BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2716

Length=1348
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009590611.1|  PREDICTED: tobamovirus multiplication protei...    405   5e-136   Nicotiana tomentosiformis
ref|XP_009788106.1|  PREDICTED: tobamovirus multiplication protei...    404   8e-136   Nicotiana sylvestris
ref|XP_004245872.1|  PREDICTED: tobamovirus multiplication protei...    397   8e-133   Solanum lycopersicum
ref|XP_006358577.1|  PREDICTED: tobamovirus multiplication protei...    394   1e-131   Solanum tuberosum [potatoes]
gb|AIX10945.1|  putative tetraspanin family protein                     390   3e-130   Gardenia jasminoides
ref|XP_011070225.1|  PREDICTED: tobamovirus multiplication protei...    375   2e-124   Sesamum indicum [beniseed]
gb|KHG01123.1|  hypothetical protein F383_00667                         369   3e-122   Gossypium arboreum [tree cotton]
gb|KJB37690.1|  hypothetical protein B456_006G215600                    367   2e-121   Gossypium raimondii
gb|KHG08208.1|  Tetraspanin-33                                          366   6e-121   Gossypium arboreum [tree cotton]
gb|KJB25374.1|  hypothetical protein B456_004G188200                    365   2e-120   Gossypium raimondii
gb|EYU33039.1|  hypothetical protein MIMGU_mgv1a011319mg                365   2e-120   Erythranthe guttata [common monkey flower]
gb|AFK40219.1|  unknown                                                 363   6e-120   Lotus japonicus
ref|XP_002527636.1|  conserved hypothetical protein                     363   7e-120   Ricinus communis
ref|XP_006485406.1|  PREDICTED: tobamovirus multiplication protei...    363   1e-119   Citrus sinensis [apfelsine]
gb|EYU33040.1|  hypothetical protein MIMGU_mgv1a011318mg                361   6e-119   Erythranthe guttata [common monkey flower]
ref|XP_007039575.1|  Tobamovirus multiplication 2A isoform 1            358   8e-118   Theobroma cacao [chocolate]
ref|XP_006385612.1|  GMFP4 family protein                               357   2e-117   Populus trichocarpa [western balsam poplar]
ref|XP_011028243.1|  PREDICTED: tobamovirus multiplication protei...    356   4e-117   Populus euphratica
gb|KJB51694.1|  hypothetical protein B456_008G228700                    356   6e-117   Gossypium raimondii
ref|XP_011018623.1|  PREDICTED: tobamovirus multiplication protei...    354   3e-116   Populus euphratica
ref|XP_012074239.1|  PREDICTED: tobamovirus multiplication protei...    353   9e-116   Jatropha curcas
ref|XP_010269960.1|  PREDICTED: tobamovirus multiplication protei...    351   4e-115   Nelumbo nucifera [Indian lotus]
ref|XP_003524459.1|  PREDICTED: tobamovirus multiplication protei...    351   5e-115   
ref|XP_002279170.2|  PREDICTED: tobamovirus multiplication protei...    350   2e-114   Vitis vinifera
ref|XP_006368443.1|  GMFP4 family protein                               349   2e-114   Populus trichocarpa [western balsam poplar]
ref|XP_003517379.1|  PREDICTED: tobamovirus multiplication protei...    348   6e-114   Glycine max [soybeans]
gb|KHN42626.1|  hypothetical protein glysoja_018869                     348   9e-114   Glycine soja [wild soybean]
gb|KEH31557.1|  tetraspanin family protein                              347   2e-113   Medicago truncatula
ref|NP_001240069.1|  uncharacterized protein LOC100793680               346   3e-113   Glycine max [soybeans]
gb|ACU24289.1|  unknown                                                 345   1e-112   Glycine max [soybeans]
ref|XP_008465936.1|  PREDICTED: tobamovirus multiplication protei...    342   2e-111   Cucumis melo [Oriental melon]
ref|XP_009397919.1|  PREDICTED: tobamovirus multiplication protei...    341   6e-111   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP12960.1|  unnamed protein product                                338   8e-111   Coffea canephora [robusta coffee]
ref|XP_003539155.1|  PREDICTED: tobamovirus multiplication protei...    340   2e-110   Glycine max [soybeans]
ref|XP_010275310.1|  PREDICTED: tobamovirus multiplication protei...    339   3e-110   Nelumbo nucifera [Indian lotus]
ref|XP_004148498.1|  PREDICTED: tobamovirus multiplication protei...    338   6e-110   Cucumis sativus [cucumbers]
ref|XP_006415200.1|  hypothetical protein EUTSA_v10008423mg             338   7e-110   Eutrema salsugineum [saltwater cress]
ref|XP_003611447.1|  GMFP4                                              337   2e-109   Medicago truncatula
gb|EPS67767.1|  hypothetical protein M569_07007                         335   7e-109   Genlisea aurea
ref|NP_564399.1|  tobamovirus multiplication 2A protein                 334   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007156640.1|  hypothetical protein PHAVU_002G005000g             333   5e-108   Phaseolus vulgaris [French bean]
ref|XP_004509001.1|  PREDICTED: tetraspanin-20-like isoform X1          333   5e-108   Cicer arietinum [garbanzo]
ref|XP_010055355.1|  PREDICTED: tobamovirus multiplication protei...    332   2e-107   Eucalyptus grandis [rose gum]
ref|XP_006305496.1|  hypothetical protein CARUB_v10009959mg             332   2e-107   Capsella rubella
ref|XP_003611445.1|  GMFP4                                              332   2e-107   
ref|XP_002893721.1|  hypothetical protein ARALYDRAFT_473428             331   4e-107   
emb|CDY48874.1|  BnaA05g35820D                                          333   5e-107   Brassica napus [oilseed rape]
ref|XP_009151428.1|  PREDICTED: tobamovirus multiplication protei...    330   8e-107   Brassica rapa
ref|XP_007156638.1|  hypothetical protein PHAVU_002G004900g             330   8e-107   Phaseolus vulgaris [French bean]
emb|CDY32286.1|  BnaC05g28640D                                          333   8e-107   Brassica napus [oilseed rape]
ref|XP_010677296.1|  PREDICTED: tobamovirus multiplication protei...    330   8e-107   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010499788.1|  PREDICTED: tobamovirus multiplication protei...    330   9e-107   Camelina sativa [gold-of-pleasure]
ref|XP_007156641.1|  hypothetical protein PHAVU_002G005100g             329   2e-106   Phaseolus vulgaris [French bean]
ref|XP_010461064.1|  PREDICTED: tobamovirus multiplication protei...    329   2e-106   Camelina sativa [gold-of-pleasure]
ref|XP_010518876.1|  PREDICTED: tobamovirus multiplication protei...    328   3e-106   Tarenaya hassleriana [spider flower]
ref|XP_007209447.1|  hypothetical protein PRUPE_ppa009704mg             328   3e-106   Prunus persica
ref|XP_009345636.1|  PREDICTED: tobamovirus multiplication protei...    328   3e-106   Pyrus x bretschneideri [bai li]
ref|XP_004511769.1|  PREDICTED: tetraspanin-20-like isoform X1          328   3e-106   Cicer arietinum [garbanzo]
ref|XP_010478663.1|  PREDICTED: tobamovirus multiplication protei...    327   2e-105   Camelina sativa [gold-of-pleasure]
ref|XP_009114889.1|  PREDICTED: tobamovirus multiplication protei...    325   5e-105   Brassica rapa
emb|CDX93836.1|  BnaA09g24360D                                          325   6e-105   
ref|XP_009385932.1|  PREDICTED: tobamovirus multiplication protei...    324   1e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006305495.1|  hypothetical protein CARUB_v10009959mg             323   2e-104   
ref|XP_008238361.1|  PREDICTED: tobamovirus multiplication protei...    323   4e-104   Prunus mume [ume]
ref|XP_009398578.1|  PREDICTED: tobamovirus multiplication protei...    322   1e-103   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY01278.1|  BnaC05g24540D                                          320   6e-103   
ref|XP_010919853.1|  PREDICTED: tobamovirus multiplication protei...    320   7e-103   Elaeis guineensis
gb|AAF81337.1|AC007767_17  Contains similarity to GMFP4 from Glyc...    318   8e-103   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010104372.1|  hypothetical protein L484_023325                   317   3e-102   
gb|KJB51696.1|  hypothetical protein B456_008G228700                    314   2e-101   Gossypium raimondii
ref|XP_008784675.1|  PREDICTED: tobamovirus multiplication protei...    315   7e-101   Phoenix dactylifera
ref|XP_010538377.1|  PREDICTED: tobamovirus multiplication protei...    315   8e-101   Tarenaya hassleriana [spider flower]
gb|AFK47448.1|  unknown                                                 309   2e-99    Medicago truncatula
ref|XP_003611446.1|  GMFP4                                              309   2e-99    
ref|XP_010933519.1|  PREDICTED: tobamovirus multiplication protei...    310   6e-99    Elaeis guineensis
emb|CBI33948.3|  unnamed protein product                                305   4e-98    Vitis vinifera
ref|XP_008788690.1|  PREDICTED: tobamovirus multiplication protei...    306   2e-97    Phoenix dactylifera
gb|EYU17843.1|  hypothetical protein MIMGU_mgv1a0124672mg               301   2e-96    Erythranthe guttata [common monkey flower]
ref|XP_010934868.1|  PREDICTED: tobamovirus multiplication protei...    301   1e-95    Elaeis guineensis
ref|XP_010053569.1|  PREDICTED: tobamovirus multiplication protei...    300   4e-95    Eucalyptus grandis [rose gum]
ref|XP_009371175.1|  PREDICTED: tobamovirus multiplication protei...    296   1e-93    Pyrus x bretschneideri [bai li]
ref|XP_004300273.1|  PREDICTED: tobamovirus multiplication protei...    293   2e-92    Fragaria vesca subsp. vesca
ref|XP_004983591.1|  PREDICTED: tetraspanin-18-like isoform X1          291   6e-92    
ref|XP_009391069.1|  PREDICTED: tobamovirus multiplication protei...    290   2e-91    Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW71821.1|  hypothetical protein EUGRSUZ_E00307                     288   1e-90    Eucalyptus grandis [rose gum]
gb|KHN21027.1|  hypothetical protein glysoja_034149                     287   2e-90    Glycine soja [wild soybean]
ref|NP_001150827.1|  tetraspanin family protein                         288   2e-90    Zea mays [maize]
ref|XP_006659267.1|  PREDICTED: tobamovirus multiplication protei...    288   2e-90    Oryza brachyantha
ref|XP_006847670.1|  PREDICTED: tobamovirus multiplication protei...    287   3e-90    Amborella trichopoda
ref|XP_006850026.1|  PREDICTED: tobamovirus multiplication protei...    286   7e-90    
gb|ACG40574.1|  tetraspanin family protein                              286   7e-90    Zea mays [maize]
gb|KHN01670.1|  hypothetical protein glysoja_012981                     283   7e-89    Glycine soja [wild soybean]
gb|KHG29161.1|  Stk31                                                   281   6e-88    Gossypium arboreum [tree cotton]
gb|KCW71823.1|  hypothetical protein EUGRSUZ_E00307                     278   4e-87    Eucalyptus grandis [rose gum]
ref|NP_001061444.1|  Os08g0282000                                       278   1e-86    
ref|XP_003573849.1|  PREDICTED: tobamovirus multiplication protei...    273   9e-85    Brachypodium distachyon [annual false brome]
gb|EMS54049.1|  hypothetical protein TRIUR3_29725                       273   2e-84    Triticum urartu
dbj|BAK04010.1|  predicted protein                                      271   9e-84    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABK22053.1|  unknown                                                 269   4e-83    Picea sitchensis
ref|XP_008788693.1|  PREDICTED: tobamovirus multiplication protei...    248   4e-76    
ref|NP_001146619.1|  hypothetical protein                               249   2e-75    Zea mays [maize]
gb|KHG29162.1|  Solute carrier family 28 member 3                       245   7e-75    Gossypium arboreum [tree cotton]
ref|XP_010934869.1|  PREDICTED: tobamovirus multiplication protei...    246   2e-74    
ref|XP_002443902.1|  hypothetical protein SORBIDRAFT_07g004040          236   2e-70    Sorghum bicolor [broomcorn]
gb|KCW77895.1|  hypothetical protein EUGRSUZ_D021561                    230   3e-69    Eucalyptus grandis [rose gum]
gb|ACN35034.1|  unknown                                                 232   5e-69    Zea mays [maize]
ref|XP_004972786.1|  PREDICTED: tetraspanin-20-like isoform X2          232   7e-69    Setaria italica
ref|XP_003573463.1|  PREDICTED: tobamovirus multiplication protei...    229   8e-68    Brachypodium distachyon [annual false brome]
gb|KCW77897.1|  hypothetical protein EUGRSUZ_D021561                    223   9e-67    Eucalyptus grandis [rose gum]
ref|NP_001061041.1|  Os08g0159100                                       218   2e-63    
ref|XP_006659854.1|  PREDICTED: tobamovirus multiplication protei...    216   3e-63    
gb|ABK25767.1|  unknown                                                 212   3e-62    Picea sitchensis
gb|EYU17845.1|  hypothetical protein MIMGU_mgv1a0219312mg               211   6e-62    Erythranthe guttata [common monkey flower]
gb|EEC82932.1|  hypothetical protein OsI_27894                          204   5e-58    Oryza sativa Indica Group [Indian rice]
ref|XP_004972785.1|  PREDICTED: tetraspanin-20-like isoform X1          202   7e-57    
ref|XP_008375915.1|  PREDICTED: tobamovirus multiplication protei...    186   1e-51    
ref|XP_002972323.1|  hypothetical protein SELMODRAFT_172827             180   6e-49    
gb|KDO40488.1|  hypothetical protein CISIN_1g033708mg                   171   1e-47    Citrus sinensis [apfelsine]
ref|XP_008352453.1|  PREDICTED: tobamovirus multiplication protei...    167   4e-45    
gb|AAD09513.1|  GMFP4                                                   163   1e-44    Glycine max [soybeans]
gb|AGW24511.1|  hypothetical protein                                    155   5e-42    Avicennia marina subsp. marina
gb|EEC83268.1|  hypothetical protein OsI_28600                          157   1e-41    Oryza sativa Indica Group [Indian rice]
gb|EEE68396.1|  hypothetical protein OsJ_26735                          158   2e-41    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001775831.1|  predicted protein                                  159   4e-41    
dbj|BAD94952.1|  hypothetical protein                                   152   8e-41    Arabidopsis thaliana [mouse-ear cress]
gb|ACL54399.1|  unknown                                                 152   1e-40    Zea mays [maize]
ref|XP_008354195.1|  PREDICTED: tobamovirus multiplication protei...    147   7e-39    
ref|XP_001762411.1|  predicted protein                                  151   4e-38    
ref|XP_008373605.1|  PREDICTED: tobamovirus multiplication protei...    145   5e-38    
gb|ADE76479.1|  unknown                                                 147   2e-36    Picea sitchensis
ref|XP_006854320.1|  PREDICTED: tetraspanin-20                          139   9e-34    Amborella trichopoda
gb|KDO40489.1|  hypothetical protein CISIN_1g038963mg                   133   1e-33    Citrus sinensis [apfelsine]
gb|KEH42419.1|  tetraspanin family protein                              131   1e-31    Medicago truncatula
gb|ACJ84998.1|  unknown                                                 131   1e-31    Medicago truncatula
gb|KDO36654.1|  hypothetical protein CISIN_1g033543mg                   127   2e-31    Citrus sinensis [apfelsine]
ref|XP_002984277.1|  hypothetical protein SELMODRAFT_229009             130   3e-31    Selaginella moellendorffii
gb|EMT27731.1|  hypothetical protein F775_29713                         130   5e-31    
gb|AFK47805.1|  unknown                                                 130   5e-31    Medicago truncatula
ref|XP_008235542.1|  PREDICTED: tetraspanin-18-like                     130   1e-30    Prunus mume [ume]
ref|XP_002972445.1|  hypothetical protein SELMODRAFT_228108             128   3e-30    Selaginella moellendorffii
gb|EAZ06370.1|  hypothetical protein OsI_28599                          124   3e-30    Oryza sativa Indica Group [Indian rice]
ref|XP_012085178.1|  PREDICTED: tetraspanin-18                          127   5e-30    Jatropha curcas
ref|XP_011083093.1|  PREDICTED: tetraspanin-18                          126   1e-29    Sesamum indicum [beniseed]
ref|XP_008372422.1|  PREDICTED: tetraspanin-18-like                     126   2e-29    Malus domestica [apple tree]
gb|KJB26070.1|  hypothetical protein B456_004G223400                    125   4e-29    Gossypium raimondii
ref|XP_010652447.1|  PREDICTED: tetraspanin-18-like                     125   4e-29    Vitis vinifera
gb|AFW87792.1|  hypothetical protein ZEAMMB73_665682                    120   5e-29    
ref|XP_007050068.1|  Tetraspanin family protein, putative               125   7e-29    Theobroma cacao [chocolate]
ref|XP_009371022.1|  PREDICTED: tetraspanin-18-like                     122   4e-28    Pyrus x bretschneideri [bai li]
ref|XP_008382665.1|  PREDICTED: tetraspanin-18-like                     122   4e-28    
gb|KDP43415.1|  hypothetical protein JCGZ_16702                         120   6e-28    Jatropha curcas
ref|XP_011080147.1|  PREDICTED: tetraspanin-18                          121   9e-28    Sesamum indicum [beniseed]
ref|XP_002517938.1|  conserved hypothetical protein                     119   1e-27    Ricinus communis
ref|XP_009592671.1|  PREDICTED: tetraspanin-20-like                     119   4e-27    Nicotiana tomentosiformis
ref|XP_009388438.1|  PREDICTED: tetraspanin-20-like                     117   9e-27    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010936082.1|  PREDICTED: tetraspanin-20-like                     117   1e-26    Elaeis guineensis
ref|XP_009342640.1|  PREDICTED: tetraspanin-19                          116   1e-26    Pyrus x bretschneideri [bai li]
ref|XP_010038335.1|  PREDICTED: tetraspanin-20                          117   2e-26    Eucalyptus grandis [rose gum]
ref|XP_010672322.1|  PREDICTED: tobamovirus multiplication protei...    115   3e-26    
ref|XP_008229174.1|  PREDICTED: tetraspanin-19                          114   6e-26    Prunus mume [ume]
ref|XP_006350290.1|  PREDICTED: tetraspanin-20-like isoform X1          115   8e-26    Solanum tuberosum [potatoes]
ref|XP_004247113.1|  PREDICTED: tetraspanin-20                          115   1e-25    Solanum lycopersicum
ref|XP_007217759.1|  hypothetical protein PRUPE_ppa011228mg             114   1e-25    Prunus persica
ref|XP_006408938.1|  hypothetical protein EUTSA_v10002082mg             112   6e-25    Eutrema salsugineum [saltwater cress]
ref|XP_004495030.1|  PREDICTED: tetraspanin-20-like                     112   6e-25    Cicer arietinum [garbanzo]
ref|XP_008789493.1|  PREDICTED: tetraspanin-18 isoform X1               111   8e-25    Phoenix dactylifera
ref|XP_008342920.1|  PREDICTED: tetraspanin-19-like isoform X1          110   1e-24    
ref|XP_007144435.1|  hypothetical protein PHAVU_007G155900g             110   4e-24    Phaseolus vulgaris [French bean]
gb|ADE77737.1|  unknown                                                 110   4e-24    Picea sitchensis
ref|XP_008448284.1|  PREDICTED: tetraspanin-19                          108   6e-24    Cucumis melo [Oriental melon]
ref|XP_006443683.1|  hypothetical protein CICLE_v10021447mg             110   1e-23    Citrus clementina [clementine]
gb|EMS68191.1|  hypothetical protein TRIUR3_27411                       106   1e-23    Triticum urartu
gb|KDO65807.1|  hypothetical protein CISIN_1g022738mg                   109   1e-23    Citrus sinensis [apfelsine]
ref|XP_009765194.1|  PREDICTED: tetraspanin-20-like                     108   1e-23    Nicotiana sylvestris
ref|XP_007201868.1|  hypothetical protein PRUPE_ppa009611mg             109   1e-23    Prunus persica
ref|XP_004140033.2|  PREDICTED: tetraspanin-19                          107   2e-23    Cucumis sativus [cucumbers]
ref|XP_004966578.1|  PREDICTED: tetraspanin-18-like                     108   2e-23    Setaria italica
gb|KJB22617.1|  hypothetical protein B456_004G057900                    108   3e-23    Gossypium raimondii
ref|XP_004290026.1|  PREDICTED: tetraspanin-18-like                     107   7e-23    Fragaria vesca subsp. vesca
gb|KCW89519.1|  hypothetical protein EUGRSUZ_A01807                     105   9e-23    Eucalyptus grandis [rose gum]
ref|XP_010051830.1|  PREDICTED: tetraspanin-19                          105   1e-22    Eucalyptus grandis [rose gum]
ref|XP_001763914.1|  predicted protein                                  107   1e-22    
ref|XP_009775665.1|  PREDICTED: tetraspanin-19                          105   1e-22    Nicotiana sylvestris
ref|XP_009591228.1|  PREDICTED: tetraspanin-19                          105   1e-22    Nicotiana tomentosiformis
gb|KFK40448.1|  hypothetical protein AALP_AA3G374400                    105   2e-22    Arabis alpina [alpine rockcress]
gb|EEC81360.1|  hypothetical protein OsI_24555                          105   2e-22    Oryza sativa Indica Group [Indian rice]
ref|NP_001058664.1|  Os06g0731400                                       105   2e-22    
emb|CDY31986.1|  BnaA07g00090D                                          105   2e-22    Brassica napus [oilseed rape]
ref|XP_010489078.1|  PREDICTED: tetraspanin-18-like                     105   4e-22    Camelina sativa [gold-of-pleasure]
ref|XP_002263228.1|  PREDICTED: tetraspanin-19                          103   4e-22    Vitis vinifera
gb|KHN05904.1|  hypothetical protein glysoja_026492                     104   4e-22    Glycine soja [wild soybean]
ref|XP_004152011.1|  PREDICTED: tetraspanin-18-like                     104   6e-22    Cucumis sativus [cucumbers]
ref|XP_010540868.1|  PREDICTED: tetraspanin-19                          103   7e-22    Tarenaya hassleriana [spider flower]
ref|XP_010495917.1|  PREDICTED: tetraspanin-18-like                     103   9e-22    Camelina sativa [gold-of-pleasure]
ref|XP_002437655.1|  hypothetical protein SORBIDRAFT_10g031310          103   9e-22    Sorghum bicolor [broomcorn]
ref|XP_008447349.1|  PREDICTED: tetraspanin-18                          104   1e-21    Cucumis melo [Oriental melon]
ref|XP_003542449.1|  PREDICTED: tetraspanin-18-like isoform X1          103   1e-21    Glycine max [soybeans]
ref|XP_012088302.1|  PREDICTED: tetraspanin-19                          102   1e-21    Jatropha curcas
ref|XP_008381481.1|  PREDICTED: tetraspanin-19-like                     102   2e-21    
ref|XP_008381480.1|  PREDICTED: tetraspanin-19-like                     101   2e-21    
ref|XP_008789494.1|  PREDICTED: tetraspanin-18 isoform X2               102   2e-21    Phoenix dactylifera
gb|KHG12596.1|  Diacylglycerol kinase eta                               103   3e-21    Gossypium arboreum [tree cotton]
ref|XP_003563209.1|  PREDICTED: tetraspanin-18-like isoform X1          102   3e-21    Brachypodium distachyon [annual false brome]
ref|XP_006409011.1|  hypothetical protein EUTSA_v10002095mg             101   3e-21    
ref|XP_010684825.1|  PREDICTED: tetraspanin-20                          103   4e-21    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010933200.1|  PREDICTED: tetraspanin-18-like                     101   4e-21    
emb|CDY65849.1|  BnaCnng48870D                                          102   5e-21    Brassica napus [oilseed rape]
ref|XP_006298516.1|  hypothetical protein CARUB_v10014594mg             100   6e-21    
ref|XP_006443681.1|  hypothetical protein CICLE_v10021447mg             102   6e-21    
ref|XP_001762323.1|  predicted protein                                98.2    7e-21    
ref|XP_002885992.1|  hypothetical protein ARALYDRAFT_480447             101   7e-21    
emb|CDM86191.1|  unnamed protein product                                100   7e-21    Triticum aestivum [Canadian hard winter wheat]
gb|KDO65809.1|  hypothetical protein CISIN_1g022738mg                   101   8e-21    Citrus sinensis [apfelsine]
ref|XP_002884219.1|  hypothetical protein ARALYDRAFT_480909             100   9e-21    
ref|XP_010488999.1|  PREDICTED: tetraspanin-19-like                     100   9e-21    
ref|XP_006357492.1|  PREDICTED: tetraspanin-19-like                     100   1e-20    Solanum tuberosum [potatoes]
ref|XP_010416099.1|  PREDICTED: tetraspanin-18                          101   1e-20    Camelina sativa [gold-of-pleasure]
emb|CDY35218.1|  BnaA01g08130D                                          100   1e-20    Brassica napus [oilseed rape]
ref|XP_010243645.1|  PREDICTED: tetraspanin-18                          101   1e-20    Nelumbo nucifera [Indian lotus]
ref|XP_009129299.1|  PREDICTED: tetraspanin-20                          100   1e-20    Brassica rapa
emb|CDY06872.1|  BnaC01g09710D                                          100   1e-20    
ref|XP_002301831.1|  hypothetical protein POPTR_0002s25480g             100   1e-20    Populus trichocarpa [western balsam poplar]
ref|XP_006443682.1|  hypothetical protein CICLE_v10021447mg             100   1e-20    
gb|ABK93560.1|  unknown                                                 100   2e-20    Populus trichocarpa [western balsam poplar]
gb|KDO65808.1|  hypothetical protein CISIN_1g022738mg                   100   2e-20    Citrus sinensis [apfelsine]
ref|NP_973493.1|  tetraspanin family protein                          98.6    2e-20    Arabidopsis thaliana [mouse-ear cress]
ref|XP_012091581.1|  PREDICTED: tetraspanin-19-like                     100   2e-20    Jatropha curcas
ref|XP_006656530.1|  PREDICTED: tetraspanin-18-like                     100   2e-20    Oryza brachyantha
gb|EYU26161.1|  hypothetical protein MIMGU_mgv1a013675mg              99.4    2e-20    Erythranthe guttata [common monkey flower]
dbj|BAD62494.1|  unknown protein                                      97.1    2e-20    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006594069.1|  PREDICTED: tetraspanin-18-like isoform X2        99.4    2e-20    Glycine max [soybeans]
ref|XP_010935654.1|  PREDICTED: tetraspanin-19-like                   98.6    3e-20    Elaeis guineensis
ref|XP_004243344.1|  PREDICTED: tetraspanin-19                        99.0    3e-20    Solanum lycopersicum
ref|XP_006412912.1|  hypothetical protein EUTSA_v10025947mg           99.8    4e-20    Eutrema salsugineum [saltwater cress]
ref|XP_006298317.1|  hypothetical protein CARUB_v10014382mg           99.4    4e-20    Capsella rubella
ref|XP_008796410.1|  PREDICTED: tetraspanin-18-like isoform X1        98.2    7e-20    Phoenix dactylifera
ref|XP_008802328.1|  PREDICTED: tetraspanin-19-like                   97.4    9e-20    Phoenix dactylifera
ref|NP_179667.2|  tetraspanin family protein                          97.4    9e-20    Arabidopsis thaliana [mouse-ear cress]
ref|NP_001242107.1|  uncharacterized protein LOC100816955             97.8    1e-19    Glycine max [soybeans]
gb|KHN48971.1|  hypothetical protein glysoja_025348                   98.6    1e-19    Glycine soja [wild soybean]
ref|XP_011024533.1|  PREDICTED: tetraspanin-20-like                   98.2    1e-19    Populus euphratica
ref|XP_010241967.1|  PREDICTED: tetraspanin-19 isoform X3             95.9    2e-19    Nelumbo nucifera [Indian lotus]
ref|XP_011085968.1|  PREDICTED: tetraspanin-19                        96.3    2e-19    Sesamum indicum [beniseed]
ref|XP_010940414.1|  PREDICTED: tetraspanin-19-like                   96.3    2e-19    Elaeis guineensis
ref|NP_001236362.1|  uncharacterized protein LOC100527459             95.5    3e-19    
ref|XP_010241963.1|  PREDICTED: tetraspanin-19 isoform X1             95.5    4e-19    Nelumbo nucifera [Indian lotus]
ref|XP_006580963.1|  PREDICTED: uncharacterized protein LOC100527...  95.5    4e-19    
ref|XP_010526469.1|  PREDICTED: tetraspanin-20                        96.7    4e-19    Tarenaya hassleriana [spider flower]
ref|XP_002521157.1|  conserved hypothetical protein                   95.1    6e-19    
ref|XP_003539915.1|  PREDICTED: tetraspanin-19-like isoform 1         94.4    1e-18    Glycine max [soybeans]
gb|KHG04274.1|  hypothetical protein F383_07750                       95.5    1e-18    Gossypium arboreum [tree cotton]
ref|XP_006653035.1|  PREDICTED: tetraspanin-19-like                   94.0    1e-18    Oryza brachyantha
gb|KJB69491.1|  hypothetical protein B456_011G026600                  95.5    1e-18    Gossypium raimondii
ref|XP_010540944.1|  PREDICTED: tetraspanin-18                        95.1    2e-18    
ref|NP_565468.1|  tetraspanin family protein                          94.7    2e-18    Arabidopsis thaliana [mouse-ear cress]
gb|AAL47370.1|  unknown protein                                       94.0    2e-18    Arabidopsis thaliana [mouse-ear cress]
gb|KHN15670.1|  hypothetical protein glysoja_050252                   94.7    2e-18    Glycine soja [wild soybean]
ref|XP_006350291.1|  PREDICTED: tetraspanin-20-like isoform X2        94.4    2e-18    
ref|XP_006377340.1|  hypothetical protein POPTR_0011s05050g           94.0    2e-18    
ref|XP_006377339.1|  hypothetical protein POPTR_0011s05050g           92.8    3e-18    Populus trichocarpa [western balsam poplar]
ref|XP_004514452.1|  PREDICTED: tetraspanin-19-like                   92.4    5e-18    Cicer arietinum [garbanzo]
ref|NP_194606.1|  tetraspanin family protein                          93.6    5e-18    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010689328.1|  PREDICTED: tetraspanin-19                        92.0    5e-18    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009101995.1|  PREDICTED: tetraspanin-19                        92.0    7e-18    
ref|NP_001190864.1|  tetraspanin family protein                       93.6    8e-18    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010240620.1|  PREDICTED: tetraspanin-19                        92.0    8e-18    
ref|XP_008796411.1|  PREDICTED: tetraspanin-18-like isoform X2        92.0    8e-18    Phoenix dactylifera
ref|XP_011027860.1|  PREDICTED: tetraspanin-19-like                   91.7    8e-18    Populus euphratica
ref|XP_009407845.1|  PREDICTED: tetraspanin-18-like                   92.0    1e-17    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002448786.1|  hypothetical protein SORBIDRAFT_06g033120        91.7    1e-17    Sorghum bicolor [broomcorn]
ref|XP_007132700.1|  hypothetical protein PHAVU_011G117300g           91.7    1e-17    Phaseolus vulgaris [French bean]
gb|AGV54188.1|  hypothetical protein                                  90.9    2e-17    Phaseolus vulgaris [French bean]
dbj|BAK01647.1|  predicted protein                                    91.7    2e-17    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002319358.1|  hypothetical protein POPTR_0013s13770g           91.3    2e-17    Populus trichocarpa [western balsam poplar]
gb|AES87215.2|  tetraspanin family protein                            92.0    2e-17    Medicago truncatula
ref|XP_001775784.1|  predicted protein                                89.7    3e-17    
ref|XP_010241966.1|  PREDICTED: tetraspanin-19 isoform X2             90.1    3e-17    Nelumbo nucifera [Indian lotus]
ref|XP_010467771.1|  PREDICTED: LOW QUALITY PROTEIN: tetraspanin-19   90.5    4e-17    Camelina sativa [gold-of-pleasure]
ref|XP_011006807.1|  PREDICTED: tetraspanin-19-like isoform X2        89.7    5e-17    Populus euphratica
gb|AFW59922.1|  hypothetical protein ZEAMMB73_645130                  89.4    6e-17    
ref|NP_001145473.1|  uncharacterized protein LOC100278862             89.4    7e-17    
ref|XP_006284299.1|  hypothetical protein CARUB_v10005468mg           90.1    8e-17    
ref|XP_008806539.1|  PREDICTED: tetraspanin-19 isoform X1             89.0    9e-17    
ref|XP_009400416.1|  PREDICTED: tetraspanin-19-like                   88.2    2e-16    
ref|XP_002867437.1|  hypothetical protein ARALYDRAFT_328819           89.4    2e-16    
ref|XP_008806541.1|  PREDICTED: tetraspanin-19 isoform X2             88.2    2e-16    
gb|EPS69019.1|  hypothetical protein M569_05751                       87.4    2e-16    
ref|XP_007025661.1|  Tetraspanin family protein, putative isoform 1   87.8    2e-16    
ref|XP_011043359.1|  PREDICTED: tetraspanin-19-like isoform X1        87.0    4e-16    
emb|CAN83474.1|  hypothetical protein VITISV_004797                   87.8    5e-16    
emb|CDY05788.1|  BnaC07g00150D                                        86.7    5e-16    
ref|XP_007043566.1|  Tetraspanin family protein                       86.7    6e-16    
gb|AFW87795.1|  hypothetical protein ZEAMMB73_665682                  85.5    7e-16    
ref|XP_003589423.1|  Tetraspanin family protein                       87.0    9e-16    
ref|XP_005644373.1|  hypothetical protein COCSUDRAFT_44255            86.3    1e-15    
ref|XP_011006804.1|  PREDICTED: tetraspanin-19-like isoform X1        85.5    1e-15    
ref|XP_002305145.2|  hypothetical protein POPTR_0004s04160g           85.5    1e-15    
ref|XP_008342921.1|  PREDICTED: tetraspanin-19-like isoform X2        84.0    2e-15    
ref|XP_006371574.1|  hypothetical protein POPTR_0019s13290g           85.1    2e-15    
ref|XP_011039741.1|  PREDICTED: tetraspanin-19 isoform X1             85.1    2e-15    
ref|XP_011039742.1|  PREDICTED: tetraspanin-19 isoform X2             84.7    2e-15    
ref|XP_010433163.1|  PREDICTED: tetraspanin-20-like                   85.9    3e-15    
ref|XP_010447919.1|  PREDICTED: tetraspanin-20-like                   85.1    4e-15    
ref|XP_008778399.1|  PREDICTED: tetraspanin-19-like                   84.0    4e-15    
ref|XP_010438387.1|  PREDICTED: tetraspanin-20                        85.1    5e-15    
ref|XP_007025662.1|  Tetraspanin family protein isoform 2             84.0    5e-15    
gb|EMS62359.1|  hypothetical protein TRIUR3_10377                     83.6    9e-15    
ref|XP_010242945.1|  PREDICTED: tetraspanin-19-like                   83.2    1e-14    
ref|XP_003605018.1|  Tetraspanin family protein                       84.0    1e-14    
ref|XP_010940675.1|  PREDICTED: tetraspanin-18 isoform X1             83.2    1e-14    
ref|XP_011466894.1|  PREDICTED: tetraspanin-19                        82.4    2e-14    
ref|XP_006436787.1|  hypothetical protein CICLE_v10033213mg           79.3    2e-14    
ref|XP_009420868.1|  PREDICTED: tetraspanin-19-like isoform X1        81.6    2e-14    
ref|XP_009420870.1|  PREDICTED: tetraspanin-19-like isoform X2        81.6    2e-14    
ref|XP_007132701.1|  hypothetical protein PHAVU_011G117300g           81.6    2e-14    
dbj|BAJ85018.1|  predicted protein                                    79.7    4e-14    
ref|XP_010239204.1|  PREDICTED: tetraspanin-18-like isoform X2        80.9    6e-14    
ref|NP_001131563.1|  uncharacterized protein LOC100192904             80.5    9e-14    
gb|ERM95204.1|  hypothetical protein AMTR_s00009p00266090             80.1    9e-14    
ref|XP_006827788.2|  PREDICTED: tetraspanin-19                        80.1    1e-13    
gb|ABK27062.1|  unknown                                               80.5    1e-13    
ref|XP_010091855.1|  hypothetical protein L484_015924                 80.5    2e-13    
emb|CDP03829.1|  unnamed protein product                              79.7    2e-13    
ref|XP_009390580.1|  PREDICTED: tetraspanin-19-like                   78.2    4e-13    
gb|EMT26254.1|  hypothetical protein F775_30948                       78.2    6e-13    
ref|XP_003635421.2|  PREDICTED: tetraspanin-19-like                   77.4    9e-13    
ref|XP_010052325.1|  PREDICTED: tetraspanin-19-like                   77.0    1e-12    
ref|XP_010910972.1|  PREDICTED: tetraspanin-19-like                   77.0    1e-12    
ref|NP_001054283.1|  Os04g0679900                                     76.3    2e-12    
gb|KDP20951.1|  hypothetical protein JCGZ_21422                       75.9    2e-12    
gb|ADT92198.1|  hypothetical protein                                  76.3    3e-12    
ref|XP_004960051.1|  PREDICTED: tetraspanin-19-like                   75.9    3e-12    
gb|KDO75921.1|  hypothetical protein CISIN_1g026705mg                 75.9    4e-12    
gb|KJB22619.1|  hypothetical protein B456_004G057900                  75.5    4e-12    
ref|XP_007213966.1|  hypothetical protein PRUPE_ppa011429mg           75.1    4e-12    
gb|KDO48162.1|  hypothetical protein CISIN_1g032113mg                 73.9    5e-12    
gb|KDO48163.1|  hypothetical protein CISIN_1g032113mg                 73.9    6e-12    
ref|XP_009382771.1|  PREDICTED: tetraspanin-19-like                   74.7    6e-12    
gb|EMT30864.1|  hypothetical protein F775_03218                       73.2    1e-11    
gb|KCW77892.1|  hypothetical protein EUGRSUZ_D021562                  71.2    1e-11    
ref|XP_006447344.1|  hypothetical protein CICLE_v10018057mg           72.8    2e-11    
gb|EMS53896.1|  hypothetical protein TRIUR3_15619                     73.2    2e-11    
ref|XP_006467818.1|  PREDICTED: tetraspanin-19-like                   73.6    2e-11    
ref|XP_004293588.1|  PREDICTED: tetraspanin-19-like isoform X1        72.8    3e-11    
ref|XP_008383761.1|  PREDICTED: tetraspanin-19-like isoform X2        72.8    3e-11    
ref|XP_011460242.1|  PREDICTED: tetraspanin-19-like isoform X2        72.8    3e-11    
ref|XP_008225065.1|  PREDICTED: tetraspanin-19-like                   72.4    3e-11    
emb|CAN81513.1|  hypothetical protein VITISV_012029                   71.6    4e-11    
ref|XP_006449320.1|  hypothetical protein CICLE_v10016622mg           72.4    4e-11    
ref|XP_002519044.1|  conserved hypothetical protein                   70.9    2e-10    
ref|NP_973494.1|  tetraspanin family protein                          69.3    2e-10    
gb|AAD20921.1|  hypothetical protein                                  68.9    2e-10    
gb|EMT02071.1|  hypothetical protein F775_29035                       70.5    2e-10    
ref|XP_010467772.1|  PREDICTED: tetraspanin-19-like                   68.6    3e-10    
dbj|BAK03197.1|  predicted protein                                    68.6    3e-10    
ref|XP_009631138.1|  PREDICTED: tetraspanin-19-like                   69.7    4e-10    
ref|XP_009762925.1|  PREDICTED: tetraspanin-19-like                   69.3    4e-10    
gb|KDO36449.1|  hypothetical protein CISIN_1g035193mg                 66.2    5e-10    
ref|XP_003082582.1|  senescence-associated protein-like (ISS)         69.7    6e-10    
emb|CEG00075.1|  unnamed product                                      69.7    7e-10    
ref|XP_010940676.1|  PREDICTED: tetraspanin-18 isoform X2             68.6    8e-10    
ref|NP_001144543.1|  uncharacterized protein LOC100277543             67.4    2e-09    
ref|XP_009337122.1|  PREDICTED: tetraspanin-19-like                   67.0    2e-09    
ref|XP_008345888.1|  PREDICTED: tetraspanin-19-like                   67.0    2e-09    
ref|XP_010686515.1|  PREDICTED: tetraspanin-19-like                   67.8    3e-09    
gb|AFW61168.1|  hypothetical protein ZEAMMB73_111506                  65.5    3e-09    
ref|NP_001146674.1|  uncharacterized protein LOC100280274             65.1    4e-09    
ref|XP_010100540.1|  hypothetical protein L484_012095                 65.9    6e-09    
gb|KDO48167.1|  hypothetical protein CISIN_1g032113mg                 64.7    6e-09    
gb|KDO48165.1|  hypothetical protein CISIN_1g032113mg                 63.9    9e-09    
gb|EYU46368.1|  hypothetical protein MIMGU_mgv1a0120572mg             64.7    1e-08    
emb|CAJ86261.1|  H0801D08.19                                          64.7    1e-08    
ref|NP_001130849.1|  uncharacterized protein LOC100191953             63.5    1e-08    
gb|ACF83532.1|  unknown                                               64.3    2e-08    
ref|XP_008674064.1|  PREDICTED: uncharacterized protein LOC100191...  64.3    2e-08    
ref|XP_011043360.1|  PREDICTED: tetraspanin-19-like isoform X2        63.5    2e-08    
ref|XP_004232858.1|  PREDICTED: tetraspanin-19                        63.9    3e-08    
ref|XP_008383757.1|  PREDICTED: tetraspanin-19-like isoform X1        63.5    3e-08    
ref|XP_010467838.1|  PREDICTED: tetraspanin-19-like                   62.4    4e-08    
gb|EYU17846.1|  hypothetical protein MIMGU_mgv1a0219311mg             60.1    5e-08    
emb|CDO99559.1|  unnamed protein product                              59.7    6e-07    
ref|XP_001420925.1|  predicted protein                                59.3    2e-06    
ref|XP_012065664.1|  PREDICTED: tobamovirus multiplication protei...  57.4    3e-06    
tpg|DAA35326.1|  TPA: hypothetical protein ZEAMMB73_410646            52.4    8e-05    
ref|XP_011096291.1|  PREDICTED: tetraspanin-19-like                   53.9    8e-05    
gb|ACG25649.1|  hypothetical protein                                  50.8    2e-04    
gb|KDO46091.1|  hypothetical protein CISIN_1g045785mg                 50.1    3e-04    
gb|KJB77287.1|  hypothetical protein B456_012G129500                  50.1    4e-04    
ref|XP_008812932.1|  PREDICTED: uncharacterized protein LOC103723703  48.9    8e-04    



