFA A DATR S+ LG+
Sbjct  167  SVWELFRGGNLKTLTIGTGLVFFQQVTG---VLYYAATILQSAGFAVATDATRVSVLLGV  223

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             KLIMTGVAV  VD+LGRRPLL+GGVSGI V+LF+L +++ F   +  +AVIALLLYVGC
Sbjct  224  FKLIMTGVAVFNVDKLGRRPLLIGGVSGIVVSLFMLAAFFVFGKGLSFLAVIALLLYVGC  283

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ+SFGPI WLMISEIFPLR RGR LSI+ LVNF  NALV  A+SP++EL+GA   F  F
Sbjct  284  YQISFGPISWLMISEIFPLRTRGRALSISTLVNFAANALVALAYSPLQELLGAPLTFVGF  343

Query  305  gviavvavifvffiIPETKGLTLEEIEAK  219
            GVI +VA++F+   +PETKGL+LEEIE +
Sbjct  344  GVIGIVALVFIVSTVPETKGLSLEEIEQQ  372


 Score = 83.6 bits (205),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = -2

Query  1125  GSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSC  946
             GS+ +  V GWR+MY  + PISI+MGIGMWWLP SPRW+LL  +QGKGDM  L   A   
Sbjct  68    GSVEISTVGGWRWMYAFAAPISIIMGIGMWWLPPSPRWLLLRVVQGKGDMSELTRQACEA  127

Query  945   LCRLRGAT  922
               RL G +
Sbjct  128   FKRLGGGS  135



>emb|CAN83894.1| hypothetical protein VITISV_039113 [Vitis vinifera]
Length=606

 Score =   165 bits (417),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 130/200 (65%), Positives = 166/200 (83%), Gaps = 0/200 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+L QQITGQPSVLY+A  I Q AGF+AA+DATR S+ +G  KL
Sbjct  369  EVFQGPSLKAFIIGGGLVLSQQITGQPSVLYFAGSILQTAGFSAASDATRVSVLIGFFKL  428

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MTG+AV+ VD +GRRPLL+GGV G+A++L LL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  429  LMTGIAVLKVDDIGRRPLLIGGVGGLALSLLLLSAYYKFLGGFPVVAVAALLLYVGCYQI  488

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP++EL+GA N+F +FG+I
Sbjct  489  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLEELLGAENLFLLFGII  548

Query  296  avvavifvffiIPETKGLTL  237
            A+++++FV   +PETKG+ +
Sbjct  549  ALLSLLFVIVYVPETKGIAI  568


 Score = 89.0 bits (219),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 51/72 (71%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG+S PI+ +MG+G+W LP SPRW+LL A+QGKG +   +E A+ 
Sbjct  269   VGSFEINEVGGWRYMYGLSAPIASLMGLGLWTLPPSPRWLLLRAVQGKGSLQENKEKAIH  328

Query  948   CLCRLRGATIGD  913
              L +LRG   GD
Sbjct  329   ALSKLRGRPAGD  340



>ref|XP_006443190.1| hypothetical protein CICLE_v10019791mg [Citrus clementina]
 gb|ESR56430.1| hypothetical protein CICLE_v10019791mg [Citrus clementina]
Length=451

 Score =   126 bits (317),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V++VAGWRYMYG S P++++MGIGMWWLPASPRW+LLCA++ KGDM  LRE+A+S
Sbjct  202   IGSLLVDLVAGWRYMYGASTPLAVIMGIGMWWLPASPRWLLLCAMKRKGDMQDLRESAIS  261

Query  948   CLCRLRGATIGDSA  907
             CLCRLRG +IGDSA
Sbjct  262   CLCRLRGQSIGDSA  275


 Score =   125 bits (315),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 139/170 (82%), Gaps = 8/170 (5%)
 Frame = -3

Query  926  QQLGIRHIIQVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVL  747
            Q +G     +VDEIL+ELS++ E+KE ++ E+F GKCLKAL IGAGL+LFQQITGQPSVL
Sbjct  269  QSIGDSAPTEVDEILTELSYVGEDKEVSLREVFHGKCLKALIIGAGLVLFQQITGQPSVL  328

Query  746  YYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVAL  567
            YYAA I Q AGF+AA+DATR SI LGL KLIMTG+AV+VV+RLGRRPLLLGGVSGI ++L
Sbjct  329  YYAASILQSAGFSAASDATRVSILLGLFKLIMTGLAVLVVERLGRRPLLLGGVSGIVISL  388

Query  566  FLLGSYYTFLDNVPPVAVIALLLYVGCYQL--SFGPIGWLMISEIFPLRV  423
            FLLGSYY FLD+VP VAV+ALLLYVGCYQ+  +F P      S+I+  R+
Sbjct  389  FLLGSYYLFLDDVPAVAVVALLLYVGCYQVIKNFNP------SKIYHFRI  432



>dbj|BAH19966.1| AT5G59250 [Arabidopsis thaliana]
Length=415

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKALTIG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  207  EVFQGPNLKALTIGGGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKL  266

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT VAV  VD LGRRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  267  LMTWVAVAKVDDLGRRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQI  326

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG I
Sbjct  327  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGGI  386

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+V+++FV  ++PETKGL+LEEIE+K L
Sbjct  387  ALVSLLFVILVVPETKGLSLEEIESKIL  414


 Score = 92.4 bits (228),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 68/116 (59%), Gaps = 6/116 (5%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++VV GWRYMYG   P++++MG+GMW LPASPRW+LL A+QGKG +   +E A+ 
Sbjct  107   VGSFQIDVVGGWRYMYGFGTPVALLMGLGMWSLPASPRWLLLRAVQGKGQLQEYKEKAML  166

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AF--SFK*RKRGHNRRNVSREVLESPNNWCWT  787
              L +LRG   GD        ++  +   +++  K G N      EV + PN    T
Sbjct  167   ALSKLRGRPPGDKISEKLVDDAYLSVKTAYEDEKSGGN----FLEVFQGPNLKALT  218



>gb|KDO39945.1| hypothetical protein CISIN_1g0102391mg [Citrus sinensis]
Length=451

 Score =   125 bits (315),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 139/170 (82%), Gaps = 8/170 (5%)
 Frame = -3

Query  926  QQLGIRHIIQVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVL  747
            Q +G     +VDEIL+ELS++ E+KE ++ E+F GKCLKAL IGAGL+LFQQITGQPSVL
Sbjct  269  QSIGDSAPTEVDEILTELSYVGEDKEVSLREVFHGKCLKALIIGAGLVLFQQITGQPSVL  328

Query  746  YYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVAL  567
            YYAA I Q AGF+AA+DATR SI LGL KLIMTG+AV+VV+RLGRRPLLLGGVSGI ++L
Sbjct  329  YYAASILQSAGFSAASDATRVSILLGLFKLIMTGLAVLVVERLGRRPLLLGGVSGIVISL  388

Query  566  FLLGSYYTFLDNVPPVAVIALLLYVGCYQL--SFGPIGWLMISEIFPLRV  423
            FLLGSYY FLD+VP VAV+ALLLYVGCYQ+  +F P      S+I+  R+
Sbjct  389  FLLGSYYLFLDDVPAVAVVALLLYVGCYQVIKNFNP------SKIYHFRI  432


 Score =   125 bits (314),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V++VAGWRYMYG S P++++MG+GMWWLPASPRW+LLCA++ KGDM  LRE+A+S
Sbjct  202   IGSLLVDLVAGWRYMYGASTPLAVIMGMGMWWLPASPRWLLLCAMKRKGDMQDLRESAIS  261

Query  948   CLCRLRGATIGDSA  907
             CLCRLRG +IGDSA
Sbjct  262   CLCRLRGQSIGDSA  275



>ref|XP_010685696.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Beta 
vulgaris subsp. vulgaris]
Length=565

 Score =   207 bits (527),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 148/210 (70%), Positives = 179/210 (85%), Gaps = 0/210 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            A+  E+FQG  LKA  IG GL+LFQQITGQPSVLYYA +I Q AGF+AA+DATR S+ +G
Sbjct  353  ASFLEVFQGPNLKAFIIGGGLVLFQQITGQPSVLYYAGQILQSAGFSAASDATRVSVLIG  412

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            L K +MTGVAV+ VD LGR+PLL+GGVSGI VALFLL +YY FL  +P VAV ALLLYVG
Sbjct  413  LFKFVMTGVAVLKVDDLGRKPLLIGGVSGITVALFLLAAYYKFLGGLPFVAVAALLLYVG  472

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
             YQ+SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NALVTFAFSP+KEL+GA N+F +
Sbjct  473  SYQISFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNALVTFAFSPLKELLGADNLFLL  532

Query  308  fgviavvavifvffiIPETKGLTLEEIEAK  219
            FGVIA+++++FV  ++PETKGL+LEEIEAK
Sbjct  533  FGVIALLSLVFVLTLVPETKGLSLEEIEAK  562


 Score = 95.5 bits (236),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 47/111 (42%), Positives = 69/111 (62%), Gaps = 7/111 (6%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +E V GWRYM+G+SVP++ VMG+GM+ LP SPRW+LL A+QGKG +   +E AV+
Sbjct  258   VGSFEIEAVGGWRYMFGLSVPVAAVMGLGMFSLPPSPRWLLLRAVQGKGSLQEYKEKAVT  317

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSR--EVLESPN  802
              L +LRG   GD        +++ +      K  ++R + +   EV + PN
Sbjct  318   ALSKLRGRPAGDKVSEKQIDDTLVSM-----KSAYDRESEASFLEVFQGPN  363



>ref|XP_010454633.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Camelina 
sativa]
Length=559

 Score =   205 bits (522),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 176/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKALTIG GL+LFQQITGQPSVLYYA  I Q AGF+AA DATR S+ +G+ KL
Sbjct  351  EVFQGPNLKALTIGGGLVLFQQITGQPSVLYYAGSILQTAGFSAATDATRVSVIIGVFKL  410

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT VAV  VD LGRRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  411  LMTWVAVAKVDDLGRRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQI  470

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NALVTFAFSP+KE +GA N+F +FG I
Sbjct  471  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNALVTFAFSPLKEFLGAENLFLLFGGI  530

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+V+++FV  ++PETKGL+LEEIE+K L
Sbjct  531  ALVSLLFVILVVPETKGLSLEEIESKIL  558


 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 67/116 (58%), Gaps = 6/116 (5%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++VV GWRYMYG   P++++MG+GMW LPASPRW+LL A+QGKG +   +E A+ 
Sbjct  251   VGSFQIDVVGGWRYMYGFGTPVALLMGLGMWSLPASPRWLLLRAVQGKGPLQEYKEKAML  310

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AF--SFK*RKRGHNRRNVSREVLESPNNWCWT  787
                +LRG   GD        ++  A   +++  K G N      EV + PN    T
Sbjct  311   AFSKLRGRPPGDKISEKLVDDAYLAVKTAYEDEKSGGNF----LEVFQGPNLKALT  362



>gb|EEE60202.1| hypothetical protein OsJ_13164 [Oryza sativa Japonica Group]
Length=488

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 143/211 (68%), Positives = 174/211 (82%), Gaps = 0/211 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
             I +MF+G  LKAL IG GL+LFQQITGQPSVLYYA  I Q AGFAAA+DA + SI +GL
Sbjct  277  NIWKMFEGASLKALIIGGGLVLFQQITGQPSVLYYATSILQTAGFAAASDAAKVSILIGL  336

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             KL+MTGVAV  VD LGRRPLL+GG+ GIAV+LFLL +YY  L++ P VAV ALLLYVG 
Sbjct  337  FKLLMTGVAVFKVDDLGRRPLLIGGIGGIAVSLFLLAAYYKILNSFPFVAVGALLLYVGS  396

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ+SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NALVTFAFSP++E +G  N+F +F
Sbjct  397  YQVSFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNALVTFAFSPLQEFLGPANIFLLF  456

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            G I++++++FV   +PETKGLTLEEIE+K L
Sbjct  457  GAISLLSLVFVILKVPETKGLTLEEIESKLL  487



>ref|XP_002866311.1| hypothetical protein ARALYDRAFT_919128 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42570.1| hypothetical protein ARALYDRAFT_919128 [Arabidopsis lyrata subsp. 
lyrata]
Length=559

 Score =   204 bits (520),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKALTIG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  351  EVFQGPNLKALTIGGGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKL  410

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT VAV  VD LGRRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  411  LMTWVAVAKVDDLGRRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVGALLLYVGCYQI  470

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG I
Sbjct  471  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKEFLGAENLFLLFGGI  530

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+V+++FV  ++PETKGL+LEEIE+K L
Sbjct  531  ALVSLLFVILVVPETKGLSLEEIESKIL  558


 Score = 91.7 bits (226),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 68/116 (59%), Gaps = 6/116 (5%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++VV GWRYMYG   P++++MG+GMW LPASPRW+LL A+QGKG +   +E A+ 
Sbjct  251   VGSFQIDVVGGWRYMYGFGTPVALLMGLGMWSLPASPRWLLLRAVQGKGQLQEYKEKAML  310

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AF--SFK*RKRGHNRRNVSREVLESPNNWCWT  787
              L +LRG   GD        ++  +   +++  K G N      EV + PN    T
Sbjct  311   ALSKLRGRPPGDKISEKLVDDAYLSVKTAYEDEKSGGNF----LEVFQGPNLKALT  362



>ref|XP_010106537.1| D-xylose-proton symporter-like 3 [Morus notabilis]
 gb|EXC10713.1| D-xylose-proton symporter-like 3 [Morus notabilis]
Length=500

 Score =   202 bits (515),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 175/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AA+DATR S+ +GL KL
Sbjct  292  EVFQGPSLKAFVIGGGLVLFQQITGQPSVLYYAGSILQSAGFSAASDATRVSVIIGLFKL  351

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV+ VD LGRRPLL+GGVSGIAV+L LL +YY FL   P VAV +LLLYVGCYQ+
Sbjct  352  VMTWIAVLKVDDLGRRPLLIGGVSGIAVSLLLLSAYYKFLGGYPLVAVASLLLYVGCYQI  411

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FGVI
Sbjct  412  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLVFGVI  471

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A ++++FV   +PETKGL+LEEIE+K L
Sbjct  472  AFLSLLFVVLYVPETKGLSLEEIESKIL  499


 Score = 96.7 bits (239),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 64/109 (59%), Gaps = 2/109 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  + +V GWRYM+GVS PI+++MG+GMW LP SPRW+LL A+QGKG M   +E A+S
Sbjct  192   VGSFQINIVGGWRYMFGVSAPIALLMGLGMWSLPPSPRWLLLRAVQGKGSMQEYKERAIS  251

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPN  802
              L +LRG   GD         ++   S K   +         EV + P+
Sbjct  252   ALSKLRGRPAGDKESERQIEGTL--ISLKSAYKEQESEGSFLEVFQGPS  298



>ref|XP_006401006.1| hypothetical protein EUTSA_v10013139mg [Eutrema salsugineum]
 gb|ESQ42459.1| hypothetical protein EUTSA_v10013139mg [Eutrema salsugineum]
Length=558

 Score =   204 bits (518),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 147/206 (71%), Positives = 176/206 (85%), Gaps = 0/206 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKALTIG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  350  EVFQGPNLKALTIGGGLVLFQQITGQPSVLYYAGSILQTAGFSAAADATRVSVIIGVFKL  409

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT VAV  VD LGRRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  410  LMTWVAVAKVDDLGRRPLLIGGVSGIALSLFLLSAYYKFLGGYPLVAVGALLLYVGCYQI  469

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KE +GA N+F +FG I
Sbjct  470  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKEYLGAENLFLLFGAI  529

Query  296  avvavifvffiIPETKGLTLEEIEAK  219
            A+V+++FV  ++PETKGL+LEEIE+K
Sbjct  530  ALVSLLFVILVVPETKGLSLEEIESK  555


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/116 (41%), Positives = 69/116 (59%), Gaps = 6/116 (5%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++VV GWRYMYG   P++++MG+GMW LPASPRW+LL A+QGKG +   +E A+ 
Sbjct  250   VGSFAIDVVGGWRYMYGFGTPVALLMGLGMWSLPASPRWLLLRAVQGKGTLEEYKEKAML  309

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AF--SFK*RKRGHNRRNVSREVLESPNNWCWT  787
              L +LRG   GD        +++ +   +++  K G N      EV + PN    T
Sbjct  310   ALSKLRGRPPGDKMSEKLVDDALLSVKAAYEDEKSGGNF----LEVFQGPNLKALT  361



>ref|XP_010535452.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X1 [Tarenaya hassleriana]
Length=557

 Score =   203 bits (516),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 176/208 (85%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKAL IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL
Sbjct  349  EVFQGPNLKALIIGGGLVLFQQITGQPSVLYYAGSILQSAGFSAAADATRVSVIVGLFKL  408

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV  VD +GRRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  409  LMTWIAVAKVDDIGRRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVAALLLYVGCYQI  468