>ref|XP_009590611.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana tomentosiformis]
 ref|XP_009590612.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana tomentosiformis]
Length=283

 Score =   405 bits (1040),  Expect = 5e-136, Method: Compositional matrix adjust.
 Identities = 229/284 (81%), Positives = 253/284 (89%), Gaps = 1/284 (0%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MACKG  ECLLKLLNFLLTL GL MVGYGIYLFVEYKNHS SGDD+P+  P SS E+++L
Sbjct  1     MACKGFWECLLKLLNFLLTLVGLAMVGYGIYLFVEYKNHSSSGDDYPVA-PTSSAEVIEL  59

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+AVS+A NIFD LPK WF+YLFIGIG +L V+SC GCIGA+TRNGCCLSCYSVL+
Sbjct  60    GRPMLMAVSVAENIFDKLPKAWFIYLFIGIGAVLVVVSCCGCIGAATRNGCCLSCYSVLL  119

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
              LLILVELGAA FIFFD+ W++EIP+D+TGNFD IYEFLED+WKI+KWVALGAV+LEAL+
Sbjct  120   FLLILVELGAAGFIFFDKSWREEIPSDKTGNFDTIYEFLEDHWKIIKWVALGAVILEALI  179

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPL+NNR   P TGVPVAGTLD+RPSRND
Sbjct  180   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLINNRPPNPATGVPVAGTLDNRPSRND  239

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWS RMREKYGLDTSEFTYNPS+SNRY  T VQP EER  C IM
Sbjct  240   AWSTRMREKYGLDTSEFTYNPSDSNRYPQTAVQPQEERKGCAIM  283



>ref|XP_009788106.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana sylvestris]
 ref|XP_009788107.1| PREDICTED: tobamovirus multiplication protein 2A [Nicotiana sylvestris]
Length=283

 Score =   404 bits (1039),  Expect = 8e-136, Method: Compositional matrix adjust.
 Identities = 228/284 (80%), Positives = 253/284 (89%), Gaps = 1/284 (0%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MACKG  ECLLKLLNFLLTL GL MVGYGIYLFVEYKNHS SGDD+P+  P SS E+++ 
Sbjct  1     MACKGFWECLLKLLNFLLTLVGLAMVGYGIYLFVEYKNHSSSGDDYPVA-PTSSAEVIEF  59

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+AVSLA+NIFD LPK WF+YLFIGIG +L V+SC GCIGA+TRNGCCLSCYSVL+
Sbjct  60    GRPMLIAVSLADNIFDKLPKAWFIYLFIGIGAVLVVVSCCGCIGAATRNGCCLSCYSVLL  119

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
              LLILVELGAA FIFFD+ W++EIP+D+TGNFD IY+FLED+WKI+KWVALGAV+LEAL+
Sbjct  120   FLLILVELGAAGFIFFDKSWREEIPSDKTGNFDTIYDFLEDHWKIIKWVALGAVILEALI  179

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPL+NNR   P TGVPVAGTLD+RPSRND
Sbjct  180   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLINNRPPNPATGVPVAGTLDNRPSRND  239

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWS RMREKYGLDTSEFTYNPS+SNRY  T VQP EER  C IM
Sbjct  240   AWSTRMREKYGLDTSEFTYNPSDSNRYPQTAVQPQEERKGCAIM  283



>ref|XP_004245872.1| PREDICTED: tobamovirus multiplication protein 2A [Solanum lycopersicum]
Length=284

 Score =   397 bits (1019),  Expect = 8e-133, Method: Compositional matrix adjust.
 Identities = 226/285 (79%), Positives = 250/285 (88%), Gaps = 2/285 (1%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MACKG  ECLLKLLNFLLTL GL MVGYGIYLFVEYKNHS SGDD+P+  PP SG++++ 
Sbjct  1     MACKGFWECLLKLLNFLLTLVGLTMVGYGIYLFVEYKNHSHSGDDYPVA-PPMSGDMIEF  59

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+AVSLA NIFD LPK WF+YLFIGIG +L V+SC GCIGA+TRNGCCLSCYS+L+
Sbjct  60    GRPMLMAVSLAENIFDKLPKPWFIYLFIGIGAVLVVVSCCGCIGAATRNGCCLSCYSMLI  119

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
              LLILVELGAA FIFFD+ WK EIP D+TGNF+ IY+FL+D+WKI+KWVALGAV+ EAL+
Sbjct  120   FLLILVELGAAGFIFFDKSWKDEIPRDKTGNFETIYDFLDDHWKIIKWVALGAVIFEALI  179

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQA-PVTGVPVAGTLDSRPSRN  401
             FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPL+NNR  A P TGVPV  TLD+RPSRN
Sbjct  180   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLINNRPPANPATGVPVTATLDNRPSRN  239

Query  400   DAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             DAWS RMREKYGLDTSEFTYNPSESNRY PT  QP EER  CTIM
Sbjct  240   DAWSTRMREKYGLDTSEFTYNPSESNRYPPTAAQPQEERKGCTIM  284



>ref|XP_006358577.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006358578.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X2 [Solanum tuberosum]
Length=284

 Score =   394 bits (1011),  Expect = 1e-131, Method: Compositional matrix adjust.
 Identities = 225/285 (79%), Positives = 249/285 (87%), Gaps = 2/285 (1%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MACKG  ECLLKLLNFLLTL GL MVGYGIYLFVEYKNHS SGDD+P+  PP SG++++ 
Sbjct  1     MACKGFWECLLKLLNFLLTLVGLTMVGYGIYLFVEYKNHSHSGDDYPVA-PPMSGDMIEF  59

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+AVSLA NIFD LPK WF+YLFIGIG +L V+SC GCIGA+TRNGCCLSCYSVL+
Sbjct  60    GRPMLMAVSLAGNIFDKLPKPWFIYLFIGIGAVLVVVSCCGCIGAATRNGCCLSCYSVLI  119

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
              LLILVELGAA FIFFD+ WK EIP D+TGNF+ IY+FL+D+WKI+KWVALGAV+ EAL+
Sbjct  120   FLLILVELGAAGFIFFDKSWKDEIPRDKTGNFETIYDFLDDHWKIIKWVALGAVIFEALI  179

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQA-PVTGVPVAGTLDSRPSRN  401
             FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPL++NR  A P TGVPV  TLD+RPSRN
Sbjct  180   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLISNRPPANPATGVPVTATLDNRPSRN  239

Query  400   DAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             DAWS RMREKYGLDTSEFTYNPSESNRY PT  QP EER  C IM
Sbjct  240   DAWSTRMREKYGLDTSEFTYNPSESNRYPPTATQPQEERKGCAIM  284



>gb|AIX10945.1| putative tetraspanin family protein [Gardenia jasminoides]
Length=286

 Score =   390 bits (1001),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 206/259 (80%), Positives = 225/259 (87%), Gaps = 1/259 (0%)
 Frame = -1

Query  1042  VGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLANNIFDNLPKEWFLY  863
             VGYGIYLFVEYK  + SGDD  +P P S+ EL+QLGRPML+AVSL +N FD LPK WF+Y
Sbjct  29    VGYGIYLFVEYKKSASSGDDSGVPVP-STEELIQLGRPMLMAVSLGDNFFDKLPKAWFIY  87

Query  862   LFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWKKEIP  683
             LFIG+GV+LF+ISCFGCIGA+TRNGCCLSCY+VLVILLILVELG AAFIFFD+ WK+EIP
Sbjct  88    LFIGVGVVLFIISCFGCIGAATRNGCCLSCYAVLVILLILVELGVAAFIFFDKSWKQEIP  147

Query  682   TDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDDEYIGG  503
             TDRTG F MIY+FLE++WKIVKWVALGAVVLEA +FLLALVVRAANR  DYDSDDEYIGG
Sbjct  148   TDRTGTFSMIYDFLEEHWKIVKWVALGAVVLEAFIFLLALVVRAANRTPDYDSDDEYIGG  207

Query  502   PRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESN  323
              RQQ RQPL+N  Q AP TGVPVAGTLDSRPSRNDAWS RMREKYGLDTSEFTYNPSESN
Sbjct  208   SRQQTRQPLINRPQPAPATGVPVAGTLDSRPSRNDAWSTRMREKYGLDTSEFTYNPSESN  267

Query  322   RYQPTNVQPAEERGRCTIM  266
             R      QP EER RCTIM
Sbjct  268   RTLQGAAQPTEERSRCTIM  286



>ref|XP_011070225.1| PREDICTED: tobamovirus multiplication protein 2A [Sesamum indicum]
 ref|XP_011070226.1| PREDICTED: tobamovirus multiplication protein 2A [Sesamum indicum]
Length=281

 Score =   375 bits (962),  Expect = 2e-124, Method: Compositional matrix adjust.
 Identities = 213/284 (75%), Positives = 242/284 (85%), Gaps = 3/284 (1%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+G  ECLLKLLNFLL L GL M+GYG+YLFV YKN + + DD  +P  P+S + VQL
Sbjct  1     MACRGFWECLLKLLNFLLILVGLAMIGYGVYLFVGYKNAASTDDD--VPISPTSEQFVQL  58

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+ VSLA+NIFD LPK WF+YLF GIG ++  I+C GCIG +TRNGCCL+CYSVLV
Sbjct  59    GRPMLLGVSLADNIFDKLPKAWFIYLFTGIGAVILFIACCGCIGTATRNGCCLTCYSVLV  118

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             ILLILVELG AAFIFFD+ WK+EIP D+TGNFDM+YEFLE +WKI+KWVALGAV+LEA++
Sbjct  119   ILLILVELGLAAFIFFDKSWKEEIPNDKTGNFDMMYEFLEKHWKIIKWVALGAVILEAVI  178

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLAL+VRAANRPADYDSD+EYIGGPRQQIRQPL+ NRQ  P TGVPVAGTLD RPSRND
Sbjct  179   FLLALIVRAANRPADYDSDEEYIGGPRQQIRQPLI-NRQPVPATGVPVAGTLDQRPSRND  237

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWS RMREKYGLDTSEFTYNP+ESNRY     QP EER RC IM
Sbjct  238   AWSTRMREKYGLDTSEFTYNPNESNRYPQAATQPQEERSRCIIM  281



>gb|KHG01123.1| hypothetical protein F383_00667 [Gossypium arboreum]
Length=278

 Score =   369 bits (948),  Expect = 3e-122, Method: Compositional matrix adjust.
 Identities = 217/284 (76%), Positives = 243/284 (86%), Gaps = 6/284 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MACKGCLECLLKLLNFL+TL GL MVGYGIYLFVEYK  +    D  +   P   + +QL
Sbjct  1     MACKGCLECLLKLLNFLMTLVGLAMVGYGIYLFVEYKRAA----DVAMLLSPVGTDQIQL  56

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+AVSL+++IFDNLPK WF+YLFIG+GV+LF ISCFGCIGASTRN CCLSCYS+LV
Sbjct  57    GRPMLMAVSLSSSIFDNLPKAWFIYLFIGVGVVLFFISCFGCIGASTRNLCCLSCYSLLV  116

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             +LLILVELG AAFIFFD+ WK+E+PTD+TG FDMIY+FLE+NW IVKWVALG VVLEA++
Sbjct  117   VLLILVELGCAAFIFFDKSWKEELPTDKTGYFDMIYQFLEENWSIVKWVALGIVVLEAVI  176

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLAL+VRAAN PADYDSDDE+I  PRQQIRQPL+ NR   P TGVPV G+LD RPSRND
Sbjct  177   FLLALMVRAANVPADYDSDDEFI-APRQQIRQPLI-NRPPVPATGVPVTGSLDQRPSRND  234

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWSARMREKYGLDTSEFTYNPSESNRYQ T  QPAE   RCTIM
Sbjct  235   AWSARMREKYGLDTSEFTYNPSESNRYQQTAPQPAEGSSRCTIM  278



>gb|KJB37690.1| hypothetical protein B456_006G215600 [Gossypium raimondii]
 gb|KJB37691.1| hypothetical protein B456_006G215600 [Gossypium raimondii]
Length=277

 Score =   367 bits (942),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 216/284 (76%), Positives = 242/284 (85%), Gaps = 7/284 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MACKGCLECLLKLLNFL+TL GL MVGYGIYLFVEYK  +    D  +   P   + +QL
Sbjct  1     MACKGCLECLLKLLNFLMTLVGLAMVGYGIYLFVEYKRAA----DVAMLLSPVGTDQIQL  56

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+AVSL+++IFDNLPK WF+YLFIG+GV+LFVISCFGCIGASTRN CCLSCYS+LV
Sbjct  57    GRPMLMAVSLSSSIFDNLPKAWFIYLFIGVGVVLFVISCFGCIGASTRNLCCLSCYSLLV  116

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             +LLILVELG AAFIFFD+ WK+E+PTD+TG FDMIY+FLE+NW IVKWVALG VVLEA++
Sbjct  117   VLLILVELGCAAFIFFDKSWKEELPTDKTGYFDMIYQFLEENWSIVKWVALGIVVLEAII  176

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLAL+VRAAN PADYDSDDE+I  PRQQIRQPL+  R   P TGVPV G+LD RPSRND
Sbjct  177   FLLALMVRAANVPADYDSDDEFI-APRQQIRQPLI--RPPVPATGVPVTGSLDQRPSRND  233

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWSARMREKYGLDTSEFTYNPSESNRYQ    QPAEE   CTIM
Sbjct  234   AWSARMREKYGLDTSEFTYNPSESNRYQQAAPQPAEESSCCTIM  277



>gb|KHG08208.1| Tetraspanin-33 [Gossypium arboreum]
Length=280

 Score =   366 bits (939),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 216/286 (76%), Positives = 245/286 (86%), Gaps = 8/286 (3%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPP--SSGELV  944
             MAC+GCLECLLKLLNFL+TLAGL MVGYGIYLFVEYKN +    D  +   P  S  +L+
Sbjct  1     MACRGCLECLLKLLNFLMTLAGLAMVGYGIYLFVEYKNAA----DTAMLLSPVGSDRDLI  56

Query  943   QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
             Q GRPML+AVSL+++IFDNLPK WFLYLFIG+G +LFVISCFGCIGA+TRN CCL+CYSV
Sbjct  57    QFGRPMLMAVSLSSSIFDNLPKAWFLYLFIGVGAVLFVISCFGCIGAATRNICCLTCYSV  116

Query  763   lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
             LVILLILVELG AAFIFFD+ WK E+PTD+TG+FDMIY+FLE+NW I+KW ALG V+LEA
Sbjct  117   LVILLILVELGCAAFIFFDKNWKDELPTDKTGDFDMIYDFLEENWTIIKWAALGIVILEA  176

Query  583   LMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
             L+FLLAL+VRAANRPADYDSDDE+I  PR QIRQPL+ NR  AP  GVPV  +L+ RPSR
Sbjct  177   LIFLLALMVRAANRPADYDSDDEFI-APRSQIRQPLI-NRPPAPAAGVPVVPSLEQRPSR  234

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             NDAWS RMREKYGLDTSEFTY+PSESNRYQP   QPAEER RCTIM
Sbjct  235   NDAWSTRMREKYGLDTSEFTYSPSESNRYQPVAPQPAEERSRCTIM  280



>gb|KJB25374.1| hypothetical protein B456_004G188200 [Gossypium raimondii]
Length=280

 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 217/291 (75%), Positives = 243/291 (84%), Gaps = 18/291 (6%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNH-------SPSGDDHPIPFPPS  959
             MAC+GCLECLLKLLNFL+TLAGL MVGYGIYLFVEYKN        SP G D        
Sbjct  1     MACRGCLECLLKLLNFLMTLAGLAMVGYGIYLFVEYKNAADTAMLLSPVGSDQ-------  53

Query  958   SGELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGccl  779
               +L+Q  RPML+AVSL+++IFDNLPK WF+YLFIG+G +LFVISCFGCIGA+TRN CCL
Sbjct  54    --DLIQFRRPMLMAVSLSSSIFDNLPKAWFIYLFIGVGAVLFVISCFGCIGAATRNLCCL  111

Query  778   scysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGA  599
             +CYSVLVILLILVELG AAFIFFD+ WK E+PTD+TG+FDMIY+FLE+NW I+KW ALG 
Sbjct  112   TCYSVLVILLILVELGCAAFIFFDKNWKDELPTDKTGDFDMIYDFLEENWTIIKWAALGI  171

Query  598   VVLEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLD  419
             V+LEAL+FLLAL+VRAANRPADYDSDDE+I  PR QIRQPL+ NR  AP  GVPV  TL+
Sbjct  172   VILEALIFLLALLVRAANRPADYDSDDEFI-APRPQIRQPLI-NRPPAPAAGVPVVPTLE  229

Query  418   SRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
              RPSRNDAWS RMREKYGLDTSEFTYNPSESNRYQP   QPAEER RCTIM
Sbjct  230   QRPSRNDAWSTRMREKYGLDTSEFTYNPSESNRYQPVAPQPAEERSRCTIM  280



>gb|EYU33039.1| hypothetical protein MIMGU_mgv1a011319mg [Erythranthe guttata]
Length=285

 Score =   365 bits (936),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 206/284 (73%), Positives = 234/284 (82%), Gaps = 0/284 (0%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MACKG  ECLLKLLNFLL L GL M+GYG+YLFVEYKN S   D      PPS+   VQL
Sbjct  1     MACKGFWECLLKLLNFLLVLVGLCMIGYGVYLFVEYKNISSDDDGGDAALPPSTDAFVQL  60

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+AVSLA+NIFD LPK WF+YLFIG+G ++  I+C GCIG +TRNGCCL+CYS+LV
Sbjct  61    GRPMLLAVSLADNIFDKLPKAWFIYLFIGLGGIVLFIACCGCIGTATRNGCCLTCYSLLV  120

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             ILLIL ELG AAFIFFD+ WK EIPTD+TGNF MIY+FL+D+WKIVKWVALGAV+LEAL+
Sbjct  121   ILLILAELGFAAFIFFDDDWKDEIPTDKTGNFSMIYDFLDDHWKIVKWVALGAVILEALI  180

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLAL+VRAAN P+DYDSD+EYIGG RQQIRQPL+N     PVTG PV   LD R SR D
Sbjct  181   FLLALIVRAANSPSDYDSDEEYIGGSRQQIRQPLINRPAGGPVTGPPVTNNLDQRTSRTD  240

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             +WS RMREKYGLDTSEFTYNPSESNRYQ +  QP+EER RC I+
Sbjct  241   SWSTRMREKYGLDTSEFTYNPSESNRYQQSATQPSEERNRCCII  284



>gb|AFK40219.1| unknown [Lotus japonicus]
Length=282

 Score =   363 bits (933),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 210/285 (74%), Positives = 239/285 (84%), Gaps = 8/285 (3%)
 Frame = -1

Query  1114  ACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LVQ  941
             AC+GC ECLLKLLNFLLTL GL MVGYGIYL VE+   S    D+ +     S +  LVQ
Sbjct  4     ACRGCWECLLKLLNFLLTLVGLAMVGYGIYLLVEFSKAS----DNTLSVSTVSDDQTLVQ  59

Query  940   LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
             LGRPML+AVSL+N+ FD+LPK WF+YLFIGIGV+LFVISCFGCIGA TR+GCCLSC++VL
Sbjct  60    LGRPMLMAVSLSNSFFDDLPKAWFIYLFIGIGVVLFVISCFGCIGAMTRSGCCLSCFAVL  119

Query  760   villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             V+LLIL ELG AAFIFFD+ WKKEIPTD+TGNFDMIYEFL +NW IV+WVALG V+ EAL
Sbjct  120   VVLLILAELGCAAFIFFDKSWKKEIPTDKTGNFDMIYEFLRENWNIVRWVALGIVIFEAL  179

Query  580   MFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRN  401
             +F+LAL+VRAANRPADYDSD+E+I  PRQQ RQPL+ NR  AP +GVPVAGT+D RPSRN
Sbjct  180   LFVLALIVRAANRPADYDSDEEFI-NPRQQARQPLL-NRPAAPASGVPVAGTIDQRPSRN  237

Query  400   DAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             DAWS RMREKYGLDTSEFTYNPSES R+Q  N QP EER RC IM
Sbjct  238   DAWSTRMREKYGLDTSEFTYNPSESQRFQQVNSQPTEERSRCAIM  282



>ref|XP_002527636.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34707.1| conserved hypothetical protein [Ricinus communis]
Length=280

 Score =   363 bits (933),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 208/284 (73%), Positives = 243/284 (86%), Gaps = 4/284 (1%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+GCLEC+LKLLN LLTL GL MVGYGIYLFVEY   +  G D  +    +   L+QL
Sbjct  1     MACRGCLECILKLLNLLLTLVGLAMVGYGIYLFVEYTRAA--GGDTLLAPATNDSSLIQL  58

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+AVSL++++ D LPK WF+YLFIG+G++LFVISCFGCIG+ TRNGCCLSCYSVLV
Sbjct  59    GRPMLMAVSLSDSLVDKLPKAWFIYLFIGVGLILFVISCFGCIGSVTRNGCCLSCYSVLV  118

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             ILLIL+ELG AAFIFFD+ WK+EIPTD+TG+FDMIY+FL++ WKIV+WVALG V+LEAL+
Sbjct  119   ILLILIELGCAAFIFFDKSWKEEIPTDKTGDFDMIYDFLKEKWKIVRWVALGVVILEALL  178

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             F+LAL+VRAANRPA+YDSDDE I  PRQQIRQPL+ NR   P TGVPVAGTLD RPSRND
Sbjct  179   FVLALIVRAANRPAEYDSDDELI-APRQQIRQPLL-NRPPGPATGVPVAGTLDQRPSRND  236

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWS RMREKYGLDTSEF+YNPSES+R+Q  + QP EER RCTIM
Sbjct  237   AWSTRMREKYGLDTSEFSYNPSESHRFQQVSTQPTEERSRCTIM  280



>ref|XP_006485406.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Citrus sinensis]
 ref|XP_006485407.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X2 [Citrus sinensis]
Length=279

 Score =   363 bits (931),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 213/286 (74%), Positives = 243/286 (85%), Gaps = 9/286 (3%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  944
             MAC+GCLECLLKLLNFLLT+ GL MVGYGIYLFVEYK    SG   P+     SG+   V
Sbjct  1     MACRGCLECLLKLLNFLLTIVGLAMVGYGIYLFVEYKRADNSGTVSPV-----SGDEGFV  55

Query  943   QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
             QLGRPML+AVSLA++IFD LPK WF+YLFIG+GV+LFVISC GCIGA+TRNGCCL+CYSV
Sbjct  56    QLGRPMLMAVSLADSIFDKLPKAWFIYLFIGVGVVLFVISCVGCIGATTRNGCCLTCYSV  115

Query  763   lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
             LVILLILVELG AAF +FD+ W++EIP DRTG+F+MIY+FL +NW IVKWVALG V+L+A
Sbjct  116   LVILLILVELGCAAFFYFDKSWREEIPADRTGDFNMIYDFLRENWNIVKWVALGVVILQA  175

Query  583   LMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
             L+FLLA++VRAANRP +YDSDDE I  PRQQIRQPL+ NR   P TGVPVAG+LD RPSR
Sbjct  176   LIFLLAIIVRAANRPVEYDSDDELI-APRQQIRQPLI-NRPTPPATGVPVAGSLDQRPSR  233

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             NDAWS RMREKYGLDTSEFTYNPSES+R+Q    QPAEER RCTIM
Sbjct  234   NDAWSTRMREKYGLDTSEFTYNPSESHRFQQVATQPAEERSRCTIM  279



>gb|EYU33040.1| hypothetical protein MIMGU_mgv1a011318mg [Erythranthe guttata]
Length=285

 Score =   361 bits (927),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 208/285 (73%), Positives = 235/285 (82%), Gaps = 1/285 (0%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MACKG  ECLLKLLNFLL L GLGM+GYG+YLFVEYKN S   D      PPS+ + VQL
Sbjct  1     MACKGFWECLLKLLNFLLVLVGLGMIGYGVYLFVEYKNISSDDDGGDSALPPSTDDFVQL  60

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+AVSLANNIFD LPK WF+YLFIG+G ++  ++C GCIG +TRNGCCL+CYSVLV
Sbjct  61    GRPMLLAVSLANNIFDKLPKAWFIYLFIGLGGIVLFVACCGCIGTATRNGCCLTCYSVLV  120

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             ILLIL ELG AAFIFFDE WK +IPTD TGNF MIYEFL+ +WKI+KWVALGAV+LEAL+
Sbjct  121   ILLILAELGFAAFIFFDESWKDKIPTDGTGNFAMIYEFLDKHWKIIKWVALGAVILEALI  180

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLAL+VRAAN PADYDSD+EYIG PRQQ RQPL+N     PVTGVPV  T D+  SR D
Sbjct  181   FLLALIVRAANTPADYDSDEEYIGRPRQQTRQPLINKPAGGPVTGVPVTNTPDNLTSRTD  240

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGR-CTIM  266
             +WS RMREKYGLDTSE+TYNPSESNRYQ +  QP+EER R CTIM
Sbjct  241   SWSRRMREKYGLDTSEYTYNPSESNRYQQSTTQPSEERSRGCTIM  285



>ref|XP_007039575.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 ref|XP_007039576.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 ref|XP_007039577.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 gb|EOY24076.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 gb|EOY24077.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
 gb|EOY24078.1| Tobamovirus multiplication 2A isoform 1 [Theobroma cacao]
Length=280

 Score =   358 bits (919),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 209/286 (73%), Positives = 241/286 (84%), Gaps = 8/286 (3%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPP--SSGELV  944
             MAC+GCL CLLKLLN L+TL GL MVGYGIYLFVEY+  S    D  +   P  S  +L+
Sbjct  1     MACRGCLGCLLKLLNLLMTLVGLAMVGYGIYLFVEYEKAS----DTAMLLSPAGSDQDLI  56

Query  943   QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
             QLGRPML+AVSL+++IFDNLPK WF+YLFIG+GV+L +ISCFGCIGA+TRN CCL+CYSV
Sbjct  57    QLGRPMLMAVSLSSSIFDNLPKAWFIYLFIGVGVVLVIISCFGCIGAATRNLCCLTCYSV  116

Query  763   lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
             LVILLILVELG AAFIFFD+ WK E+PTD+TG+FDMIY+FL+++W IVKW ALG V+LEA
Sbjct  117   LVILLILVELGCAAFIFFDKSWKDELPTDKTGDFDMIYKFLKEHWSIVKWAALGVVILEA  176

Query  583   LMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
             L+FLLAL+VRAANRP DYDSDDE++  PR QIRQPL+ NR   P TGVPVAG+L+ R SR
Sbjct  177   LIFLLALMVRAANRPVDYDSDDEFM-APRPQIRQPLI-NRPPVPATGVPVAGSLEQRSSR  234

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             NDAWS RMREKYGLDTSEFTYNPSESNRYQ    QPAEER RCTIM
Sbjct  235   NDAWSTRMREKYGLDTSEFTYNPSESNRYQQVTPQPAEERSRCTIM  280



>ref|XP_006385612.1| GMFP4 family protein [Populus trichocarpa]
 gb|ABK92751.1| unknown [Populus trichocarpa]
 gb|ERP63409.1| GMFP4 family protein [Populus trichocarpa]
Length=280

 Score =   357 bits (916),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 208/285 (73%), Positives = 242/285 (85%), Gaps = 6/285 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE-LVQ  941
             MACKGCLECLLKLLNFLLTL GL MVG+GIYLFVEY     + D+  +    S G+ L Q
Sbjct  1     MACKGCLECLLKLLNFLLTLVGLAMVGFGIYLFVEYTR---ADDNVALVSTLSDGQGLTQ  57

Query  940   LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
             LGRPML+ +SL++NI D LPK WF+YLF+ +GV+LF+ISCFGCIGA+TRNGCCL+CYSVL
Sbjct  58    LGRPMLMTMSLSDNILDKLPKAWFIYLFVAVGVILFIISCFGCIGAATRNGCCLTCYSVL  117

Query  760   villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             ++LLILVELG AAFIFFD+ WK+EIPTD+TG+FDM+Y+FL++ W IVKWVALG V+LEAL
Sbjct  118   IVLLILVELGCAAFIFFDKSWKEEIPTDKTGDFDMLYDFLKEKWNIVKWVALGIVILEAL  177

Query  580   MFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRN  401
             +FLLAL+VRAANRP +YDSDDE I  PRQQ RQPL+ NR  AP TGVPVAGTLD RPSRN
Sbjct  178   IFLLALLVRAANRPVEYDSDDELI-APRQQNRQPLL-NRPPAPATGVPVAGTLDQRPSRN  235

Query  400   DAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             DAWS RMREKYGLDTSEFTYNPSE +R+QP + QP EER RCTIM
Sbjct  236   DAWSTRMREKYGLDTSEFTYNPSEPHRFQPVSAQPTEERSRCTIM  280



>ref|XP_011028243.1| PREDICTED: tobamovirus multiplication protein 2A-like [Populus 
euphratica]
Length=280

 Score =   356 bits (914),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 208/285 (73%), Positives = 243/285 (85%), Gaps = 6/285 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE-LVQ  941
             MACKGCLECLLKLLNFLLTL GL M+G+GIYLFVEY     + D+  +    + G+ L Q
Sbjct  1     MACKGCLECLLKLLNFLLTLVGLAMIGFGIYLFVEYTR---ADDNVALVSTLNDGQGLTQ  57

Query  940   LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
             LGRPML+ VSL++NI D LPK WF+YLF+ +GV+LF+ISCFGCIGA+TRNGCCL+CYSVL
Sbjct  58    LGRPMLMTVSLSDNILDKLPKAWFIYLFVAVGVILFIISCFGCIGAATRNGCCLTCYSVL  117

Query  760   villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             ++LLILVELG AAFIFFD+ WK+EIP D+TG+FDM+Y+FL++ W IVKWVALG V+LEAL
Sbjct  118   IVLLILVELGCAAFIFFDKNWKEEIPPDKTGDFDMLYDFLKEKWNIVKWVALGIVILEAL  177

Query  580   MFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRN  401
             +FLLAL+VRAANRP +YDSDDE I  PRQQ RQPL+ NR  AP TGVPVAGTLD RPSRN
Sbjct  178   IFLLALLVRAANRPLEYDSDDELI-APRQQNRQPLL-NRPPAPATGVPVAGTLDQRPSRN  235

Query  400   DAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             DAWS RMREKYGLDTSEFTYNPSES+R+QP + QPAEER RCTIM
Sbjct  236   DAWSTRMREKYGLDTSEFTYNPSESHRFQPVSAQPAEERSRCTIM  280



>gb|KJB51694.1| hypothetical protein B456_008G228700 [Gossypium raimondii]
 gb|KJB51695.1| hypothetical protein B456_008G228700 [Gossypium raimondii]
Length=280

 Score =   356 bits (913),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 211/291 (73%), Positives = 243/291 (84%), Gaps = 18/291 (6%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNH-------SPSGDDHPIPFPPS  959
             MAC+GCLECLLKLLNFL+T+AGL MVGYGIYLFV+YK+        SP G D        
Sbjct  1     MACRGCLECLLKLLNFLMTVAGLAMVGYGIYLFVKYKDAADTVMLLSPVGSDQ-------  53

Query  958   SGELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGccl  779
               +L+QLGRPML+AVSL+++IFDNLPK WFLYLFIG+GV+LF+ISCFGCIG +TRN CCL
Sbjct  54    --DLIQLGRPMLMAVSLSSSIFDNLPKAWFLYLFIGVGVVLFIISCFGCIGTATRNLCCL  111

Query  778   scysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGA  599
             +CYS+LVILLILVELG AAFIFFD+ WK EIPTD+TG+FDMIYEFLE+NW I+KWVALG 
Sbjct  112   TCYSLLVILLILVELGCAAFIFFDKSWKDEIPTDKTGDFDMIYEFLEENWTILKWVALGI  171

Query  598   VVLEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLD  419
             VVLEA +FLLAL+VRAAN PADYDSDDE+I  PR+Q RQPL++     P +GVPV+ +LD
Sbjct  172   VVLEAFIFLLALMVRAANIPADYDSDDEFI-APREQ-RQPLISRPPSVPASGVPVSVSLD  229

Query  418   SRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
              RPSRNDAWSARMREKYGLDTSEFTYNP+ESNRYQ     PAEER RCTIM
Sbjct  230   QRPSRNDAWSARMREKYGLDTSEFTYNPAESNRYQQVVPPPAEERSRCTIM  280



>ref|XP_011018623.1| PREDICTED: tobamovirus multiplication protein 2A [Populus euphratica]
 ref|XP_011018624.1| PREDICTED: tobamovirus multiplication protein 2A [Populus euphratica]
 ref|XP_011018625.1| PREDICTED: tobamovirus multiplication protein 2A [Populus euphratica]
Length=280

 Score =   354 bits (909),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 208/285 (73%), Positives = 239/285 (84%), Gaps = 6/285 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE-LVQ  941
             MACKGCLECLLKLLNFLLTL GL M+GYGIYLFVEYK    + D+  +   PS G+ L  
Sbjct  1     MACKGCLECLLKLLNFLLTLVGLAMIGYGIYLFVEYKR---ADDNVGLVSTPSDGQGLTL  57

Query  940   LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
             LGRPML+AVSL+ +IFD LPK WF+YLFI +GV+LFVISCFGC+GA+TRNGCCL+CYSVL
Sbjct  58    LGRPMLIAVSLSESIFDKLPKAWFIYLFIAVGVILFVISCFGCVGAATRNGCCLTCYSVL  117

Query  760   villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             +ILLILVELG AAFIFFD+ WK+ +PTD++G+FDMIY+FL++NW IVKWVALG VVLEAL
Sbjct  118   IILLILVELGCAAFIFFDKSWKEVLPTDKSGDFDMIYKFLKENWNIVKWVALGIVVLEAL  177

Query  580   MFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRN  401
             +FLL LVVRAANRP +YDSDDE+I   RQQ RQPL+ NR  AP  GVPV GTLD RP RN
Sbjct  178   IFLLTLVVRAANRPVEYDSDDEFIAS-RQQTRQPLL-NRPPAPAAGVPVTGTLDQRPGRN  235

Query  400   DAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             DAWS RMREKYGLDTSEF+YNPSE +R QP + QP EER RCTIM
Sbjct  236   DAWSTRMREKYGLDTSEFSYNPSEPHRLQPASAQPTEERSRCTIM  280



>ref|XP_012074239.1| PREDICTED: tobamovirus multiplication protein 2A [Jatropha curcas]
 ref|XP_012074240.1| PREDICTED: tobamovirus multiplication protein 2A [Jatropha curcas]
 gb|KDP36200.1| hypothetical protein JCGZ_10291 [Jatropha curcas]
Length=279

 Score =   353 bits (905),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 207/284 (73%), Positives = 236/284 (83%), Gaps = 5/284 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+GCLEC+LKLLNFLLTL GL MVGYGIYLFVEYK  +      P+       +L+QL
Sbjct  1     MACRGCLECILKLLNFLLTLVGLAMVGYGIYLFVEYKRAADGESLAPVS---GGSDLIQL  57

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+AVS + +IFD LPK WF+YLFIG+GV+LFVISCFGCIG+ TRN CCLSCYSVLV
Sbjct  58    GRPMLMAVSFSESIFDKLPKAWFIYLFIGVGVILFVISCFGCIGSVTRNACCLSCYSVLV  117

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             ILLILVELG AAFIFFD+ WK+EIPTD+TG F+ IY+FL++NWKIVKWVALG V LEAL+
Sbjct  118   ILLILVELGCAAFIFFDKSWKEEIPTDKTGVFNDIYDFLKENWKIVKWVALGIVALEALL  177

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             F++AL+VRAANRP +YDSDDE I  PRQQ+RQPL+ NR   P  GVPVAG LD RPSRND
Sbjct  178   FVIALMVRAANRPVEYDSDDELI-APRQQVRQPLI-NRPPGPAAGVPVAGALDQRPSRND  235

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWS RMREKYGLDTSEF+YNPSES R+Q    QPAEER RCTIM
Sbjct  236   AWSTRMREKYGLDTSEFSYNPSESQRFQQVQTQPAEERSRCTIM  279



>ref|XP_010269960.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
 ref|XP_010269962.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
 ref|XP_010269963.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
 ref|XP_010269964.1| PREDICTED: tobamovirus multiplication protein 2A-like [Nelumbo 
nucifera]
Length=280

 Score =   351 bits (901),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 209/285 (73%), Positives = 235/285 (82%), Gaps = 6/285 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSG-ELVQ  941
             M+C+GC ECLLKLLNFLLTL GL MVGYGIYL VE+K  S   DD   P P S   E ++
Sbjct  1     MSCRGCFECLLKLLNFLLTLVGLAMVGYGIYLLVEWKRAS---DDTNSPSPLSDNHEFIE  57

Query  940   LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
             LGRPML+ VSL++NI D LPK WF+YLFI IGV++FVISCFGCIGA TRNGCCL+CYSVL
Sbjct  58    LGRPMLLVVSLSSNILDKLPKAWFIYLFIAIGVVIFVISCFGCIGAVTRNGCCLTCYSVL  117

Query  760   villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             +ILLILVELG AAFIFFD  WK  +PTD+T +F+MIYEFL+ NWKI KWVALGAV+LEAL
Sbjct  118   LILLILVELGCAAFIFFDHSWKDALPTDKTRDFEMIYEFLKKNWKIAKWVALGAVILEAL  177

Query  580   MFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRN  401
             +FLLAL+VRAAN+PADYDSDDEYI  PR   RQPL+ NRQ  P TG PVAG+LD RPSRN
Sbjct  178   VFLLALMVRAANQPADYDSDDEYI-APRSTARQPLI-NRQGVPSTGSPVAGSLDQRPSRN  235

Query  400   DAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             DAWS RMREKYGLDTSEFTYNPS+ NR+Q    QPAEER RCTIM
Sbjct  236   DAWSTRMREKYGLDTSEFTYNPSDPNRFQQAPAQPAEERSRCTIM  280



>ref|XP_003524459.1| PREDICTED: tobamovirus multiplication protein 2A isoform X1 [Glycine 
max]
 ref|XP_006579675.1| PREDICTED: tobamovirus multiplication protein 2A isoform X2 [Glycine 
max]
 ref|XP_006579676.1| PREDICTED: tobamovirus multiplication protein 2A isoform X3 [Glycine 
max]
Length=277

 Score =   351 bits (900),  Expect = 5e-115, Method: Compositional matrix adjust.
 Identities = 210/289 (73%), Positives = 234/289 (81%), Gaps = 17/289 (6%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPS-----GDDHPIPFPPSSG  953
             MAC+GC ECLLKLLNF+LTLAGL MVGYGIYLFVEY N +P      GDD          
Sbjct  1     MACRGCWECLLKLLNFILTLAGLAMVGYGIYLFVEY-NKTPDNTLTVGDDQ---------  50

Query  952   ELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclsc  773
              LVQLGRPMLVAVSL+N+  D+LPK WF+YLFIGIG +LFVISCFGCI A TRNGCCLS 
Sbjct  51    TLVQLGRPMLVAVSLSNSFLDDLPKAWFIYLFIGIGAVLFVISCFGCIAALTRNGCCLSF  110

Query  772   ysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVV  593
             YSVLV+LLILVELG AAFIFFD+ WK+EIPTD+TG+FDMIY FL +NW IV+WVALG V+
Sbjct  111   YSVLVLLLILVELGCAAFIFFDKSWKEEIPTDKTGDFDMIYGFLRENWNIVRWVALGIVI  170

Query  592   LEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSR  413
              EAL+F+LAL+VRAANRP +YDSD+EYI  PRQQ RQPL+ NR   PV+G P  GTLD R
Sbjct  171   FEALLFVLALIVRAANRPTEYDSDEEYI-NPRQQARQPLL-NRPAGPVSGAPATGTLDQR  228

Query  412   PSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             PSRNDAWS RMREKYGLDTSEFTYNPSES+RYQ  N QP EE  RC IM
Sbjct  229   PSRNDAWSTRMREKYGLDTSEFTYNPSESHRYQQVNSQPTEEGSRCAIM  277



>ref|XP_002279170.2| PREDICTED: tobamovirus multiplication protein 2A [Vitis vinifera]
Length=280

 Score =   350 bits (897),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 202/284 (71%), Positives = 237/284 (83%), Gaps = 4/284 (1%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+GCLECLLK+LNFLLTL GL MVGYGIYLFVEYK  S  G+   I       +++QL
Sbjct  1     MACRGCLECLLKILNFLLTLVGLAMVGYGIYLFVEYKKSS--GETLTISPVMGDSDVIQL  58

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRP+++AV+L+++I DNLPK WF+Y F  IGV+LFVISCFGC+GA TRNGCCLSCY+VLV
Sbjct  59    GRPVMMAVTLSSSILDNLPKAWFIYCFFAIGVILFVISCFGCVGAVTRNGCCLSCYAVLV  118

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             ILLIL+ELG AAFIFFD+ W+ +IPTD+TG+FDMIY+FL++NWKIVKWVAL AV+LEAL+
Sbjct  119   ILLILIELGCAAFIFFDKSWEDDIPTDKTGDFDMIYDFLKENWKIVKWVALAAVILEALL  178

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             F+L L+VRAAN+P DYDSDDE+I   RQ +RQPL+ NR     TGVPVAG +D RPSRND
Sbjct  179   FVLTLMVRAANKPDDYDSDDEFI-AQRQSVRQPLI-NRPPVAATGVPVAGAIDQRPSRND  236

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWS RMREKYGLDTSEFTYNPSESNRY P   QP EER RCTIM
Sbjct  237   AWSTRMREKYGLDTSEFTYNPSESNRYPPGQQQPTEERSRCTIM  280



>ref|XP_006368443.1| GMFP4 family protein [Populus trichocarpa]
 gb|ERP65012.1| GMFP4 family protein [Populus trichocarpa]
Length=280

 Score =   349 bits (896),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 205/285 (72%), Positives = 238/285 (84%), Gaps = 6/285 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE-LVQ  941
             MACKGCLECLLKLLNFLLTL GL M+GYGIYLFVEY+    + D+  +   PS G+ L  
Sbjct  1     MACKGCLECLLKLLNFLLTLVGLAMIGYGIYLFVEYRR---ADDNVGLVSTPSDGQGLTL  57

Query  940   LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
             LGRPML+AVSL+ +I D LPK WF+YLFI +GV+LFVISCFGCIGA+TRNGCCL+CYSVL
Sbjct  58    LGRPMLIAVSLSESILDKLPKAWFIYLFIAVGVILFVISCFGCIGAATRNGCCLTCYSVL  117

Query  760   villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             +ILLILVELG AAFIFFD+ WK+ +PTD++G+FDMIY+FL++NW IV+WVALG V+LEAL
Sbjct  118   IILLILVELGCAAFIFFDKSWKEVLPTDKSGDFDMIYKFLKENWNIVRWVALGIVILEAL  177

Query  580   MFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRN  401
             +FLL LVVRAANRP +YDSDDE+I   RQQ RQPL+ NR  AP  GVPV+GTLD RP RN
Sbjct  178   IFLLTLVVRAANRPVEYDSDDEFIAS-RQQTRQPLL-NRPPAPAAGVPVSGTLDQRPGRN  235

Query  400   DAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             DAWS RMREKYGLDTSEF+YNPSE +R QP   QP EER RCTIM
Sbjct  236   DAWSTRMREKYGLDTSEFSYNPSEPHRLQPAAAQPTEERSRCTIM  280



>ref|XP_003517379.1| PREDICTED: tobamovirus multiplication protein 2A-like [Glycine 
max]
Length=283

 Score =   348 bits (893),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 208/286 (73%), Positives = 242/286 (85%), Gaps = 5/286 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  944
             MAC+GC ECLLKL NF+LTL GL +VGYGIYLFVE+   S   DD+     P S +  L+
Sbjct  1     MACRGCWECLLKLFNFILTLTGLAIVGYGIYLFVEFSKAS--DDDNTPAISPVSDDSALI  58

Query  943   QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
             QLGRP+L+AVSL+N+ FDNLP+ WF+YLFIGIGV+LF+ISCFGCIGA+TRNGCCLSCYS+
Sbjct  59    QLGRPVLMAVSLSNDFFDNLPRAWFIYLFIGIGVVLFLISCFGCIGAATRNGCCLSCYSI  118

Query  763   lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
             LV LLILVELG AAFIFFD+ WK+EIPTD+TG+FD IY FL +NW IVKWVALG V+ EA
Sbjct  119   LVALLILVELGCAAFIFFDKNWKEEIPTDKTGDFDAIYGFLIENWNIVKWVALGIVIFEA  178

Query  583   LMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
             L+FLLAL+VRAANRPADYDSD+E+I  PRQQ+RQPL+N    +P TG+PVAGT+D RPSR
Sbjct  179   LLFLLALIVRAANRPADYDSDEEFIN-PRQQVRQPLLNRPAASPATGLPVAGTMDQRPSR  237

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             NDAWS RMREKYGLDTSEFTYNPSESNR+Q  N QP EE+ RCTIM
Sbjct  238   NDAWSTRMREKYGLDTSEFTYNPSESNRFQQVNSQPTEEKSRCTIM  283



>gb|KHN42626.1| hypothetical protein glysoja_018869 [Glycine soja]
Length=283

 Score =   348 bits (892),  Expect = 9e-114, Method: Compositional matrix adjust.
 Identities = 208/286 (73%), Positives = 241/286 (84%), Gaps = 5/286 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  944
             MAC+GC ECLLKL NF+LTL GL +VGYGIYLFVE+   S   DD+     P S +  L+
Sbjct  1     MACRGCWECLLKLFNFILTLTGLAIVGYGIYLFVEFSKAS--DDDNTPAISPVSDDSALI  58

Query  943   QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
             QLGRP+L+AVSL+NN FDNLP+ WF+YLFIGIGV+LF+ SCFGCIGA+TRNGCCLSCYS+
Sbjct  59    QLGRPVLMAVSLSNNFFDNLPRAWFIYLFIGIGVVLFLFSCFGCIGAATRNGCCLSCYSI  118

Query  763   lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
             LV LLILVELG AAFIFFD+ WK+EIPTD+TG+FD IY FL +NW IVKWVALG V+ EA
Sbjct  119   LVALLILVELGCAAFIFFDKNWKEEIPTDKTGDFDAIYGFLIENWNIVKWVALGIVIFEA  178

Query  583   LMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
             L+FLLAL+VRAANRPADYDSD+E+I  PRQQ+RQPL+N    +P TG+PVAGT+D RPSR
Sbjct  179   LLFLLALIVRAANRPADYDSDEEFIN-PRQQVRQPLLNRPAASPATGLPVAGTMDQRPSR  237

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             NDAWS RMREKYGLDTSEFTYNPSESNR+Q  N QP EE+ RCTIM
Sbjct  238   NDAWSTRMREKYGLDTSEFTYNPSESNRFQQVNSQPTEEKSRCTIM  283



>gb|KEH31557.1| tetraspanin family protein [Medicago truncatula]
Length=280

 Score =   347 bits (889),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 200/284 (70%), Positives = 231/284 (81%), Gaps = 4/284 (1%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+GC ECLLKLLNF+LT+ GL MVGYGIYL VE+   S   +   +  P     LVQL
Sbjct  1     MACRGCWECLLKLLNFILTITGLAMVGYGIYLLVEFSRAS--DNSMMLSAPSDDQTLVQL  58

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+A+ L++NIFDNLPK WF+YLFIG+G +LFVISCFGCI + TRNGCCLSCYS+LV
Sbjct  59    GRPMLMALPLSDNIFDNLPKAWFIYLFIGVGAVLFVISCFGCIASMTRNGCCLSCYSILV  118

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             +LLILVELG AAFIFFD+ WK+EIP D+TG+FDM+Y FL +NW IVKWVALG V+ EAL+
Sbjct  119   VLLILVELGCAAFIFFDKSWKEEIPRDKTGDFDMVYNFLRENWTIVKWVALGIVIFEALL  178

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             F+LAL+VRAANRP DYDSD+E+I  PRQQ RQPL+ NR   P  GVPV GT D R +RND
Sbjct  179   FILALIVRAANRPVDYDSDEEFI-NPRQQARQPLL-NRPAGPAPGVPVTGTTDPRSNRND  236

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWS RMREKYGLDTSEFTYNPSES R+Q  N QPAEER RCTIM
Sbjct  237   AWSTRMREKYGLDTSEFTYNPSESQRFQQVNSQPAEERSRCTIM  280



>ref|NP_001240069.1| uncharacterized protein LOC100793680 [Glycine max]
 gb|ACU21254.1| unknown [Glycine max]
Length=277

 Score =   346 bits (888),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 204/284 (72%), Positives = 230/284 (81%), Gaps = 7/284 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+GC ECLLKLLNF+LTLAGL MVGYGIYLFVEY        D+ + F     E VQ 
Sbjct  1     MACRGCWECLLKLLNFILTLAGLAMVGYGIYLFVEYNK----AWDNTLNFSEDKTE-VQF  55

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPMLV VSL+N+  D LPK WF+YLFIGIG +LFVISCFGCI A TRNGCCLS YSVLV
Sbjct  56    GRPMLVVVSLSNSFLDELPKAWFIYLFIGIGAVLFVISCFGCIAALTRNGCCLSFYSVLV  115

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             +LLILVELG AAF FFD+ WK+EIP D+TG+FDMIYEFL +NW +V+WVALG V+ EAL+
Sbjct  116   LLLILVELGCAAFTFFDKSWKEEIPKDKTGDFDMIYEFLRENWNVVRWVALGIVIFEALL  175

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             F+LAL+VRAANRP +YDSD+EYI  PRQQ+RQPL+ NR   P +G P  GTLD RPSRND
Sbjct  176   FVLALIVRAANRPPEYDSDEEYI-NPRQQVRQPLL-NRPAGPASGAPATGTLDKRPSRND  233

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWSARMREKYGLDTSEFTYNPSES+RYQ  N QP EER RC IM
Sbjct  234   AWSARMREKYGLDTSEFTYNPSESHRYQQVNPQPTEERSRCAIM  277