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NA VTFAFSP+KEL+GA N+F +FG +
Sbjct  469  SFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNAAVTFAFSPLKELLGAENLFLLFGAV  528

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+V+++FV  I+PETKGL+LEEIE+K L
Sbjct  529  ALVSLLFVILIVPETKGLSLEEIESKIL  556


 Score = 89.0 bits (219),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 63/109 (58%), Gaps = 2/109 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++VV GWRYMYGV  P++++MG+GMW LP SPRW+LL A+QGKG +   ++ A+ 
Sbjct  249   VGSFTIDVVGGWRYMYGVGSPVALLMGLGMWSLPPSPRWLLLRAVQGKGSLQEYKDRAML  308

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPN  802
              L +LRG   GD        +++   S K             EV + PN
Sbjct  309   ALSKLRGRPPGDKMSEKQINDAL--LSVKSAYEDEQSGGNFLEVFQGPN  355



>ref|XP_006424895.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
 gb|ESR38135.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
Length=534

 Score =   155 bits (391),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  351  ELFQGPNLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKL  410

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV  VD LGRRPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ+
Sbjct  411  VMTWIAVAKVDDLGRRPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVAALLLYVGCYQI  470

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMK  342
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+K
Sbjct  471  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLK  515


 Score = 90.1 bits (222),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 40/72 (56%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG+S P++++MGIGMW LP SPRW+LL A+QGKG +   +E A+S
Sbjct  251   VGSFQINAVGGWRYMYGLSAPLALLMGIGMWSLPPSPRWLLLRAVQGKGSLQEYKEQAIS  310

Query  948   CLCRLRGATIGD  913
              L +LR    GD
Sbjct  311   ALGKLRRRPPGD  322



>ref|NP_001287653.1| D-xylose-proton symporter-like 3, chloroplastic-like [Solanum 
lycopersicum]
 ref|XP_004235087.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
isoform X1 [Solanum lycopersicum]
 dbj|BAO96238.1| vacuolar glucose transporter 1 [Solanum lycopersicum]
 dbj|BAQ03806.1| vacuolar glucose transporter 1 [Solanum lycopersicum]
Length=545

 Score =   201 bits (510),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 175/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+ QG  LKA TIG GL+LFQQITGQPSVLYYA  I Q AGF+AAADA R S+ +G+ K 
Sbjct  337  EVLQGPSLKAFTIGGGLVLFQQITGQPSVLYYAGSILQSAGFSAAADAARVSVVIGIFKS  396

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT VAV+  D LGRRPLL+GGVSGIA++LFLL +YY FL + P VAV ALLLYVGCYQ+
Sbjct  397  LMTAVAVLKADDLGRRPLLIGGVSGIALSLFLLSAYYKFLGSYPFVAVSALLLYVGCYQI  456

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FGVI
Sbjct  457  SFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGVI  516

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++FV   +PETKGLTLEEIE+K L
Sbjct  517  ALLSLVFVVTSVPETKGLTLEEIESKIL  544


 Score = 91.7 bits (226),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 65/114 (57%), Gaps = 2/114 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++V+ GWRYM+G S PI+++MG GMW LP SPRW+LL AIQGKG +   ++ A+ 
Sbjct  237   VGSYEIDVIGGWRYMFGFSAPIALLMGFGMWTLPPSPRWLLLRAIQGKGPLQEYKQKAIG  296

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPNNWCWT  787
              L +LRG   GD        +++   S K             EVL+ P+   +T
Sbjct  297   ALSKLRGRPDGDKISEKQIEDTI--ISLKTAYTDEEAEGNFLEVLQGPSLKAFT  348



>ref|XP_006342314.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic-like 
[Solanum tuberosum]
Length=545

 Score =   200 bits (509),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 175/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+ QG  LKA TIG GL+LFQQITGQPSVLYYA  I Q AGF+AAADA R S+ +G+ K 
Sbjct  337  EVLQGPSLKAFTIGGGLVLFQQITGQPSVLYYAGSILQSAGFSAAADAARVSVVIGIFKS  396

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT VAV+  D LGRRPLL+GGVSGIA++LFLL +YY FL + P VAV ALLLYVGCYQ+
Sbjct  397  LMTAVAVLKADDLGRRPLLIGGVSGIALSLFLLSAYYKFLGSYPFVAVSALLLYVGCYQI  456

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FGVI
Sbjct  457  SFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGVI  516

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++FV   +PETKGLTLEEIE+K L
Sbjct  517  ALLSLVFVVTSVPETKGLTLEEIESKIL  544


 Score = 94.0 bits (232),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 65/114 (57%), Gaps = 2/114 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++V+ GWRYM+G S PI+++MG GMW LP SPRW+LL AIQGKG +   +E A+ 
Sbjct  237   VGSYEIDVIGGWRYMFGFSAPIALLMGFGMWTLPPSPRWLLLRAIQGKGPLQEYKENAIG  296

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPNNWCWT  787
              L +LRG   GD        +++   S K             EVL+ P+   +T
Sbjct  297   ALSKLRGRPAGDKVSEKQIEDTI--ISLKTAYTDEEAEGNFLEVLQGPSLKAFT  348



>ref|XP_007132040.1| hypothetical protein PHAVU_011G061800g [Phaseolus vulgaris]
 gb|ESW04034.1| hypothetical protein PHAVU_011G061800g [Phaseolus vulgaris]
Length=558

 Score =   193 bits (490),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 175/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA +I Q AGF+AA+DAT+ S+ +G  KL
Sbjct  350  EVFQGPNLKAFIIGGGLVLFQQITGQPSVLYYAGQILQSAGFSAASDATKVSVVIGFFKL  409

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT VAV+ VD LGRRPLL+GGVSGIA++L LL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  410  LMTWVAVLKVDDLGRRPLLIGGVSGIALSLVLLSAYYKFLGGFPFVAVGALLLYVGCYQI  469

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFP+R RG+G+S+AVL NF +NA+VTFAFSP+KEL+GA N+F +FG I
Sbjct  470  SFGPISWLMVSEIFPIRTRGKGISLAVLTNFASNAVVTFAFSPLKELLGAENLFLLFGAI  529

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A+++++FV F +PETKGL+LE+IE+K L
Sbjct  530  AILSLLFVIFSVPETKGLSLEDIESKIL  557


 Score = 92.4 bits (228),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 63/109 (58%), Gaps = 2/109 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS +++ V GWR+MYG S P++++MG+GMW LP SPRW+LL A+QGKG    L+E A+ 
Sbjct  250   VGSFLIDSVGGWRFMYGFSAPVAVLMGLGMWTLPPSPRWLLLRAVQGKGSFQDLKEKAII  309

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPN  802
              L +LRG   GD        +++   S K             EV + PN
Sbjct  310   SLSKLRGRPPGDKESERQIEDTL--LSLKSAYGQQESEGNFLEVFQGPN  356



>gb|AFK37407.1| unknown [Lotus japonicus]
Length=563

 Score =   192 bits (489),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 171/208 (82%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AA+DAT+ S+ +GL KL
Sbjct  355  EVFQGPNLKAFIIGGGLVLFQQITGQPSVLYYAGSILQSAGFSAASDATKVSVVIGLFKL  414

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
             MT VAV+ VD LGRRPLL+ GVSGI ++L LL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  415  QMTWVAVLKVDDLGRRPLLIAGVSGIGLSLGLLSAYYKFLGGFPLVAVGALLLYVGCYQI  474

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SE FP+R RGRG+S+AVL NF +NA+VTFAFSP+KEL+GA N+F +FG I
Sbjct  475  SFGPISWLMVSETFPIRTRGRGISLAVLTNFASNAVVTFAFSPLKELLGAENLFLLFGAI  534

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            ++VA++FV F +PETKGL+LEEIE+K L
Sbjct  535  SLVALLFVIFSVPETKGLSLEEIESKIL  562


 Score = 95.1 bits (235),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 62/109 (57%), Gaps = 2/109 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWR+MYG S P++++MG+GMW LPASPRW+LL A+QGKG    L+E A+ 
Sbjct  255   VGSFQISSVGGWRFMYGFSAPVAVLMGLGMWTLPASPRWLLLKAVQGKGSFQDLKEKAIF  314

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPN  802
              L +LRG   GD         ++   S K   +         EV + PN
Sbjct  315   SLSKLRGRPPGDKESERQIEETL--VSLKSAYKDQESEGNFLEVFQGPN  361



>ref|XP_011089518.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic [Sesamum 
indicum]
Length=558

 Score =   191 bits (484),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 175/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADAT+ S+ +G+ KL
Sbjct  350  EVFQGPSLKAFIIGGGLVLFQQITGQPSVLYYAGPILQTAGFSAAADATKLSVVVGVFKL  409

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MTGVAV+ VD LGRRPLL+GGV+G+A +L LL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  410  LMTGVAVLKVDDLGRRPLLIGGVAGLAFSLLLLSAYYKFLGGFPFVAVAALLLYVGCYQI  469

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +FG I
Sbjct  470  SFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNAIVTFAFSPLKELLGAENLFLLFGAI  529

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            AV++++FV   +PETKGL+LEEIE+K L
Sbjct  530  AVLSLVFVVTSVPETKGLSLEEIESKIL  557


 Score = 86.3 bits (212),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 63/109 (58%), Gaps = 2/109 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VG+  +  + GWRYMYG S PI+++MG+GMW LP SPRW+LL A+QGKG +   +E A+ 
Sbjct  250   VGNFEINAIGGWRYMYGFSAPIALLMGLGMWSLPPSPRWLLLRAVQGKGSLQEYKEKALL  309

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPN  802
              L +LRG +  D        +++   S K    G+       EV + P+
Sbjct  310   ALRKLRGCSGEDKVSERQIEDTL--VSLKTAYAGNESEGSFLEVFQGPS  356



>gb|EYU45952.1| hypothetical protein MIMGU_mgv1a003885mg [Erythranthe guttata]
Length=558

 Score =   188 bits (478),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGFAAAADAT+ S+ +G+ KL
Sbjct  350  EVFQGPSLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFAAAADATKLSVVIGVFKL  409

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MTGVAV+ VD LGRRPLL+GGV G+A +L LL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  410  LMTGVAVLKVDDLGRRPLLIGGVGGLAFSLLLLSAYYKFLGGFPFVAVAALLLYVGCYQI  469

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RG+G+S++VL NFG+NALVTFAF P+KEL+GA N+F +FG I
Sbjct  470  SFGPISWLMVSEIFPLRTRGKGISLSVLTNFGSNALVTFAFFPLKELLGADNLFLLFGAI  529

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A++A++FV  I+PETKGLTLEEIE+K L
Sbjct  530  ALLALVFVVLIVPETKGLTLEEIESKIL  557


 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 63/109 (58%), Gaps = 2/109 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG S PI+++MGIGMW LPASPRW+LL A+QGKG +   +E AV 
Sbjct  250   VGSFEINAVGGWRYMYGCSAPIALLMGIGMWSLPASPRWLLLRAVQGKGPLQEYKEKAVL  309

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPN  802
              L +LRG +  D        ++V   S K      +      EV + P+
Sbjct  310   ALRKLRGRSNDDKVSEKQIEDTV--VSLKTAYADQDSEGNFLEVFQGPS  356



>ref|XP_010535453.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=531

 Score =   184 bits (467),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 125/172 (73%), Positives = 145/172 (84%), Gaps = 0/172 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKAL IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL
Sbjct  349  EVFQGPNLKALIIGGGLVLFQQITGQPSVLYYAGSILQSAGFSAAADATRVSVIVGLFKL  408

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV  VD +GRRPLL+GGVSGIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  409  LMTWIAVAKVDDIGRRPLLIGGVSGIALSLFLLSAYYKFLGGFPLVAVAALLLYVGCYQI  468

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGN  321
            SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NA VTFAFSP+KEL+GA N
Sbjct  469  SFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNAAVTFAFSPLKELLGAEN  520


 Score = 88.6 bits (218),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 63/109 (58%), Gaps = 2/109 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++VV GWRYMYGV  P++++MG+GMW LP SPRW+LL A+QGKG +   ++ A+ 
Sbjct  249   VGSFTIDVVGGWRYMYGVGSPVALLMGLGMWSLPPSPRWLLLRAVQGKGSLQEYKDRAML  308

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPN  802
              L +LRG   GD        +++   S K             EV + PN
Sbjct  309   ALSKLRGRPPGDKMSEKQINDAL--LSVKSAYEDEQSGGNFLEVFQGPN  355



>ref|XP_006424896.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
 gb|ESR38136.1| hypothetical protein CICLE_v10028127mg [Citrus clementina]
Length=443

 Score =   182 bits (463),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  235  ELFQGPNLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKL  294

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV  VD LGRRPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ+
Sbjct  295  VMTWIAVAKVDDLGRRPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVAALLLYVGCYQI  354

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  I
Sbjct  355  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAI  414

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A +AV+F+   +PETKGL+LEEIE+K L
Sbjct  415  AFLAVLFIVRTVPETKGLSLEEIESKIL  442


 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 62/109 (57%), Gaps = 2/109 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG+S P++++MGIGMW LP SPRW+LL A+QGKG +   +E A+S
Sbjct  135   VGSFQINAVGGWRYMYGLSAPLALLMGIGMWSLPPSPRWLLLRAVQGKGSLQEYKEQAIS  194

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPN  802
              L +LR    GD        +++   S K             E+ + PN
Sbjct  195   ALGKLRRRPPGDKLSERQIEDTL--VSLKSSYTDEKSEGGFLELFQGPN  241



>gb|KDO66622.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=436

 Score =   182 bits (462),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  228  EVFQGPNLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKL  287

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV  VD LGRRPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ+
Sbjct  288  VMTWIAVAKVDDLGRRPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQI  347

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  I
Sbjct  348  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAI  407

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A +AV+F+   +PETKGL+LEEIE+K L
Sbjct  408  AFLAVLFIVRTVPETKGLSLEEIESKIL  435


 Score = 91.7 bits (226),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 62/109 (57%), Gaps = 2/109 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG+S P++++MGIGMW LP SPRW+LL A+QGKG +   +E A+S
Sbjct  128   VGSFQINAVGGWRYMYGLSAPLALLMGIGMWSLPPSPRWLLLRAVQGKGSLQEYKEQAIS  187

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPN  802
              L +LR    GD        +++   S K             EV + PN
Sbjct  188   ALGKLRRRPPGDKLSERQIEDTL--VSLKSSYTDEKSEGSFLEVFQGPN  234



>gb|KDO66620.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
 gb|KDO66621.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=443

 Score =   182 bits (461),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  235  EVFQGPNLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKL  294

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV  VD LGRRPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ+
Sbjct  295  VMTWIAVAKVDDLGRRPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQI  354

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  I
Sbjct  355  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAI  414

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A +AV+F+   +PETKGL+LEEIE+K L
Sbjct  415  AFLAVLFIVRTVPETKGLSLEEIESKIL  442


 Score = 91.3 bits (225),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 62/109 (57%), Gaps = 2/109 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG+S P++++MGIGMW LP SPRW+LL A+QGKG +   +E A+S
Sbjct  135   VGSFQINAVGGWRYMYGLSAPLALLMGIGMWSLPPSPRWLLLRAVQGKGSLQEYKEQAIS  194

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPN  802
              L +LR    GD        +++   S K             EV + PN
Sbjct  195   ALGKLRRRPPGDKLSERQIEDTL--VSLKSSYTDEKSEGSFLEVFQGPN  241



>gb|KDO66618.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=553

 Score =   182 bits (461),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  345  EVFQGPNLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKL  404

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV  VD LGRRPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ+
Sbjct  405  VMTWIAVAKVDDLGRRPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQI  464

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  I
Sbjct  465  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAI  524

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A +AV+F+   +PETKGL+LEEIE+K L
Sbjct  525  AFLAVLFIVRTVPETKGLSLEEIESKIL  552


 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 62/109 (57%), Gaps = 2/109 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG+S P++++MGIGMW LP SPRW+LL A+QGKG +   +E A+S
Sbjct  245   VGSFQINAVGGWRYMYGLSAPLALLMGIGMWSLPPSPRWLLLRAVQGKGSLQEYKEQAIS  304

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPN  802
              L +LR    GD        +++   S K             EV + PN
Sbjct  305   ALGKLRRRPPGDKLSERQIEDTL--VSLKSSYTDEKSEGSFLEVFQGPN  351



>gb|KDO66619.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=559

 Score =   181 bits (460),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  351  EVFQGPNLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKL  410

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV  VD LGRRPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ+
Sbjct  411  VMTWIAVAKVDDLGRRPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQI  470

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+KEL+GA N+F +F  I
Sbjct  471  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLKELLGAENIFLLFAAI  530

Query  296  avvavifvffiIPETKGLTLEEIEAKYL  213
            A +AV+F+   +PETKGL+LEEIE+K L
Sbjct  531  AFLAVLFIVRTVPETKGLSLEEIESKIL  558


 Score = 90.9 bits (224),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 62/109 (57%), Gaps = 2/109 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG+S P++++MGIGMW LP SPRW+LL A+QGKG +   +E A+S
Sbjct  251   VGSFQINAVGGWRYMYGLSAPLALLMGIGMWSLPPSPRWLLLRAVQGKGSLQEYKEQAIS  310

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPN  802
              L +LR    GD        +++   S K             EV + PN
Sbjct  311   ALGKLRRRPPGDKLSERQIEDTL--VSLKSSYTDEKSEGSFLEVFQGPN  357



>ref|XP_010492634.1| PREDICTED: D-xylose-proton symporter-like 2 [Camelina sativa]
Length=147

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 109/123 (89%), Gaps = 0/123 (0%)
 Frame = -3

Query  581  IAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSI  402
            + V+LFLLGSYY F    P VAV+ALLLYVGCYQLSFGPIGWLMISEIFPL++RGRGLS+
Sbjct  25   MVVSLFLLGSYYLFFSASPVVAVVALLLYVGCYQLSFGPIGWLMISEIFPLKLRGRGLSL  84

Query  401  AVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEA  222
            AVLVNFG NALVTFAFSP+KEL+GAG +F  FGVI V+++ F+FFI+PETKGL+LEEIEA
Sbjct  85   AVLVNFGANALVTFAFSPLKELLGAGILFCAFGVICVLSLFFIFFIVPETKGLSLEEIEA  144

Query  221  KYL  213
            K L
Sbjct  145  KCL  147



>ref|XP_007016337.1| Major facilitator superfamily protein isoform 2, partial [Theobroma 
cacao]
 gb|EOY33956.1| Major facilitator superfamily protein isoform 2, partial [Theobroma 
cacao]
Length=493

 Score =   171 bits (433),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 119/165 (72%), Positives = 138/165 (84%), Gaps = 0/165 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  I  GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL
Sbjct  329  EVFQGPSLKAFIIAGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRLSVLVGLFKL  388

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AVV VD LGRRPLL+GGV GIA++LFLL +YY FL   P VAV ALLLYVGCYQ+
Sbjct  389  LMTWIAVVKVDDLGRRPLLIGGVGGIALSLFLLSAYYKFLGGFPFVAVAALLLYVGCYQI  448

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMK  342
            SFGPI WLM+SEIFPLR RG+G+S+AVL NFG+NA+VTFAFSP+K
Sbjct  449  SFGPISWLMVSEIFPLRTRGKGISLAVLTNFGSNAIVTFAFSPLK  493


 Score = 69.7 bits (169),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/48 (63%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGK  985
             VGS  +  V GWR+MYG S PI+++MGIGMW LP SPRW+LL A+QG 
Sbjct  253   VGSFQINAVGGWRFMYGCSAPIALLMGIGMWSLPPSPRWLLLRAVQGD  300



>ref|NP_197203.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
 emb|CAC01714.1| sugar transporter-like protein [Arabidopsis thaliana]
 gb|AED92371.1| D-xylose-proton symporter-like 2 [Arabidopsis thaliana]
Length=440

 Score =   105 bits (262),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 93/211 (44%), Positives = 113/211 (54%), Gaps = 64/211 (30%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
            T GE+FQGKCLKAL IG GL+LFQ                                    
Sbjct  294  TFGELFQGKCLKALIIGGGLVLFQ------------------------------------  317

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
             +LIMTGVA                     V +  LG     L  V       + L   C
Sbjct  318  -QLIMTGVA--------------------VVVIDRLGRRPLLLGGVG-----GMRLTSCC  351

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
               +    G  ++ EIFPL++RGRGLS+AVLVNFG NALVTFAFSP+KEL+GAG +F  F
Sbjct  352  CSCTAALCG--LLPEIFPLKLRGRGLSLAVLVNFGANALVTFAFSPLKELLGAGILFCGF  409

Query  305  gviavvavifvffiIPETKGLTLEEIEAKYL  213
            GVI V++++F+FFI+PETKGLTLEEIEAK L
Sbjct  410  GVICVLSLVFIFFIVPETKGLTLEEIEAKCL  440


 Score =   101 bits (252),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL V V +GWRYMY  SVP++++MGIGMWWLPASPRW+LL  IQGKG++   RE A+ 
Sbjct  200   IGSLTVNVHSGWRYMYATSVPLAVIMGIGMWWLPASPRWLLLRVIQGKGNVENQREAAIK  259

Query  948   CLCRLRGATIGDSAHH  901
              LC LRG    DSA  
Sbjct  260   SLCCLRGPAFVDSAAE  275



>gb|KJB26762.1| hypothetical protein B456_004G258400 [Gossypium raimondii]
Length=395

 Score =   121 bits (303),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 55/76 (72%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+VE V+GWRYMYG S P++++MGIGM WLPASPRW+LL AIQGKG+M  LRETAV 
Sbjct  197   IGSLLVETVSGWRYMYGASTPLAVIMGIGMCWLPASPRWLLLRAIQGKGNMQELRETAVC  256

Query  948   CLCRLRGATIGDSAHH  901
             CLCRLRG +IGDSA  
Sbjct  257   CLCRLRGQSIGDSASQ  272


 Score = 83.6 bits (205),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 70/96 (73%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = -3

Query  926  QQLGIRHIIQVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVL  747
            Q +G      VDEIL+ELS++ EEKE T+GE+F GKCLKA+ IGAGL+LFQQITGQPSVL
Sbjct  264  QSIGDSASQHVDEILTELSYVGEEKEVTLGEIFHGKCLKAMIIGAGLVLFQQITGQPSVL  323

Query  746  YYaakifqdagfaaaadatrASIFLGLLKLIMTGVA  639
            YYAA I Q AGF+AA+DATR SI LGLLKLIMTGVA
Sbjct  324  YYAASILQSAGFSAASDATRVSILLGLLKLIMTGVA  359



>gb|EPS60345.1| hypothetical protein M569_14457, partial [Genlisea aurea]
Length=153

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 132/149 (89%), Gaps = 0/149 (0%)
 Frame = -3

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGC  486
            ++L++TGVAV+ VDRLGRRPLLLGGVSGI V+LFLLGSYY F D  P +AV ALL+YVG 
Sbjct  5    VQLVLTGVAVLFVDRLGRRPLLLGGVSGIVVSLFLLGSYYAFFDQAPGLAVFALLVYVGS  64

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            YQ+SFGPIGWLMISEIFPL +RGRGLSI VLVNFG NA+VT AFSP++ELVGAG VFF F
Sbjct  65   YQVSFGPIGWLMISEIFPLCLRGRGLSIVVLVNFGANAVVTLAFSPLQELVGAGAVFFAF  124

Query  305  gviavvavifvffiIPETKGLTLEEIEAK  219
            GV+AV+++ F+F ++PETKGLTLEEIEAK
Sbjct  125  GVVAVLSLAFIFSVVPETKGLTLEEIEAK  153



>ref|XP_002325479.2| hypothetical protein POPTR_0019s08330g [Populus trichocarpa]
 gb|EEE99860.2| hypothetical protein POPTR_0019s08330g [Populus trichocarpa]
Length=446

 Score =   118 bits (296),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V+ VAGWRYMY  S P++++MGIGMWWLPASPRW+LL AIQGKG M  LRETA+ 
Sbjct  198   IGSLLVDTVAGWRYMYVASTPLAVIMGIGMWWLPASPRWLLLRAIQGKGSMQELRETAIC  257

Query  948   CLCRLRGATIGDSA  907
             CLCRLRG  IGD+A
Sbjct  258   CLCRLRGEAIGDTA  271


 Score = 81.3 bits (199),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
            T+ E+F+GKCLKALTIGAGL+LFQQITGQPSVLYYAA I Q AGF+AA+DATR SI LGL
Sbjct  292  TLAEVFRGKCLKALTIGAGLVLFQQITGQPSVLYYAASILQSAGFSAASDATRVSILLGL  351

Query  665  LKLIMTGVA  639
             KLIMTG A
Sbjct  352  FKLIMTGTA  360



>ref|NP_001141928.1| uncharacterized protein LOC100274077 [Zea mays]
 gb|ACF87321.1| unknown [Zea mays]
Length=148

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 108/123 (88%), Gaps = 0/123 (0%)
 Frame = -3

Query  581  IAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSI  402
            IA++LFLL +YY  L+N P VAV ALLLYVG YQ+SFGPI WLM+SEIFPLR RGRG+S+
Sbjct  25   IALSLFLLAAYYKILNNFPFVAVGALLLYVGAYQVSFGPISWLMVSEIFPLRTRGRGISL  84

Query  401  AVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEA  222
            AVL NFG+NALVTFAFSP+KEL+G  N+FF+FGVIAV++++FV  ++PETKGL+LEEIE+
Sbjct  85   AVLTNFGSNALVTFAFSPLKELLGPANIFFLFGVIAVLSLVFVILVVPETKGLSLEEIES  144

Query  221  KYL  213
            K L
Sbjct  145  KIL  147



>gb|KDO39947.1| hypothetical protein CISIN_1g0102391mg [Citrus sinensis]
Length=381

 Score =   125 bits (313),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V++VAGWRYMYG S P++++MG+GMWWLPASPRW+LLCA++ KGDM  LRE+A+S
Sbjct  202   IGSLLVDLVAGWRYMYGASTPLAVIMGMGMWWLPASPRWLLLCAMKRKGDMQDLRESAIS  261

Query  948   CLCRLRGATIGDSA  907
             CLCRLRG +IGDSA
Sbjct  262   CLCRLRGQSIGDSA  275


 Score = 68.6 bits (166),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 60/90 (67%), Positives = 73/90 (81%), Gaps = 0/90 (0%)
 Frame = -3

Query  926  QQLGIRHIIQVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVL  747
            Q +G     +VDEIL+ELS++ E+KE ++ E+F GKCLKAL IGAGL+LFQQITGQPSVL
Sbjct  269  QSIGDSAPTEVDEILTELSYVGEDKEVSLREVFHGKCLKALIIGAGLVLFQQITGQPSVL  328

Query  746  YYaakifqdagfaaaadatrASIFLGLLKL  657
            YYAA I Q AGF+AA+DATR SI LGL K+
Sbjct  329  YYAASILQSAGFSAASDATRVSILLGLFKV  358



>gb|KDO39946.1| hypothetical protein CISIN_1g0102391mg [Citrus sinensis]
Length=355

 Score =   125 bits (313),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             +GSL+V++VAGWRYMYG S P++++MG+GMWWLPASPRW+LLCA++ KGDM  LRE+A+S
Sbjct  202   IGSLLVDLVAGWRYMYGASTPLAVIMGMGMWWLPASPRWLLLCAMKRKGDMQDLRESAIS  261

Query  948   CLCRLRGATIGDSA  907
             CLCRLRG +IGDSA
Sbjct  262   CLCRLRGQSIGDSA  275


 Score = 64.3 bits (155),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = -3

Query  926  QQLGIRHIIQVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVL  747
            Q +G     +VDEIL+ELS++ E+KE ++ E+F GKCLKAL IGAGL+LFQQITGQPSVL
Sbjct  269  QSIGDSAPTEVDEILTELSYVGEDKEVSLREVFHGKCLKALIIGAGLVLFQQITGQPSVL  328

Query  746  YY  741
            YY
Sbjct  329  YY  330



>gb|KJB20003.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
Length=484

 Score = 95.5 bits (236),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 84/119 (71%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL
Sbjct  353  EVFQGPSLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRLSVVVGLFKL  412

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQ  480
            +MT +AV  VD LGRRPLL+GGV GIA++LFLL +YY FL   P VAV ALLLYVGCYQ
Sbjct  413  LMTWIAVAKVDDLGRRPLLIGGVGGIALSLFLLCAYYKFLGEFPYVAVAALLLYVGCYQ  471


 Score = 92.0 bits (227),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG S P++++MG+GMW LP SPRW++L A+QGKG +  L+E A+ 
Sbjct  253   VGSFQINAVGGWRYMYGCSAPVALLMGLGMWSLPPSPRWLILRAVQGKGSLQELKEKAIL  312

Query  948   CLCRLRGATIGDSAHH  901
              L +LRG   GD A  
Sbjct  313   ALSKLRGRAPGDEASE  328



>gb|KDO66623.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=559

 Score =   154 bits (388),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 136/165 (82%), Gaps = 0/165 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  351  EVFQGPNLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKL  410

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV  VD LGRRPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ+
Sbjct  411  VMTWIAVAKVDDLGRRPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQI  470

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMK  342
            SFGPI WLM+SEIFPLR RGRG+S+AVL NFG+NA+VTFAFSP+K
Sbjct  471  SFGPISWLMVSEIFPLRTRGRGISLAVLTNFGSNAIVTFAFSPLK  515


 Score = 90.1 bits (222),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 62/109 (57%), Gaps = 2/109 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG+S P++++MGIGMW LP SPRW+LL A+QGKG +   +E A+S
Sbjct  251   VGSFQINAVGGWRYMYGLSAPLALLMGIGMWSLPPSPRWLLLRAVQGKGSLQEYKEQAIS  310

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPN  802
              L +LR    GD        +++   S K             EV + PN
Sbjct  311   ALGKLRRRPPGDKLSERQIEDTL--VSLKSSYTDEKSEGSFLEVFQGPN  357



>ref|XP_009779937.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Nicotiana sylvestris]
Length=462

 Score = 95.1 bits (235),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADA R S+ +G+ K 
Sbjct  344  EVFQGPSLKAFIIGGGLVLFQQITGQPSVLYYAGSILQSAGFSAAADAARVSVVIGIFKS  403

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQ  480
            +MT VAV+  D LGRRPLL+GGVSGIA++LFLL +YY FL + P VAV ALLLYVGCYQ
Sbjct  404  LMTAVAVLKADDLGRRPLLIGGVSGIALSLFLLSAYYKFLGSFPFVAVAALLLYVGCYQ  462


 Score = 90.9 bits (224),  Expect(2) = 9e-38, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYM+G+S PI+++MG+GMW LP SPRW+LL AIQ KG + G +E A+ 
Sbjct  244   VGSYEINAVGGWRYMFGLSAPIALLMGLGMWSLPPSPRWLLLRAIQSKGPLQGYKEKAIG  303

Query  948   CLCRLRGATIGDSAHH  901
              L +LRG   GD    
Sbjct  304   ALSKLRGRPAGDKVSE  319



>ref|XP_005645204.1| hypothetical protein COCSUDRAFT_67173 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE20660.1| hypothetical protein COCSUDRAFT_67173 [Coccomyxa subellipsoidea 
C-169]
Length=564

 Score =   122 bits (306),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 113/206 (55%), Positives = 140/206 (68%), Gaps = 7/206 (3%)
 Frame = -3

Query  833  MFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLI  654
            +F+G+ LK L IG+ L+LFQQITGQPSVLYYAA+IF+ AGF A  DAT  S+ LGL KL+
Sbjct  357  LFRGRFLKPLLIGSSLMLFQQITGQPSVLYYAAEIFEKAGFGAGKDATGVSVLLGLFKLL  416

Query  653  MTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLD--NVPPVAVIALLLYVGCYQ  480
            MTGVAV+ VD +GRRPLLLGGV  +  AL  LG     L        +VIALL+YV    
Sbjct  417  MTGVAVLSVDSVGRRPLLLGGVGAMVGALLALGGSQLLLSGGTATWTSVIALLMYV----  472

Query  479  LSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgv  300
             SFGPI WL++ EIFPL VRG   ++A + NFG+N LV+     ++E  G G  +  F  
Sbjct  473  -SFGPISWLIVGEIFPLAVRGPASALATITNFGSNFLVSLVLPSVQEAFGPGGTYLAFAG  531

Query  299  iavvavifvffiIPETKGLTLEEIEA  222
            I VVA+  +F I+PETKG TLEEIEA
Sbjct  532  IGVVALATIFAIVPETKGKTLEEIEA  557


 Score = 51.2 bits (121),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 39/69 (57%), Gaps = 8/69 (12%)
 Frame = -2

Query  1119  LMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSCLC  940
             L ++ V GWR MYG++   ++V+  GM WLP SPRW+LL    G GD       A + L 
Sbjct  268   LFIDDVGGWRAMYGLAAGPALVVLAGMAWLPDSPRWLLL---NGDGD-----AKAEAALM  319

Query  939   RLRGATIGD  913
             R RG   GD
Sbjct  320   RARGKYGGD  328



>ref|XP_005845570.1| hypothetical protein CHLNCDRAFT_25635 [Chlorella variabilis]
 gb|EFN53468.1| hypothetical protein CHLNCDRAFT_25635 [Chlorella variabilis]
Length=502