>gb|ACU24289.1| unknown [Glycine max]
Length=283

 Score =   345 bits (884),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 207/286 (72%), Positives = 240/286 (84%), Gaps = 5/286 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  944
             MAC+GC ECLLKL NF+LTL GL +VGYGIYLFVE+   S   DD+     P S +  L+
Sbjct  1     MACRGCWECLLKLFNFILTLTGLAIVGYGIYLFVEFSKAS--DDDNTPAISPVSDDSALI  58

Query  943   QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
             QLGRP+L+AVSL+N+ FDNLP+ WF+YLFIGIGV+LF+ISCFGCIGA+TRNGCCLSCYS+
Sbjct  59    QLGRPVLMAVSLSNDFFDNLPRAWFIYLFIGIGVVLFLISCFGCIGAATRNGCCLSCYSI  118

Query  763   lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
             LV LLILVELG AAFIFFD+ WK+EIPTD+TG+FD IY FL +NW IVKWVALG V+ EA
Sbjct  119   LVALLILVELGCAAFIFFDKNWKEEIPTDKTGDFDAIYGFLIENWNIVKWVALGIVIFEA  178

Query  583   LMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
             L+FLLAL+VRAANRPADYDSD+E I  PRQQ+RQPL+N    +P TG+PVAGT+D RP R
Sbjct  179   LLFLLALIVRAANRPADYDSDEELIN-PRQQVRQPLLNRPAASPATGLPVAGTMDQRPGR  237

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             NDAWS RMREKYGLDTSEFTYNPSESNR+Q  N QP EE+ RCTIM
Sbjct  238   NDAWSTRMREKYGLDTSEFTYNPSESNRFQQVNSQPTEEKSRCTIM  283



>ref|XP_008465936.1| PREDICTED: tobamovirus multiplication protein 2A [Cucumis melo]
Length=279

 Score =   342 bits (877),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 209/284 (74%), Positives = 238/284 (84%), Gaps = 5/284 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+GC ECLLKLLNF L+L GL MVGYGIYL VEY     S  D P P      +LVQL
Sbjct  1     MACRGCFECLLKLLNFFLSLLGLAMVGYGIYLLVEYLQ---SSSDVPGPSLSGDHDLVQL  57

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+AVSL++NIFDNLPK WF+YLFI  GV++FV+SCFGCIGA+TR+GCCLSCYS+L+
Sbjct  58    GRPMLMAVSLSSNIFDNLPKAWFIYLFIATGVIVFVVSCFGCIGAATRSGCCLSCYSILL  117

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             +LLILV+LG AAFIFFD+ W+ EIP D+TGNFD IYE LE+ WKI++WVALG ++ EAL+
Sbjct  118   LLLILVQLGCAAFIFFDKNWRDEIPGDKTGNFDKIYELLENKWKIIRWVALGTIIFEALL  177

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLALVVRAANRP DYDSDDEYI  PRQQIRQPL+ NR  AP TGVPVAGTLD RPSRND
Sbjct  178   FLLALVVRAANRPVDYDSDDEYI-APRQQIRQPLI-NRPVAPATGVPVAGTLDQRPSRND  235

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWSARMREKYGLDTSEFTYNPSES+R+Q    Q AEE+ RCTIM
Sbjct  236   AWSARMREKYGLDTSEFTYNPSESHRFQQVAPQAAEEKSRCTIM  279



>ref|XP_009397919.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=284

 Score =   341 bits (874),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 205/286 (72%), Positives = 231/286 (81%), Gaps = 4/286 (1%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSG--ELV  944
             MACKG  ECLLKLLNF+LTLAGL MVGYG+YL VE+ N   SG D   P  P+S   E +
Sbjct  1     MACKGFWECLLKLLNFILTLAGLAMVGYGVYLLVEW-NKVASGSDGEDPASPTSSDSEFL  59

Query  943   QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
             +LGRP+LVAVSL+++  D LPK WF+YLFIGIGV+LFVISCFGCIGA TRNGCCLSCY+ 
Sbjct  60    KLGRPILVAVSLSSSFLDYLPKAWFIYLFIGIGVVLFVISCFGCIGAVTRNGCCLSCYAF  119

Query  763   lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
             LVILL+L EL AAAFIFFD  WK  +P D+T NFD+IY FLEDNWKI KWVALG V+LEA
Sbjct  120   LVILLVLAELAAAAFIFFDHSWKDLVPDDKTRNFDIIYNFLEDNWKIAKWVALGVVILEA  179

Query  583   LMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
             L+F+LAL+VRA NRP +YDSDD+    PR  IRQPLM NRQ AP TGVPV GTLD RPSR
Sbjct  180   LVFMLALIVRAVNRPIEYDSDDDVCIAPRSSIRQPLM-NRQGAPATGVPVLGTLDHRPSR  238

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             NDAWS RMREKYGLDTSEFTYNPS+ +RYQ   V PAEERG CTI+
Sbjct  239   NDAWSQRMREKYGLDTSEFTYNPSDPSRYQQATVPPAEERGHCTIL  284



>emb|CDP12960.1| unnamed protein product [Coffea canephora]
Length=221

 Score =   338 bits (866),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 183/221 (83%), Positives = 199/221 (90%), Gaps = 2/221 (1%)
 Frame = -1

Query  922  VAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillil  743
            +AVSLA NIFD LPK WF+YLFIG+GV+LFVISCFGCIGA+TRNGCCLSCY+VLVILLIL
Sbjct  1    MAVSLAANIFDKLPKAWFIYLFIGVGVVLFVISCFGCIGAATRNGCCLSCYAVLVILLIL  60

Query  742  veLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLAL  563
            +ELG AAFIFFD+ WK+EIP DRTG F MIY+FLE++WKIVKWVALGAVVLEAL+FLLAL
Sbjct  61   IELGVAAFIFFDKSWKEEIPADRTGTFGMIYDFLEEHWKIVKWVALGAVVLEALVFLLAL  120

Query  562  VVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSAR  383
            VVRAANRPA+YDSDDEYIGGPRQQIRQPL+N  Q AP TGVPVAGTLDSRPSRNDAWS R
Sbjct  121  VVRAANRPANYDSDDEYIGGPRQQIRQPLINRPQPAPATGVPVAGTLDSRPSRNDAWSTR  180

Query  382  MREK--YGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            MREK  YGLDTSEFTYNPS+SNRY     QP EER RCTIM
Sbjct  181  MREKACYGLDTSEFTYNPSDSNRYPQGTAQPTEERSRCTIM  221



>ref|XP_003539155.1| PREDICTED: tobamovirus multiplication protein 2A-like [Glycine 
max]
 gb|KHN34864.1| hypothetical protein glysoja_004630 [Glycine soja]
Length=283

 Score =   340 bits (871),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 203/285 (71%), Positives = 237/285 (83%), Gaps = 3/285 (1%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS-GELVQ  941
             MAC+GC ECLLKL NF+LTL GL +VGYGIYLFVE+   S   D+ P   P S    L+Q
Sbjct  1     MACRGCWECLLKLFNFILTLTGLAIVGYGIYLFVEFSKAS-DDDNMPAISPVSDDSSLIQ  59

Query  940   LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
             LGRP+L+AVSL+N+ FDNLP+ WF+YLFIGIGV+LF+ISCFGCIGA+ RNGCCLSCYS+L
Sbjct  60    LGRPVLMAVSLSNDFFDNLPRAWFIYLFIGIGVVLFLISCFGCIGAAARNGCCLSCYSIL  119

Query  760   villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             V LLILVELG AAFIFFD+ WK++IPTD+TG FD IY FL +NW I+KWVALG V+ EAL
Sbjct  120   VALLILVELGCAAFIFFDKNWKEQIPTDKTGEFDAIYGFLIENWNIMKWVALGIVIFEAL  179

Query  580   MFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRN  401
             +FLLAL+VRAANRPADYDSD+E+I  PRQQ++QPL+N     P TG+PVAGT+D RPSRN
Sbjct  180   LFLLALIVRAANRPADYDSDEEFIN-PRQQVQQPLLNRLPAGPATGIPVAGTIDQRPSRN  238

Query  400   DAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             DAWS RMREKYGLDTSEFTYNPSESNR+Q  N QP EE+ RC IM
Sbjct  239   DAWSTRMREKYGLDTSEFTYNPSESNRFQQVNSQPTEEKSRCAIM  283



>ref|XP_010275310.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
 ref|XP_010275311.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
 ref|XP_010275312.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
 ref|XP_010275313.1| PREDICTED: tobamovirus multiplication protein 2A [Nelumbo nucifera]
Length=280

 Score =   339 bits (869),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 218/285 (76%), Positives = 238/285 (84%), Gaps = 6/285 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDD-HPIPFPPSSGELVQ  941
             MAC+GCLECLLKLLNFLLTL GL MVGYGIYL VE+K  S   D   P+     + E VQ
Sbjct  1     MACRGCLECLLKLLNFLLTLVGLAMVGYGIYLLVEWKKTSADTDSLSPLS---DNHEFVQ  57

Query  940   LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
             LGRPML+ VSL++NIFD LPK WF+YLFI +GV+LF+ISC GCIGA TRNGCCL+CYS+L
Sbjct  58    LGRPMLLVVSLSSNIFDKLPKAWFIYLFIAVGVILFIISCCGCIGAVTRNGCCLTCYSIL  117

Query  760   villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             VILLILVELG AAFIFFD  WK  +PTD+TG+FDMIYEFLE NWKI KWVALGAVVLEAL
Sbjct  118   VILLILVELGCAAFIFFDHSWKDTLPTDKTGDFDMIYEFLEKNWKIAKWVALGAVVLEAL  177

Query  580   MFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRN  401
             +FLLALVVRAANRPADYDSDDEYI  PR  +RQPL+ NRQ  P TGVPVA  LD RPSRN
Sbjct  178   LFLLALVVRAANRPADYDSDDEYI-APRSTVRQPLI-NRQGVPATGVPVACALDQRPSRN  235

Query  400   DAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             DAWS RMREKYGLDTSEFTYNPSESNR+Q   VQPAEER RCTIM
Sbjct  236   DAWSTRMREKYGLDTSEFTYNPSESNRFQQGPVQPAEERSRCTIM  280



>ref|XP_004148498.1| PREDICTED: tobamovirus multiplication protein 2A [Cucumis sativus]
 gb|KGN60424.1| hypothetical protein Csa_3G904130 [Cucumis sativus]
Length=279

 Score =   338 bits (867),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 208/285 (73%), Positives = 238/285 (84%), Gaps = 7/285 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEY-KNHSPSGDDHPIPFPPSSGELVQ  941
             MAC+GC ECLLKLLNF L+L GL MVGYGIYL VEY ++HS    D P P      +LVQ
Sbjct  1     MACRGCFECLLKLLNFFLSLLGLAMVGYGIYLLVEYLQSHS----DVPGPSLSGDHDLVQ  56

Query  940   LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
             LGRPML+AVSL+++IFDNLPK WF+YLFI  GV +FV+SCFGCIGA+TR+GCCLSCYS+L
Sbjct  57    LGRPMLMAVSLSSSIFDNLPKAWFIYLFIATGVTIFVVSCFGCIGAATRSGCCLSCYSIL  116

Query  760   villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             ++LLILV+LG  AFIFFD+ W+ EIP DRTGNFD IYE LE  W+I++WVALG ++ EAL
Sbjct  117   LLLLILVQLGCGAFIFFDKNWRDEIPGDRTGNFDKIYELLESKWEIIRWVALGTIIFEAL  176

Query  580   MFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRN  401
             +FLLALVVRAANRP DYDSDDEYI  PRQQIRQPL+ NR  AP TGVPVAGTLD RPSRN
Sbjct  177   LFLLALVVRAANRPVDYDSDDEYI-APRQQIRQPLI-NRPVAPATGVPVAGTLDQRPSRN  234

Query  400   DAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             DAWS RMREKYGLDTSEFTYNPSES+R+Q    QPAEE+ RCTIM
Sbjct  235   DAWSTRMREKYGLDTSEFTYNPSESHRFQQVAPQPAEEKSRCTIM  279



>ref|XP_006415200.1| hypothetical protein EUTSA_v10008423mg [Eutrema salsugineum]
 dbj|BAJ34310.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ33553.1| hypothetical protein EUTSA_v10008423mg [Eutrema salsugineum]
Length=280

 Score =   338 bits (866),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 210/286 (73%), Positives = 241/286 (84%), Gaps = 8/286 (3%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  944
             MAC+GCLECLLKLLNFLL +AGLGM+GYGIYLFVEYK  +    D+ + F P +G+   V
Sbjct  1     MACRGCLECLLKLLNFLLAVAGLGMIGYGIYLFVEYKRAT----DNSVTFNPVNGDQSYV  56

Query  943   QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
              LGRPML+AV+L++N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CCLSCYS+
Sbjct  57    SLGRPMLMAVALSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRSVCCLSCYSL  116

Query  763   lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
             L+ILLIL ELGAAAFIFFD  W+ EIP+DRTGNFD IY FL +NWKIV+WVALGAVV EA
Sbjct  117   LLILLILAELGAAAFIFFDHSWRDEIPSDRTGNFDTIYNFLRENWKIVRWVALGAVVFEA  176

Query  583   LMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
             L+FLLAL+VRAAN PA+YDSDDE I  PRQQIRQP + NRQ APVTGVPVA TLD RPSR
Sbjct  177   LLFLLALMVRAANSPAEYDSDDEII-APRQQIRQPFI-NRQAAPVTGVPVAPTLDQRPSR  234

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             +D WSARMREKYGLDTSEFTYNPSES+R+Q    Q  EE+GRCTIM
Sbjct  235   SDPWSARMREKYGLDTSEFTYNPSESHRFQQMPTQQNEEKGRCTIM  280



>ref|XP_003611447.1| GMFP4 [Medicago truncatula]
 gb|AES94405.1| tobamovirus multiplication protein 2A [Medicago truncatula]
Length=289

 Score =   337 bits (865),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 188/268 (70%), Positives = 218/268 (81%), Gaps = 10/268 (4%)
 Frame = -1

Query  1048  GMVGYGIYLFVEYKNHSPSGDDHPIPFP-----PSSGE--LVQLGRPMLVAVSLANNIFD  890
              +VGYGIYL V +   S   DD P   P     P SG+  L+Q GRPML+AVSL++NIFD
Sbjct  25    AIVGYGIYLLVAFAKAS--DDDKPDISPTPDISPVSGDSALIQFGRPMLMAVSLSDNIFD  82

Query  889   NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
              LPK WF+YLFIG+G +LFV+SCFGCIGA+TRNGCCL CYS+LV LLILVELG AAF+FF
Sbjct  83    KLPKAWFIYLFIGVGAVLFVVSCFGCIGATTRNGCCLICYSILVALLILVELGCAAFLFF  142

Query  709   DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADY  530
             D+ WK+EIPTD+TG+FDMIY FL +NW IV+WVALG V+ EAL+FLLAL+VRA NRPADY
Sbjct  143   DKSWKEEIPTDKTGDFDMIYGFLRENWDIVRWVALGIVIFEALLFLLALIVRAVNRPADY  202

Query  529   DSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSE  350
             DSDDE I  PRQQ+RQPL+NNRQ  P +G+PVAGT D RP+RNDAWS RMREKYGLDTSE
Sbjct  203   DSDDELIN-PRQQVRQPLLNNRQAGPPSGLPVAGTTDQRPNRNDAWSTRMREKYGLDTSE  261

Query  349   FTYNPSESNRYQPTNVQPAEERGRCTIM  266
             FTYNPSES R+Q  N QP EE+ RCTIM
Sbjct  262   FTYNPSESQRFQQANSQPTEEKSRCTIM  289



>gb|EPS67767.1| hypothetical protein M569_07007 [Genlisea aurea]
Length=281

 Score =   335 bits (860),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 204/284 (72%), Positives = 240/284 (85%), Gaps = 3/284 (1%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+G  +CLLKLLNFLL L GL M+GYGIYLFVEYKN +   DD P  FPPS+ ++V L
Sbjct  1     MACRGFFDCLLKLLNFLLILVGLAMIGYGIYLFVEYKNGASGDDDGP--FPPSNPDIVML  58

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+ + LA++IFDNLP+ WF+YLF GIGV++ VISCFGCIGAS RN CCL+CY+V V
Sbjct  59    GRPMLMGLYLADSIFDNLPRAWFIYLFTGIGVVVLVISCFGCIGASIRNRCCLTCYAVFV  118

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             +LLIL+ELG AAF+FFD+ WK+EIP D+TGNFD IYEFL+DNW+I+KW+ALG V+ EAL+
Sbjct  119   VLLILLELGLAAFVFFDKSWKEEIPRDKTGNFDQIYEFLDDNWEIIKWLALGFVIFEALL  178

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLALVVRA NRPADYDSD+EYI  PRQQIRQPL+ +R   P  G+PVAGTLD RPSRND
Sbjct  179   FLLALVVRAGNRPADYDSDEEYITAPRQQIRQPLI-SRPPVPAAGIPVAGTLDQRPSRND  237

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWS RMREKYGLDT+EFTYNPS+ NRYQ +  QPAEER RCTIM
Sbjct  238   AWSTRMREKYGLDTTEFTYNPSDPNRYQQSATQPAEERSRCTIM  281



>ref|NP_564399.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 ref|NP_973952.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 ref|NP_001031127.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 sp|Q9C5W7.1|TOM2A_ARATH RecName: Full=Tobamovirus multiplication protein 2A; Short=AtTOM2A 
[Arabidopsis thaliana]
 gb|AAG50101.1|AF334723_1 unknown protein [Arabidopsis thaliana]
 gb|AAK60280.1|AF385687_1 At1g32400/F5D14_22 [Arabidopsis thaliana]
 gb|AAM66092.1| unknown [Arabidopsis thaliana]
 dbj|BAC24019.1| tobamovirus multiplication 2A [Arabidopsis thaliana]
 gb|AEE31476.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 gb|AEE31477.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
 gb|AEE31478.1| tobamovirus multiplication 2A protein [Arabidopsis thaliana]
Length=280

 Score =   334 bits (856),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 209/286 (73%), Positives = 242/286 (85%), Gaps = 8/286 (3%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  944
             MAC+GCLECLLKLLNFLL +AGLGM+GYGIYLFVEYK  +    D+ + F  ++G+   V
Sbjct  1     MACRGCLECLLKLLNFLLAVAGLGMIGYGIYLFVEYKRVT----DNSVTFDLTNGDQSYV  56

Query  943   QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
               GRP+L+AVSL++NIFDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CCLSCYS+
Sbjct  57    SFGRPILMAVSLSSNIFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRSVCCLSCYSL  116

Query  763   lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
             L+ILLILVELG AAFIFFD  W+ E+P+DRTGNFD IY FL +NWKIV+WVALGAVV EA
Sbjct  117   LLILLILVELGFAAFIFFDNSWRDELPSDRTGNFDTIYNFLRENWKIVRWVALGAVVFEA  176

Query  583   LMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
             L+FLLAL+VRAAN PA+YDSDDEY+  PRQQIRQP + NRQ APVTGVPVA TLD RPSR
Sbjct  177   LLFLLALMVRAANTPAEYDSDDEYL-APRQQIRQPFI-NRQAAPVTGVPVAPTLDQRPSR  234

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             +D WSARMREKYGLDTSEFTYNPSES+R+Q    QP EE+GRCTIM
Sbjct  235   SDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNEEKGRCTIM  280



>ref|XP_007156640.1| hypothetical protein PHAVU_002G005000g [Phaseolus vulgaris]
 gb|ESW28634.1| hypothetical protein PHAVU_002G005000g [Phaseolus vulgaris]
Length=282

 Score =   333 bits (854),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 201/285 (71%), Positives = 235/285 (82%), Gaps = 4/285 (1%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS-GELVQ  941
             MAC+GC ECLLKLLNF+L L GL +VGYGIYL VE+   S   DD P   P S    L+Q
Sbjct  1     MACRGCWECLLKLLNFILNLTGLAIVGYGIYLLVEFSKAS--DDDTPDISPVSDDSALIQ  58

Query  940   LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
             LGRP+L+AVSL+N+ FDNLP+ WF+YLFIGIGV+LF+ISCFGCIGA+TRNGCCLSCYS L
Sbjct  59    LGRPILMAVSLSNSFFDNLPRAWFIYLFIGIGVVLFLISCFGCIGAATRNGCCLSCYSTL  118

Query  760   villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             V+LLIL+ELG A FIFFD+ WK+EIPTD+TG+FD IYEFL +NW IVKWVALG V+ EAL
Sbjct  119   VVLLILIELGCAGFIFFDKNWKEEIPTDKTGDFDAIYEFLSENWNIVKWVALGIVIFEAL  178

Query  580   MFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRN  401
             +FLLAL+VRAANRPA+YDSD+E+I  PRQQ+RQPL+N     P  G+P +GT D R SRN
Sbjct  179   LFLLALIVRAANRPAEYDSDEEFI-NPRQQVRQPLLNRPAAGPSAGLPASGTTDQRSSRN  237

Query  400   DAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             DAWS RMREKYGLDTSEFTYNPSES+R+Q  N Q AEE+ RCTIM
Sbjct  238   DAWSTRMREKYGLDTSEFTYNPSESSRFQQVNSQIAEEKSRCTIM  282



>ref|XP_004509001.1| PREDICTED: tetraspanin-20-like isoform X1 [Cicer arietinum]
 ref|XP_004509002.1| PREDICTED: tetraspanin-20-like isoform X2 [Cicer arietinum]
Length=280

 Score =   333 bits (854),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 196/284 (69%), Positives = 230/284 (81%), Gaps = 4/284 (1%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+G  ECLLKLLNFLLT+ GL MVGYGIYL VE+   S S  +  +        LVQL
Sbjct  1     MACRGFWECLLKLLNFLLTVTGLAMVGYGIYLLVEFSKASDSSLN--VSTVSDGQTLVQL  58

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRP+L+AV L+++ FD+LPK WF+YLFIG+G +LFVISCFGCI + TRNGCCLSCYSVLV
Sbjct  59    GRPLLMAVPLSDSFFDDLPKAWFIYLFIGVGAVLFVISCFGCIASVTRNGCCLSCYSVLV  118

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             +LLILVELG AAF+FFD+ WK+EIP D++G+FDM+Y+FL  NW IVKWVALG V+ EAL+
Sbjct  119   VLLILVELGCAAFVFFDKNWKEEIPRDKSGDFDMLYQFLRANWNIVKWVALGIVIFEALL  178

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             F+LAL+VRAANRPADYDSD+E+I  PRQQ RQPL+ NR   P  GVPV G +D R SRND
Sbjct  179   FILALIVRAANRPADYDSDEEFI-NPRQQARQPLL-NRPAGPAPGVPVTGPVDQRSSRND  236

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWS RMREKYGLDTSEFTYNPSES+R+Q  N QP EER RCTIM
Sbjct  237   AWSTRMREKYGLDTSEFTYNPSESHRFQQVNSQPTEERSRCTIM  280



>ref|XP_010055355.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
 gb|KCW71822.1| hypothetical protein EUGRSUZ_E00307 [Eucalyptus grandis]
Length=279

 Score =   332 bits (850),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 208/284 (73%), Positives = 238/284 (84%), Gaps = 5/284 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+GCL C LKLLNFL TLAGL MVGYGIYL V Y N S   D   +    + G L++L
Sbjct  1     MACRGCLGCFLKLLNFLFTLAGLAMVGYGIYLLVMYLNSS--SDAVSVLPVGTGGNLIEL  58

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML AVSL+++IFD+LPK WF+YLF+G+GV+LFVISCFGCIGASTRNGCCLSCYSVLV
Sbjct  59    GRPMLTAVSLSDSIFDDLPKAWFIYLFMGVGVILFVISCFGCIGASTRNGCCLSCYSVLV  118

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             I+LILVELG AAFI+FD+ W+ E+PTD TG+F MIY+FLE++W IVKWVALG VVLEAL+
Sbjct  119   IILILVELGCAAFIYFDKSWEDELPTDNTGDFAMIYDFLEEHWSIVKWVALGIVVLEALL  178

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLAL+VRAANRP +YDSDDEYI  PRQQIRQP +N  +  P TGVPVAGTLD RP RND
Sbjct  179   FLLALMVRAANRPVEYDSDDEYI-APRQQIRQPFIN--RPPPATGVPVAGTLDQRPIRND  235

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AW+ARMREKYGLDTSEFTYNPSES+R+Q    Q AEER RCTIM
Sbjct  236   AWTARMREKYGLDTSEFTYNPSESSRHQQVPPQNAEERSRCTIM  279



>ref|XP_006305496.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
 gb|EOA38394.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
Length=280

 Score =   332 bits (850),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 203/286 (71%), Positives = 240/286 (84%), Gaps = 8/286 (3%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  944
             MAC+GCLECLLKLLNFLL + GLGM+GYGIYLFVEYK  +    D+ + F P +G+   V
Sbjct  1     MACRGCLECLLKLLNFLLAVVGLGMIGYGIYLFVEYKRAT----DNSVTFDPVNGDQSFV  56

Query  943   QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
               GRPML+AV++++N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CCLSCYS+
Sbjct  57    SFGRPMLMAVAMSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRSVCCLSCYSL  116

Query  763   lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
             L+ILLILVELG AAFIFFD  W++EIP+DRTGNF+ IY FL++NW IV+WVALGAVV EA
Sbjct  117   LLILLILVELGVAAFIFFDHSWREEIPSDRTGNFETIYNFLQENWMIVRWVALGAVVFEA  176

Query  583   LMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
             L+FLLAL+VR+AN P +YDSDDE+I  PRQQIRQP + NRQ  PVTGVPVA TLD RPSR
Sbjct  177   LLFLLALMVRSANSPPEYDSDDEFI-APRQQIRQPFI-NRQATPVTGVPVAPTLDQRPSR  234

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             +D WSARMREKYGLDTSEFTYNPSES+R+Q    QP EE+GRCTIM
Sbjct  235   SDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNEEKGRCTIM  280



>ref|XP_003611445.1| GMFP4 [Medicago truncatula]
Length=294

 Score =   332 bits (851),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 186/273 (68%), Positives = 216/273 (79%), Gaps = 15/273 (5%)
 Frame = -1

Query  1048  GMVGYGIYLFVEYKNHSPSGDDHPIPFP-----PSSGE--LVQLGRPMLVAVSLANNIFD  890
              +VGYGIYL V +   S   DD P   P     P SG+  L+Q GRPML+AVSL++NIFD
Sbjct  25    AIVGYGIYLLVAFAKAS--DDDKPDISPTPDISPVSGDSALIQFGRPMLMAVSLSDNIFD  82

Query  889   NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl-----villilveLGAA  725
              LPK WF+YLFIG+G +LFV+SCFGCIGA+TRNGCCL C S+      V LLILVELG A
Sbjct  83    KLPKAWFIYLFIGVGAVLFVVSCFGCIGATTRNGCCLICVSLSNYSILVALLILVELGCA  142

Query  724   AFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAAN  545
             AF+FFD+ WK+EIPTD+TG+FDMIY FL +NW IV+WVALG V+ EAL+FLLAL+VRA N
Sbjct  143   AFLFFDKSWKEEIPTDKTGDFDMIYGFLRENWDIVRWVALGIVIFEALLFLLALIVRAVN  202

Query  544   RPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYG  365
             RPADYDSDDE I  PRQQ+RQPL+NNRQ  P +G+PVAGT D RP+RNDAWS RMREKYG
Sbjct  203   RPADYDSDDELIN-PRQQVRQPLLNNRQAGPPSGLPVAGTTDQRPNRNDAWSTRMREKYG  261

Query  364   LDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             LDTSEFTYNPSES R+Q  N QP EE+ RCTIM
Sbjct  262   LDTSEFTYNPSESQRFQQANSQPTEEKSRCTIM  294



>ref|XP_002893721.1| hypothetical protein ARALYDRAFT_473428 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69980.1| hypothetical protein ARALYDRAFT_473428 [Arabidopsis lyrata subsp. 
lyrata]
Length=280

 Score =   331 bits (848),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 207/286 (72%), Positives = 238/286 (83%), Gaps = 8/286 (3%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  944
             M  +GCLECLLKLLNFLL + GLGM+GYGIYLFVEYK  +    D+ + F  ++G+   V
Sbjct  1     MTFRGCLECLLKLLNFLLAVVGLGMIGYGIYLFVEYKRVT----DNSVTFDSTNGDQSYV  56

Query  943   QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
               GRPML+AVSL++N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CCLSCYS+
Sbjct  57    SFGRPMLMAVSLSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRSVCCLSCYSL  116

Query  763   lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
             L+ILLILVELG AAFIFFD  W+ E+P+DRTGNFD IY FL +NWKIV+WVALGAVV EA
Sbjct  117   LLILLILVELGFAAFIFFDNSWRDELPSDRTGNFDTIYNFLRENWKIVRWVALGAVVFEA  176

Query  583   LMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
             L+FLLAL+VRAAN P +YDSDDEYI  PRQQIRQP + NRQ APVTGVPVA TLD RPSR
Sbjct  177   LLFLLALIVRAANTPPEYDSDDEYI-APRQQIRQPFI-NRQAAPVTGVPVAPTLDQRPSR  234

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             ND WSARMREKYGLDTSEFTYNPSES+R+Q    QP EE+GRCTIM
Sbjct  235   NDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNEEKGRCTIM  280



>emb|CDY48874.1| BnaA05g35820D [Brassica napus]
Length=344

 Score =   333 bits (853),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 204/284 (72%), Positives = 237/284 (83%), Gaps = 5/284 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+GCLECLLKLLNFLL +AGLGM+GYGIYLFVEY+  +   D++ + F       V  
Sbjct  66    MACRGCLECLLKLLNFLLAVAGLGMIGYGIYLFVEYQRAT---DNNSLNFTRDDQSYVSF  122

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML++++L++N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +RN CCLSCYS+L+
Sbjct  123   GRPMLMSLALSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRNVCCLSCYSLLL  182

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             ILLIL ELGAAAFIFFD  W+ EIP+DRTGNFD IY FL +NW IV+WVALGAVV EAL+
Sbjct  183   ILLILAELGAAAFIFFDNSWRDEIPSDRTGNFDTIYNFLRENWNIVRWVALGAVVFEALL  242

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLAL+VRAAN PA+YDSDDE+I  PR QIRQP + NRQ APVTGVPVA TLD RPSR+D
Sbjct  243   FLLALMVRAANTPAEYDSDDEFITPPR-QIRQPFI-NRQPAPVTGVPVAPTLDQRPSRSD  300

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
              WSARMREKYGLDTSEFTYNPSES+R+Q    QP EE+GRCTIM
Sbjct  301   PWSARMREKYGLDTSEFTYNPSESHRFQQMPTQPNEEKGRCTIM  344



>ref|XP_009151428.1| PREDICTED: tobamovirus multiplication protein 2A [Brassica rapa]
Length=279

 Score =   330 bits (846),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 204/284 (72%), Positives = 237/284 (83%), Gaps = 5/284 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+GCLECLLKLLNFLL +AGLGM+GYGIYLFVEY+  +   D++ + F       V  
Sbjct  1     MACRGCLECLLKLLNFLLAVAGLGMIGYGIYLFVEYQRAT---DNNSLNFTRDDQSHVSF  57