 Score =   141 bits (355),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 117/211 (55%), Positives = 146/211 (69%), Gaps = 0/211 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            +   E+ + +  + L IG  L+LFQQITGQPSVLYYAAKIFQ AGFA A +AT  S+ LG
Sbjct  290  SNFAELLRPRYRRPLAIGMSLMLFQQITGQPSVLYYAAKIFQAAGFAGAEEATGVSLVLG  349

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
              KLIMTG+AV  VD  GRRPLLL GVSGI ++L  LG+     D V    ++ALLLYVG
Sbjct  350  FFKLIMTGIAVATVDSWGRRPLLLYGVSGIVLSLLALGTAQVARDMVAWTNLVALLLYVG  409

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
            CYQLSFGPI WL+  E+FPL+VRG+ +++A L NFG+N LV+ A   + E  G    +F 
Sbjct  410  CYQLSFGPISWLLCGEVFPLKVRGQAIALATLTNFGSNFLVSLALPTITESFGPAATYFT  469

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKY  216
            F  I V AV+ +  I+PETKG TLEEIEA +
Sbjct  470  FAAIGVGAVVTIHAIVPETKGKTLEEIEALW  500



>gb|EPS57619.1| hypothetical protein M569_17198, partial [Genlisea aurea]
Length=304

 Score =   101 bits (252),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 44/71 (62%), Positives = 57/71 (80%), Gaps = 1/71 (1%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGD-MPGLRETAV  952
             VGSL+V+   GWRYMY +  P+++VMG GMWWLPASPRWILL A++GKG+    LR+TA+
Sbjct  149   VGSLLVDTFVGWRYMYAIITPVTLVMGFGMWWLPASPRWILLRAVEGKGEQQEALRDTAI  208

Query  951   SCLCRLRGATI  919
             +CLCRLRG  +
Sbjct  209   TCLCRLRGRAV  219


 Score = 70.1 bits (170),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 48/64 (75%), Positives = 56/64 (88%), Gaps = 0/64 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            AT+ E+F+GKCLKAL IG GLILFQQITGQPSVLYYA  IF+ AGF+AA+DAT+ SI LG
Sbjct  241  ATLAELFRGKCLKALIIGGGLILFQQITGQPSVLYYAPTIFKSAGFSAASDATKVSILLG  300

Query  668  LLKL  657
            LLK+
Sbjct  301  LLKV  304



>ref|XP_011400947.1| D-xylose-proton symporter-like 3, chloroplastic [Auxenochlorella 
protothecoides]
 gb|KFM27940.1| D-xylose-proton symporter-like 3, chloroplastic [Auxenochlorella 
protothecoides]
Length=529

 Score =   131 bits (330),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 111/213 (52%), Positives = 149/213 (70%), Gaps = 5/213 (2%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+ + +  + L IGAGL+LFQQ+TGQPSVLYYAA IFQ AGF ++  AT  S+ LGL KL
Sbjct  309  ELARPRYRRPLAIGAGLMLFQQVTGQPSVLYYAASIFQAAGFQSSGQATGVSLGLGLFKL  368

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPP-----VAVIALLLYV  492
            +MTGVAV  VDRLGRRPLLL GVSG+  AL  L         + P       + ALL+YV
Sbjct  369  VMTGVAVATVDRLGRRPLLLWGVSGLVGALLCLALASGGALPIDPGLVAWTNLAALLVYV  428

Query  491  GCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvff  312
            GCYQ+SFGPI WL++SEIFPL+VRG+ +++A L NF +N  V+ A   ++E +G    + 
Sbjct  429  GCYQVSFGPISWLIVSEIFPLKVRGQAMALATLTNFSSNFAVSLALPSVRESIGPSATYL  488

Query  311  ifgviavvavifvffiIPETKGLTLEEIEAKYL  213
            +F V+ V +++ ++ I+PETKG TLEEIEA ++
Sbjct  489  VFAVVGVASLVTIYNIVPETKGKTLEEIEALWM  521


 Score = 33.1 bits (74),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 31/78 (40%), Gaps = 6/78 (8%)
 Frame = -2

Query  1113  VEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRET------AV  952
             V+   GWR+M G +   +  +  GM WLP SPRW+LL           L  T      A 
Sbjct  221   VDASGGWRWMLGAATAPAAALAAGMAWLPESPRWLLLSGAGRGAAAAALHRTQGRNASAA  280

Query  951   SCLCRLRGATIGDSAHHP  898
             S    L G      A  P
Sbjct  281   SVAVELAGMQAATEAESP  298



>gb|KJB20002.1| hypothetical protein B456_003G129000 [Gossypium raimondii]
Length=456

 Score = 92.0 bits (227),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG S P++++MG+GMW LP SPRW++L A+QGKG +  L+E A+ 
Sbjct  253   VGSFQINAVGGWRYMYGCSAPVALLMGLGMWSLPPSPRWLILRAVQGKGSLQELKEKAIL  312

Query  948   CLCRLRGATIGDSAHH  901
              L +LRG   GD A  
Sbjct  313   ALSKLRGRAPGDEASE  328


 Score = 62.0 bits (149),  Expect(2) = 3e-28, Method: Compositional matrix adjust.
 Identities = 46/66 (70%), Positives = 53/66 (80%), Gaps = 0/66 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL
Sbjct  353  EVFQGPSLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRLSVVVGLFKL  412

Query  656  IMTGVA  639
            +MT +A
Sbjct  413  LMTWIA  418



>gb|EMT28553.1| D-xylose-proton symporter-like protein 3 [Aegilops tauschii]
Length=374

 Score = 85.5 bits (210),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 37/72 (51%), Positives = 52/72 (72%), Gaps = 0/72 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  ++VV GWRYM+G S P++ +M +GMW LP SPRW+LL A+QGKG M   ++ A++
Sbjct  188   VGSYEIDVVGGWRYMFGFSAPLAAIMAVGMWSLPPSPRWLLLRAVQGKGPMEDNKKKAMN  247

Query  948   CLCRLRGATIGD  913
              L RL+G +  D
Sbjct  248   ALRRLKGPSASD  259


 Score = 67.8 bits (164),  Expect(2) = 6e-28, Method: Compositional matrix adjust.
 Identities = 44/69 (64%), Positives = 53/69 (77%), Gaps = 0/69 (0%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
            +I ++F+G  LKA TIG GL+LFQQITGQPSVLYYA  I Q AGF  A+DA + SI +GL
Sbjct  284  SIFQVFEGASLKAFTIGGGLVLFQQITGQPSVLYYATSILQTAGFTTASDAAKVSILIGL  343

Query  665  LKLIMTGVA  639
             K +MTGVA
Sbjct  344  FKFVMTGVA  352



>ref|XP_007016338.1| Major facilitator superfamily protein isoform 3, partial [Theobroma 
cacao]
 gb|EOY33957.1| Major facilitator superfamily protein isoform 3, partial [Theobroma 
cacao]
Length=463

 Score = 90.5 bits (223),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWR+MYG S PI+++MGIGMW LP SPRW+LL A+QGKG +   +E A+ 
Sbjct  253   VGSFQINAVGGWRFMYGCSAPIALLMGIGMWSLPPSPRWLLLRAVQGKGYLQEYKEKAIL  312

Query  948   CLCRLRGATIGDSAHH  901
              L +LRG   GD A  
Sbjct  313   ALSKLRGRAPGDEASE  328


 Score = 60.1 bits (144),  Expect(2) = 4e-27, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  I  GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +GL KL
Sbjct  353  EVFQGPSLKAFIIAGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRLSVLVGLFKL  412

Query  656  IMTGVA  639
            +MT +A
Sbjct  413  LMTWIA  418



>ref|XP_001416926.1| MFS family transporter: sugar (galactose/glucose) [Ostreococcus 
lucimarinus CCE9901]
 gb|ABO95219.1| MFS family transporter: sugar (galactose/glucose) [Ostreococcus 
lucimarinus CCE9901]
Length=530

 Score =   110 bits (276),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 133/212 (63%), Gaps = 5/212 (2%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
             +F  K ++ L IG  ++LFQQ TGQPSVLYYA + F+ AG++    A   S+ LG+ KL
Sbjct  319  SLFDKKYVRPLYIGLSVVLFQQFTGQPSVLYYATQTFEAAGWSVEDAANV-SVILGIWKL  377

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYT----FLDNVPPVAVIALLLYVG  489
             MTG+AV  VD LGRRPLLLGG+S I   LF L +  T            +V A+ LYVG
Sbjct  378  FMTGIAVSKVDSLGRRPLLLGGISIITACLFALAALNTPGEVQTTAQAQASVAAIFLYVG  437

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
             YQLSFGPI WL++ E+FP +VR   + +A L NFG+N LV+     ++E VG    +  
Sbjct  438  AYQLSFGPIAWLLVGEVFPSKVRSAAVGLATLSNFGSNFLVSLFLPTVQETVGLRGTYLG  497

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKYL  213
            F  + V+A+  ++F + ET+G TLEEIEA+ +
Sbjct  498  FASVGVLALASIYFTVVETRGKTLEEIEAELM  529


 Score = 37.0 bits (84),  Expect(2) = 2e-26, Method: Compositional matrix adjust.
 Identities = 21/58 (36%), Positives = 28/58 (48%), Gaps = 4/58 (7%)
 Frame = -2

Query  1098  GWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSCLCRLRGA  925
             GWR +   + P+  ++  G  WLP SPRWI        GD    R+ A   L R+R A
Sbjct  232   GWRQLSLEATPLIGLLLAGAIWLPDSPRWI----ASKSGDGKDTRDEAREALVRIREA  285



>ref|WP_013644894.1| major facilitator transporter [Methanobacterium lacus]
 ref|YP_004290515.1| sugar transporter [Methanobacterium lacus]
 gb|ADZ09543.1| sugar transporter [Methanobacterium lacus]
Length=453

 Score =   103 bits (257),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 92/207 (44%), Positives = 146/207 (71%), Gaps = 3/207 (1%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            ++ + K   AL IG GL  FQQ+TG  +V+YYA  I + AG   A     A++ +G++ +
Sbjct  240  DLLEPKIRSALIIGIGLAAFQQLTGINTVIYYAPTILEFAGLQTATVTIFATVGIGVVNV  299

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYT---FLDNVPPVAVIALLLYVGC  486
            ++T V+++++DRLGRRPLLL G++G+ V+L ++G  +       ++  +AVI L+LYVG 
Sbjct  300  LLTVVSILLIDRLGRRPLLLAGITGMIVSLGIMGLAFIIPGLTSSLGWLAVICLMLYVGS  359

Query  485  YQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffif  306
            + +S GPI WLMI+EI+PLR+RGR +SI  ++N+ TN +V   F  + EL+GA   F+++
Sbjct  360  FAISLGPIFWLMIAEIYPLRIRGRAMSIVTMINWATNLVVAITFLTIIELLGASGTFWLY  419

Query  305  gviavvavifvffiIPETKGLTLEEIE  225
            GVIAV++++FV++ +PETKG +LEEIE
Sbjct  420  GVIAVLSLLFVYYRVPETKGKSLEEIE  446


 Score = 41.2 bits (95),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 19/56 (34%), Positives = 34/56 (61%), Gaps = 9/56 (16%)
 Frame = -2

Query  1095  WRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSCLCRLRG  928
             WR+M G++V  S+++ +GM+++P SPRW++           G    AV+ L ++RG
Sbjct  169   WRWMLGLAVIPSLILALGMFFMPPSPRWLI---------SKGFESKAVAVLKKIRG  215



>ref|XP_007016339.1| Major facilitator superfamily protein isoform 4, partial [Theobroma 
cacao]
 gb|EOY33958.1| Major facilitator superfamily protein isoform 4, partial [Theobroma 
cacao]
Length=416

 Score = 90.9 bits (224),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWR+MYG S PI+++MGIGMW LP SPRW+LL A+QGKG +   +E A+ 
Sbjct  253   VGSFQINAVGGWRFMYGCSAPIALLMGIGMWSLPPSPRWLLLRAVQGKGYLQEYKEKAIL  312

Query  948   CLCRLRGATIGDSAHH  901
              L +LRG   GD A  
Sbjct  313   ALSKLRGRAPGDEASE  328


 Score = 51.6 bits (122),  Expect(2) = 9e-25, Method: Compositional matrix adjust.
 Identities = 24/32 (75%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYY  741
            E+FQG  LKA  I  GL+LFQQITGQPSVLYY
Sbjct  353  EVFQGPSLKAFIIAGGLVLFQQITGQPSVLYY  384



>ref|XP_003062688.1| major facilitator superfamily [Micromonas pusilla CCMP1545]
 gb|EEH53507.1| major facilitator superfamily [Micromonas pusilla CCMP1545]
Length=510

 Score =   111 bits (278),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 137/216 (63%), Gaps = 9/216 (4%)
 Frame = -3

Query  842  IGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLL  663
            +GE+ + K ++ L +G  ++LFQQITGQPSVLYYA ++F  AGF A+  A   S+ LG+ 
Sbjct  293  VGELLRKKNVRPLFVGLSVVLFQQITGQPSVLYYAEQVFIAAGFDASEGAGV-SVILGVF  351

Query  662  KLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLD--------NVPPVAVIA  507
            KL+MTG AV  VD +GRRPLLLGGV+ + +A   LG+    L         N   ++V+A
Sbjct  352  KLVMTGFAVKYVDSVGRRPLLLGGVAAMMLATVALGACSDALATGDPADSLNTARLSVLA  411

Query  506  LLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGA  327
            +  YVG YQ+SFGPI WL++ EIFP RVR   +  A L NF +N LV      M    G 
Sbjct  412  IFAYVGAYQVSFGPIAWLLVGEIFPQRVRSAAVGTATLTNFASNYLVALYLPTMIASYGQ  471

Query  326  GNvffifgviavvavifvffiIPETKGLTLEEIEAK  219
               ++IF V+ V+A+  ++  +PETKG +LEEIEA+
Sbjct  472  AGTYYIFSVMGVIALASIYLTVPETKGKSLEEIEAE  507



>ref|XP_007510995.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66555.1| predicted protein [Bathycoccus prasinos]
Length=595

 Score =   100 bits (249),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 94/217 (43%), Positives = 135/217 (62%), Gaps = 12/217 (6%)
 Frame = -3

Query  833  MFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLI  654
            +   K  KAL +G  ++LFQQ+TGQPSVLYYA + F+ AG++A   +   ++ +G+ KL 
Sbjct  369  ILDKKYAKALYVGLSVVLFQQLTGQPSVLYYATQTFEAAGWSAQGASNI-AVVVGVFKLF  427

Query  653  MTGVAvvvvdrlgrrplllggvsGIAVALFLLG-----------SYYTFLDNVPPVAVIA  507
            MT +AV  VD LGRRPLLLGGVS I ++L +L                  +    ++V A
Sbjct  428  MTVIAVWKVDSLGRRPLLLGGVSLITLSLMVLALASPDFAGSGVEAAALSETQARISVAA  487

Query  506  LLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGA  327
            + LYVG YQ+SFGPI WL++ E+FP +VR + + IA L+NFG+N +V+       E +G 
Sbjct  488  IFLYVGAYQVSFGPIAWLLVGEVFPTKVRSQAVGIATLLNFGSNFIVSLNLPYAIEQIGI  547

Query  326  GNvffifgviavvavifvffiIPETKGLTLEEIEAKY  216
             + +F F  I V++V  ++F + ETKG TLEEIE  Y
Sbjct  548  KSTYFGFASIGVLSVASIYFSVVETKGKTLEEIEDAY  584


 Score = 35.4 bits (80),  Expect(2) = 8e-23, Method: Compositional matrix adjust.
 Identities = 20/63 (32%), Positives = 32/63 (51%), Gaps = 12/63 (19%)
 Frame = -2

Query  1098  GWRYMYGVSVPISIVMGIGM-WWLPASPRWILLCAIQGKGDMPGLRETAVSCLCRLRGAT  922
             GWR M+  SVP +++  +G  + LP SPRW+   A +     P L+        +LRG  
Sbjct  287   GWRSMFLTSVPFAVLTLVGAGFILPDSPRWL---ASKNMDSFPALK--------KLRGPN  335

Query  921   IGD  913
             + +
Sbjct  336   VSE  338



>gb|EKD53804.1| hypothetical protein ACD_60C00149G0003 [uncultured bacterium]
Length=466

 Score = 94.0 bits (232),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 87/218 (40%), Positives = 140/218 (64%), Gaps = 3/218 (1%)
 Frame = -3

Query  833  MFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLI  654
            +F       L IG GL + QQITG  +++YYA  IF  AGF     A  A++ +GL+ ++
Sbjct  236  LFARHIKSTLIIGVGLAIIQQITGINTIIYYAPTIFNLAGFEGPTAAILATMGVGLVFVV  295

Query  653  MTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIAL---LLYVGCY  483
             T +A+ ++D LGRRPLLL G+ G+A++L LL   ++     P +  IAL   L+Y+ C+
Sbjct  296  STIIALPLIDTLGRRPLLLIGLLGMALSLGLLSIAFSHAGTFPFLKWIALSSMLIYIACF  355

Query  482  QLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifg  303
              S GPI WLMI+EI+PL++RG G SIA   N+G+N +V   F  + E +GA + F I+ 
Sbjct  356  GFSLGPIMWLMIAEIYPLKIRGLGCSIATAANWGSNMIVALTFLSLIEYMGASHTFLIYC  415

Query  302  viavvavifvffiIPETKGLTLEEIEAKYLT*LFLRMM  189
            ++++++++F+++++PETK +TLE+IE      L+ + M
Sbjct  416  LLSIISLLFIYYLVPETKDITLEQIEENLRAGLYFKKM  453


 Score = 41.6 bits (96),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 22/58 (38%), Positives = 36/58 (62%), Gaps = 9/58 (16%)
 Frame = -2

Query  1098  GWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSCLCRLRGA  925
             GWR+M G  +  ++ + +GM++LP SPRW  +C+   +GD P    +A + L R+ GA
Sbjct  166   GWRFMLGTGIVPAVGLLLGMFFLPDSPRW--MCS---RGDAP----SAFAILKRIHGA  214



>ref|XP_005831465.1| hypothetical protein GUITHDRAFT_109605 [Guillardia theta CCMP2712]
 gb|EKX44485.1| hypothetical protein GUITHDRAFT_109605 [Guillardia theta CCMP2712]
Length=431

 Score =   107 bits (267),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 97/201 (48%), Positives = 133/201 (66%), Gaps = 13/201 (6%)
 Frame = -3

Query  812  KALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvv  633
            KALTIG GL+LFQQ++GQPSVLYYA +IF+ AG    A A    + + L++    G    
Sbjct  237  KALTIGVGLVLFQQLSGQPSVLYYANRIFERAGLGFEAAAIMTLLSVNLVEDPKWG----  292

Query  632  vvdrlgrrplllggvsGIAVALFLLGSYYTF-LDNVPPVAVIA-LLLYVGCYQLSFGPIG  459
                  RRPLLL G SG+AV+L +L + ++   D++   AVIA ++ YVGCYQ+ FGPI 
Sbjct  293  ------RRPLLLLGTSGMAVSLLVLAALFSGGADSINQSAVIASIVAYVGCYQIGFGPIT  346

Query  458  WLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavi  279
            WL++SE+FPL++R   +S+  L NFG+N LVT AF   ++ +G   +F  F  IAV AV 
Sbjct  347  WLILSEVFPLKIRAAAVSVGTLANFGSNVLVTLAFESERQSLGETLLFLQFAAIAVAAVA  406

Query  278  fvffiIPETK-GLTLEEIEAK  219
            F F ++PET+ GLTLE+IE K
Sbjct  407  FEFKMVPETRWGLTLEQIEEK  427



>ref|XP_005708849.1| MFS transporter, SP family, sugar:H+ symporter [Galdieria sulphuraria]
 gb|EME32329.1| MFS transporter, SP family, sugar:H+ symporter [Galdieria sulphuraria]
Length=592

 Score =   108 bits (270),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 136/212 (64%), Gaps = 9/212 (4%)
 Frame = -3

Query  845  TIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGL  666
            +  E+   +  K L +   L+ FQQITGQPSVLY+A ++F+D G    A     ++ LG+
Sbjct  384  SYSELLTPQSRKPLFVALSLVTFQQITGQPSVLYFANRLFEDTGLGFVA-----AVGLGI  438

Query  665  LKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVP---PVAVIALLLY  495
             KLIMT V+ ++VD++GRRPLLL G +GI V LF+L   ++    V    P+ V+ +  Y
Sbjct  439  WKLIMTIVSSILVDKVGRRPLLLIGSTGITVTLFVLAWLFSGNGEVSLQIPI-VLGIFCY  497

Query  494  VGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvf  315
            VG YQ+ FGPI WL++SEIFPLRVR   L+I  L+NFG N +VT  F   +E  G   +F
Sbjct  498  VGSYQIGFGPITWLVLSEIFPLRVRSASLAIGTLINFGMNLMVTSTFEWEREWFGTSGLF  557

Query  314  fifgviavvavifvffiIPETKGLTLEEIEAK  219
              F +I + ++ F++  + ETKGLTLEEIEAK
Sbjct  558  LQFALIGLFSIWFIYEKVVETKGLTLEEIEAK  589



>gb|KIZ01781.1| hypothetical protein MNEG_6180 [Monoraphidium neglectum]
Length=537

 Score =   107 bits (266),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 104/208 (50%), Positives = 143/208 (69%), Gaps = 4/208 (2%)
 Frame = -3

Query  827  QGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMT  648
            + +  + L IG+ L+LFQQITGQPSVLYYA +IF+ AGF++  +A   S+ LG  KL+MT
Sbjct  307  EARYRRPLLIGSSLMLFQQITGQPSVLYYANQIFEKAGFSSGQEAAEVSVVLGAFKLLMT  366

Query  647  GVAvvvvdrlgrrplllggvsGIAVALF----LLGSYYTFLDNVPPVAVIALLLYVGCYQ  480
             VAV  VD+LGRRPLLL GVSG+ VAL       GS       V  V+V+ALLLYVGCYQ
Sbjct  367  IVAVATVDKLGRRPLLLAGVSGMVVALLALGLAQGSGGGGGGAVAGVSVVALLLYVGCYQ  426

Query  479  LSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgv  300
            +SFGPI WL++ E+FPL VR + +++A ++N+ +N  V+ A   ++E VG    +  F  
Sbjct  427  VSFGPISWLIVGEVFPLAVRSQAIALAAVMNYASNFGVSLALPTVQEAVGLPATYLGFAG  486

Query  299  iavvavifvffiIPETKGLTLEEIEAKY  216
            + VVA++ ++  +PETKG TLEEIEA +
Sbjct  487  VGVVALLSIYLTVPETKGKTLEEIEAMW  514



>emb|CEF97100.1| NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 
3 [Ostreococcus tauri]
Length=499

 Score =   106 bits (265),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 133/210 (63%), Gaps = 9/210 (4%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
             +F+ + L+ L IG  ++LFQQ TGQPSVLYYA + F+ AG++A   A   S+ LG+ KL
Sbjct  288  HLFEKRYLRPLYIGLSVVLFQQFTGQPSVLYYANQTFEAAGWSAEDAANV-SVILGVWKL  346

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLL------GSYYTFLDNVPPVAVIALLLY  495
             MT +AV  VD LGRRPLLLGGVS + V LF L      G   T       +AVI   LY
Sbjct  347  FMTAIAVSKVDSLGRRPLLLGGVSVVTVCLFALAALNAPGEAQTVAQAQASLAVI--FLY  404

Query  494  VGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvf  315
            VG YQLSFGPI WL++ E+FP +VR   + +A L NFG+N LV+     ++E +G    +
Sbjct  405  VGAYQLSFGPIAWLLVGEVFPAKVRSAAVGLATLSNFGSNFLVSLFLPTVEETIGLRGTY  464

Query  314  fifgviavvavifvffiIPETKGLTLEEIE  225
              F  + V+AV+ ++F + ET+G TLEEIE
Sbjct  465  LGFASVGVLAVVSIYFTVVETRGKTLEEIE  494



>gb|EWM26836.1| d-xylose-proton symporter-like protein [Nannochloropsis gaditana]
Length=663

 Score =   102 bits (255),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 86/211 (41%), Positives = 136/211 (64%), Gaps = 12/211 (6%)
 Frame = -3

Query  821  KCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGV  642
            +  + L +G G++ FQQ++GQPSVLY++ +I +D G A +A     ++ +G+ KL+ T  
Sbjct  322  RYRRPLIVGLGVVTFQQVSGQPSVLYFSNEILRDFGLADSA-----TLLVGVFKLVATMG  376

Query  641  AvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDN-------VPPVAVIALLLYVGCY  483
            AV+ VDR GRR LLL G+  + +AL LL + +            +  V + A+ LY+  Y
Sbjct  377  AVLTVDRRGRRTLLLLGIGVMVLALALLSAMFAVEKEPGAKGQALDGVLIAAMFLYIAGY  436

Query  482  QLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifg  303
            Q+ FGP+ W+++SEI+P  VRG  + +AV+ NFG+N LVTFAF P++E +G    F +F 
Sbjct  437  QVGFGPVSWILVSEIYPTEVRGETVGLAVMANFGSNLLVTFAFDPVRESIGTSATFGLFL  496

Query  302  viavvavifvffiIPETKGLTLEEIEAKYLT  210
             +A+ A +FV+ ++PETKGL LE I A++ +
Sbjct  497  GVAMAAWLFVYMLLPETKGLALEMIGAQFQS  527



>gb|KEH30181.1| monosaccharide-H+ symporter [Medicago truncatula]
Length=81

 Score = 91.3 bits (225),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = -3

Query  452  MISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifv  273
            M+SEIFPLR RGRG+S+AVL NF  NA+VTFAFSP+KE +GA N+F +F  IA+V+++F+
Sbjct  1    MVSEIFPLRTRGRGISMAVLTNFAANAVVTFAFSPLKEYLGAENLFLLFAAIALVSLVFI  60

Query  272  ffiIPETKGLTLEEIEAKYL  213
               +PETKGL+LEEIE+K L
Sbjct  61   VTSVPETKGLSLEEIESKIL  80



>gb|KDD76485.1| sugar transporter [Helicosporidium sp. ATCC 50920]
Length=587

 Score = 98.2 bits (243),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 90/178 (51%), Positives = 118/178 (66%), Gaps = 5/178 (3%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            A +  +FQ +  + L  G  L+LFQQITGQPSVLYYAA IF+ AGF+++  AT  S+ LG
Sbjct  328  ADVLTLFQRQYRRPLVAGTCLMLFQQITGQPSVLYYAASIFKAAGFSSSWAATGVSLALG  387

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLL-----GSYYTFLDNVPPVAVIAL  504
              KL+MT VAVV VD LGRRPLLLGGV  +  +L LL     G        V   ++  L
Sbjct  388  NFKLLMTCVAVVTVDSLGRRPLLLGGVGALVFSLVLLWVCAGGVLPLGPSGVAWTSLGGL  447

Query  503  LLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVG  330
            LLYVG YQLSFGP+ WL++ E+FPLRVR + +++A LVNF  N +V+ A   M+ ++G
Sbjct  448  LLYVGAYQLSFGPLSWLIVGEVFPLRVRSQAIALATLVNFSANFVVSLALPIMQRVLG  505



>ref|WP_022247679.1| sugar transporter [Clostridium sp. CAG:306]
 emb|CDC20516.1| sugar transporter [Clostridium sp. CAG:306]
Length=455

 Score = 96.3 bits (238),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 81/203 (40%), Positives = 133/203 (66%), Gaps = 4/203 (2%)
 Frame = -3

Query  806  LTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvv  627
            L +G G++  Q  TG  +++YYA  IF+ +GF +   A  A+  +G++  +MT VA+   
Sbjct  246  LVVGIGIMFAQICTGINTIIYYAPTIFKISGFDSNISAIYAATGIGVVNFLMTIVAIAFT  305

Query  626  drlgrrplllggvsGIAVALFLLGSYYTFLD----NVPPVAVIALLLYVGCYQLSFGPIG  459
            D+LGR+PLL  G++G+ ++L  LG  + F D    N+  VAV +L+ Y+ C+  S GPIG
Sbjct  306  DKLGRKPLLYFGLTGVMLSLIALGCAFQFADVLGDNLKWVAVGSLITYIICFACSLGPIG  365

Query  458  WLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavi  279
            W+++SE+FPLR+RG  +S+  + NFG N LV F+F P+   +G    F++FG ++++ + 
Sbjct  366  WILVSEVFPLRIRGAAMSLCTVANFGFNFLVVFSFLPLIHRIGEACTFWMFGAVSLLCIF  425

Query  278  fvffiIPETKGLTLEEIEAKYLT  210
            FV+F +PETKG++LE IE  ++ 
Sbjct  426  FVYFCVPETKGISLETIEKNWID  448



>emb|CBJ33077.1| conserved unknown protein [Ectocarpus siliculosus]
Length=523

 Score = 95.9 bits (237),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 78/120 (65%), Gaps = 5/120 (4%)
 Frame = -3

Query  539  LDNVPPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTF  360
            LD      + A+ +Y+G YQ+ FGP+ WL+ISEIFPL VRG+ +S+AV+VNFG N LVTF
Sbjct  403  LDTQKACILAAMFVYIGGYQVGFGPVVWLIISEIFPLDVRGKAISVAVVVNFGFNLLVTF  462

Query  359  AFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAKYLT*LFLRMMHNH  180
             F  M E +G+   F IF V    ++ F+   +PETKGL+LE+IEA     LFLR    +
Sbjct  463  IFPTMLEDLGSSWTFAIFAVADAYSLYFIKTRVPETKGLSLEQIEA-----LFLRRGQRN  517



>ref|XP_009605737.1| PREDICTED: D-xylose-proton symporter-like 3, chloroplastic isoform 
X2 [Nicotiana tomentosiformis]
Length=457

 Score = 94.7 bits (234),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADA R S+ +G+ K 
Sbjct  339  EVFQGPSLKAFIIGGGLVLFQQITGQPSVLYYAGSILQSAGFSAAADAARVSVVIGVFKS  398

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQ  480
            +MT VAV+  D LGRRPLL+GGVSGIA++LFLL +YY FL + P VAV ALLLYVGCYQ
Sbjct  399  LMTAVAVLKADDLGRRPLLIGGVSGIALSLFLLSAYYKFLGSFPFVAVAALLLYVGCYQ  457


 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 45/109 (41%), Positives = 62/109 (57%), Gaps = 2/109 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  + VV GWRYM+G+S PI+++MG+GMW LP SPRW+LL AIQ KG +   +E A+ 
Sbjct  239   VGSYEINVVGGWRYMFGLSAPIALLMGLGMWSLPPSPRWLLLRAIQSKGPLQEYKEKAIG  298

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPN  802
              L +LRG   GD        +++   S K             EV + P+
Sbjct  299   ALSKLRGRPAGDKVSEKQIEDTI--ISLKTAYSDEEAEGNFLEVFQGPS  345



>ref|WP_007424295.1| MULTISPECIES: major facilitator transporter [Acidiphilium]
 gb|ABQ29692.1| sugar transporter [Acidiphilium cryptum JF-5]
 dbj|BAJ79908.1| sugar transporter [Acidiphilium multivorum AIU301]
 gb|EGO94042.1| Sugar transporter [Acidiphilium sp. PM]
 dbj|GAN73548.1| major facilitator superfamily sugar transporter [Acidiphilium 
multivorum AIU301]
Length=447

 Score = 83.2 bits (204),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 82/206 (40%), Positives = 133/206 (65%), Gaps = 2/206 (1%)
 Frame = -3

Query  833  MFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLI  654
            + + +    L +G GL +FQQITG  +V+Y+A  IFQ AG ++A+ +  A+  +GL+ ++
Sbjct  233  LLEPRARMPLIVGIGLAVFQQITGINTVIYFAPTIFQKAGLSSASVSILATAGVGLVNVV  292

Query  653  MTGVAvvvvdrlgrrplllggvsGIAVALFLL-GSYYTFLDN-VPPVAVIALLLYVGCYQ  480
            MT VA+ ++D  GRR LLL G+SG+ V L  + G +   +   +  V VI++  YV  + 
Sbjct  293  MTFVAMRLLDSAGRRRLLLVGLSGMLVTLLAVAGGFMAGMQGGLAWVTVISVAAYVAFFA  352

Query  479  LSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgv  300
            +  GP+ WL+I+EIFPL VRGRG+S+A + N+  N LV+  F  +   +G G  F I+  
Sbjct  353  IGLGPVFWLLIAEIFPLAVRGRGMSLATIANWAFNMLVSITFLDLVHGLGRGPTFLIYAA  412

Query  299  iavvavifvffiIPETKGLTLEEIEA  222
            + ++ ++F +F++PETKG +LE+IEA
Sbjct  413  MTLITLVFTWFLVPETKGRSLEQIEA  438


 Score = 35.0 bits (79),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 31/67 (46%), Gaps = 9/67 (13%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VG L      GWR+M  +     +++  GM  LP SPRW     + GKG     RE A  
Sbjct  148   VGYLFSHGGDGWRWMLALGALPGVILFAGMLVLPESPRW-----LAGKGH----REAARK  198

Query  948   CLCRLRG  928
              L  LRG
Sbjct  199   SLAFLRG  205



>ref|WP_035187416.1| major facilitator transporter [Acidiphilium sp. JA12-A1]
 gb|KDM66511.1| putative metabolite transport protein CsbC [Acidiphilium sp. 
JA12-A1]
Length=447

 Score = 83.2 bits (204),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 131/206 (64%), Gaps = 2/206 (1%)
 Frame = -3