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML++++L++N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +RN CCLSCYS+L+
Sbjct  58    GRPMLMSLALSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRNVCCLSCYSLLL  117

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             ILLIL ELGAAAFIFFD  W+ EIP+DRTGNFD IY FL +NW IV+WVALGAVV EAL+
Sbjct  118   ILLILAELGAAAFIFFDNSWRDEIPSDRTGNFDTIYNFLRENWNIVRWVALGAVVFEALL  177

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLAL+VRAAN PA+YDSDDE+I  PR QIRQP + NRQ APVTGVPVA TLD RPSR+D
Sbjct  178   FLLALMVRAANTPAEYDSDDEFITPPR-QIRQPFI-NRQPAPVTGVPVAPTLDQRPSRSD  235

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
              WSARMREKYGLDTSEFTYNPSES+R+Q    QP EE+GRCTIM
Sbjct  236   PWSARMREKYGLDTSEFTYNPSESHRFQQMPTQPNEEKGRCTIM  279



>ref|XP_007156638.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
 ref|XP_007156639.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
 gb|ESW28632.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
 gb|ESW28633.1| hypothetical protein PHAVU_002G004900g [Phaseolus vulgaris]
Length=283

 Score =   330 bits (846),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 197/286 (69%), Positives = 239/286 (84%), Gaps = 5/286 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSG-ELVQ  941
             MAC+GC ECLLKLLNF+L++ GL +VGYGIYLFVE+   S   DD P   P S    L+Q
Sbjct  1     MACRGCWECLLKLLNFILSITGLAIVGYGIYLFVEFSKVS--DDDTPDISPVSDDYALIQ  58

Query  940   LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
             LGRPML+AVSL+++ FDNLP+ WF++LFIG+GV+LF+ISCFGCIGA+TRNGCCLS YS+L
Sbjct  59    LGRPMLMAVSLSDSFFDNLPRAWFIFLFIGVGVVLFLISCFGCIGAATRNGCCLSFYSIL  118

Query  760   villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             V LLIL+ELG AAFIFFD+ WK+EIP D+TG+FD IY FL +NW IV+WVALG  + +AL
Sbjct  119   VALLILIELGCAAFIFFDKNWKEEIPKDKTGDFDAIYGFLSENWNIVRWVALGIGIFQAL  178

Query  580   MFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNN-RQQAPVTGVPVAGTLDSRPSR  404
             +FLLAL+VRAANRPADYDSD+E+I  PRQQ+RQPL+N     +  TG+PV+GT+D RPSR
Sbjct  179   LFLLALIVRAANRPADYDSDEEFIN-PRQQVRQPLLNRPAAGSTTTGLPVSGTIDQRPSR  237

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             +DAWSARMREKYGLDTSEFTYNPSES+R+Q  N QP EE+ RCTIM
Sbjct  238   SDAWSARMREKYGLDTSEFTYNPSESSRFQQVNSQPTEEKSRCTIM  283



>emb|CDY32286.1| BnaC05g28640D [Brassica napus]
Length=370

 Score =   333 bits (854),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 205/284 (72%), Positives = 237/284 (83%), Gaps = 5/284 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+GCLECLLKLLNFLL +AGLGM+GYGIYLFVEY+  +   D++ + F       V  
Sbjct  92    MACRGCLECLLKLLNFLLAVAGLGMIGYGIYLFVEYQRAT---DNNSLNFTGDDQSYVSF  148

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML++V+L++N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +RN CCLSCYS+L+
Sbjct  149   GRPMLMSVALSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRNICCLSCYSLLL  208

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             ILLIL ELGAAAFIFFD  W+ EIP+DRTGNFD IY FL +NW IV+WVALGAVV EAL+
Sbjct  209   ILLILAELGAAAFIFFDNSWRDEIPSDRTGNFDTIYNFLRENWNIVRWVALGAVVFEALL  268

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLAL+VRAAN PA+YDSDDE+I  PR QIRQP + NRQ APVTGVPVA TLD RPSR+D
Sbjct  269   FLLALMVRAANTPAEYDSDDEFITPPR-QIRQPFI-NRQPAPVTGVPVAPTLDQRPSRSD  326

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
              WSARMREKYGLDTSEFTYNPSES+R+Q    QP EE+GRCTIM
Sbjct  327   PWSARMREKYGLDTSEFTYNPSESHRFQQMPTQPNEEKGRCTIM  370



>ref|XP_010677296.1| PREDICTED: tobamovirus multiplication protein 2A [Beta vulgaris 
subsp. vulgaris]
Length=278

 Score =   330 bits (845),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 193/286 (67%), Positives = 228/286 (80%), Gaps = 10/286 (3%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  944
             M C+G   CLLKLLNFL+TLAGL MVGYGIYLFV YK  SP         PP S E  ++
Sbjct  1     MGCQGFWGCLLKLLNFLMTLAGLAMVGYGIYLFVMYKQASPDTG-----LPPISPEETMI  55

Query  943   QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
             QLGRP++++VSL+N++FDNLPK WF+Y+FIGIG +LFVISCFGCIGAST+NGCCLS Y+V
Sbjct  56    QLGRPLIMSVSLSNSVFDNLPKAWFIYMFIGIGAVLFVISCFGCIGASTKNGCCLSTYAV  115

Query  763   lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
              +ILLIL+ELG AAF+FFD+ W  EIPTD+TGNFDMI +FLE++W I KWV LG VVLEA
Sbjct  116   FIILLILLELGCAAFVFFDKNWNDEIPTDKTGNFDMINDFLEEHWSIAKWVLLGIVVLEA  175

Query  583   LMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
              +FLL ++VR+ NRPADYDSD+E+I   RQ  +QPL+N  +  P TGVPVAG +D RPSR
Sbjct  176   ALFLLTVIVRSMNRPADYDSDEEFI-NQRQSAKQPLIN--RPPPATGVPVAGAIDQRPSR  232

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             NDAWSARMREKYGLDTSEFTYNP+ES RYQ    QP  E  RCTIM
Sbjct  233   NDAWSARMREKYGLDTSEFTYNPTESGRYQQPAAQPTVEGNRCTIM  278



>ref|XP_010499788.1| PREDICTED: tobamovirus multiplication protein 2A isoform X1 [Camelina 
sativa]
 ref|XP_010499789.1| PREDICTED: tobamovirus multiplication protein 2A isoform X2 [Camelina 
sativa]
Length=276

 Score =   330 bits (845),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 204/284 (72%), Positives = 238/284 (84%), Gaps = 8/284 (3%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+GCLECLLKLLNFLL + GLGM+GYGIYLFVEYK  +    D+ + F   S   +  
Sbjct  1     MACRGCLECLLKLLNFLLAVVGLGMIGYGIYLFVEYKRAT----DNSVTFDDQS--YISF  54

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+AV+L++N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CCLSCYS+L+
Sbjct  55    GRPMLMAVTLSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRSVCCLSCYSLLL  114

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             ILLILVELGAAAFIFFD  W++EIP+DRTGNF+ IY FL +NW IV+WVALGAVV EAL+
Sbjct  115   ILLILVELGAAAFIFFDHSWREEIPSDRTGNFETIYNFLRENWMIVRWVALGAVVFEALL  174

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLAL+VR+AN P +YDSDDE+I  PRQQIRQP + NRQ APVTGVPVA TLD RPSR+D
Sbjct  175   FLLALMVRSANSPPEYDSDDEFI-APRQQIRQPFI-NRQAAPVTGVPVAPTLDQRPSRSD  232

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
              WSARMREKYGLDTSEFTYNPSES+R+Q    QP EE+GRCTIM
Sbjct  233   PWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNEEKGRCTIM  276



>ref|XP_007156641.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
 ref|XP_007156642.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
 gb|ESW28635.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
 gb|ESW28636.1| hypothetical protein PHAVU_002G005100g [Phaseolus vulgaris]
Length=279

 Score =   329 bits (844),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 200/286 (70%), Positives = 239/286 (84%), Gaps = 9/286 (3%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  944
             MAC+GC ECLLKLLNF+L+L GL +VGYGIYLFVE+   S + D   +   P S +  L+
Sbjct  1     MACRGCWECLLKLLNFILSLTGLAIVGYGIYLFVEF---SKASDGETLTTSPVSDDSALI  57

Query  943   QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
             QLGRP+L+ VSL+N+  DNLP  WF+++FIGIGV+LF+ISCFGCIGA+TRNGCCLSCYS+
Sbjct  58    QLGRPVLMTVSLSNSFLDNLPSAWFIFVFIGIGVVLFLISCFGCIGAATRNGCCLSCYSI  117

Query  763   lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
             LV+LLIL+ELG AAFIFFD+ WK+EIPTD+TG+FD IYEFL +NW IV+WVALG VV EA
Sbjct  118   LVVLLILIELGCAAFIFFDKNWKEEIPTDKTGDFDAIYEFLSENWNIVRWVALGIVVFEA  177

Query  583   LMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
             L+FLLAL+VRA N+PADYDSD+E+I  PRQ   QPL+N    APVTG+PVAGT+D RPSR
Sbjct  178   LLFLLALIVRAVNKPADYDSDEEFI-NPRQ---QPLLNRPAAAPVTGLPVAGTIDQRPSR  233

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             NDAWSARMREKYGLDTSEFTYNPSES+R+Q  N Q  EE+ RCTIM
Sbjct  234   NDAWSARMREKYGLDTSEFTYNPSESSRFQQVNSQSTEEKSRCTIM  279



>ref|XP_010461064.1| PREDICTED: tobamovirus multiplication protein 2A-like [Camelina 
sativa]
Length=280

 Score =   329 bits (843),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 204/286 (71%), Positives = 238/286 (83%), Gaps = 8/286 (3%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPP--SSGELV  944
             MAC+GCLECLLKLLNFLL + GLGM+GYGIYLFVEYK  +    D+ + F P  S    V
Sbjct  1     MACRGCLECLLKLLNFLLAVVGLGMIGYGIYLFVEYKRAT----DNSVTFDPVNSDQSYV  56

Query  943   QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
               GRP+L+AV+L++N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CCLSCYS+
Sbjct  57    SFGRPLLMAVTLSSNVFDNLPKAWFIYLFIGIGVTLFVISCCGCVGTCSRSVCCLSCYSL  116

Query  763   lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
             L+ILLILVELGAAAFIFFD  W++EIP+DRTGNF+ IY FL +NW IV+WVALGAVV EA
Sbjct  117   LLILLILVELGAAAFIFFDHSWREEIPSDRTGNFETIYNFLRENWMIVRWVALGAVVFEA  176

Query  583   LMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
             L+FLLAL+VR+AN P +YDSDDE+I  PRQQIRQP + NRQ APVTGVPVA T D RPSR
Sbjct  177   LLFLLALMVRSANSPPEYDSDDEFI-APRQQIRQPFI-NRQAAPVTGVPVAPTSDQRPSR  234

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             +D WSARMREKYGLDTSEFTYNPSES+R+Q    QP EE+GRCTIM
Sbjct  235   SDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNEEKGRCTIM  280



>ref|XP_010518876.1| PREDICTED: tobamovirus multiplication protein 2A [Tarenaya hassleriana]
 ref|XP_010518877.1| PREDICTED: tobamovirus multiplication protein 2A [Tarenaya hassleriana]
Length=279

 Score =   328 bits (842),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 206/284 (73%), Positives = 232/284 (82%), Gaps = 5/284 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+GCLECLLK LNFLL L GLGMVGYGIYLFVEY+    + + H +      G  V  
Sbjct  1     MACRGCLECLLKFLNFLLALVGLGMVGYGIYLFVEYQR--ATDNSHMVTQTGDDG-YVSF  57

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+ V+L+N+IFD LPK WF+YLFIGIGV+LFV+SC GC+G  TRNGCCLSCYS LV
Sbjct  58    GRPMLMVVALSNDIFDKLPKAWFIYLFIGIGVVLFVVSCCGCVGTCTRNGCCLSCYSALV  117

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             ILLI+VELG AAFIFFD+ WKKEIP DRTGNF+MIY+FL+DNWKIVKWVALGAVVLEAL+
Sbjct  118   ILLIIVELGCAAFIFFDKSWKKEIPADRTGNFNMIYKFLQDNWKIVKWVALGAVVLEALL  177

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLAL+VRAAN P DYDSD++ I  PRQQIRQP + NRQ    TGVPVA TLD RPSRND
Sbjct  178   FLLALMVRAANAPPDYDSDEDLI-VPRQQIRQPFI-NRQPVAATGVPVAPTLDQRPSRND  235

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWS RMREKYGLDTSEFTYNPSES+R+Q    Q  EER RC +M
Sbjct  236   AWSTRMREKYGLDTSEFTYNPSESHRFQQMPAQQNEERSRCIVM  279



>ref|XP_007209447.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
 ref|XP_007209448.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
 gb|EMJ10646.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
 gb|EMJ10647.1| hypothetical protein PRUPE_ppa009704mg [Prunus persica]
Length=281

 Score =   328 bits (842),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 204/291 (70%), Positives = 235/291 (81%), Gaps = 17/291 (6%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPS-------GDDHPIPFPPS  959
             MAC+GC EC+LKLLNF+LTL GL MVGYGIYL VEY   + +       GD+        
Sbjct  1     MACRGCWECVLKLLNFVLTLVGLAMVGYGIYLLVEYLKAADTVAMSSLVGDNQ-------  53

Query  958   SGELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGccl  779
                L+QL RPML+ VSL++NI DNLPK WF+YLFIGIG ++FVISCFGC+ A TRNGCCL
Sbjct  54    --ALIQLSRPMLMTVSLSSNIVDNLPKAWFIYLFIGIGAIIFVISCFGCVAAMTRNGCCL  111

Query  778   scysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGA  599
             SCYSVL+ILLILVELG AAFIFFD+ W+ EIPTD++G+F+MIY FL+ +W IV+WVALGA
Sbjct  112   SCYSVLLILLILVELGGAAFIFFDKSWEAEIPTDKSGDFEMIYAFLKAHWDIVRWVALGA  171

Query  598   VVLEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLD  419
             VV EAL+FLLALVVRAANRPA+YDSDDE I  PRQQIRQPL+NNR   P TGVPVAG  D
Sbjct  172   VVFEALLFLLALVVRAANRPAEYDSDDELIA-PRQQIRQPLINNRPAVPATGVPVAGASD  230

Query  418   SRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
              RP+RNDAWS RMREKYGLDT+EFTYNPSESNR+QP   QP EER RC+IM
Sbjct  231   QRPNRNDAWSTRMREKYGLDTAEFTYNPSESNRFQPVPAQPQEERSRCSIM  281



>ref|XP_009345636.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
 ref|XP_009345644.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
Length=282

 Score =   328 bits (842),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 210/292 (72%), Positives = 236/292 (81%), Gaps = 18/292 (6%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKN-------HSPSGDDHPIPFPPS  959
             MAC+GCLECLLKLLNF+LTL GL MVGYGIYL VEY          SP GD H       
Sbjct  1     MACRGCLECLLKLLNFVLTLVGLAMVGYGIYLLVEYLRAADTTVMSSPVGDVH-------  53

Query  958   SGELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGccl  779
               +LVQL RPML+ VSL++NI DNLPK WF+YLFIGIG ++FVISCFGC+GA TRNGCCL
Sbjct  54    --DLVQLSRPMLMTVSLSDNILDNLPKAWFIYLFIGIGAIIFVISCFGCVGAMTRNGCCL  111

Query  778   scysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGA  599
             SCYSVLVILLILVELGAAAFIFFD+ W+ EIPTD +G+F MIY FL+ +W IV+WVALGA
Sbjct  112   SCYSVLVILLILVELGAAAFIFFDKSWEDEIPTDSSGDFKMIYAFLKAHWNIVRWVALGA  171

Query  598   VVLEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLD  419
             VV EAL+FLLALVVRAANRPA+YDSDDE I  PRQQIRQPL++NR   P TGVPVAG LD
Sbjct  172   VVFEALLFLLALVVRAANRPAEYDSDDELI-APRQQIRQPLISNRPAVPATGVPVAGALD  230

Query  418   SR-PSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
              R P+RNDAWS RMREKYGLDT+EFTYNPSES+R+Q    QP EER RC +M
Sbjct  231   QRTPNRNDAWSTRMREKYGLDTAEFTYNPSESHRFQQVAAQPQEERSRCIVM  282



>ref|XP_004511769.1| PREDICTED: tetraspanin-20-like isoform X1 [Cicer arietinum]
 ref|XP_004511770.1| PREDICTED: tetraspanin-20-like isoform X2 [Cicer arietinum]
 ref|XP_004511771.1| PREDICTED: tetraspanin-20-like isoform X3 [Cicer arietinum]
Length=281

 Score =   328 bits (842),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 202/285 (71%), Positives = 233/285 (82%), Gaps = 5/285 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS-GELVQ  941
             MAC+G  ECLLKLLNF+LTL GL MVGYGIYLFV +   S   DD P   P S    L+Q
Sbjct  1     MACRGFWECLLKLLNFILTLTGLAMVGYGIYLFVGFTKAS--DDDIPEISPVSDDSALIQ  58

Query  940   LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
             LGRPML+A+SL++++FD LPK WF+YLFIG+G +LFV+SCFGCIGA TRNGCCL CYS+L
Sbjct  59    LGRPMLLAMSLSDSLFDKLPKAWFIYLFIGVGAVLFVVSCFGCIGAKTRNGCCLICYSIL  118

Query  760   villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             V LLILVELG AAF+FFD+ WK+EIPTD+TG+FDMIY FL +NW IV+WVALG V+ EAL
Sbjct  119   VALLILVELGCAAFLFFDKSWKQEIPTDKTGDFDMIYGFLRENWNIVRWVALGIVIFEAL  178

Query  580   MFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRN  401
             +FLLAL+VRA NRP DYDSDDE I   RQQ+RQPL+ NRQ  P TG+PVAGT D RP+RN
Sbjct  179   LFLLALIVRAVNRPVDYDSDDELI-IQRQQVRQPLI-NRQTGPPTGLPVAGTTDQRPNRN  236

Query  400   DAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             DAWS RMREKYGLDTSEFTYNPSES R+Q  N QP EE+ RCTIM
Sbjct  237   DAWSTRMREKYGLDTSEFTYNPSESQRFQQVNSQPTEEKSRCTIM  281



>ref|XP_010478663.1| PREDICTED: tobamovirus multiplication protein 2A-like [Camelina 
sativa]
Length=281

 Score =   327 bits (837),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 202/286 (71%), Positives = 238/286 (83%), Gaps = 7/286 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  944
             MAC+GCLECLLKLLNFLL + GLGM+GYGIYLFVEYK  +   D+    F P +G+   +
Sbjct  1     MACRGCLECLLKLLNFLLAVVGLGMIGYGIYLFVEYKRAT---DNSSGTFDPVNGDQSYI  57

Query  943   QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
               GRP+L+AV+L++N+FDNLPK WF+YLFIGIGV LFVISC GC+G  +R+ CCLSCYS+
Sbjct  58    SFGRPLLMAVTLSSNVFDNLPKAWFIYLFIGIGVALFVISCCGCVGTCSRSVCCLSCYSL  117

Query  763   lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
             L+ILLILVELG AAFIFFD  W++EIP+DRTGNF+ IY FL +NW IV+WVALGAVV EA
Sbjct  118   LLILLILVELGVAAFIFFDHSWREEIPSDRTGNFETIYNFLRENWMIVRWVALGAVVFEA  177

Query  583   LMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
             L+FLLAL+VR+AN P +YDSDDE+I  PRQQIRQP + NRQ  PVTGVPVA TLD RPSR
Sbjct  178   LLFLLALMVRSANSPPEYDSDDEFI-APRQQIRQPFI-NRQATPVTGVPVAPTLDQRPSR  235

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             +D WSARMREKYGLDTSEFTYNPSES+R+Q    QP EE+GRCTIM
Sbjct  236   SDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNEEKGRCTIM  281



>ref|XP_009114889.1| PREDICTED: tobamovirus multiplication protein 2A [Brassica rapa]
Length=281

 Score =   325 bits (834),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 200/287 (70%), Positives = 238/287 (83%), Gaps = 9/287 (3%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS---GEL  947
             MAC+GCLECLLKLLNF+L +AGLG++GYGIYLFVE+K  +    DH +   P++      
Sbjct  1     MACRGCLECLLKLLNFILAVAGLGIIGYGIYLFVEFKRAT----DHSVSLIPTNVNDQSY  56

Query  946   VQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscys  767
             V  GRPML+AV+L++N+FDNLPK WF+YLFIGIGV+LFV SC GC+G  +R+ CCLSCYS
Sbjct  57    VSFGRPMLMAVALSSNVFDNLPKAWFIYLFIGIGVVLFVTSCCGCVGTCSRSICCLSCYS  116

Query  766   vlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLE  587
             +L+ILLIL ELGAAAFIFFD  W+ +IP+D+TGNFD IY FL++NW IV+WVALGAVV E
Sbjct  117   LLLILLILAELGAAAFIFFDNSWRDQIPSDKTGNFDTIYHFLKENWNIVRWVALGAVVFE  176

Query  586   ALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPS  407
             AL+FLLAL+VRAAN P +YDSDDE+I  PR QIRQP + NRQ APVTGVPVA TLD RPS
Sbjct  177   ALLFLLALMVRAANTPDEYDSDDEFIAPPR-QIRQPFI-NRQPAPVTGVPVAPTLDQRPS  234

Query  406   RNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             R+D WSARMREKYGLDTSEFTYNPSES+R+Q    QP EE+GRCTIM
Sbjct  235   RSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPTQPNEEKGRCTIM  281



>emb|CDX93836.1| BnaA09g24360D [Brassica napus]
Length=281

 Score =   325 bits (833),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 200/287 (70%), Positives = 238/287 (83%), Gaps = 9/287 (3%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS---GEL  947
             MAC+GCLECLLKLLNF+L +AGL ++GYGIYLFVE+K  +    DH + F P++      
Sbjct  1     MACRGCLECLLKLLNFILAVAGLSIIGYGIYLFVEFKRAT----DHSVSFIPTNVNDQSY  56

Query  946   VQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscys  767
             V  GRPML+AV+L++N+FDNLPK WF+YLFIGIGV+LFV SC GC+G  +R+ CCLSCYS
Sbjct  57    VSFGRPMLMAVALSSNVFDNLPKAWFIYLFIGIGVVLFVTSCCGCVGTCSRSICCLSCYS  116

Query  766   vlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLE  587
             +L+ILLIL ELGAAAFIFFD  W+ +IP+D+TGNFD IY FL++NW IV+WVALGAVV E
Sbjct  117   LLLILLILAELGAAAFIFFDNSWRDQIPSDKTGNFDTIYHFLKENWNIVRWVALGAVVFE  176

Query  586   ALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPS  407
             AL+FLLAL+VRAAN P +YDSDDE+I  PR QIRQP + NRQ APVTGVPVA TLD RPS
Sbjct  177   ALLFLLALMVRAANTPDEYDSDDEFIAPPR-QIRQPFI-NRQPAPVTGVPVAPTLDQRPS  234

Query  406   RNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             R+D WSARMREKYGLDTSEFTYNPSES+R+Q    QP EE+GRCTIM
Sbjct  235   RSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPTQPNEEKGRCTIM  281



>ref|XP_009385932.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009385933.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=283

 Score =   324 bits (831),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 205/285 (72%), Positives = 229/285 (80%), Gaps = 3/285 (1%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSG-ELVQ  941
             MACKG  ECLLKLLNFLLTL GL MVGYGIYL V +   S SG    + FP     E ++
Sbjct  1     MACKGFWECLLKLLNFLLTLTGLAMVGYGIYLLVIWNKASSSGVGEDLAFPTGGDPEFLK  60

Query  940   LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
             LGRPMLVAVSL+++  D+LPK WF+YLFIG+G+++FVISCFGCIGA TRNGCCLSCY+ L
Sbjct  61    LGRPMLVAVSLSSSFLDHLPKAWFIYLFIGVGIIIFVISCFGCIGALTRNGCCLSCYAFL  120

Query  760   villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             VILL+LVE+ AAAFI FD  WK  IP D+TGNF+ IY FLEDNWKI KWVALGAV+LEA 
Sbjct  121   VILLVLVEVAAAAFIIFDHSWKDLIPDDKTGNFETIYNFLEDNWKIAKWVALGAVILEAF  180

Query  580   MFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRN  401
             +F+LAL+VRAANRPA+YDSDDEYI  PR  IRQPLM NRQ  P TGVPV GTLD RPSRN
Sbjct  181   VFVLALIVRAANRPAEYDSDDEYI-APRSTIRQPLM-NRQGTPATGVPVLGTLDHRPSRN  238

Query  400   DAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             DAWS RMREKYGLDTSEFTYNPS+ NRYQP      EERGRC IM
Sbjct  239   DAWSQRMREKYGLDTSEFTYNPSDPNRYQPATAPQVEERGRCIIM  283



>ref|XP_006305495.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
 gb|EOA38393.1| hypothetical protein CARUB_v10009959mg [Capsella rubella]
Length=256

 Score =   323 bits (827),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 183/262 (70%), Positives = 218/262 (83%), Gaps = 8/262 (3%)
 Frame = -1

Query  1045  MVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LVQLGRPMLVAVSLANNIFDNLPKEW  872
             M+GYGIYLFVEYK  +    D+ + F P +G+   V  GRPML+AV++++N+FDNLPK W
Sbjct  1     MIGYGIYLFVEYKRAT----DNSVTFDPVNGDQSFVSFGRPMLMAVAMSSNVFDNLPKAW  56

Query  871   FLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWKK  692
             F+YLFIGIGV LFVISC GC+G  +R+ CCLSCYS+L+ILLILVELG AAFIFFD  W++
Sbjct  57    FIYLFIGIGVALFVISCCGCVGTCSRSVCCLSCYSLLLILLILVELGVAAFIFFDHSWRE  116

Query  691   EIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDDEY  512
             EIP+DRTGNF+ IY FL++NW IV+WVALGAVV EAL+FLLAL+VR+AN P +YDSDDE+
Sbjct  117   EIPSDRTGNFETIYNFLQENWMIVRWVALGAVVFEALLFLLALMVRSANSPPEYDSDDEF  176

Query  511   IGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPS  332
             I  PRQQIRQP + NRQ  PVTGVPVA TLD RPSR+D WSARMREKYGLDTSEFTYNPS
Sbjct  177   I-APRQQIRQPFI-NRQATPVTGVPVAPTLDQRPSRSDPWSARMREKYGLDTSEFTYNPS  234

Query  331   ESNRYQPTNVQPAEERGRCTIM  266
             ES+R+Q    QP EE+GRCTIM
Sbjct  235   ESHRFQQMPAQPNEEKGRCTIM  256



>ref|XP_008238361.1| PREDICTED: tobamovirus multiplication protein 2A [Prunus mume]
Length=281

 Score =   323 bits (828),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 201/291 (69%), Positives = 235/291 (81%), Gaps = 17/291 (6%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPS-------GDDHPIPFPPS  959
             MAC+GC ECLLKLLNF+LTL GL MVGYGIYL VEY   + +       GD+        
Sbjct  1     MACRGCWECLLKLLNFVLTLVGLAMVGYGIYLLVEYLKAADTVAMSSLVGDNQ-------  53

Query  958   SGELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGccl  779
                L+QL RPML+ VSL++NI+DNLPK WF+Y+FIGIG ++FVISCFGC+ A TRNGCCL
Sbjct  54    --ALIQLSRPMLMTVSLSSNIWDNLPKAWFIYVFIGIGAIIFVISCFGCVAAMTRNGCCL  111

Query  778   scysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGA  599
             SCYSVL+ILLILVEL  AAFIFFD+ W+ EIPTD++G+F+MIY FL+ +W IV+WVALGA
Sbjct  112   SCYSVLLILLILVELAGAAFIFFDKSWEAEIPTDKSGDFEMIYAFLKAHWDIVRWVALGA  171

Query  598   VVLEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLD  419
             VV EAL+FLLALVVRAAN+PA+YDSDDE I  PRQQIRQPL+N+R   P TGVPVAG  D
Sbjct  172   VVFEALLFLLALVVRAANKPAEYDSDDELIA-PRQQIRQPLINSRPAVPATGVPVAGASD  230

Query  418   SRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
              RP+RNDAWS RMREKYGLDT+EFTYNPSESNR+QP   QP EER RC+IM
Sbjct  231   QRPNRNDAWSTRMREKYGLDTAEFTYNPSESNRFQPVPAQPQEERSRCSIM  281



>ref|XP_009398578.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=283

 Score =   322 bits (825),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 198/285 (69%), Positives = 227/285 (80%), Gaps = 3/285 (1%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDD-HPIPFPPSSGELVQ  941
             MAC+G  ECLLKLLNFLLTL GL MVGYG YL VE+   S S DD  PI     + E + 
Sbjct  1     MACRGLWECLLKLLNFLLTLTGLAMVGYGAYLLVEWNRVSSSDDDDEPISPTGDNPEFLT  60

Query  940   LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
              GRPMLVAVSL+++  D LPK WF+YL IGIGV+LF+ISCFG IGA +RNGCCLSCYS L
Sbjct  61    FGRPMLVAVSLSSSFLDKLPKAWFIYLIIGIGVVLFIISCFGFIGAVSRNGCCLSCYSFL  120

Query  760   villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             VILLILVELGAAAFIFFD  WK  IP D+TGNFD+IY+FLE+NWKI KWVALGAV+LEAL
Sbjct  121   VILLILVELGAAAFIFFDHSWKHIIPVDKTGNFDVIYDFLEENWKIAKWVALGAVILEAL  180

Query  580   MFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRN  401
             +FLLAL+VRAANRP +YDSDDEYI      IRQPL+ N+Q AP TG+PV+GTLD RPSR+
Sbjct  181   VFLLALIVRAANRPVEYDSDDEYI-AQSSGIRQPLI-NQQGAPATGMPVSGTLDQRPSRH  238

Query  400   DAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             DAWS RMREKYGLDTS+FTYN S+ NR Q +    +EERG C I+
Sbjct  239   DAWSQRMREKYGLDTSKFTYNSSDPNRSQQSATPSSEERGGCNIL  283



>emb|CDY01278.1| BnaC05g24540D [Brassica napus]
Length=281

 Score =   320 bits (820),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 199/287 (69%), Positives = 235/287 (82%), Gaps = 9/287 (3%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS---GEL  947
             MAC+GCLECLLKLLNFLL +AGLG++ YGIYLFV +K  +    DH + F P++      
Sbjct  1     MACRGCLECLLKLLNFLLAVAGLGIIAYGIYLFVVFKRAT----DHSVSFIPTNVNDQSY  56

Query  946   VQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscys  767
             V  GRPML+AV+L++N+FDNLPK WF+YLFIGIGV+LFV SC GC+G  +R+ CCLSCYS
Sbjct  57    VSFGRPMLMAVALSSNVFDNLPKAWFVYLFIGIGVVLFVTSCCGCVGTCSRSICCLSCYS  116

Query  766   vlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLE  587
             +L+ILLIL ELGAAAFIFFD  W+ +IP+D+TGNFD IY FL+ NW IV+WVALGAVV E
Sbjct  117   LLLILLILAELGAAAFIFFDNSWRDQIPSDKTGNFDTIYHFLKQNWNIVRWVALGAVVFE  176

Query  586   ALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPS  407
             AL+FLLAL+VRAAN P +YDSDDE+I  PR QIRQP + NRQ APVTGVPV  TLD RPS
Sbjct  177   ALLFLLALMVRAANTPDEYDSDDEFIAPPR-QIRQPFI-NRQPAPVTGVPVVPTLDQRPS  234

Query  406   RNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             R+D WSARMREKYGLDTSEFTYNPSES+R+Q    QP EE+GRCTIM
Sbjct  235   RSDPWSARMREKYGLDTSEFTYNPSESHRFQQMPTQPNEEKGRCTIM  281



>ref|XP_010919853.1| PREDICTED: tobamovirus multiplication protein 2A-like [Elaeis 
guineensis]
 ref|XP_010919854.1| PREDICTED: tobamovirus multiplication protein 2A-like [Elaeis 
guineensis]
Length=282

 Score =   320 bits (820),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 202/284 (71%), Positives = 229/284 (81%), Gaps = 2/284 (1%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+G  ECLLKLLNFLL L GL MVGYG YL VE+   S S DD PI     + EL++L
Sbjct  1     MACRGFWECLLKLLNFLLMLTGLAMVGYGAYLLVEWMKISSSEDDDPISPVGDNYELLKL  60

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML   +L+++I D LPK WF+YLFIGIGV+LF+ISCFGCIG   RNGCC+SCYS LV
Sbjct  61    GRPMLAVATLSDSILDKLPKAWFIYLFIGIGVILFIISCFGCIGVVMRNGCCISCYSFLV  120

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             ILLILVELGAAAFIFFD RWK  IP D+TG+FDMIY+FL+ NWKI KWVALGAV+LEAL+
Sbjct  121   ILLILVELGAAAFIFFDHRWKDVIPADKTGDFDMIYDFLKKNWKIAKWVALGAVILEALL  180

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLAL+VRAAN PADYDSDDEYI  P   IRQPLM +RQ  P TGVPV GTLD RPSRND
Sbjct  181   FLLALMVRAANTPADYDSDDEYI-TPASGIRQPLM-HRQGVPATGVPVHGTLDQRPSRND  238

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWS RMREKYGLDTSEFTYNP + +R+Q  +  P +ERGRCTI+
Sbjct  239   AWSQRMREKYGLDTSEFTYNPLDPSRHQQASAPPPDERGRCTIL  282



>gb|AAF81337.1|AC007767_17 Contains similarity to GMFP4 from Glycine max gb|U64915. ESTs 
gb|AV442477, gb|AV441037, gb|AV534954, gb|AV560678 and gb|AV518757 
come from this gene [Arabidopsis thaliana]
Length=252

 Score =   318 bits (816),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 189/286 (66%), Positives = 218/286 (76%), Gaps = 36/286 (13%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  944
             MAC+GCLECLLKLLNFLL +AGLGM+GYGIYLFVEYK  +    D+ + F  ++G+   V
Sbjct  1     MACRGCLECLLKLLNFLLAVAGLGMIGYGIYLFVEYKRVT----DNSVTFDLTNGDQSYV  56

Query  943   QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
               GRP+L+AVSL++NIFDNLPK WF+YLFIGIGV LFVISC GC+               
Sbjct  57    SFGRPILMAVSLSSNIFDNLPKAWFIYLFIGIGVALFVISCCGCV---------------  101

Query  763   lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
                          AFIFFD  W+ E+P+DRTGNFD IY FL +NWKIV+WVALGAVV EA
Sbjct  102   -------------AFIFFDNSWRDELPSDRTGNFDTIYNFLRENWKIVRWVALGAVVFEA  148

Query  583   LMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
             L+FLLAL+VRAAN PA+YDSDDEY+  PRQQIRQP + NRQ APVTGVPVA TLD RPSR
Sbjct  149   LLFLLALMVRAANTPAEYDSDDEYL-APRQQIRQPFI-NRQAAPVTGVPVAPTLDQRPSR  206

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             +D WSARMREKYGLDTSEFTYNPSES+R+Q    QP EE+GRCTIM
Sbjct  207   SDPWSARMREKYGLDTSEFTYNPSESHRFQQMPAQPNEEKGRCTIM  252



>ref|XP_010104372.1| hypothetical protein L484_023325 [Morus notabilis]
 gb|EXB99792.1| hypothetical protein L484_023325 [Morus notabilis]
Length=251

 Score =   317 bits (812),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 191/289 (66%), Positives = 216/289 (75%), Gaps = 43/289 (15%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHS-----PSGDDHPIPFPPSSG  953
             MAC+GCLECLLKLLNFLLTL GL +VGYGIYL VEY   +     P GDDH         
Sbjct  1     MACRGCLECLLKLLNFLLTLVGLAIVGYGIYLLVEYTKSTDDTAPPVGDDH---------  51

Query  952   ELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclsc  773
               +QLGRPML+A S++  IFD LPK WF+YLFIG+G +LFVISCFGC+GA TRNGCCLSC
Sbjct  52    NSMQLGRPMLMAASMSAGIFDKLPKAWFIYLFIGLGAILFVISCFGCVGAVTRNGCCLSC  111

Query  772   ysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVV  593
                                        EIPTD+TG+FDM+Y FL+D+WKIV+WVALGAVV
Sbjct  112   ---------------------------EIPTDKTGDFDMVYAFLKDHWKIVRWVALGAVV  144

Query  592   LEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSR  413
              EAL+FL AL+V++ANRPA+YDSDDE+I  PRQQIRQPL+N RQ AP TGVPVAGTLD R
Sbjct  145   FEALLFLFALLVKSANRPAEYDSDDEFIA-PRQQIRQPLIN-RQAAPATGVPVAGTLDQR  202

Query  412   PSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             PSRNDAWS RMREKYGLDTSEFTYNPSESNR+Q    QP EER RCTIM
Sbjct  203   PSRNDAWSTRMREKYGLDTSEFTYNPSESNRFQQVAPQPTEERSRCTIM  251



>gb|KJB51696.1| hypothetical protein B456_008G228700 [Gossypium raimondii]
Length=219

 Score =   314 bits (804),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 169/221 (76%), Positives = 194/221 (88%), Gaps = 2/221 (1%)
 Frame = -1

Query  928  MLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvill  749
            ML+AVSL+++IFDNLPK WFLYLFIG+GV+LF+ISCFGCIG +TRN CCL+CYS+LVILL
Sbjct  1    MLMAVSLSSSIFDNLPKAWFLYLFIGVGVVLFIISCFGCIGTATRNLCCLTCYSLLVILL  60

Query  748  ilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLL  569
            ILVELG AAFIFFD+ WK EIPTD+TG+FDMIYEFLE+NW I+KWVALG VVLEA +FLL
Sbjct  61   ILVELGCAAFIFFDKSWKDEIPTDKTGDFDMIYEFLEENWTILKWVALGIVVLEAFIFLL  120

Query  568  ALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWS  389
            AL+VRAAN PADYDSDDE+I  PR+Q RQPL++     P +GVPV+ +LD RPSRNDAWS
Sbjct  121  ALMVRAANIPADYDSDDEFI-APREQ-RQPLISRPPSVPASGVPVSVSLDQRPSRNDAWS  178

Query  388  ARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            ARMREKYGLDTSEFTYNP+ESNRYQ     PAEER RCTIM
Sbjct  179  ARMREKYGLDTSEFTYNPAESNRYQQVVPPPAEERSRCTIM  219



>ref|XP_008784675.1| PREDICTED: tobamovirus multiplication protein 2A-like [Phoenix 
dactylifera]
 ref|XP_008784676.1| PREDICTED: tobamovirus multiplication protein 2A-like [Phoenix 
dactylifera]
 ref|XP_008784677.1| PREDICTED: tobamovirus multiplication protein 2A-like [Phoenix 
dactylifera]
Length=282

 Score =   315 bits (806),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 202/284 (71%), Positives = 227/284 (80%), Gaps = 2/284 (1%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+G  ECLLKLLNFLL L GL MVGYG YL VE+   S   DD PI     + EL++L
Sbjct  1     MACRGFWECLLKLLNFLLMLTGLAMVGYGAYLLVEWIKISSGQDDGPISPVSDNYELLKL  60

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML  V+L+ +I D LPK WF+YLFIGIGV+LF+ISCFGCIG   RNGCCLSCYSVLV
Sbjct  61    GRPMLAVVTLSESILDKLPKAWFIYLFIGIGVILFIISCFGCIGVIARNGCCLSCYSVLV  120

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             ILLILVELGAAAFIFFD  WK  IP D+T +FDMIYEFL++NWKI KWVALGAV+LEAL+
Sbjct  121   ILLILVELGAAAFIFFDHSWKDVIPADKTRDFDMIYEFLKENWKIAKWVALGAVILEALL  180

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLAL+VRAAN PADYDSDDEYI  P    RQPL+ +RQ  P TGVPV GTLD RPSRND
Sbjct  181   FLLALIVRAANTPADYDSDDEYI-NPGSGFRQPLI-HRQAVPATGVPVPGTLDQRPSRND  238

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWS RMREKYGLDTSEFTYNP + +R+Q  +  PA ERGRCTI+
Sbjct  239   AWSQRMREKYGLDTSEFTYNPLDPSRHQQASAPPAAERGRCTIL  282



>ref|XP_010538377.1| PREDICTED: tobamovirus multiplication protein 2A-like [Tarenaya 
hassleriana]
 ref|XP_010538378.1| PREDICTED: tobamovirus multiplication protein 2A-like [Tarenaya 
hassleriana]
Length=280

 Score =   315 bits (806),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 203/285 (71%), Positives = 231/285 (81%), Gaps = 6/285 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+GCLECLLKLLNFLL L GLGMVGYGIYLFVEY+  +   D+  +    S    + L
Sbjct  1     MACRGCLECLLKLLNFLLALVGLGMVGYGIYLFVEYQRAT---DNSHMVAQTSGDGYISL  57

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+AVSL+N+IFD LPK WF+YLFIGIGV+LFV+SC GC+G  TRN CCLSCYS LV
Sbjct  58    GRPMLMAVSLSNDIFDKLPKPWFIYLFIGIGVILFVVSCCGCLGVCTRNVCCLSCYSALV  117

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             ILL++VELG AAFIFFD+ WK+EIP D+TGNFDMIY FL+DNWKIVKWVALGAVVLEAL+
Sbjct  118   ILLVVVELGCAAFIFFDKSWKEEIPADKTGNFDMIYMFLQDNWKIVKWVALGAVVLEALL  177

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLAL+VRAAN P DYDSDD+ I  PRQQIRQP + NRQ    TGVPV   +   PSR+D
Sbjct  178   FLLALMVRAANAPPDYDSDDDII-VPRQQIRQPFL-NRQPVTATGVPVTTAIPQPPSRDD  235

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERG-RCTIM  266
             AWS RMREKYGLDTSEFTYNPSE+NR+Q    Q  +ERG RCTIM
Sbjct  236   AWSTRMREKYGLDTSEFTYNPSEANRFQQMPSQQNDERGSRCTIM  280



>gb|AFK47448.1| unknown [Medicago truncatula]
Length=220

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 193/221 (87%), Gaps = 1/221 (0%)
 Frame = -1

Query  928  MLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvill  749
            ML+AVSL++NIFD LPK WF+YLFIG+G +LFV+SCFGCIGA+TRNGCCL CYS+LV LL
Sbjct  1    MLMAVSLSDNIFDKLPKAWFIYLFIGVGAVLFVVSCFGCIGATTRNGCCLICYSILVALL  60

Query  748  ilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLL  569
            ILVELG AAF+FFD+ WK+EIPTD+TG+FDMIY FL +NW IV+WVALG V+ EAL+FLL
Sbjct  61   ILVELGCAAFLFFDKSWKEEIPTDKTGDFDMIYGFLRENWDIVRWVALGIVIFEALLFLL  120

Query  568  ALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWS  389
            AL+VRA NRPADYDSDDE I  PRQQ+RQPL+NNRQ  P +G+PVAGT D RP+RNDAWS
Sbjct  121  ALIVRAVNRPADYDSDDELIN-PRQQVRQPLLNNRQAGPPSGLPVAGTTDQRPNRNDAWS  179

Query  388  ARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             RMREKYGLDTSEFTYNPSES R+Q  N QP EE+ RCTIM
Sbjct  180  TRMREKYGLDTSEFTYNPSESQRFQQANFQPTEEKSRCTIM  220



>ref|XP_003611446.1| GMFP4 [Medicago truncatula]
Length=220

 Score =   309 bits (791),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 167/221 (76%), Positives = 193/221 (87%), Gaps = 1/221 (0%)
 Frame = -1

Query  928  MLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvill  749
            ML+AVSL++NIFD LPK WF+YLFIG+G +LFV+SCFGCIGA+TRNGCCL CYS+LV LL
Sbjct  1    MLMAVSLSDNIFDKLPKAWFIYLFIGVGAVLFVVSCFGCIGATTRNGCCLICYSILVALL  60

Query  748  ilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLL  569
            ILVELG AAF+FFD+ WK+EIPTD+TG+FDMIY FL +NW IV+WVALG V+ EAL+FLL
Sbjct  61   ILVELGCAAFLFFDKSWKEEIPTDKTGDFDMIYGFLRENWDIVRWVALGIVIFEALLFLL  120

Query  568  ALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWS  389
            AL+VRA NRPADYDSDDE I  PRQQ+RQPL+NNRQ  P +G+PVAGT D RP+RNDAWS
Sbjct  121  ALIVRAVNRPADYDSDDELIN-PRQQVRQPLLNNRQAGPPSGLPVAGTTDQRPNRNDAWS  179

Query  388  ARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             RMREKYGLDTSEFTYNPSES R+Q  N QP EE+ RCTIM
Sbjct  180  TRMREKYGLDTSEFTYNPSESQRFQQANSQPTEEKSRCTIM  220



>ref|XP_010933519.1| PREDICTED: tobamovirus multiplication protein 2A-like [Elaeis 
guineensis]
Length=283

 Score =   310 bits (794),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 194/284 (68%), Positives = 221/284 (78%), Gaps = 1/284 (0%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+G  EC+LKLLNFLLT+ GL MVGYG+YL VE+   S    D PI     + E  +L
Sbjct  1     MACRGFWECMLKLLNFLLTIIGLAMVGYGVYLLVEWNKISSGDGDGPISPVSDNYEFTKL  60

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
              RPML  V+L+ +I D LP  WF+YLFIGIGV+LFVISCFGCIGA TRNGCCLS YS LV
Sbjct  61    RRPMLAVVTLSESILDKLPNAWFIYLFIGIGVILFVISCFGCIGALTRNGCCLSFYSFLV  120

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             ILLILVELGAAAFIFFD  WK  IP D+TG+FDM+Y FL++NWKI KWV LGAV+LEAL+
Sbjct  121   ILLILVELGAAAFIFFDHSWKDLIPADKTGDFDMMYGFLKENWKIAKWVVLGAVILEALL  180

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             F LAL+VRAANRPADYDSDD+    PR  I+QPL+ NRQ  P TGVPV   LD RPSRND
Sbjct  181   FFLALIVRAANRPADYDSDDDEYIAPRSGIQQPLI-NRQGVPATGVPVPAILDQRPSRND  239

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWS RMREKYGLDTSEFT+NPS  +RY   +  PAEERGRCTI+
Sbjct  240   AWSQRMREKYGLDTSEFTHNPSGLSRYHQASAPPAEERGRCTIL  283



>emb|CBI33948.3| unnamed protein product [Vitis vinifera]
Length=217

 Score =   305 bits (781),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 161/219 (74%), Positives = 188/219 (86%), Gaps = 2/219 (1%)
 Frame = -1

Query  922  VAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillil  743
            +AV+L+++I DNLPK WF+Y F  IGV+LFVISCFGC+GA TRNGCCLSCY+VLVILLIL
Sbjct  1    MAVTLSSSILDNLPKAWFIYCFFAIGVILFVISCFGCVGAVTRNGCCLSCYAVLVILLIL  60

Query  742  veLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLAL  563
            +ELG AAFIFFD+ W+ +IPTD+TG+FDMIY+FL++NWKIVKWVAL AV+LEAL+F+L L
Sbjct  61   IELGCAAFIFFDKSWEDDIPTDKTGDFDMIYDFLKENWKIVKWVALAAVILEALLFVLTL  120

Query  562  VVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSAR  383
            +VRAAN+P DYDSDDE+I   RQ +RQPL+ NR     TGVPVAG +D RPSRNDAWS R
Sbjct  121  MVRAANKPDDYDSDDEFIAQ-RQSVRQPLI-NRPPVAATGVPVAGAIDQRPSRNDAWSTR  178

Query  382  MREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            MREKYGLDTSEFTYNPSESNRY P   QP EER RCTIM
Sbjct  179  MREKYGLDTSEFTYNPSESNRYPPGQQQPTEERSRCTIM  217



>ref|XP_008788690.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008788691.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Phoenix dactylifera]
 ref|XP_008788692.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X1 [Phoenix dactylifera]
Length=279

 Score =   306 bits (783),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 191/284 (67%), Positives = 225/284 (79%), Gaps = 5/284 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+GC ECLLKLLNF+LT+AGL MVGYG+YL VE+   S  G + PI     +  ++ L
Sbjct  1     MACRGCFECLLKLLNFVLTVAGLAMVGYGVYLLVEWNKVSAGGGEDPISPDSDNPAMLTL  60

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+ V ++ +  D LPK WF+YLFIGIGV+LF+ISC GC+GA+TRNGCCLS YS LV
Sbjct  61    GRPMLLVVPVSTSFVDQLPKAWFIYLFIGIGVILFIISCCGCVGATTRNGCCLSWYSFLV  120

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             ILLILVEL AAAFIFFD  WK  IP D+TG+FDMIY FL++NWKI KWVALGAV+LEAL 
Sbjct  121   ILLILVELAAAAFIFFDHSWKDAIPADKTGDFDMIYNFLKENWKIAKWVALGAVILEALA  180

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLAL++RA N+PADYDSDDEYI  P+  I QPL+ NRQ  P +GVP   +LD RPSRND
Sbjct  181   FLLALMIRAVNQPADYDSDDEYI-APKSAIHQPLI-NRQGLPPSGVP---SLDHRPSRND  235

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWS RMREKYGLDTSEFTYNPS+ +R+Q   V  AEE GRCTI+
Sbjct  236   AWSQRMREKYGLDTSEFTYNPSDPSRFQQATVTSAEESGRCTIL  279



>gb|EYU17843.1| hypothetical protein MIMGU_mgv1a0124672mg, partial [Erythranthe 
guttata]
Length=221

 Score =   301 bits (771),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 161/225 (72%), Positives = 185/225 (82%), Gaps = 5/225 (2%)
 Frame = -1

Query  940  LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
            LGRPML+AVSLA+NIFD LPK WF+YLFIG+G ++  I+C GCIG +TRNGCCL+CYS+L
Sbjct  1    LGRPMLLAVSLADNIFDKLPKAWFIYLFIGLGGIVLFIACCGCIGTATRNGCCLTCYSLL  60

Query  760  villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
            VILLIL ELG AAFIFFD+ WK     D    F MIY+FL+D+WKIVKWVALGAV+LEAL
Sbjct  61   VILLILAELGFAAFIFFDDDWK-----DVNWKFSMIYDFLDDHWKIVKWVALGAVILEAL  115

Query  580  MFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRN  401
            +FLLAL+VRAAN P+DYDSD+EYIGG RQQIRQPL+N     PVTG PV   LD R SR 
Sbjct  116  IFLLALIVRAANSPSDYDSDEEYIGGSRQQIRQPLINRPAGGPVTGPPVTNNLDQRTSRT  175

Query  400  DAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            D+WS RMREKYGLDTSEFTYNPSESNRYQ +  QP+EER RC I+
Sbjct  176  DSWSTRMREKYGLDTSEFTYNPSESNRYQQSATQPSEERNRCCII  220



>ref|XP_010934868.1| PREDICTED: tobamovirus multiplication protein 2A isoform X1 [Elaeis 
guineensis]
Length=280

 Score =   301 bits (771),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 192/285 (67%), Positives = 226/285 (79%), Gaps = 6/285 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+GC ECLLKLLNF+LT+AGL MVGYG+YL VE+   S  G + PI     +  ++ L
Sbjct  1     MACRGCFECLLKLLNFVLTVAGLAMVGYGVYLLVEWIKVSSGGGEDPISPVSDNPVMLTL  60

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+   ++ +  D LPK WF+YLFIGIGV+LF+ISC GC+GA+TRNGCCLSCYS LV
Sbjct  61    GRPMLLVAPISTSFVDQLPKAWFIYLFIGIGVILFIISCCGCVGATTRNGCCLSCYSFLV  120

Query  757   illilveLGAAAFIFFDERWKKEI-PTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             ILLILVEL AAAFIFFD  WK  I P D+TG+FDMIY FL+ NWKI KWVALGAV+LEAL
Sbjct  121   ILLILVELAAAAFIFFDHSWKDAIIPADKTGDFDMIYSFLKKNWKIAKWVALGAVILEAL  180

Query  580   MFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRN  401
              FLLAL++RA N+P DYDSDDEYI  PR+ IRQPL+ NRQ  P +GVP   +LD RPSRN
Sbjct  181   AFLLALMIRAVNQPTDYDSDDEYI-APRRGIRQPLI-NRQGLPPSGVP---SLDHRPSRN  235

Query  400   DAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             DAWS RMREKYGLDTSEFTYNPS+ +R+Q   +  AEERGRCTI+
Sbjct  236   DAWSQRMREKYGLDTSEFTYNPSDPSRFQQATITSAEERGRCTIL  280



>ref|XP_010053569.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
 ref|XP_010053570.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
 ref|XP_010053571.1| PREDICTED: tobamovirus multiplication protein 2A-like [Eucalyptus 
grandis]
Length=284

 Score =   300 bits (768),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 201/287 (70%), Positives = 236/287 (82%), Gaps = 6/287 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+GCLEC+LKLLNFLLTL GL MVGYGIYLFVEYK  S SG     P     G  VQL
Sbjct  1     MACRGCLECVLKLLNFLLTLVGLAMVGYGIYLFVEYK-RSSSGTVGYSPIGADEGS-VQL  58

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRP+LV VSL+ +IFDNLPK WF++LFIG+GV+LF+ISCFGCIG+ TRNGCCL+CYSVLV
Sbjct  59    GRPLLVTVSLSASIFDNLPKAWFIFLFIGVGVVLFIISCFGCIGSVTRNGCCLTCYSVLV  118

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             ILLILVELG AAFI+FD+ W+ ++PTD TG+FDMIY+FL+++W IV+WVALG VVLEAL+
Sbjct  119   ILLILVELGCAAFIYFDKSWEDDLPTDATGDFDMIYDFLKEHWTIVRWVALGVVVLEALV  178

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNN---RQQAPVTGVPVAGTLDSRPS  407
             FLLAL+VRAANRPA+YDSDDE I  P+QQIR+PL++        P  GV  AG LD RPS
Sbjct  179   FLLALLVRAANRPAEYDSDDELI-APQQQIRRPLLSRPPPPPPQPAAGVAAAGALDQRPS  237

Query  406   RNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             RNDAWS RMREKYGLDT+EF+YNP+ESNR+Q    QP EER RC+IM
Sbjct  238   RNDAWSTRMREKYGLDTAEFSYNPNESNRFQQGPTQPTEERSRCSIM  284



>ref|XP_009371175.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
 ref|XP_009371176.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
 ref|XP_009371177.1| PREDICTED: tobamovirus multiplication protein 2A-like [Pyrus 
x bretschneideri]
Length=280

 Score =   296 bits (758),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 206/292 (71%), Positives = 233/292 (80%), Gaps = 20/292 (7%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPS-------GDDHPIPFPPS  959
             MAC+GCLECLLKLLNF+LTL GL MVGYGIYL VEY   S S       GDDH       
Sbjct  1     MACRGCLECLLKLLNFVLTLVGLAMVGYGIYLLVEYLRASDSTVMSSAVGDDH-------  53

Query  958   SGELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGccl  779
               +LVQL RP+L+ VSL+ +I DNLPK WF+YLFIGIG ++F+ISCFGC+GA TRNGCCL
Sbjct  54    --DLVQLSRPLLMTVSLSTSILDNLPKAWFIYLFIGIGAIIFIISCFGCVGAMTRNGCCL  111

Query  778   scysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGA  599
             SCYSVLVILLILVELGAAAFIFFD+ W+ EIPTD +G+F+MIY FL+ +W IV+WVALGA
Sbjct  112   SCYSVLVILLILVELGAAAFIFFDKSWEDEIPTDSSGDFEMIYAFLKAHWTIVRWVALGA  171

Query  598   VVLEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLD  419
             VV EAL+FLLALVVRAANRPA+YDSDDE I  PRQQIRQPL+ NRQ  P TG PVAG LD
Sbjct  172   VVFEALLFLLALVVRAANRPAEYDSDDELI-APRQQIRQPLIANRQAVPATGAPVAGALD  230

Query  418   SR-PSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
              R P+RNDAWS RMREKYGL+T+EFTYNPSES      + QP EER RC IM
Sbjct  231   QRPPNRNDAWSTRMREKYGLNTAEFTYNPSESQ--SQVSAQPQEERSRCIIM  280



>ref|XP_004300273.1| PREDICTED: tobamovirus multiplication protein 2A [Fragaria vesca 
subsp. vesca]
Length=271

 Score =   293 bits (749),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 184/285 (65%), Positives = 218/285 (76%), Gaps = 15/285 (5%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDH-PIPFPPSSGELVQ  941
             MAC+GCL  LLKLLNF+LTL GL MVGYGIYL VEY   + + + + P+     +  L+Q
Sbjct  1     MACRGCLVFLLKLLNFILTLVGLAMVGYGIYLLVEYMKVADTANVYSPVG---ETDALIQ  57

Query  940   LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
             LGRPML  VSL+ +  DNLPK WF+YLFIG+GV++FVISCFGCIGA TRNGCCLSCYSVL
Sbjct  58    LGRPMLTTVSLSASFLDNLPKAWFIYLFIGVGVIIFVISCFGCIGAVTRNGCCLSCYSVL  117

Query  760   villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             +ILLILVEL AAAFIFFD+ W+ EIPTD TG+F+MIY+FLE +W IVKWV LGAV+ EAL
Sbjct  118   LILLILVELAAAAFIFFDKSWETEIPTDATGDFEMIYDFLEAHWSIVKWVVLGAVIFEAL  177

Query  580   MFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRN  401
             +FLLAL VRA NRP +YDSD+E           PL+N     P TGVPVAG  + RP+RN
Sbjct  178   IFLLALGVRAVNRPVEYDSDEE-----------PLINRPPPVPATGVPVAGAGNQRPTRN  226

Query  400   DAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             DAWS RMREKYGLDTS + Y+PS+S+R Q    QP EER RC+IM
Sbjct  227   DAWSTRMREKYGLDTSLYPYDPSDSSRLQQPQAQPQEERSRCSIM  271



>ref|XP_004983591.1| PREDICTED: tetraspanin-18-like isoform X1 [Setaria italica]
 ref|XP_004983592.1| PREDICTED: tetraspanin-18-like isoform X2 [Setaria italica]
Length=278

 Score =   291 bits (746),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 175/284 (62%), Positives = 213/284 (75%), Gaps = 9/284 (3%)
 Frame = -1

Query  1114  ACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLG  935
             AC+G  ECLL+LLNF+LT+AGL MVGYGIYL VE+   S  G         +  E++ LG
Sbjct  3     ACRGFFECLLRLLNFVLTVAGLAMVGYGIYLLVEWMKISKGGGGG------TPAEVLVLG  56

Query  934   RPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvi  755
             RP+L AV+L ++  D LPK WF+YLFIG+G ++F++S FGCIGA TRN CCL  Y+ LV+
Sbjct  57    RPLLGAVALGDSFLDKLPKAWFIYLFIGVGAIVFLVSLFGCIGAGTRNTCCLCFYAFLVL  116

Query  754   llilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMF  575
             LLIL E GAAAFIFFD  WK  IP D+T NFD++Y+FL+DNW+I +WVALG VV EA++F
Sbjct  117   LLILAEGGAAAFIFFDNSWKDVIPKDKTHNFDVMYDFLKDNWEIARWVALGVVVFEAVLF  176

Query  574   LLALVVRAANRPADYDSDDEYIG-GPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             LLALVVRA N+PA+YDSDDE I  G    +RQPL++  Q  P TGVPV  TLD R SRND
Sbjct  177   LLALVVRAMNKPAEYDSDDEIIAIGRSPTLRQPLIHG-QNVPATGVPVP-TLDQRASRND  234

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWS RMREKYGLDTS+FTYNPS+ +RYQ      AEER RCTI+
Sbjct  235   AWSQRMREKYGLDTSQFTYNPSDPSRYQQNGAPQAEERSRCTIL  278



>ref|XP_009391069.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391140.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391209.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391294.1| PREDICTED: tobamovirus multiplication protein 2A-like [Musa acuminata 
subsp. malaccensis]
Length=275

 Score =   290 bits (742),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 189/287 (66%), Positives = 213/287 (74%), Gaps = 15/287 (5%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSG-ELVQ  941
             MACKG  E LLKLLNFLLTL GL MVGYG+YL +EY   S  GD      P S+  +   
Sbjct  1     MACKGFWEYLLKLLNFLLTLTGLAMVGYGVYLLMEYNKVSSGGDGDDQVAPTSNDPKFWM  60

Query  940   LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
             +GRPMLV V L+++  D+LPK WF+YLFIG+G +LFVISC GCIGA TRNGCCLSCYS L
Sbjct  61    IGRPMLVGVPLSSSFLDHLPKAWFIYLFIGVGAILFVISCIGCIGAVTRNGCCLSCYSFL  120

Query  760   villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             VILLILVEL AAAFIFF+  WK  IP D+TGNFD IYEFLE+NWKI KWVALGAV+LEAL
Sbjct  121   VILLILVELAAAAFIFFNHSWKDLIPDDKTGNFDTIYEFLENNWKITKWVALGAVILEAL  180

Query  580   MFLLALVVR-AANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
             +F+L+L+VR AANR  +YDSDDEY       IRQPLM NRQ  P    PV GTLD RPSR
Sbjct  181   VFVLSLMVRAAANRAVEYDSDDEY-------IRQPLM-NRQGVP----PVLGTLDHRPSR  228

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERG-RCTIM  266
             NDAWS RMREKYGL+T EF Y  S  +RYQ      AEERG RC I+
Sbjct  229   NDAWSQRMREKYGLNTFEFAYKQSNPSRYQQATASQAEERGSRCIIL  275



>gb|KCW71821.1| hypothetical protein EUGRSUZ_E00307 [Eucalyptus grandis]
Length=260