Query  833  MFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLI  654
            + + +    L +G GL +FQQITG  +V+Y+A  IFQ AG ++A+ +  A+  +GL+ ++
Sbjct  233  LLEPRARMPLIVGIGLAVFQQITGINTVIYFAPTIFQKAGLSSASVSILATAGVGLVNVV  292

Query  653  MTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYT--FLDNVPPVAVIALLLYVGCYQ  480
            MT VA+ ++D  GRR LLL G+SG+ V L  +   +       +  V VI++  YV  + 
Sbjct  293  MTFVAMRLLDSAGRRRLLLVGLSGMLVTLLAVAGGFIAGMQGGLAWVTVISVAAYVAFFA  352

Query  479  LSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgv  300
            +  GP+ WL+I+EIFPL VRGRG+S+A + N+  N LV+  F  +   +G G  F I+  
Sbjct  353  IGLGPVFWLLIAEIFPLAVRGRGMSLATIANWAFNMLVSITFLDLVHGLGRGPTFLIYAA  412

Query  299  iavvavifvffiIPETKGLTLEEIEA  222
            + ++ ++F +F++PETKG +LE+IEA
Sbjct  413  MTLITLVFTWFLVPETKGRSLEQIEA  438


 Score = 35.0 bits (79),  Expect(2) = 1e-17, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 31/67 (46%), Gaps = 9/67 (13%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VG L      GWR+M  +     +++  GM  LP SPRW     + GKG     RE A  
Sbjct  148   VGYLFSHGGDGWRWMLALGALPGVILFAGMLVLPESPRW-----LAGKGH----REAARK  198

Query  948   CLCRLRG  928
              L  LRG
Sbjct  199   SLAFLRG  205



>gb|AES88921.2| sugar transporter [Medicago truncatula]
Length=493

 Score = 93.6 bits (231),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 60/109 (55%), Gaps = 2/109 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWR+MYG S P++++MG+GMW LP SPRW+LL A+QGKG    L+E A+ 
Sbjct  248   VGSFQISTVGGWRFMYGFSAPLAVLMGLGMWTLPESPRWLLLNAVQGKGSFQDLKEKAIV  307

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPN  802
              L +LRG   GD         S+   S K             EV + PN
Sbjct  308   SLGKLRGRPPGDKESEKQIEESL--VSLKSAYEDQESEASFLEVFQGPN  354


 Score = 83.6 bits (205),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 96/124 (77%), Gaps = 2/124 (2%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            A+  E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADA + S+ +G
Sbjct  344  ASFLEVFQGPNLKAFVIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADAAKVSVVIG  403

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            L KL+MT VAV+ VD LGRRPLL+GGVSGIA++L LL +YY FL  +P VAV ALLLY  
Sbjct  404  LFKLVMTSVAVLKVDDLGRRPLLIGGVSGIALSLVLLSAYYKFLGGLPIVAVAALLLY--  461

Query  488  CYQL  477
            C+ L
Sbjct  462  CWLL  465



>ref|XP_003606724.1| D-xylose-proton symporter-like protein [Medicago truncatula]
Length=485

 Score = 93.2 bits (230),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 60/109 (55%), Gaps = 2/109 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWR+MYG S P++++MG+GMW LP SPRW+LL A+QGKG    L+E A+ 
Sbjct  248   VGSFQISTVGGWRFMYGFSAPLAVLMGLGMWTLPESPRWLLLNAVQGKGSFQDLKEKAIV  307

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPN  802
              L +LRG   GD         S+   S K             EV + PN
Sbjct  308   SLGKLRGRPPGDKESEKQIEESL--VSLKSAYEDQESEASFLEVFQGPN  354


 Score = 83.6 bits (205),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 80/120 (67%), Positives = 94/120 (78%), Gaps = 2/120 (2%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADA + S+ +GL KL
Sbjct  348  EVFQGPNLKAFVIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADAAKVSVVIGLFKL  407

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT VAV+ VD LGRRPLL+GGVSGIA++L LL +YY FL  +P VAV ALLLY  C+ L
Sbjct  408  VMTSVAVLKVDDLGRRPLLIGGVSGIALSLVLLSAYYKFLGGLPIVAVAALLLY--CWLL  465



>ref|WP_032724722.1| MFS sugar transporter [Escherichia coli]
 gb|KDX14402.1| MFS transporter, sugar porter family protein [Escherichia coli 
2-156-04_S1_C2]
Length=460

 Score = 81.6 bits (200),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 132/206 (64%), Gaps = 1/206 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+F  +  KAL +G  + LFQQITG  ++ YYA +IF+ AG   +   +  ++ +GL+ +
Sbjct  252  ELFTPRLRKALVVGFCVALFQQITGINAIFYYAPEIFKTAGVDVSGAMSF-TVLIGLVLV  310

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            I T V++ ++D++GRR LL+ G +G+A+AL  +G  +   +    + +I +L YV  + +
Sbjct  311  ISTLVSMWIIDKVGRRSLLIFGSAGMAIALGCIGLLFRASETQTTLLLICILAYVAIFAV  370

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            S+G + +++I+EIFP+ VRG  +SIA    +G N LV+  F  + E + A N FFIF  I
Sbjct  371  SYGTVAYVIIAEIFPIHVRGIAVSIATFALWGGNFLVSRYFPVLVENISAANTFFIFSGI  430

Query  296  avvavifvffiIPETKGLTLEEIEAK  219
            +++A+ FV   +PETKG TLEEIE +
Sbjct  431  SIIALFFVLTKVPETKGKTLEEIETE  456


 Score = 35.4 bits (80),  Expect(2) = 3e-17, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 37/78 (47%), Gaps = 16/78 (21%)
 Frame = -2

Query  1098  GWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGL---------RETAVSC  946
             GWR ++   +  +IV  + + W+P SPRW+    I+   D+ GL           TA   
Sbjct  179   GWRIIFATGIAPAIVFLLLLIWVPESPRWL----IRKGRDVQGLTILRKINPDETTAREQ  234

Query  945   LCRLRGATIGDSAHHPSR  892
             L  ++ A + DS   PSR
Sbjct  235   LAAIKSALLSDS---PSR  249



>ref|WP_032717438.1| MFS sugar transporter [Escherichia coli]
 gb|KDV94173.1| MFS transporter, sugar porter family protein [Escherichia coli 
2-156-04_S1_C1]
Length=460

 Score = 81.3 bits (199),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 132/206 (64%), Gaps = 1/206 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+F  +  KAL +G  + LFQQITG  ++ YYA +IF+ AG   +   +  ++ +GL+ +
Sbjct  252  ELFTPRLRKALVVGFCVALFQQITGINAIFYYAPEIFKTAGVDVSGAMSF-TVLIGLVLV  310

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            I T V++ ++D++GRR LL+ G +G+A+AL  +G  +   +    + +I +L YV  + +
Sbjct  311  ISTLVSMWIIDKVGRRSLLIFGSAGMAIALGCIGLLFRASETQTTLLLICILAYVAIFAV  370

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            S+G + +++I+EIFP+ VRG  +SIA    +G N LV+  F  + E + A N FFIF  I
Sbjct  371  SYGTVAYVIIAEIFPIHVRGIAVSIATFALWGGNFLVSRYFPVLVENISAANTFFIFSGI  430

Query  296  avvavifvffiIPETKGLTLEEIEAK  219
            +++A+ FV   +PETKG TLEEIE +
Sbjct  431  SIIALFFVLTKVPETKGKTLEEIETE  456


 Score = 35.4 bits (80),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 37/78 (47%), Gaps = 16/78 (21%)
 Frame = -2

Query  1098  GWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGL---------RETAVSC  946
             GWR ++   +  +IV  + + W+P SPRW+    I+   D+ GL           TA   
Sbjct  179   GWRIIFATGIAPAIVFLLLLIWVPESPRWL----IRKGRDVQGLTILRKINPDETTAREQ  234

Query  945   LCRLRGATIGDSAHHPSR  892
             L  ++ A + DS   PSR
Sbjct  235   LAAIKSALLSDS---PSR  249



>ref|WP_006110627.1| sugar transporter [Natrialba asiatica]
 gb|ELY98470.1| sugar transporter [Natrialba asiatica DSM 12278]
Length=481

 Score = 80.9 bits (198),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 85/235 (36%), Positives = 145/235 (62%), Gaps = 4/235 (2%)
 Frame = -3

Query  914  IRHIIQVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaa  735
            IR   Q+D  L E++   + +   + ++FQ   +  L +G+GL +FQQ+TG  +V+YYA 
Sbjct  225  IRTEDQIDAELREITETIQSETGGLRDLFQPWIVPMLVVGSGLAIFQQVTGINAVMYYAP  284

Query  734  kifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLG  555
            +I +  GF         ++ +G++ +IMT VAV ++DR GRRPLLL G++G+   L + G
Sbjct  285  RILESTGFGDTNSILA-TVAIGVVNVIMTAVAVALIDRTGRRPLLLTGLTGMTAMLGIAG  343

Query  554  SYYTFLDNVPPVAVIA---LLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNF  384
              Y        + V+A   L+LYV  + +  GP  WL+ISEI+P+ VRG  + +  ++N+
Sbjct  344  LVYYLPGLSGGLGVLATGSLMLYVAFFAIGLGPAFWLLISEIYPMEVRGIAMGVVTVLNW  403

Query  383  GTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAK  219
              N LV+  F  + +++G    F+++G++++VA++F + ++PETKG +LEEIEA 
Sbjct  404  AANLLVSLTFLRLVDVIGQSGTFWLYGILSLVALVFCYRLVPETKGRSLEEIEAD  458


 Score = 35.8 bits (81),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 18/55 (33%), Positives = 30/55 (55%), Gaps = 9/55 (16%)
 Frame = -2

Query  1095  WRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSCLCRLR  931
             WR+M G+ +  + ++ +GM ++P SPRW+            G +ETA   L R+R
Sbjct  181   WRWMLGLGMVPAAILFVGMLFMPESPRWLY---------EQGYKETARDVLSRIR  226



>ref|WP_022187653.1| sugar transporter [Azospirillum sp. CAG:260]
 emb|CDB39512.1| sugar transporter [Azospirillum sp. CAG:260]
Length=462

 Score = 92.0 bits (227),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 85/209 (41%), Positives = 130/209 (62%), Gaps = 4/209 (2%)
 Frame = -3

Query  830  FQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIM  651
            F    L  + +G G++  Q  TG  +++YY A IFQ AGF     A  A+I +G++  +M
Sbjct  245  FARWMLMPVIVGIGMMFMQICTGINTIIYYTATIFQAAGFTDTLGALYATIGVGVVNFLM  304

Query  650  TGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLD----NVPPVAVIALLLYVGCY  483
            T VA+   DRLGR+PLL  G++GI  +LF+LG  +   D    ++  VAV ++++Y+ C+
Sbjct  305  TFVAIFFTDRLGRKPLLYAGLAGITASLFVLGGSFWLTDYLGDSLKWVAVGSIVIYIACF  364

Query  482  QLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifg  303
              S GPIGW++ISEI PL++RG  +SI  + NFG N LV   F  + E +G    F++FG
Sbjct  365  AFSLGPIGWIIISEIMPLKIRGLAMSICTMANFGFNFLVALTFPVLLEHIGEAYTFWMFG  424

Query  302  viavvavifvffiIPETKGLTLEEIEAKY  216
            ++ + ++ F F  IPETKG +LE+IE  +
Sbjct  425  LVGIFSLWFTFRYIPETKGRSLEQIEKNW  453



>gb|KIZ46811.1| MFS sugar transporter [Raoultella ornithinolytica]
Length=460

 Score = 81.3 bits (199),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 132/206 (64%), Gaps = 1/206 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+F  +  KAL +G  + LFQQITG  ++ YYA +IF+ AG   +   +  ++ +GL+ +
Sbjct  252  ELFTPRLRKALVVGFCVALFQQITGINAIFYYAPEIFKTAGVDVSGAMSF-TVLIGLVLV  310

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            I T V++ ++D++GRR LL+ G +G+A+AL  +G  +   +    + +I +L YV  + +
Sbjct  311  ISTLVSMWIIDKVGRRSLLIFGSAGMAIALGCIGLLFRASETQTTLLLICILAYVAIFAV  370

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            S+G + +++I+EIFP+ VRG  +SIA    +G N LV+  F  + E + A N FFIF  I
Sbjct  371  SYGTVAYVIIAEIFPIHVRGIAVSIATFALWGGNFLVSRYFPVLVENISAANTFFIFSGI  430

Query  296  avvavifvffiIPETKGLTLEEIEAK  219
            +++A+ FV   +PETKG TLEEIE +
Sbjct  431  SIIALFFVLTKVPETKGKTLEEIETE  456


 Score = 34.7 bits (78),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 38/75 (51%), Gaps = 10/75 (13%)
 Frame = -2

Query  1098  GWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRE------TAVSCLCR  937
             GWR ++   +  +IV  + + W+P SPRW++      +G +  LR+      TA   L  
Sbjct  179   GWRIIFATGIAPAIVFLLLLIWVPESPRWLIRKGRDAQG-LTILRKINPDETTAREQLAA  237

Query  936   LRGATIGDSAHHPSR  892
             ++ A + DS   PSR
Sbjct  238   IKSALLSDS---PSR  249



>ref|WP_044346672.1| MFS sugar transporter [Raoultella ornithinolytica]
Length=465

 Score = 81.3 bits (199),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 132/206 (64%), Gaps = 1/206 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+F  +  KAL +G  + LFQQITG  ++ YYA +IF+ AG   +   +  ++ +GL+ +
Sbjct  257  ELFTPRLRKALVVGFCVALFQQITGINAIFYYAPEIFKTAGVDVSGAMSF-TVLIGLVLV  315

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            I T V++ ++D++GRR LL+ G +G+A+AL  +G  +   +    + +I +L YV  + +
Sbjct  316  ISTLVSMWIIDKVGRRSLLIFGSAGMAIALGCIGLLFRASETQTTLLLICILAYVAIFAV  375

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            S+G + +++I+EIFP+ VRG  +SIA    +G N LV+  F  + E + A N FFIF  I
Sbjct  376  SYGTVAYVIIAEIFPIHVRGIAVSIATFALWGGNFLVSRYFPVLVENISAANTFFIFSGI  435

Query  296  avvavifvffiIPETKGLTLEEIEAK  219
            +++A+ FV   +PETKG TLEEIE +
Sbjct  436  SIIALFFVLTKVPETKGKTLEEIETE  461


 Score = 34.7 bits (78),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 38/75 (51%), Gaps = 10/75 (13%)
 Frame = -2

Query  1098  GWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRE------TAVSCLCR  937
             GWR ++   +  +IV  + + W+P SPRW++      +G +  LR+      TA   L  
Sbjct  184   GWRIIFATGIAPAIVFLLLLIWVPESPRWLIRKGRDAQG-LTILRKINPDETTAREQLAA  242

Query  936   LRGATIGDSAHHPSR  892
             ++ A + DS   PSR
Sbjct  243   IKSALLSDS---PSR  254



>ref|WP_005772424.1| major facilitator transporter [Coxiella burnetii]
 ref|NP_819388.2| D-xylose-proton symporter [Coxiella burnetii RSA 493]
 gb|ABX78561.1| D-xylose-proton symporter [Coxiella burnetii RSA 331]
 gb|EDR36245.1| D-xylose-proton symporter [Coxiella burnetii Q321]
 gb|AAO89902.2| D-xylose-proton symporter [Coxiella burnetii RSA 493]
 gb|AIT62840.1| Sugar transporter (Precursor) [Coxiella burnetii str. Namibia]
 gb|KJY14286.1| major facilitator transporter [Coxiella burnetii]
Length=463

 Score = 86.3 bits (212),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 130/206 (63%), Gaps = 3/206 (1%)
 Frame = -3

Query  833  MFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLI  654
            +F       L I  GL +FQQ+TG  +VLYYA  I +  GF A+  A  A++ +G + +I
Sbjct  244  LFSKIIRPTLFIAIGLAVFQQVTGINTVLYYAPTILKMTGFQASQTAILATMGIGAVLVI  303

Query  653  MTGVAvvvvdrlgrrplllggvsGIAVALFLLG---SYYTFLDNVPPVAVIALLLYVGCY  483
            +T +++ ++D LGRRPLL  GV  + V+L +L      +  +D +  +A  +LL+++  +
Sbjct  304  ITIISLPLIDSLGRRPLLFIGVGAMTVSLLVLSWSFKVHGHMDYMRWIAFGSLLVFISGF  363

Query  482  QLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifg  303
             +S GPI WLM SEIFPLRVRG G SI    N+ +N LVT  F  + E +G    FFI+ 
Sbjct  364  SISLGPIMWLMFSEIFPLRVRGLGASIGACTNWASNWLVTITFLTLIEYLGPSGTFFIYF  423

Query  302  viavvavifvffiIPETKGLTLEEIE  225
            +I+V+ +IF++  +PETKG+TLE+IE
Sbjct  424  IISVITLIFIYTSVPETKGVTLEQIE  449


 Score = 29.6 bits (65),  Expect(2) = 6e-17, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 9/57 (16%)
 Frame = -2

Query  1098  GWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSCLCRLRG  928
              WR M+   V  + ++ +GM  LP SPRWI            G  E A+  L +LRG
Sbjct  171   AWRSMFAAGVIPAALLLLGMIVLPYSPRWIF---------SRGHEEKALWILRKLRG  218



>ref|WP_011997243.1| major facilitator transporter [Coxiella burnetii]
 gb|ABS76630.1| D-xylose-proton symporter [Coxiella burnetii Dugway 5J108-111]
Length=463

 Score = 86.3 bits (212),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 130/206 (63%), Gaps = 3/206 (1%)
 Frame = -3

Query  833  MFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLI  654
            +F       L I  GL +FQQ+TG  +VLYYA  I +  GF A+  A  A++ +G + +I
Sbjct  244  LFSKIIRPTLFIAIGLAVFQQVTGINTVLYYAPTILKMTGFQASQTAILATMGIGAVLVI  303

Query  653  MTGVAvvvvdrlgrrplllggvsGIAVALFLLG---SYYTFLDNVPPVAVIALLLYVGCY  483
            +T +++ ++D LGRRPLL  GV  + V+L +L      +  +D +  +A  +LL+++  +
Sbjct  304  ITIISLPLIDSLGRRPLLFIGVGAMTVSLLVLSWSFKVHGHMDYMRWIAFGSLLVFISGF  363

Query  482  QLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifg  303
             +S GPI WLM SEIFPLRVRG G SI    N+ +N LVT  F  + E +G    FFI+ 
Sbjct  364  SISLGPIMWLMFSEIFPLRVRGLGASIGACTNWASNWLVTITFLTLIEYLGPSGTFFIYF  423

Query  302  viavvavifvffiIPETKGLTLEEIE  225
            +I+V+ +IF++  +PETKG+TLE+IE
Sbjct  424  IISVITLIFIYTSVPETKGVTLEQIE  449


 Score = 29.6 bits (65),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 9/57 (16%)
 Frame = -2

Query  1098  GWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSCLCRLRG  928
              WR M+   V  + ++ +GM  LP SPRWI            G  E A+  L +LRG
Sbjct  171   AWRSMFAAGVIPAALLLLGMIVLPYSPRWIF---------SRGHEEKALWILRKLRG  218



>ref|WP_032138490.1| major facilitator transporter [Coxiella burnetii]
Length=463

 Score = 86.3 bits (212),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 130/206 (63%), Gaps = 3/206 (1%)
 Frame = -3

Query  833  MFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLI  654
            +F       L I  GL +FQQ+TG  +VLYYA  I +  GF A+  A  A++ +G + +I
Sbjct  244  LFSKIIRPTLFIAIGLAVFQQVTGINTVLYYAPTILKMTGFQASQTAILATMGIGAVLVI  303

Query  653  MTGVAvvvvdrlgrrplllggvsGIAVALFLLG---SYYTFLDNVPPVAVIALLLYVGCY  483
            +T +++ ++D LGRRPLL  GV  + V+L +L      +  +D +  +A  +LL+++  +
Sbjct  304  ITIISLPLIDSLGRRPLLFIGVGAMTVSLLVLSWSFKVHGHMDYMRWIAFGSLLVFISGF  363

Query  482  QLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifg  303
             +S GPI WLM SEIFPLRVRG G SI    N+ +N LVT  F  + E +G    FFI+ 
Sbjct  364  SISLGPIMWLMFSEIFPLRVRGLGASIGACTNWASNWLVTITFLTLIEYLGPSGTFFIYF  423

Query  302  viavvavifvffiIPETKGLTLEEIE  225
            +I+V+ +IF++  +PETKG+TLE+IE
Sbjct  424  IISVITLIFIYTSVPETKGVTLEQIE  449


 Score = 29.6 bits (65),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 9/57 (16%)
 Frame = -2

Query  1098  GWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSCLCRLRG  928
              WR M+   V  + ++ +GM  LP SPRWI            G  E A+  L +LRG
Sbjct  171   AWRSMFAAGVIPAALLLLGMIVLPYSPRWIF---------SRGHEEKALWILRKLRG  218



>gb|ACJ18943.1| D-xylose-proton symporter [Coxiella burnetii CbuG_Q212]
Length=409

 Score = 86.3 bits (212),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 86/206 (42%), Positives = 130/206 (63%), Gaps = 3/206 (1%)
 Frame = -3

Query  833  MFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLI  654
            +F       L I  GL +FQQ+TG  +VLYYA  I +  GF A+  A  A++ +G + +I
Sbjct  190  LFSKIIRPTLFIAIGLAVFQQVTGINTVLYYAPTILKMTGFQASQTAILATMGIGAVLVI  249

Query  653  MTGVAvvvvdrlgrrplllggvsGIAVALFLLG---SYYTFLDNVPPVAVIALLLYVGCY  483
            +T +++ ++D LGRRPLL  GV  + V+L +L      +  +D +  +A  +LL+++  +
Sbjct  250  ITIISLPLIDSLGRRPLLFIGVGAMTVSLLVLSWSFKVHGHMDYMRWIAFGSLLVFISGF  309

Query  482  QLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifg  303
             +S GPI WLM SEIFPLRVRG G SI    N+ +N LVT  F  + E +G    FFI+ 
Sbjct  310  SISLGPIMWLMFSEIFPLRVRGLGASIGACTNWASNWLVTITFLTLIEYLGPSGTFFIYF  369

Query  302  viavvavifvffiIPETKGLTLEEIE  225
            +I+V+ +IF++  +PETKG+TLE+IE
Sbjct  370  IISVITLIFIYTSVPETKGVTLEQIE  395


 Score = 29.6 bits (65),  Expect(2) = 7e-17, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 9/57 (16%)
 Frame = -2

Query  1098  GWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSCLCRLRG  928
              WR M+   V  + ++ +GM  LP SPRWI            G  E A+  L +LRG
Sbjct  117   AWRSMFAAGVIPAALLLLGMIVLPYSPRWIF---------SRGHEEKALWILRKLRG  164



>ref|WP_005769170.1| major facilitator transporter [Coxiella burnetii]
 gb|EAX33375.1| D-xylose-proton symporter [Coxiella burnetii 'MSU Goat Q177']
Length=463

 Score = 85.9 bits (211),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 128/197 (65%), Gaps = 3/197 (2%)
 Frame = -3

Query  806  LTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvv  627
            L I  GL +FQQ+TG  +VLYYA  I +  GF A+  A  A++ +G + +I+T +++ ++
Sbjct  253  LFIAIGLAVFQQVTGINTVLYYAPTILKMTGFQASQTAILATMGIGAVLVIITIISLPLI  312

Query  626  drlgrrplllggvsGIAVALFLLG---SYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGW  456
            D LGRRPLL  GV  + V+L +L      +  +D +  +A  +LL+++  + +S GPI W
Sbjct  313  DSLGRRPLLFIGVGAMTVSLLVLSWSFKVHGHMDYMRWIAFGSLLVFISGFSISLGPIMW  372

Query  455  LMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavif  276
            LM SEIFPLRVRG G SI    N+ +N LVT  F  + E +G    FFI+ +I+V+ +IF
Sbjct  373  LMFSEIFPLRVRGLGASIGACTNWASNWLVTITFLTLIEYLGPSGTFFIYFIISVITLIF  432

Query  275  vffiIPETKGLTLEEIE  225
            ++  +PETKG+TLE+IE
Sbjct  433  IYTSVPETKGVTLEQIE  449


 Score = 29.6 bits (65),  Expect(2) = 8e-17, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 9/57 (16%)
 Frame = -2

Query  1098  GWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSCLCRLRG  928
              WR M+   V  + ++ +GM  LP SPRWI            G  E A+  L +LRG
Sbjct  171   AWRSMFAAGVIPAALLLLGMIVLPYSPRWIF---------SRGHEEKALWILRKLRG  218



>ref|WP_004861850.1| sugar porter (SP) family MFS transporter [Klebsiella oxytoca]
 gb|EHT09670.1| sugar porter (SP) family MFS transporter [Klebsiella oxytoca 
10-5246]
Length=460

 Score = 80.5 bits (197),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 131/206 (64%), Gaps = 1/206 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+F  +  KAL +G  + LFQQITG  ++ YYA +IF+ AG   +   +  ++ +GL+ +
Sbjct  252  ELFTPRLRKALVVGFCVALFQQITGINAIFYYAPEIFKTAGVDVSGAMSF-TVLIGLVLV  310

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            I T V++ ++D++GRR LL+ G  G+A+AL  +G  +   +    + +I +L YV  + +
Sbjct  311  ISTLVSMWIIDKVGRRSLLIFGSVGMAIALGSIGLLFRASETQTTLLLICILAYVAIFAV  370

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            S+G + +++I+EIFP+ VRG  +SIA    +G N LV+  F  + E + A N FFIF  I
Sbjct  371  SYGTVAYVIIAEIFPIHVRGIAVSIATFALWGGNFLVSRYFPVLVENISAANTFFIFSGI  430

Query  296  avvavifvffiIPETKGLTLEEIEAK  219
            +++A+ FV   +PETKG TLEEIE +
Sbjct  431  SIIALFFVLTKVPETKGKTLEEIETE  456


 Score = 35.0 bits (79),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 38/75 (51%), Gaps = 10/75 (13%)
 Frame = -2

Query  1098  GWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRE------TAVSCLCR  937
             GWR ++   +  +IV  + + W+P SPRW++      +G +  LR+      TA   L  
Sbjct  179   GWRIIFATGIAPAIVFLLLLIWVPESPRWLIRKGRDAQG-LTILRKINPDETTAREQLAA  237

Query  936   LRGATIGDSAHHPSR  892
             ++ A + DS   PSR
Sbjct  238   IKSALLSDS---PSR  249



>gb|ACJ19821.1| D-xylose-proton symporter [Coxiella burnetii CbuK_Q154]
Length=409

 Score = 85.9 bits (211),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 85/197 (43%), Positives = 128/197 (65%), Gaps = 3/197 (2%)
 Frame = -3

Query  806  LTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvv  627
            L I  GL +FQQ+TG  +VLYYA  I +  GF A+  A  A++ +G + +I+T +++ ++
Sbjct  199  LFIAIGLAVFQQVTGINTVLYYAPTILKMTGFQASQTAILATMGIGAVLVIITIISLPLI  258

Query  626  drlgrrplllggvsGIAVALFLLG---SYYTFLDNVPPVAVIALLLYVGCYQLSFGPIGW  456
            D LGRRPLL  GV  + V+L +L      +  +D +  +A  +LL+++  + +S GPI W
Sbjct  259  DSLGRRPLLFIGVGAMTVSLLVLSWSFKVHGHMDYMRWIAFGSLLVFISGFSISLGPIMW  318

Query  455  LMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavif  276
            LM SEIFPLRVRG G SI    N+ +N LVT  F  + E +G    FFI+ +I+V+ +IF
Sbjct  319  LMFSEIFPLRVRGLGASIGACTNWASNWLVTITFLTLIEYLGPSGTFFIYFIISVITLIF  378

Query  275  vffiIPETKGLTLEEIE  225
            ++  +PETKG+TLE+IE
Sbjct  379  IYTSVPETKGVTLEQIE  395


 Score = 29.6 bits (65),  Expect(2) = 9e-17, Method: Compositional matrix adjust.
 Identities = 20/57 (35%), Positives = 27/57 (47%), Gaps = 9/57 (16%)
 Frame = -2

Query  1098  GWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSCLCRLRG  928
              WR M+   V  + ++ +GM  LP SPRWI            G  E A+  L +LRG
Sbjct  117   AWRSMFAAGVIPAALLLLGMIVLPYSPRWIF---------SRGHEEKALWILRKLRG  164



>ref|XP_009036253.1| general sugar transporter [Aureococcus anophagefferens]
 gb|EGB09136.1| general sugar transporter [Aureococcus anophagefferens]
Length=498

 Score = 91.3 bits (225),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 92/218 (42%), Positives = 131/218 (60%), Gaps = 19/218 (9%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
             +   K  +ALT G G++L QQ+TGQPSVLYYA+ IF  AG    A     ++F+G+ KL
Sbjct  262  SLLDAKYRRALTAGLGVVLLQQLTGQPSVLYYASTIFDAAGIGTVA-----TVFVGVFKL  316

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLD-----NVPPVAVIALL-LY  495
              T  AVV VDR GRR LL  GV  + +AL  L   +   D     +    A++ L+ +Y
Sbjct  317  FATLFAVVTVDRRGRRELLFVGVGSMFLALAALALAFYDFDPSGGFSAQKGAIVGLIFVY  376

Query  494  VGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAF----SPMKELVGA  327
            +  YQ+ FGPI WL+ISE+FPL VRG+ +++AV  NF +N LV+F F    + +K L+G+
Sbjct  377  IAGYQVGFGPIAWLLISEVFPLEVRGQAVALAVQANFASNMLVSFLFPVAQTGLKALLGS  436

Query  326  GNvffif----gviavvavifvffiIPETKGLTLEEIE  225
                 +      V+ + A+ F+   +PETKG+TLEEIE
Sbjct  437  TWYLTVLFGIFAVLDLYALHFINRNVPETKGMTLEEIE  474



>ref|WP_034935483.1| hypothetical protein [Erwinia mallotivora]
 gb|EXU76216.1| hypothetical protein BG55_06355 [Erwinia mallotivora]
Length=488

 Score = 82.8 bits (203),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 77/202 (38%), Positives = 129/202 (64%), Gaps = 10/202 (5%)
 Frame = -3

Query  800  IGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdr  621
            IG  L +FQQ  G   VLYYA ++F+  G +      + +I +G++ L+ T +A+  VD+
Sbjct  278  IGVMLSVFQQFVGINVVLYYAPEVFRTVGSSTDVALLQ-TIIVGVINLLFTTIAIATVDK  336

Query  620  lgrrplllggvsGIAVALFLLGS-YYTFLDNVPPVAVIALLLYVGCYQLSFGPIGWLMIS  444
             GR+PL + G  G+AV +F LGS +Y+ L   P VA+ A+L YV  + +S+GP+ W++++
Sbjct  337  FGRKPLQIIGALGMAVGMFTLGSAFYSKLS--PTVALAAMLFYVAAFAISWGPVCWVLLA  394

Query  443  EIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKE------LVGAGNvffifgviavvav  282
            EIFP R+R + +S+AV   +  N LV++ F  M +          G  ++++GV+A++A 
Sbjct  395  EIFPNRIRSKAMSVAVAAQWIANYLVSWTFPMMDKNSYLNAHFNNGFAYWMYGVMALLAA  454

Query  281  ifvffiIPETKGLTLEEIEAKY  216
            +F++  +PETKG TLEE+EA++
Sbjct  455  LFMWKYVPETKGRTLEELEAQW  476


 Score = 32.0 bits (71),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 31/63 (49%), Gaps = 9/63 (14%)
 Frame = -2

Query  1098  GWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSCLCRLRGATI  919
             GWRYM+  +   S++  I ++ +P SPRW+            G+ + A + L +L G   
Sbjct  196   GWRYMFLSAALPSLLFFILLFTVPESPRWL---------AAKGMTQQAAAVLEKLSGKLR  246

Query  918   GDS  910
             G S
Sbjct  247   GMS  249



>ref|WP_025318950.1| major facilitator transporter [Granulibacter bethesdensis]
 gb|AHJ68933.1| hypothetical protein GbCGDNIH2_1264 [Granulibacter bethesdensis 
CGDNIH2]
Length=448

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 79/199 (40%), Positives = 126/199 (63%), Gaps = 5/199 (3%)
 Frame = -3

Query  806  LTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvv  627
            L IG GL + QQ+TG  +V+Y+  +IF  AG    + +  A++ +G++ + MT +A+ ++
Sbjct  244  LVIGVGLAVLQQVTGINTVIYFGPQIFSAAGIGDHSASILANVLIGVVNVGMTIIAMRLM  303

Query  626  drlgrrplllggvsGIAVALFLLGSYYTFLDNVPP-----VAVIALLLYVGCYQLSFGPI  462
            DR GRR LL+ G+ G+ + L LL   +    + P      +A+ AL +Y+  + +  GP+
Sbjct  304  DRAGRRSLLINGLLGMTIGLLLLAFGFWIGTSGPGGASAWIAIAALSIYIAAFAIGMGPV  363

Query  461  GWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvav  282
             WL+ISEIFPL  RGRG+++A +VN+G+NA+V + F PM   VG  + F IF  ++V++V
Sbjct  364  FWLIISEIFPLHARGRGMAVATVVNWGSNAIVAYTFLPMLNSVGIISTFLIFAFMSVLSV  423