 Score =   288 bits (736),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 181/284 (64%), Positives = 210/284 (74%), Gaps = 24/284 (8%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+GCL C LKLLNFL TLAGL MVGYGIYL V Y N S   D   +    + G L++L
Sbjct  1     MACRGCLGCFLKLLNFLFTLAGLAMVGYGIYLLVMYLNSS--SDAVSVLPVGTGGNLIEL  58

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML AVSL+++IFD+LPK WF+YLF+G+GV+LFVIS    I                 
Sbjct  59    GRPMLTAVSLSDSIFDDLPKAWFIYLFMGVGVILFVISLLVIILILVE------------  106

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
                    LG AAFI+FD+ W+ E+PTD TG+F MIY+FLE++W IVKWVALG VVLEAL+
Sbjct  107   -------LGCAAFIYFDKSWEDELPTDNTGDFAMIYDFLEEHWSIVKWVALGIVVLEALL  159

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLAL+VRAANRP +YDSDDEYI  PRQQIRQP +N  +  P TGVPVAGTLD RP RND
Sbjct  160   FLLALMVRAANRPVEYDSDDEYI-APRQQIRQPFIN--RPPPATGVPVAGTLDQRPIRND  216

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AW+ARMREKYGLDTSEFTYNPSES+R+Q    Q AEER RCTIM
Sbjct  217   AWTARMREKYGLDTSEFTYNPSESSRHQQVPPQNAEERSRCTIM  260



>gb|KHN21027.1| hypothetical protein glysoja_034149 [Glycine soja]
Length=250

 Score =   287 bits (734),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 184/289 (64%), Positives = 207/289 (72%), Gaps = 44/289 (15%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPS-----GDDHPIPFPPSSG  953
             MAC+GC ECLLKLLNF+LTLAGL MVGYGIYLFVEY N +P      GDD          
Sbjct  1     MACRGCWECLLKLLNFILTLAGLAMVGYGIYLFVEY-NKTPDNTLTVGDDQ---------  50

Query  952   ELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclsc  773
              LVQLGRPMLVAVSL+N+  D+LPK  FL                             + 
Sbjct  51    TLVQLGRPMLVAVSLSNSFLDDLPKACFL---------------------------NPTK  83

Query  772   ysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVV  593
             YSVLV+LLILVELG AAFIFFD+ WK+EIPTD+TG+FDMIY FL +NW IV+WVALG V+
Sbjct  84    YSVLVLLLILVELGCAAFIFFDKSWKEEIPTDKTGDFDMIYGFLRENWNIVRWVALGIVI  143

Query  592   LEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSR  413
              EAL+F+LAL+VRAANRP +YDSD+EYI  PRQQ RQPL+ NR   PV+G P  GTLD R
Sbjct  144   FEALLFVLALIVRAANRPTEYDSDEEYI-NPRQQARQPLL-NRPAGPVSGAPATGTLDQR  201

Query  412   PSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             PSRNDAWS RMREKYGLDTSEFTYNPSES+RYQ  N QP EE  RC IM
Sbjct  202   PSRNDAWSTRMREKYGLDTSEFTYNPSESHRYQQVNSQPTEEGSRCAIM  250



>ref|NP_001150827.1| tetraspanin family protein [Zea mays]
 ref|XP_008678655.1| PREDICTED: tetraspanin family protein isoform X1 [Zea mays]
 gb|ACN27909.1| unknown [Zea mays]
 tpg|DAA46389.1| TPA: tetraspanin family protein isoform 1 [Zea mays]
 tpg|DAA46390.1| TPA: tetraspanin family protein isoform 2 [Zea mays]
Length=279

 Score =   288 bits (736),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 175/284 (62%), Positives = 210/284 (74%), Gaps = 8/284 (3%)
 Frame = -1

Query  1114  ACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLG  935
             AC+G  ECLL+LLNF+LT+AGL MVGYGIYL VE+   S  G    +     + E++  G
Sbjct  3     ACRGFFECLLRLLNFILTVAGLAMVGYGIYLLVEWMKISEDGSSGGL-----TAEVLVSG  57

Query  934   RPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvi  755
             RP+L AV+L ++  D LPK WF+YLFIG+G  +F++S FGCIGA TRN CCL  Y+ LVI
Sbjct  58    RPLLGAVALGDSFLDMLPKAWFIYLFIGVGATVFLVSLFGCIGAGTRNTCCLCFYAFLVI  117

Query  754   llilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMF  575
             LLIL E GAAAFIFFD  WK  IP D+T NFD++Y FL+ NW+I +WVALG VV EA++F
Sbjct  118   LLILAEAGAAAFIFFDHSWKDVIPVDKTHNFDVMYGFLKKNWEIARWVALGVVVFEAVLF  177

Query  574   LLALVVRAANRPADYDSDDEYIG-GPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             LLALVVRA N+PA+YDSDDE I  G    +RQPL++  Q  P TGVPV  TLD R SRND
Sbjct  178   LLALVVRAMNKPAEYDSDDEIIAIGRSPTMRQPLIHA-QNVPATGVPVP-TLDQRSSRND  235

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWS RMREKYGLDTS+FTYNPS+ +RYQ      AEER RCTIM
Sbjct  236   AWSQRMREKYGLDTSQFTYNPSDPSRYQQNGAPQAEERSRCTIM  279



>ref|XP_006659267.1| PREDICTED: tobamovirus multiplication protein 2A-like [Oryza 
brachyantha]
Length=287

 Score =   288 bits (737),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 188/289 (65%), Positives = 221/289 (76%), Gaps = 7/289 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIP--FPPSSGELV  944
             MAC+G  ECLLKLLNF+LT+AGL MVGYGIYL VE+   S  G     P   P    EL+
Sbjct  1     MACRGFFECLLKLLNFVLTVAGLAMVGYGIYLLVEWMRISGGGGGGGGPRASPAPPAELL  60

Query  943   QLGRPMLVAVSLAN--NIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscy  770
               GRPML AV+L +  + FD LPK WF+YLFIG+G ++FVIS FGCIGA+TRN CCL CY
Sbjct  61    MFGRPMLTAVALGDGGSFFDKLPKAWFIYLFIGVGAIIFVISLFGCIGAATRNTCCLCCY  120

Query  769   svlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVL  590
             + LVILLILVE GAAAFIFFD  WK  IP D+T NFD++Y+FL+DNW+I +WVALG+VV 
Sbjct  121   AFLVILLILVEAGAAAFIFFDHSWKDVIPVDKTENFDVMYDFLKDNWEIARWVALGSVVF  180

Query  589   EALMFLLALVVRAANRPADYDSDDEYIGGPRQ-QIRQPLMNNRQQAPVTGVPVAGTLDSR  413
             E L+FLLALVVRA N+PA+YDSDDE +   R   IRQPL+++ Q AP TGVPVA TL+ R
Sbjct  181   EVLLFLLALVVRAMNKPAEYDSDDEILATSRSTSIRQPLIHS-QNAPATGVPVA-TLEQR  238

Query  412   PSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
              SRNDAWS RMREKYGLDTS+FTYNPS++ RYQ     PAEER RC IM
Sbjct  239   ASRNDAWSQRMREKYGLDTSQFTYNPSDAGRYQQNGAPPAEERSRCVIM  287



>ref|XP_006847670.1| PREDICTED: tobamovirus multiplication protein 2A [Amborella trichopoda]
 gb|ERN09251.1| hypothetical protein AMTR_s00149p00039360 [Amborella trichopoda]
Length=284

 Score =   287 bits (735),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 163/264 (62%), Positives = 200/264 (76%), Gaps = 6/264 (2%)
 Frame = -1

Query  1048  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLANNIFDNLPKEWF  869
              M+GYGIYL VE+KN S +     +    S+  +++LGRP+L    L+++I   L + WF
Sbjct  24    AMIGYGIYLLVEWKNDSSTVTLISVL---SNQPMIKLGRPLLHMGPLSSSILTELSEAWF  80

Query  868   LYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWKKE  689
             +Y FI +GV+L VISCFGCIGA TR+GCCLSCYSVL+ILLI+VELG A FIFFD  WK+ 
Sbjct  81    VYSFIVVGVILCVISCFGCIGAFTRHGCCLSCYSVLLILLIIVELGLAGFIFFDHSWKET  140

Query  688   IPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRP-ADYDSDDEY  512
             IPTD+TG+FDMIY FL+ +W I KWVALGAV+LEAL FLLALVVRA N P  +YDSDDEY
Sbjct  141   IPTDKTGDFDMIYNFLKKHWNIAKWVALGAVILEALTFLLALVVRATNWPQGEYDSDDEY  200

Query  511   IGGPRQQIRQPLMNNRQQ--APVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYN  338
             I  PR  I QPL+ + +Q  A VTGVPV+G  D R SRNDAWS R+REKYGLDTSEFTYN
Sbjct  201   IAAPRTGIWQPLIGSNRQAGAQVTGVPVSGASDQRLSRNDAWSTRLREKYGLDTSEFTYN  260

Query  337   PSESNRYQPTNVQPAEERGRCTIM  266
             P++S+R+Q      AEER RC+I+
Sbjct  261   PTDSSRFQQQAAPVAEERSRCSIL  284



>ref|XP_006850026.1| PREDICTED: tobamovirus multiplication protein 2A [Amborella trichopoda]
 gb|ERN11607.1| hypothetical protein AMTR_s00022p00189290 [Amborella trichopoda]
Length=276

 Score =   286 bits (732),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 185/284 (65%), Positives = 213/284 (75%), Gaps = 8/284 (3%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MACKG  ECLLKLLNFLLTL GL MVGYG+YL + +K  +    D PI    S  E  +L
Sbjct  1     MACKGFFECLLKLLNFLLTLVGLAMVGYGVYLLIIWKKSTSGHTDFPIS-DGSEPEQFRL  59

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
              RP + A  L+ N +D LP  WF+YLFI IG +LFVISC GCIGA+TRN CCLSCYSVL+
Sbjct  60    VRPFIYAGYLSANFWDKLPTPWFIYLFIAIGAILFVISCIGCIGAATRNICCLSCYSVLL  119

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             +LLI+VELG AAFIFFD  W+KEIP D+TG+F+MIY FL++NWKI KWVALGAV+LEAL+
Sbjct  120   VLLIVVELGLAAFIFFDHNWEKEIPNDKTGDFNMIYNFLKENWKIAKWVALGAVILEALV  179

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLAL VRAAN P +YDSDDEYI       RQPL+ +R  AP TG+PV    D R +R D
Sbjct  180   FLLALAVRAANMPPEYDSDDEYIAP-----RQPLI-SRAGAPATGIPV-NIADQRQNRPD  232

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWS RM+EKYGLDTSEFTYNPSES RY      PAEER RCTIM
Sbjct  233   AWSTRMKEKYGLDTSEFTYNPSESGRYTAPAPAPAEERSRCTIM  276



>gb|ACG40574.1| tetraspanin family protein [Zea mays]
Length=279

 Score =   286 bits (732),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 174/284 (61%), Positives = 210/284 (74%), Gaps = 8/284 (3%)
 Frame = -1

Query  1114  ACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLG  935
             AC+G  ECLL+LLNF+LT+AGL MVGYGIYL VE+   S  G    +     + E++  G
Sbjct  3     ACRGFFECLLRLLNFILTVAGLAMVGYGIYLLVEWMKISEDGSSGGL-----TAEVLVSG  57

Query  934   RPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvi  755
             RP+L AV+L ++  D LPK WF+YLFIG+G  +F++S FGCIGA TRN CCL  Y+ LVI
Sbjct  58    RPLLGAVALGDSFLDMLPKAWFIYLFIGVGATVFLVSLFGCIGAGTRNTCCLCFYAFLVI  117

Query  754   llilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMF  575
             LLIL E GAAAFIFFD  WK  IP D+T NFD++Y FL+ NW+I +WVALG VV EA++F
Sbjct  118   LLILAEAGAAAFIFFDHSWKDVIPVDKTHNFDVMYGFLKKNWEIARWVALGVVVFEAVLF  177

Query  574   LLALVVRAANRPADYDSDDEYIG-GPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             LLALVVRA N+PA+YDSDDE I  G    +RQPL++  Q  P TGVPV  TLD R SRND
Sbjct  178   LLALVVRAMNKPAEYDSDDEIIAIGRSPTMRQPLIHA-QNVPATGVPVP-TLDQRSSRND  235

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWS RMREKYGLDTS+FTYNPS+ +RYQ      AEER +CTIM
Sbjct  236   AWSQRMREKYGLDTSQFTYNPSDPSRYQQNGAPQAEERSQCTIM  279



>gb|KHN01670.1| hypothetical protein glysoja_012981 [Glycine soja]
Length=250

 Score =   283 bits (723),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 178/284 (63%), Positives = 203/284 (71%), Gaps = 34/284 (12%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+GC ECLLKLLNF+LTLAGL MVGYGIYLFVEY        D+ + F     E VQ 
Sbjct  1     MACRGCWECLLKLLNFILTLAGLAMVGYGIYLFVEYN----KAWDNTLNFSEDKTE-VQF  55

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPMLV VSL+N+  D LPK  FL                             + YSVLV
Sbjct  56    GRPMLVVVSLSNSFLDELPKACFL---------------------------NPTKYSVLV  88

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             +LLILVELG AAF FFD+ WK+EIP D+TG+FDMIYEFL +NW +V+WVALG V+ EAL+
Sbjct  89    LLLILVELGCAAFTFFDKSWKEEIPKDKTGDFDMIYEFLRENWNVVRWVALGIVIFEALL  148

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             F+LAL+VRAANRP +YDSD+EYI  PRQQ+RQPL+ NR   P +G P  GTLD RPSRND
Sbjct  149   FVLALIVRAANRPPEYDSDEEYI-NPRQQVRQPLL-NRPAGPASGAPATGTLDKRPSRND  206

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWSARMREKYGLDTSEFTYNPSES+RYQ  N QP EER RC IM
Sbjct  207   AWSARMREKYGLDTSEFTYNPSESHRYQQVNPQPTEERSRCAIM  250



>gb|KHG29161.1| Stk31 [Gossypium arboreum]
Length=259

 Score =   281 bits (718),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 171/295 (58%), Positives = 203/295 (69%), Gaps = 47/295 (16%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPP--SSGELV  944
             MAC+GCLECLLKLLNFL+T+AGL +V YGIYLFV+YK+ +    D  + F P  S  +L+
Sbjct  1     MACRGCLECLLKLLNFLVTVAGLAIVRYGIYLFVKYKDAA----DTVMLFSPVGSDQDLI  56

Query  943   QLGRPMLVAVSLANNIFDNLPKEWFLYLFI---------GIGVLLFVISCFGCIGASTRN  791
             QLGRPML+AVSL+++IFDNLPK  F   F          G+ VL    SC          
Sbjct  57    QLGRPMLMAVSLSSSIFDNLPKACFNGFFFQDPPDAWWWGLLVLTLDDSC----------  106

Query  790   GcclscysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWV  611
                                   AFIFFD+ WK EIPTD+TG+FD+IYEFLE+NW IVKWV
Sbjct  107   --------------------KIAFIFFDKSWKDEIPTDKTGDFDLIYEFLEENWTIVKWV  146

Query  610   ALGAVVLEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVA  431
             ALG VVLEA +F LAL+VRAAN PADYDSDD++I   R++ RQPL++     P +GVPV+
Sbjct  147   ALGIVVLEAFIFWLALMVRAANIPADYDSDDDFIA--RREQRQPLISRPPSVPASGVPVS  204

Query  430   GTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
              +LD RPSRNDAWSARMREKYGLDTSEFTYNP+ESNRYQ     PAEER RCTIM
Sbjct  205   VSLDQRPSRNDAWSARMREKYGLDTSEFTYNPAESNRYQQVVPPPAEERSRCTIM  259



>gb|KCW71823.1| hypothetical protein EUGRSUZ_E00307 [Eucalyptus grandis]
Length=251

 Score =   278 bits (712),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 181/249 (73%), Positives = 209/249 (84%), Gaps = 5/249 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+GCL C LKLLNFL TLAGL MVGYGIYL V Y N S   D   +    + G L++L
Sbjct  1     MACRGCLGCFLKLLNFLFTLAGLAMVGYGIYLLVMYLNSS--SDAVSVLPVGTGGNLIEL  58

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML AVSL+++IFD+LPK WF+YLF+G+GV+LFVISCFGCIGASTRNGCCLSCYSVLV
Sbjct  59    GRPMLTAVSLSDSIFDDLPKAWFIYLFMGVGVILFVISCFGCIGASTRNGCCLSCYSVLV  118

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
             I+LILVELG AAFI+FD+ W+ E+PTD TG+F MIY+FLE++W IVKWVALG VVLEAL+
Sbjct  119   IILILVELGCAAFIYFDKSWEDELPTDNTGDFAMIYDFLEEHWSIVKWVALGIVVLEALL  178

Query  577   FLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             FLLAL+VRAANRP +YDSDDEYI  PRQQIRQP +N  +  P TGVPVAGTLD RP RND
Sbjct  179   FLLALMVRAANRPVEYDSDDEYI-APRQQIRQPFIN--RPPPATGVPVAGTLDQRPIRND  235

Query  397   AWSARMREK  371
             AW+ARMREK
Sbjct  236   AWTARMREK  244



>ref|NP_001061444.1| Os08g0282000 [Oryza sativa Japonica Group]
 dbj|BAC99958.1| senescence-associated protein-like [Oryza sativa Japonica Group]
 dbj|BAF23358.1| Os08g0282000 [Oryza sativa Japonica Group]
 dbj|BAG95056.1| unnamed protein product [Oryza sativa Japonica Group]
Length=284

 Score =   278 bits (712),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 186/287 (65%), Positives = 221/287 (77%), Gaps = 6/287 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+G  ECLLKLLNF+LT+AGL MVGYGIYL VE+   S  G   P   P    EL+  
Sbjct  1     MACRGFFECLLKLLNFVLTVAGLAMVGYGIYLLVEWMRISGGGGGAPPS-PAPPAELLMF  59

Query  937   GRPMLVAVSLAN--NIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
             GRPML AV+L +  + FD LPK WF+YLFIG+G ++FVIS FGCIGA+TRN CCL CY+ 
Sbjct  60    GRPMLTAVALGDGGSFFDKLPKAWFIYLFIGVGAIIFVISLFGCIGAATRNTCCLCCYAF  119

Query  763   lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
             LVILLILVE GAAAFIFFDE WK  IP D+T NFD++Y+FL++NW+I +WVALG+V+ E 
Sbjct  120   LVILLILVEAGAAAFIFFDESWKDVIPVDKTENFDVMYDFLKENWEIARWVALGSVIFEV  179

Query  583   LMFLLALVVRAANRPADYDSDDEYIGGPRQ-QIRQPLMNNRQQAPVTGVPVAGTLDSRPS  407
             L+FLLALVVRA N+PA+YDSDDE I   R   IRQPL+++ Q  P TGVPVA TL+ R S
Sbjct  180   LLFLLALVVRAMNKPAEYDSDDEIIATSRSTSIRQPLIHS-QNVPATGVPVA-TLEQRAS  237

Query  406   RNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             RNDAWS RMREKYGLDTS+FTYNPS+ +RYQ     PAEER RC I+
Sbjct  238   RNDAWSQRMREKYGLDTSQFTYNPSDPSRYQQNGAPPAEERNRCVIL  284



>ref|XP_003573849.1| PREDICTED: tobamovirus multiplication protein 2A-like [Brachypodium 
distachyon]
Length=283

 Score =   273 bits (699),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 183/286 (64%), Positives = 213/286 (74%), Gaps = 8/286 (3%)
 Frame = -1

Query  1114  ACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLG  935
             AC+G  ECLL+LLNF+LT+AGL MVGYGIYL VE+   S  G            +L+  G
Sbjct  3     ACRGFFECLLRLLNFVLTVAGLAMVGYGIYLLVEWMRISGGGAPPSPA---PPADLLLFG  59

Query  934   RPMLVAVSLANN--IFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
             RPML  V LA+    FD LPK WF+YLFIG+G ++F++S FGCIGA TRN CCL CYS L
Sbjct  60    RPMLTVVGLADGGGFFDKLPKAWFIYLFIGVGAVVFIVSLFGCIGAGTRNTCCLCCYSFL  119

Query  760   villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             +ILLILVE GAAAFIFFD  WK  IP D T NFD +Y+FLE+NW+I +WVALG VV E L
Sbjct  120   IILLILVEAGAAAFIFFDHSWKDVIPVDYTRNFDAMYDFLEENWEIARWVALGVVVFEVL  179

Query  580   MFLLALVVRAANRPADYDSDDEYIGGPRQ-QIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
             +FLLA+VVRA N+PA+YDSDDE IG  R   IRQPL+++ Q AP TGVPV  TLD R SR
Sbjct  180   LFLLAVVVRALNKPAEYDSDDEIIGTARSTSIRQPLIHS-QNAPATGVPVP-TLDQRASR  237

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             NDAWS RMREKYGLDTS+FTYNPS+S RYQ     PAEER RCTI+
Sbjct  238   NDAWSQRMREKYGLDTSQFTYNPSDSARYQQNGAPPAEERNRCTIL  283



>gb|EMS54049.1| hypothetical protein TRIUR3_29725 [Triticum urartu]
Length=285

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 184/286 (64%), Positives = 211/286 (74%), Gaps = 6/286 (2%)
 Frame = -1

Query  1114  ACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLG  935
             AC+G  ECLL+LLNF LT+AGL MVGYGIYL VE+   S  G   P   P    EL+  G
Sbjct  3     ACRGFFECLLRLLNFFLTVAGLAMVGYGIYLLVEWMRISGGGGGAPPS-PAPPAELLTFG  61

Query  934   RPMLVAVSLAN--NIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
             RPML  V+L    + FD LPK WF+YLFIG+G ++FV+S FGCIGA TRN CCL CYS L
Sbjct  62    RPMLTVVALGEGGSFFDKLPKAWFIYLFIGVGAVIFVVSLFGCIGAGTRNTCCLCCYSFL  121

Query  760   villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             VILLIL E G AAFIFFD  WK  IP D+T NFD +Y+FL +NWKI +WVALG VV E L
Sbjct  122   VILLILAEAGGAAFIFFDHSWKDVIPVDKTQNFDAMYDFLNENWKIARWVALGVVVFEVL  181

Query  580   MFLLALVVRAANRPADYDSDDEYIGGPRQ-QIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
             +FLLAL VRA N+PA+YDSDDE IG  R   IRQPL+++ Q AP TGVPV  TLD R SR
Sbjct  182   LFLLALAVRAMNKPAEYDSDDEIIGTARSTSIRQPLIHS-QNAPATGVPVP-TLDQRASR  239

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             NDAWS RMREKYGLDTS+FTYNPS++ RYQ     PAEER RCT+M
Sbjct  240   NDAWSQRMREKYGLDTSQFTYNPSDATRYQQNGAPPAEERSRCTVM  285



>dbj|BAK04010.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=285

 Score =   271 bits (692),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 180/286 (63%), Positives = 212/286 (74%), Gaps = 6/286 (2%)
 Frame = -1

Query  1114  ACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLG  935
             AC+G  ECLL+LLNF LT+AGL MVGYGIYL  E+   S  G   P   P    EL+  G
Sbjct  3     ACRGFFECLLRLLNFFLTVAGLAMVGYGIYLLAEWMRISGGGGGAPPS-PAPPAELLMFG  61

Query  934   RPMLVAVSLAN--NIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
             RPML  V+L    + FD LP+ WF+YLFIG+G ++F++S FGCIGA TRN CCL CYS L
Sbjct  62    RPMLTVVALGEGGSFFDKLPEAWFIYLFIGVGAVIFIVSLFGCIGAGTRNTCCLCCYSFL  121

Query  760   villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             VILLIL E G AAFIFFD  WK  IP D+T NFD +Y+FL++NWKI +WVALG V+ + L
Sbjct  122   VILLILAEAGGAAFIFFDHSWKDVIPVDKTQNFDAMYDFLKENWKIARWVALGVVIFQVL  181

Query  580   MFLLALVVRAANRPADYDSDDEYIGGPRQ-QIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
             +FLLALVVRA N+PA+YDSDDE IG  R   IRQPL+++ Q AP TGVPV  TLD R SR
Sbjct  182   LFLLALVVRAMNKPAEYDSDDEIIGTARSTSIRQPLIHS-QNAPATGVPVP-TLDQRASR  239

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             NDAWS RMREKYGLDTS+FTYNPS++ RYQ     PAEER RCT+M
Sbjct  240   NDAWSQRMREKYGLDTSQFTYNPSDATRYQQNGAPPAEERSRCTVM  285



>gb|ABK22053.1| unknown [Picea sitchensis]
Length=282

 Score =   269 bits (688),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 149/262 (57%), Positives = 190/262 (73%), Gaps = 4/262 (2%)
 Frame = -1

Query  1048  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLANNIFDNLPKEWF  869
             GMVGYGIY+ V+++  S S +   IP   + G+++ LGRP+L    L+ +  D LP  WF
Sbjct  24    GMVGYGIYMMVKWEQDSVSVNS-VIPATANKGDVLILGRPLLFLAPLSTSFLDKLPGAWF  82

Query  868   LYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWKKE  689
             +YLF+ +GV+LF++SC GCI  +TR GCCL CY+VLV+LLI+VEL  A FIFFD +W+K 
Sbjct  83    IYLFMAVGVILFIVSCSGCIAVATRRGCCLCCYTVLVVLLIVVELALAGFIFFDHKWEKV  142

Query  688   IPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANR-PADYDSDDEY  512
             IPTD+TG FD I +FLE + KIV+WVALG V+L+    +LALVV+AANR P +YDSDDEY
Sbjct  143   IPTDKTGYFDDIKDFLEKHVKIVRWVALGIVILQVFAVILALVVKAANRGPEEYDSDDEY  202

Query  511   IGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPS  332
             I      +RQPL+ NRQ A V  V   G+ + R SRNDAWS RMREKYGLDTSEFTYNP+
Sbjct  203   IAARSTSVRQPLI-NRQGAQVAAVSTPGS-EQRTSRNDAWSTRMREKYGLDTSEFTYNPT  260

Query  331   ESNRYQPTNVQPAEERGRCTIM  266
             ++NRY      P EE+ RCTIM
Sbjct  261   DANRYAQPAPPPPEEKSRCTIM  282



>ref|XP_008788693.1| PREDICTED: tobamovirus multiplication protein 2A-like isoform 
X2 [Phoenix dactylifera]
Length=202

 Score =   248 bits (633),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 171/208 (82%), Gaps = 7/208 (3%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
             LP+  F+YLFIGIGV+LF+ISC GC+GA+TRNGCCLS YS LVILLILVEL AAAFIFF
Sbjct  2    KLPR--FIYLFIGIGVILFIISCCGCVGATTRNGCCLSWYSFLVILLILVELAAAAFIFF  59

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADY  530
            D  WK  IP D+TG+FDMIY FL++NWKI KWVALGAV+LEAL FLLAL++RA N+PADY
Sbjct  60   DHSWKDAIPADKTGDFDMIYNFLKENWKIAKWVALGAVILEALAFLLALMIRAVNQPADY  119

Query  529  DSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSE  350
            DSDDEYI  P+  I QPL+ NRQ  P +GVP   +LD RPSRNDAWS RMREKYGLDTSE
Sbjct  120  DSDDEYI-APKSAIHQPLI-NRQGLPPSGVP---SLDHRPSRNDAWSQRMREKYGLDTSE  174

Query  349  FTYNPSESNRYQPTNVQPAEERGRCTIM  266
            FTYNPS+ +R+Q   V  AEE GRCTI+
Sbjct  175  FTYNPSDPSRFQQATVTSAEESGRCTIL  202



>ref|NP_001146619.1| hypothetical protein [Zea mays]
 gb|ACF86508.1| unknown [Zea mays]
 gb|ACR38384.1| unknown [Zea mays]
 gb|AFW87797.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
Length=279

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 173/284 (61%), Positives = 208/284 (73%), Gaps = 8/284 (3%)
 Frame = -1

Query  1114  ACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLG  935
             AC+G  ECLL+LLNF+LT+AGL MVGYGIYL VE+   S  G         S+ E++  G
Sbjct  3     ACRGFFECLLRLLNFILTVAGLAMVGYGIYLLVEWMKISEDGIGGA-----STAEVLVSG  57

Query  934   RPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvi  755
             RP+L AV L ++  DNLPK WF+YLFI +G ++ ++S FGCIGA TRN CCL  Y+ LVI
Sbjct  58    RPLLGAVILGDSFLDNLPKAWFIYLFICVGTIVILVSLFGCIGAGTRNTCCLCFYAFLVI  117

Query  754   llilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMF  575
             LLIL E  AAAFIFFD  WK  IP D+T NFD++Y+FL++NW+I +WVALG VV EA++ 
Sbjct  118   LLILAEAAAAAFIFFDHGWKDVIPVDKTHNFDVMYDFLKENWEIARWVALGVVVFEAVLL  177

Query  574   LLALVVRAANRPADYDSDDEYIG-GPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRND  398
             LLAL VRA N+PA+YDSDDE I  G    IRQPL++  Q  P TGVPV  TLD R SRND
Sbjct  178   LLALAVRAMNKPAEYDSDDEIIAIGRSPTIRQPLIHT-QNVPATGVPVP-TLDQRASRND  235

Query  397   AWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             AWS RMREKYGLDTS+FTYNPS+ +RYQ      AEER RCTIM
Sbjct  236   AWSQRMREKYGLDTSQFTYNPSDPSRYQQNGTPRAEERSRCTIM  279



>gb|KHG29162.1| Solute carrier family 28 member 3 [Gossypium arboreum]
Length=201

 Score =   245 bits (625),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 132/233 (57%), Positives = 157/233 (67%), Gaps = 40/233 (17%)
 Frame = -1

Query  961  SSGELVQLGRPMLVAVSLAN-NIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGc  785
            S  +L+QLGRPML+AVSL++ NI       W +   +G+ VL    SC            
Sbjct  8    SDQDLIQLGRPMLMAVSLSSINI-------WNVIYLVGLLVLTLDDSC------------  48

Query  784  clscysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVAL  605
                                AFIFFD+ WK EIPTD+TG+FD+IYEFLE+NW IVKWVAL
Sbjct  49   ------------------KIAFIFFDKSWKDEIPTDKTGDFDLIYEFLEENWTIVKWVAL  90

Query  604  GAVVLEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGT  425
            G VVLEA +F LAL+VRAAN PADYDSDD++I   R++ RQPL++     P +GVPV+ +
Sbjct  91   GIVVLEAFIFWLALMVRAANIPADYDSDDDFIA--RREQRQPLISRPPSVPASGVPVSVS  148

Query  424  LDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            LD RPSRNDAWSARMREKYGLDTSEFTYNP+ESNRYQ     PAEER RCTIM
Sbjct  149  LDQRPSRNDAWSARMREKYGLDTSEFTYNPAESNRYQQVVPPPAEERSRCTIM  201



>ref|XP_010934869.1| PREDICTED: tobamovirus multiplication protein 2A isoform X2 [Elaeis 
guineensis]
Length=267