Query  281  ifvffiIPETKGLTLEEIE  225
             F    +PET G TLE+IE
Sbjct  424  FFTIRFVPETTGQTLEDIE  442



>ref|WP_006826745.1| sugar transporter [Natrialba taiwanensis]
 gb|ELY88310.1| sugar transporter [Natrialba taiwanensis DSM 12281]
Length=481

 Score = 80.5 bits (197),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 84/235 (36%), Positives = 145/235 (62%), Gaps = 4/235 (2%)
 Frame = -3

Query  914  IRHIIQVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaa  735
            IR   Q+D  L E++   + +   + ++FQ   +  L +G+GL +FQQ+TG  +V+YYA 
Sbjct  225  IRTEGQIDAELREITETIQSETGGLRDLFQPWIVPMLVVGSGLAIFQQVTGINAVMYYAP  284

Query  734  kifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLG  555
            +I +  GF         ++ +G++ +IMT VAV ++DR GRRPLLL G++G+   L + G
Sbjct  285  RILESTGFGDTNSILA-TVAIGVVNVIMTAVAVALIDRTGRRPLLLTGLAGMTATLGIAG  343

Query  554  SYYTFLDNVPPVAVIA---LLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNF  384
              Y        + V+A   L+LYV  + +  GP  WL+ISEI+P+ VRG  + +  ++N+
Sbjct  344  LVYYLPGLSGGLGVLATGSLMLYVAFFAIGLGPAFWLLISEIYPMEVRGIAMGVVTVLNW  403

Query  383  GTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAK  219
              N L++  F  + +++G    F+++G++++VA++F + ++PETKG +LEEIEA 
Sbjct  404  AANLLISLTFLRLVDVIGQSGTFWLYGILSLVALVFCYRLVPETKGRSLEEIEAD  458


 Score = 34.7 bits (78),  Expect(2) = 1e-16, Method: Compositional matrix adjust.
 Identities = 19/55 (35%), Positives = 30/55 (55%), Gaps = 9/55 (16%)
 Frame = -2

Query  1095  WRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSCLCRLR  931
             WR+M G+ +  + ++ +GM ++P SPRW     +   GD     ETA   L R+R
Sbjct  181   WRWMLGLGMVPAAILFVGMLFMPESPRW-----LYEHGD----EETARDVLSRIR  226



>gb|KDO66624.1| hypothetical protein CISIN_1g008624mg [Citrus sinensis]
Length=496

 Score = 90.9 bits (224),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 62/109 (57%), Gaps = 2/109 (2%)
 Frame = -2

Query  1128  VGSLMVEVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVS  949
             VGS  +  V GWRYMYG+S P++++MGIGMW LP SPRW+LL A+QGKG +   +E A+S
Sbjct  251   VGSFQINAVGGWRYMYGLSAPLALLMGIGMWSLPPSPRWLLLRAVQGKGSLQEYKEQAIS  310

Query  948   CLCRLRGATIGDSAHHPSR*NSV*AFSFK*RKRGHNRRNVSREVLESPN  802
              L +LR    GD        +++   S K             EV + PN
Sbjct  311   ALGKLRRRPPGDKLSERQIEDTL--VSLKSSYTDEKSEGSFLEVFQGPN  357


 Score = 78.2 bits (191),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 103/136 (76%), Gaps = 4/136 (3%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+FQG  LKA  IG GL+LFQQITGQPSVLYYA  I Q AGF+AAADATR S+ +G+ KL
Sbjct  351  EVFQGPNLKAFIIGGGLVLFQQITGQPSVLYYAGPILQSAGFSAAADATRVSVVIGVFKL  410

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            +MT +AV  VD LGRRPLL+GGV GIA++L LL +YY  L   P VAV ALLLYVGCYQ 
Sbjct  411  VMTWIAVAKVDDLGRRPLLIGGVCGIALSLLLLSAYYKILGGFPLVAVSALLLYVGCYQA  470

Query  476  SFGPIGWLM--ISEIF  435
            S   I WL+  ++E+F
Sbjct  471  SI--IFWLLAKVTELF  484



>ref|WP_015842962.1| MFS transporter [Paenibacillus sp. JDR-2]
 gb|ACT00016.1| sugar transporter [Paenibacillus sp. JDR-2]
Length=457

 Score = 80.1 bits (196),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 74/211 (35%), Positives = 131/211 (62%), Gaps = 1/211 (0%)
 Frame = -3

Query  848  ATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLG  669
            +++ E+F+     AL +G  L + QQ+TG  +V+YYA +IF+  G    +   + +I +G
Sbjct  246  SSLKEIFRPGIRLALIVGVVLAVLQQVTGINAVMYYAPEIFKSMGSGTDSSLLQ-TILIG  304

Query  668  LLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVG  489
            L+  + T +A+ ++D++GR+ LLL G S + + L ++G  +        + +I +L+YV 
Sbjct  305  LVNFLFTILAIWLIDKVGRKVLLLVGSSVMTICLAVIGIAFHTGHTTGSLVLIFILIYVA  364

Query  488  CYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffi  309
             + +S GP+ W+++SEIFP RVRGR  +IA +  +  + +V+ +F PM E  G    F+I
Sbjct  365  AFAVSLGPVVWVVLSEIFPNRVRGRATAIASMALWIADYVVSQSFPPMLESAGPSVTFWI  424

Query  308  fgviavvavifvffiIPETKGLTLEEIEAKY  216
            FG ++++  +F   ++PETKG +LEEIEA +
Sbjct  425  FGAMSLITFLFTMRVVPETKGKSLEEIEASW  455


 Score = 34.3 bits (77),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 16/61 (26%), Positives = 31/61 (51%), Gaps = 9/61 (15%)
 Frame = -2

Query  1110  EVVAGWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSCLCRLR  931
             ++   WR+M+G+ V   ++  + ++ +P SPRW++           G  E A+  L R+ 
Sbjct  174   DIANAWRWMFGIGVVPGVIFFVLLFLVPESPRWLI---------KQGRSEQALHILLRIH  224

Query  930   G  928
             G
Sbjct  225   G  225



>ref|WP_015584353.1| sugar transporter [Raoultella ornithinolytica]
 gb|AGJ85986.1| sugar transporter [Raoultella ornithinolytica B6]
Length=460

 Score = 81.3 bits (199),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 81/206 (39%), Positives = 132/206 (64%), Gaps = 1/206 (0%)
 Frame = -3

Query  836  EMFQGKCLKALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKL  657
            E+F  +  KAL +G  + LFQQITG  ++ YYA +IF+ AG   +   +  ++ +GL+ +
Sbjct  252  ELFTPRLRKALVVGFCVALFQQITGINAIFYYAPEIFKTAGVDVSGAMSF-TVLIGLVLV  310

Query  656  IMTGVAvvvvdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIALLLYVGCYQL  477
            I T V++ ++D++GRR LL+ G +G+A+AL  +G  +   +    + +I +L YV  + +
Sbjct  311  ISTLVSMWIIDKVGRRSLLIFGSAGMAIALGCIGLLFRASETQTTLLLICILAYVAIFAV  370

Query  476  SFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgvi  297
            S+G + +++I+EIFP+ VRG  +SIA    +G N LV+  F  + E + A N FFIF  I
Sbjct  371  SYGTVAYVIIAEIFPIHVRGIAVSIATFALWGGNFLVSRYFPVLVENISAANTFFIFSGI  430

Query  296  avvavifvffiIPETKGLTLEEIEAK  219
            +++A+ FV   +PETKG TLEEIE +
Sbjct  431  SIIALFFVLTKVPETKGKTLEEIETE  456


 Score = 33.1 bits (74),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 10/75 (13%)
 Frame = -2

Query  1098  GWRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRE------TAVSCLCR  937
             GWR ++   +  +I   + + W+P SPRW++      +G +  LR+      TA   L  
Sbjct  179   GWRIIFATGIAPAIAFLLLLIWVPESPRWLIRKGRDAQG-LTILRKINPDETTAREQLAA  237

Query  936   LRGATIGDSAHHPSR  892
             ++ A + DS   PSR
Sbjct  238   IKSALLSDS---PSR  249



>ref|XP_005783754.1| hypothetical protein EMIHUDRAFT_232111 [Emiliania huxleyi CCMP1516]
 gb|EOD31325.1| hypothetical protein EMIHUDRAFT_232111 [Emiliania huxleyi CCMP1516]
Length=502

 Score = 90.5 bits (223),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 74/109 (68%), Gaps = 7/109 (6%)
 Frame = -3

Query  527  PPVAVIALLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSP  348
            PPV V AL+LYV  YQ+ FGPI WL+ISE+FP++ R R LS+AV VNFG N LVTF  SP
Sbjct  391  PPVVVFALMLYVCGYQVGFGPIAWLIISEVFPIKTRTRALSMAVTVNFGFNLLVTFLLSP  450

Query  347  MKELV-------GAGNvffifgviavvavifvffiIPETKGLTLEEIEA  222
            ++  +       G+  +F I+  + +V+  FV   +PETKG +LE+IEA
Sbjct  451  LQTALDALSPGKGSSYLFAIYAALCLVSSTFVHACVPETKGKSLEQIEA  499



>ref|WP_006665058.1| sugar transporter [Natrialba aegyptia]
 gb|ELZ06923.1| sugar transporter [Natrialba aegyptia DSM 13077]
Length=481

 Score = 78.6 bits (192),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 83/235 (35%), Positives = 144/235 (61%), Gaps = 4/235 (2%)
 Frame = -3

Query  914  IRHIIQVDeilselshlseekEATIGEMFQGKCLKALTIGAGLILFQQITGQPSVLYYaa  735
            IR   Q+D  L E++   + +   + ++FQ   +  L +G+GL +FQQ+TG  +V+YYA 
Sbjct  225  IRTEGQIDAELREITETIQSETGGLRDLFQPWIVPMLVVGSGLAIFQQVTGINAVMYYAP  284

Query  734  kifqdagfaaaadatrASIFLGLLKLIMTGVAvvvvdrlgrrplllggvsGIAVALFLLG  555
            +I +  GF         ++ +G++ +IMT VAV ++DR GRRPLLL G++G+   L + G
Sbjct  285  RILESTGFGDTNSILA-TVAIGVVNVIMTAVAVALIDRTGRRPLLLTGLAGMTATLGIAG  343

Query  554  SYYTFLDNVPPVAVIA---LLLYVGCYQLSFGPIGWLMISEIFPLRVRGRGLSIAVLVNF  384
              Y        + V+A   L+LYV  + +  GP  WL+ISEI+P+ VRG  + +  ++N+
Sbjct  344  LVYYLPGLSGGLGVLATGSLMLYVAFFAIGLGPAFWLLISEIYPMEVRGIAMGVVTVLNW  403

Query  383  GTNALVTFAFSPMKELVGAGNvffifgviavvavifvffiIPETKGLTLEEIEAK  219
              N LV+  F  + +++     F+++G+++++A++F + ++PETKG +LEEIEA 
Sbjct  404  AANLLVSLTFLRLVDIISESGTFWLYGILSLIALVFCYRLVPETKGRSLEEIEAD  458


 Score = 35.4 bits (80),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 30/55 (55%), Gaps = 9/55 (16%)
 Frame = -2

Query  1095  WRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSCLCRLR  931
             WR+M G+ +  + ++ IGM ++P SPRW     +   GD     ETA   L R+R
Sbjct  181   WRWMLGLGMVPAAILFIGMLFMPESPRW-----LYEHGD----EETARDVLSRIR  226



>ref|WP_011631971.1| major facilitator transporter [Granulibacter bethesdensis]
 gb|ABI62162.1| sugar-proton symporter [Granulibacter bethesdensis CGDNIH1]
Length=448

 Score = 89.4 bits (220),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 126/199 (63%), Gaps = 5/199 (3%)
 Frame = -3

Query  806  LTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvv  627
            L IG GL + QQ+TG  +V+Y+  +IF  AG    + +  A++ +G++ + MT +A+ ++
Sbjct  244  LVIGVGLAVLQQVTGINTVIYFGPQIFSAAGIGDHSASILANVLIGVVNVGMTIIAMRLM  303

Query  626  drlgrrplllggvsGIAVALFLLGSYYTFLDNVPP-----VAVIALLLYVGCYQLSFGPI  462
            DR GRR LL+ G+ G+ + L LL   +    + P      +A+ AL +Y+  + +  GP+
Sbjct  304  DRAGRRSLLINGLLGMTIGLLLLAFGFWIGTSGPGGASAWIAIAALSIYIAAFAIGMGPV  363

Query  461  GWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvav  282
             WL+ISEIFPL  RGRG+++A + N+G+NA+V + F PM   VG  + F IF +++VV++
Sbjct  364  FWLIISEIFPLHARGRGMAVATVANWGSNAIVAYTFLPMLNSVGIISTFLIFALMSVVSI  423

Query  281  ifvffiIPETKGLTLEEIE  225
             F    +PET G TLE+IE
Sbjct  424  FFTIRFVPETTGQTLEDIE  442



>ref|WP_020694258.1| hypothetical protein [Reyranella massiliensis]
Length=459

 Score = 76.3 bits (186),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 83/201 (41%), Positives = 122/201 (61%), Gaps = 1/201 (0%)
 Frame = -3

Query  809  ALTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvv  630
            AL +G GL   QQ++G  +V+YYA +IF  AGF +    T A++ +G + ++ T VA+ +
Sbjct  240  ALIVGTGLFFLQQLSGINAVIYYAPEIFSHAGFDSVRTQTLATVGVGAVNVLTTIVAMFL  299

Query  629  vdrlgrrplllggvsGIAVALFLLGSYYTFLDNVPPVAVIA-LLLYVGCYQLSFGPIGWL  453
            +DR+GRRPLL+ G  G A  + ++     F   VP   +IA LLLY+  + ++ GP+  L
Sbjct  300  IDRIGRRPLLVIGFFGTAFTMLVIAVGVIFPQAVPSWIIIAMLLLYIASFAIAVGPLPHL  359

Query  452  MISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvavifv  273
            ++SEIFPLRVRG G+S+A L N+G N LV FAF  M    G    F +F VI +  + F 
Sbjct  360  LMSEIFPLRVRGPGMSMASLSNWGFNFLVVFAFPLMLAGPGLAFTFTVFAVICLGGIAFT  419

Query  272  ffiIPETKGLTLEEIEAKYLT  210
               +PET G +LE IE   ++
Sbjct  420  LTRVPETTGHSLEAIEKHLMS  440


 Score = 37.4 bits (85),  Expect(2) = 3e-16, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 30/56 (54%), Gaps = 9/56 (16%)
 Frame = -2

Query  1095  WRYMYGVSVPISIVMGIGMWWLPASPRWILLCAIQGKGDMPGLRETAVSCLCRLRG  928
             WR M+G+ V    +  IG+ +LP SPRW++L          G  E A + L RLRG
Sbjct  157   WRVMFGLGVVPGALFLIGLIFLPESPRWLVL---------KGFPEKARAGLIRLRG  203



>ref|WP_025286678.1| major facilitator transporter [Granulibacter bethesdensis]
 gb|AHJ63069.1| hypothetical protein GbCGDNIH3_1264 [Granulibacter bethesdensis 
CGDNIH3]
Length=448

 Score = 89.4 bits (220),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 78/199 (39%), Positives = 126/199 (63%), Gaps = 5/199 (3%)
 Frame = -3

Query  806  LTIGAGLILFQQITGQPSVLYYaakifqdagfaaaadatrASIFLGLLKLIMTGVAvvvv  627
            L IG GL + QQ+TG  +V+Y+  +IF  AG    + +  A++ +G++ + MT +A+ ++
Sbjct  244  LVIGVGLAVLQQVTGINTVIYFGPQIFSAAGIGDHSASILANVLIGVVNVGMTIIAMRLM  303

Query  626  drlgrrplllggvsGIAVALFLLGSYYTFLDNVPP-----VAVIALLLYVGCYQLSFGPI  462
            DR GRR LL+ G+ G+ + L LL   +    + P      +A+ AL +Y+  + +  GP+
Sbjct  304  DRAGRRSLLINGLLGMTIGLLLLAFGFWIGTSGPGGASAWIAIAALSIYIAAFAIGMGPV  363

Query  461  GWLMISEIFPLRVRGRGLSIAVLVNFGTNALVTFAFSPMKELVGAGNvffifgviavvav  282
             WL+ISEIFPL  RGRG+++A + N+G+NA+V + F PM   VG  + F IF +++VV++
Sbjct  364  FWLIISEIFPLHARGRGMAVATVANWGSNAIVAYTFLPMLNSVGIISTFLIFALMSVVSI  423

Query  281  ifvffiIPETKGLTLEEIE  225
             F    +PET G TLE+IE
Sbjct  424  FFTIRFVPETTGQTLEDIE  442



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3045518397000