 Score =   246 bits (628),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 168/253 (66%), Positives = 197/253 (78%), Gaps = 6/253 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+GC ECLLKLLNF+LT+AGL MVGYG+YL VE+   S  G + PI     +  ++ L
Sbjct  1     MACRGCFECLLKLLNFVLTVAGLAMVGYGVYLLVEWIKVSSGGGEDPISPVSDNPVMLTL  60

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+   ++ +  D LPK WF+YLFIGIGV+LF+ISC GC+GA+TRNGCCLSCYS LV
Sbjct  61    GRPMLLVAPISTSFVDQLPKAWFIYLFIGIGVILFIISCCGCVGATTRNGCCLSCYSFLV  120

Query  757   illilveLGAAAFIFFDERWKKEI-PTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             ILLILVEL AAAFIFFD  WK  I P D+TG+FDMIY FL+ NWKI KWVALGAV+LEAL
Sbjct  121   ILLILVELAAAAFIFFDHSWKDAIIPADKTGDFDMIYSFLKKNWKIAKWVALGAVILEAL  180

Query  580   MFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRN  401
              FLLAL++RA N+P DYDSDDEYI  PR+ IRQPL+ NRQ  P +GVP   +LD RPSRN
Sbjct  181   AFLLALMIRAVNQPTDYDSDDEYI-APRRGIRQPLI-NRQGLPPSGVP---SLDHRPSRN  235

Query  400   DAWSARMREKYGL  362
             DAWS RMRE   L
Sbjct  236   DAWSQRMRESMVL  248



>ref|XP_002443902.1| hypothetical protein SORBIDRAFT_07g004040 [Sorghum bicolor]
 gb|EES13397.1| hypothetical protein SORBIDRAFT_07g004040 [Sorghum bicolor]
Length=274

 Score =   236 bits (601),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 157/288 (55%), Positives = 199/288 (69%), Gaps = 18/288 (6%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+G  EC+LKLLN ++   GL MVGYG YL V +   +P          PS G+LV+L
Sbjct  1     MACRGFFECVLKLLNLVVMAVGLAMVGYGAYLLVMWLQVAPPLPPPAPSPAPSGGDLVRL  60

Query  937   GRPMLVAV----SLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscy  770
             GRP+L+ V    S ++   + L   WF++ FIG+G +LF+ S FGC GA  RNGCCLS Y
Sbjct  61    GRPLLLLVDASLSDSDGTAERLSSAWFIFAFIGVGAILFITSIFGCAGA--RNGCCLSIY  118

Query  769   svlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVL  590
             S L+IL ILVELGA  FIFF+  WK+ IP D+TGNFDM+Y FL++NW+I KWVALGAVV 
Sbjct  119   SFLIILFILVELGAGGFIFFNHSWKEVIPVDKTGNFDMMYSFLKENWRIAKWVALGAVVF  178

Query  589   EALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRP  410
             EAL+F +A++V++ N+ ADYDSDDEYIG  R  IRQPL+N  QQA  T  P    LD RP
Sbjct  179   EALLFTVAIIVQSGNQ-ADYDSDDEYIGA-RSGIRQPLVN--QQAAATD-PRVPNLDYRP  233

Query  409   SRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
              RNDAWS RMREKYG+D    +++P   NR+Q   + P E+R RCTI+
Sbjct  234   IRNDAWSQRMREKYGVD----SFDP---NRFQQATISPGEQRNRCTIL  274



>gb|KCW77895.1| hypothetical protein EUGRSUZ_D021561, partial [Eucalyptus grandis]
 gb|KCW77896.1| hypothetical protein EUGRSUZ_D021561, partial [Eucalyptus grandis]
Length=204

 Score =   230 bits (587),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 144/205 (70%), Positives = 174/205 (85%), Gaps = 4/205 (2%)
 Frame = -1

Query  871  FLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWKK  692
            F++LFIG+GV+LF+ISCFGCIG+ TRNGCCL+CYSVLVILLILVELG AAFI+FD+ W+ 
Sbjct  1    FIFLFIGVGVVLFIISCFGCIGSVTRNGCCLTCYSVLVILLILVELGCAAFIYFDKSWED  60

Query  691  EIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDDEY  512
            ++PTD TG+FDMIY+FL+++W IV+WVALG VVLEAL+FLLAL+VRAANRPA+YDSDDE 
Sbjct  61   DLPTDATGDFDMIYDFLKEHWTIVRWVALGVVVLEALVFLLALLVRAANRPAEYDSDDEL  120

Query  511  IGGPRQQIRQPLMNN---RQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTY  341
            I  P+QQIR+PL++        P  GV  AG LD RPSRNDAWS RMREKYGLDT+EF+Y
Sbjct  121  I-APQQQIRRPLLSRPPPPPPQPAAGVAAAGALDQRPSRNDAWSTRMREKYGLDTAEFSY  179

Query  340  NPSESNRYQPTNVQPAEERGRCTIM  266
            NP+ESNR+Q    QP EER RC+IM
Sbjct  180  NPNESNRFQQGPTQPTEERSRCSIM  204



>gb|ACN35034.1| unknown [Zea mays]
 gb|AFW61169.1| hypothetical protein ZEAMMB73_111506 [Zea mays]
Length=275

 Score =   232 bits (592),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 155/287 (54%), Positives = 197/287 (69%), Gaps = 15/287 (5%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEY-KNHSPSGDDHPIPFPPSSGELVQ  941
             MAC+G  EC+LKLLN ++   GL MVGYG +L V + +              P SGELV+
Sbjct  1     MACRGFFECVLKLLNLVVMAVGLAMVGYGAFLLVTWLQVAPLPPPSSSPDAVPPSGELVR  60

Query  940   LGRPMLVAV--SLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscys  767
             LGRP+L+ V  SL++   + L   WF++ FIG+G +LFV S FGC GA  RNGCCLS YS
Sbjct  61    LGRPLLLFVDASLSDGTAERLSSAWFIFAFIGVGAILFVTSIFGCAGA--RNGCCLSIYS  118

Query  766   vlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLE  587
              L+IL ILVEL A  FIFF+  WK+ IP D+TGNFDM+Y FL++NW+I KWVALGAVV E
Sbjct  119   FLIILFILVELAAGGFIFFNHSWKEVIPVDKTGNFDMMYSFLKENWRIAKWVALGAVVFE  178

Query  586   ALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPS  407
             AL+F +A++V++ N+  DYDSDDEYIG  R  IRQPL+ N+Q A     P    LD RP 
Sbjct  179   ALLFTVAIIVQSGNQ-TDYDSDDEYIGA-RSGIRQPLV-NQQAAAAAADPRVPNLDYRPI  235

Query  406   RNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             RNDAWS RMREKYG+D    +++P   NR+QP  + P E+R RCTI+
Sbjct  236   RNDAWSQRMREKYGVD----SFDP---NRFQPATISPGEQRNRCTIL  275



>ref|XP_004972786.1| PREDICTED: tetraspanin-20-like isoform X2 [Setaria italica]
Length=278

 Score =   232 bits (591),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 156/292 (53%), Positives = 198/292 (68%), Gaps = 22/292 (8%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPS-----SG  953
             MAC+G  ECLLKLLN ++   GL MVGYG YL V +    P       P P        G
Sbjct  1     MACRGFFECLLKLLNLIVMAVGLAMVGYGAYLLVMWLQVVPPPAPPLPPSPAPVVVAAGG  60

Query  952   ELVQLGRPMLVAV---SLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcc  782
             ELV+LGRP+++ V   SL++   +     WF++ FIG+GV+LF+ S FGC GA  RNGCC
Sbjct  61    ELVRLGRPLMLLVDASSLSDGTAERFSSAWFIFTFIGVGVVLFITSIFGCAGA--RNGCC  118

Query  781   lscysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALG  602
             LS YS L+IL ILVEL    FIFF+  WK+ IP D+TGNFDM+Y FL++NW+I KWVALG
Sbjct  119   LSIYSFLIILFILVELATGGFIFFNHSWKEVIPVDKTGNFDMMYSFLKENWRIAKWVALG  178

Query  601   AVVLEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTL  422
             AV+ EAL+F +A++V++ N+ ADYDSDDEYI  PR  IRQPL+N +Q A    VP    L
Sbjct  179   AVIFEALLFTVAIIVQSGNQ-ADYDSDDEYI-VPRSGIRQPLVNQQQGAADPRVP---NL  233

Query  421   DSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             D RP RNDAWS RMREKYG+D    +++P   NR+Q   + PAE+R RCTI+
Sbjct  234   DYRPIRNDAWSQRMREKYGVD----SFDP---NRFQQATISPAEQRNRCTIL  278



>ref|XP_003573463.1| PREDICTED: tobamovirus multiplication protein 2A-like [Brachypodium 
distachyon]
Length=278

 Score =   229 bits (584),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 154/291 (53%), Positives = 195/291 (67%), Gaps = 20/291 (7%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPS----SGE  950
             MAC+G  EC+LKLLNF++ + GL M GYG YL V +              P +     G+
Sbjct  1     MACRGFFECVLKLLNFVVMVVGLAMAGYGAYLLVLWLQVLSPPLPPSPAPPAAVAPSGGD  60

Query  949   LVQLGRPMLVAVSLA---NNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGccl  779
             LV+LGRPML+ +  +   N   + L   WF++ FIGIGV+LF+ S FGC GASTR+GCCL
Sbjct  61    LVRLGRPMLLLLDASLSDNGTVERLSSAWFIFAFIGIGVILFITSIFGCAGASTRSGCCL  120

Query  778   scysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGA  599
             S YS L+IL ILVEL A  FIFFD  WK  IP D+TGNFDMIY FL++NW+I KWVALG+
Sbjct  121   STYSFLIILFILVELAAGCFIFFDHDWKNVIPVDKTGNFDMIYSFLKENWRIAKWVALGS  180

Query  598   VVLEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLD  419
             VV EAL+F +AL+V++  +  DYDSDDEYIG  R  +RQPL+N +  A     P    LD
Sbjct  181   VVFEALLFTVALIVQSGIQD-DYDSDDEYIGA-RSGVRQPLVNKQAAAD----PRVPNLD  234

Query  418   SRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
              RP RNDAWS RMR+KYG+D    T++P   NR+Q   + PAE+R RCTI+
Sbjct  235   YRPIRNDAWSQRMRDKYGVD----TFDP---NRFQQATISPAEQRSRCTIL  278



>gb|KCW77897.1| hypothetical protein EUGRSUZ_D021561, partial [Eucalyptus grandis]
Length=188

 Score =   223 bits (569),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 158/205 (77%), Gaps = 20/205 (10%)
 Frame = -1

Query  871  FLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWKK  692
            F++LFIG+GV+LF+ISCFGCIG+ TRN                VELG AAFI+FD+ W+ 
Sbjct  1    FIFLFIGVGVVLFIISCFGCIGSVTRN----------------VELGCAAFIYFDKSWED  44

Query  691  EIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDDEY  512
            ++PTD TG+FDMIY+FL+++W IV+WVALG VVLEAL+FLLAL+VRAANRPA+YDSDDE 
Sbjct  45   DLPTDATGDFDMIYDFLKEHWTIVRWVALGVVVLEALVFLLALLVRAANRPAEYDSDDEL  104

Query  511  IGGPRQQIRQPLMNN---RQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTY  341
            I  P+QQIR+PL++        P  GV  AG LD RPSRNDAWS RMREKYGLDT+EF+Y
Sbjct  105  I-APQQQIRRPLLSRPPPPPPQPAAGVAAAGALDQRPSRNDAWSTRMREKYGLDTAEFSY  163

Query  340  NPSESNRYQPTNVQPAEERGRCTIM  266
            NP+ESNR+Q    QP EER RC+IM
Sbjct  164  NPNESNRFQQGPTQPTEERSRCSIM  188



>ref|NP_001061041.1| Os08g0159100 [Oryza sativa Japonica Group]
 dbj|BAC99658.1| senescence-associated protein-like [Oryza sativa Japonica Group]
 dbj|BAF22955.1| Os08g0159100 [Oryza sativa Japonica Group]
 dbj|BAG92210.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG91640.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE68082.1| hypothetical protein OsJ_26119 [Oryza sativa Japonica Group]
Length=278

 Score =   218 bits (555),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 153/292 (52%), Positives = 196/292 (67%), Gaps = 22/292 (8%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSG-----  953
             MAC+G  E +LKLLN ++ + GL M+GYG YL V +    PS    P     + G     
Sbjct  1     MACRGFFEWVLKLLNLVVMVVGLAMMGYGAYLLVAWLQLLPSPPPLPPAPAVAPGGGGGG  60

Query  952   ELVQLGRPMLVAV---SLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcc  782
             E+V+LGRP+L+ +   SL +   + L   WF+Y FIG+GV+LF+ S FGC GAS R GCC
Sbjct  61    EMVRLGRPLLLLLDVSSLPDGTAERLSAAWFIYAFIGVGVILFITSIFGCAGAS-RGGCC  119

Query  781   lscysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALG  602
             LS YS L+IL ILVEL A  FIFF+  WK  IP D+TGNFDM+Y FL++NW+I KWVALG
Sbjct  120   LSFYSFLIILFILVELAAGGFIFFNHSWKDVIPVDKTGNFDMMYSFLKENWRIAKWVALG  179

Query  601   AVVLEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTL  422
             AV+ EA++F +AL+V++ N+ ADYDSDDEYI  PR   RQPL+N +   PV   P    L
Sbjct  180   AVLFEAVLFTVALIVQSGNQ-ADYDSDDEYI-APRSSTRQPLVNKQ---PVAD-PRVPNL  233

Query  421   DSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             D RP RNDAWS RMREKYG+D    T++P   NR+Q   + PAE+R RC I+
Sbjct  234   DYRPIRNDAWSQRMREKYGVD----TFDP---NRFQQATISPAEQRNRCAIL  278



>ref|XP_006659854.1| PREDICTED: tobamovirus multiplication protein 2A-like [Oryza 
brachyantha]
Length=250

 Score =   216 bits (551),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 148/286 (52%), Positives = 189/286 (66%), Gaps = 38/286 (13%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+G  E +LKLLNF++ + GL MVGYG YL V +                        
Sbjct  1     MACRGFFEWVLKLLNFVVMVVGLAMVGYGAYLLVVWLQ----------------------  38

Query  937   GRPMLVA--VSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
             GRP+L+   VS+++ I + L   WF++ FIG+GV+LF+ S FGC GAS R GCCLS YS 
Sbjct  39    GRPLLLLLDVSMSDGIEERLSSAWFIFTFIGVGVILFITSIFGCSGAS-RGGCCLSFYSF  97

Query  763   lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
             L+IL ILVEL A  FIFF+  WK  IP D+TGNFDM+Y FL+DNW+I KWVALGAV+ EA
Sbjct  98    LIILFILVELAAGGFIFFNHSWKDVIPVDKTGNFDMMYSFLKDNWRIAKWVALGAVLYEA  157

Query  583   LMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSR  404
             ++F +A++V++ N+ ADYDSDDEYI  PR   RQPL+N +  A     P    LD RP R
Sbjct  158   VLFTVAIIVQSGNQ-ADYDSDDEYI-VPRSSTRQPLVNKQPVAD----PRVPNLDYRPIR  211

Query  403   NDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             NDAWS RMREKYG+D    T++P   NR+Q   + PAE+R RCTI+
Sbjct  212   NDAWSQRMREKYGVD----TFDP---NRFQQATISPAEQRSRCTIL  250



>gb|ABK25767.1| unknown [Picea sitchensis]
Length=196

 Score =   212 bits (539),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 120/198 (61%), Positives = 149/198 (75%), Gaps = 3/198 (2%)
 Frame = -1

Query  856  IGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWKKEIPTD  677
            + +GV+LF++SC GCI  +TR GCCL CY+VLV+LLI+VEL  A FIFFD +W+K IPTD
Sbjct  1    MAVGVILFIVSCSGCIAVATRRGCCLCCYTVLVVLLIVVELALAGFIFFDHKWEKVIPTD  60

Query  676  RTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANR-PADYDSDDEYIGGP  500
            +TG FD I +FLE + KIV+WVALG V+L+    +LALVV+AANR P +YDSDDEY+   
Sbjct  61   KTGYFDDIKDFLEKHVKIVRWVALGIVILQVFAVILALVVKAANRGPEEYDSDDEYLTTR  120

Query  499  RQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNR  320
               +RQPL+ NRQ A V  V   G+ + R SRNDAWS RMREKYGLDTSEFTYNP+++NR
Sbjct  121  ATSVRQPLI-NRQGAQVAAVSTPGS-EQRTSRNDAWSTRMREKYGLDTSEFTYNPTDANR  178

Query  319  YQPTNVQPAEERGRCTIM  266
            Y      P EE+ RCTIM
Sbjct  179  YAQPAPPPPEEKSRCTIM  196



>gb|EYU17845.1| hypothetical protein MIMGU_mgv1a0219312mg, partial [Erythranthe 
guttata]
Length=207

 Score =   211 bits (538),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 139/200 (70%), Positives = 159/200 (80%), Gaps = 9/200 (5%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MACKG  ECLLKLLNFLL L GLGM+GYG+YLFVEYKN S   D      PPS+   VQL
Sbjct  1     MACKGFWECLLKLLNFLLVLVGLGMIGYGVYLFVEYKNISSDDDGGDSALPPSTDAFVQL  60

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
             GRPML+AVSLA+NIFD LPK WF+YLFIG+G ++  I+C GCIG +TRNGCCL+CYSVLV
Sbjct  61    GRPMLLAVSLADNIFDKLPKAWFIYLFIGLGGIVLFIACCGCIGTATRNGCCLTCYSVLV  120

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVV-----  593
             ILLIL ELG AAFIFFDE WK +IPTD TGNF MIYEFL+ +WKI+KWVALGAV      
Sbjct  121   ILLILAELGFAAFIFFDESWKDKIPTDGTGNFAMIYEFLDKHWKIIKWVALGAVYTRVIL  180

Query  592   ----LEALMFLLALVVRAAN  545
                 ++AL+FLLAL+VRAAN
Sbjct  181   TTVKMQALIFLLALIVRAAN  200



>gb|EEC82932.1| hypothetical protein OsI_27894 [Oryza sativa Indica Group]
Length=305

 Score =   204 bits (520),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 150/319 (47%), Positives = 192/319 (60%), Gaps = 49/319 (15%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSS-----G  953
             MAC+G  E +LKLLNF++ + GL M+GYG YL V +    PS    P P           
Sbjct  1     MACRGFFEWVLKLLNFVVMVVGLAMMGYGAYLLVAWLQLLPSPPLPPAPAVAPGGGGGGS  60

Query  952   ELVQLGRPMLVAV---SLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcc  782
             E+V+LGRP+L+ +   SL +   + L   WF+Y FIG+GV+LF+ S FGC GAS R GCC
Sbjct  61    EMVRLGRPLLLLLDVSSLPDGTAEKLSAAWFIYTFIGVGVILFITSIFGCAGAS-RGGCC  119

Query  781   lscysvlvill---------------------------ilveLGAAAFIFFDERWKKEIP  683
             LS  S   +                             ILVEL A  FIFF+  WK  IP
Sbjct  120   LSFVSKFNMHAYERDICSCCFPLMHATFEKYSFLIILFILVELAAGGFIFFNHSWKDVIP  179

Query  682   TDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDDEYIGG  503
              D+TGNFDM+Y FL++NW+I KWVALGAV+ EA++F +AL+V++ N+ ADYDSDDEYI  
Sbjct  180   VDKTGNFDMMYSFLKENWRIAKWVALGAVLFEAVLFTVALIVQSGNQ-ADYDSDDEYI-A  237

Query  502   PRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESN  323
             PR   RQPL+N +   PV   P    LD RP RNDAWS RMREKYG+D    T++P   N
Sbjct  238   PRSSTRQPLVNKQ---PVAD-PRVPNLDYRPIRNDAWSQRMREKYGVD----TFDP---N  286

Query  322   RYQPTNVQPAEERGRCTIM  266
             R+Q   + PAE+R RC I+
Sbjct  287   RFQQATISPAEQRNRCAIL  305



>ref|XP_004972785.1| PREDICTED: tetraspanin-20-like isoform X1 [Setaria italica]
Length=332

 Score =   202 bits (514),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 141/257 (55%), Positives = 175/257 (68%), Gaps = 15/257 (6%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPS-----SG  953
             MAC+G  ECLLKLLN ++   GL MVGYG YL V +    P       P P        G
Sbjct  1     MACRGFFECLLKLLNLIVMAVGLAMVGYGAYLLVMWLQVVPPPAPPLPPSPAPVVVAAGG  60

Query  952   ELVQLGRPMLVAV---SLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcc  782
             ELV+LGRP+++ V   SL++   +     WF++ FIG+GV+LF+ S FGC GA  RNGCC
Sbjct  61    ELVRLGRPLMLLVDASSLSDGTAERFSSAWFIFTFIGVGVVLFITSIFGCAGA--RNGCC  118

Query  781   lscysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALG  602
             LS YS L+IL ILVEL    FIFF+  WK+ IP D+TGNFDM+Y FL++NW+I KWVALG
Sbjct  119   LSIYSFLIILFILVELATGGFIFFNHSWKEVIPVDKTGNFDMMYSFLKENWRIAKWVALG  178

Query  601   AVVLEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTL  422
             AV+ EAL+F +A++V++ N+ ADYDSDDEYI  PR  IRQPL+N +Q A    VP    L
Sbjct  179   AVIFEALLFTVAIIVQSGNQ-ADYDSDDEYI-VPRSGIRQPLVNQQQGAADPRVP---NL  233

Query  421   DSRPSRNDAWSARMREK  371
             D RP RNDAWS RMREK
Sbjct  234   DYRPIRNDAWSQRMREK  250



>ref|XP_008375915.1| PREDICTED: tobamovirus multiplication protein 2A-like [Malus 
domestica]
Length=248

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 147/186 (79%), Gaps = 16/186 (9%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKN-------HSPSGDDHPIPFPPS  959
             MAC+GCLECLLKLLNF+LTL GL MVGYGIYL VEY          SP GD H       
Sbjct  1     MACRGCLECLLKLLNFVLTLVGLAMVGYGIYLLVEYLRAADTTVMSSPVGDVH-------  53

Query  958   SGELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGccl  779
               +LVQL RPML+ VSL++NI DNLPK WF+YLFIGIG ++FVISCFGC+GA TRNGCCL
Sbjct  54    --DLVQLSRPMLMTVSLSDNILDNLPKAWFIYLFIGIGAIIFVISCFGCVGAMTRNGCCL  111

Query  778   scysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGA  599
             SCYSVLVILLILVELGAAAFIFFD+ W+ EIP D +G+F+MIY FL+ +W IV+WVALGA
Sbjct  112   SCYSVLVILLILVELGAAAFIFFDKSWEDEIPMDSSGDFEMIYAFLKAHWNIVRWVALGA  171

Query  598   VVLEAL  581
             VV E +
Sbjct  172   VVFEVI  177



>ref|XP_002972323.1| hypothetical protein SELMODRAFT_172827 [Selaginella moellendorffii]
 gb|EFJ26409.1| hypothetical protein SELMODRAFT_172827 [Selaginella moellendorffii]
Length=282

 Score =   180 bits (456),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 112/264 (42%), Positives = 155/264 (59%), Gaps = 10/264 (4%)
 Frame = -1

Query  1048  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLANNIFDNLP-KEW  872
              M+ Y +++  E+  HS     HP    P+  +L       L  V+   N +   P +  
Sbjct  26    AMIVYSLWMLNEW--HSRQEPSHPPAASPAPEQLQDHHHAFLAIVAEKGNGYPRGPGRAT  83

Query  871   FLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWKK  692
             F+Y F+G+G ++ VI+C G + A T +GCCL  Y++L+++L+L +   A FI FD+ W+K
Sbjct  84    FIYAFLGVGAIVLVITCTGHVAAETASGCCLCFYTLLLVVLLLAQAVLAGFIIFDKNWEK  143

Query  691   EIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPAD--YDSDD  518
              +P D TG FD I  F++ N+ I KWVALG ++LEAL   LA+V+R+    A   YDSDD
Sbjct  144   AVPEDPTGEFDRIAHFIKRNFAICKWVALGVIILEALSLFLAIVLRSVALGAQRGYDSDD  203

Query  517   EYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYN  338
             +    P +  RQPL+N RQ       P A   +SRP RNDAWS RMREKYGLDT+EFTYN
Sbjct  204   DM---PVRNTRQPLLN-RQATQSNATPSAPA-ESRPPRNDAWSTRMREKYGLDTAEFTYN  258

Query  337   PSESNRYQPTNVQPAEERGRCTIM  266
             P +S R    N  P E +  C IM
Sbjct  259   PVDSKRVPAQNQPPPEPKRGCVIM  282



>gb|KDO40488.1| hypothetical protein CISIN_1g033708mg [Citrus sinensis]
Length=113

 Score =   171 bits (432),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 93/109 (85%), Gaps = 2/109 (2%)
 Frame = -1

Query  592  LEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSR  413
            L+AL+FLLA++VRAANRP +YDSDDE I  PRQQIRQPL+N R   P TGVPVAG+LD R
Sbjct  7    LQALIFLLAIIVRAANRPVEYDSDDELIA-PRQQIRQPLIN-RPTPPATGVPVAGSLDQR  64

Query  412  PSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            PSRNDAWS RMREKYGLDTSEFTYNPSES+R+Q    QPAEER RCTIM
Sbjct  65   PSRNDAWSTRMREKYGLDTSEFTYNPSESHRFQQVATQPAEERSRCTIM  113



>ref|XP_008352453.1| PREDICTED: tobamovirus multiplication protein 2A-like [Malus 
domestica]
Length=198

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 149/187 (80%), Gaps = 16/187 (9%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKN-------HSPSGDDHPIPFPPS  959
             MAC+GCLECLLKLLNF+LTL GL MVGYGIYL VEY          SP GDDH       
Sbjct  1     MACRGCLECLLKLLNFVLTLVGLAMVGYGIYLLVEYLRASDSTVMSSPVGDDH-------  53

Query  958   SGELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGccl  779
               +LVQL RP+L+ VSL+ ++ DNLPK WF+YLFIGIG ++F+ISCFGC+GA TRNGCCL
Sbjct  54    --DLVQLSRPLLMTVSLSTSVLDNLPKAWFIYLFIGIGAIIFIISCFGCVGAMTRNGCCL  111

Query  778   scysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGA  599
             SCYSVLVILLILVELGAAAFIFFD+ W+ EIPTD +G+F+MIY FL+ +W IV+WVALGA
Sbjct  112   SCYSVLVILLILVELGAAAFIFFDKSWEDEIPTDSSGDFEMIYAFLKAHWTIVRWVALGA  171

Query  598   VVLEALM  578
             VV E ++
Sbjct  172   VVFEVIL  178



>gb|AAD09513.1| GMFP4, partial [Glycine max]
Length=111

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 88/109 (81%), Gaps = 2/109 (2%)
 Frame = -1

Query  592  LEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSR  413
            L+AL+F+LAL+VRAANRP +YDSD+EYI  PRQQ RQP +N R   PV+G P  GTLD R
Sbjct  5    LQALLFVLALIVRAANRPTEYDSDEEYIN-PRQQARQPFLN-RPAGPVSGAPATGTLDQR  62

Query  412  PSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            PSRNDAWS RMREKYGLDTSEFTYNPSES+RYQ  N QP EE  RC IM
Sbjct  63   PSRNDAWSTRMREKYGLDTSEFTYNPSESHRYQQVNSQPTEEGSRCAIM  111



>gb|AGW24511.1| hypothetical protein, partial [Avicennia marina var. marina]
Length=91

 Score =   155 bits (391),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 81/89 (91%), Gaps = 1/89 (1%)
 Frame = -1

Query  586  ALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPS  407
            AL+FLLAL+VRAAN+PADYDSD+EYIGGPRQQIRQPL+N R  AP TG PV GTLD RPS
Sbjct  1    ALLFLLALIVRAANKPADYDSDEEYIGGPRQQIRQPLIN-RPAAPTTGGPVVGTLDQRPS  59

Query  406  RNDAWSARMREKYGLDTSEFTYNPSESNR  320
            RNDAWS RMREKYGLDTSEFTY+PSESNR
Sbjct  60   RNDAWSQRMREKYGLDTSEFTYSPSESNR  88



>gb|EEC83268.1| hypothetical protein OsI_28600 [Oryza sativa Indica Group]
Length=195

 Score =   157 bits (397),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 138/179 (77%), Gaps = 3/179 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+G  ECLLKLLNF+LT+AGL MVGYGIYL VE+   S  G   P   P    EL+  
Sbjct  1     MACRGFFECLLKLLNFVLTVAGLAMVGYGIYLLVEWMRISGGGGGAPPS-PAPPAELLMF  59

Query  937   GRPMLVAVSLAN--NIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
             GRPML AV+L +  + FD LPK WF+YLFIG+G ++FVIS FGCIGA+TRN CCL CY+ 
Sbjct  60    GRPMLTAVALGDGGSFFDKLPKAWFIYLFIGVGAIIFVISLFGCIGAATRNTCCLCCYAF  119

Query  763   lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLE  587
             LVILLILVE GAAAFIFFDE WK  IP D+T NFD++Y+FL++NW+I +WVALG+V+ E
Sbjct  120   LVILLILVEAGAAAFIFFDESWKDVIPVDKTENFDVMYDFLKENWEIARWVALGSVIFE  178



>gb|EEE68396.1| hypothetical protein OsJ_26735 [Oryza sativa Japonica Group]
Length=221

 Score =   158 bits (399),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 114/180 (63%), Positives = 138/180 (77%), Gaps = 3/180 (2%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             MAC+G  ECLLKLLNF+LT+AGL MVGYGIYL VE+   S  G   P   P    EL+  
Sbjct  1     MACRGFFECLLKLLNFVLTVAGLAMVGYGIYLLVEWMRISGGGGGAPPS-PAPPAELLMF  59

Query  937   GRPMLVAVSLAN--NIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
             GRPML AV+L +  + FD LPK WF+YLFIG+G ++FVIS FGCIGA+TRN CCL CY+ 
Sbjct  60    GRPMLTAVALGDGGSFFDKLPKAWFIYLFIGVGAIIFVISLFGCIGAATRNTCCLCCYAF  119

Query  763   lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
             LVILLILVE GAAAFIFFDE WK  IP D+T NFD++Y+FL++NW+I +WVALG+V+ E 
Sbjct  120   LVILLILVEAGAAAFIFFDESWKDVIPVDKTENFDVMYDFLKENWEIARWVALGSVIFEV  179



>ref|XP_001775831.1| predicted protein [Physcomitrella patens]
 gb|EDQ59370.1| predicted protein [Physcomitrella patens]
Length=297

 Score =   159 bits (402),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 100/228 (44%), Positives = 130/228 (57%), Gaps = 8/228 (4%)
 Frame = -1

Query  943  QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
            Q+ RP L      N+   +LP  WF+Y F   G +   +S  G I A   N  CLSCYSV
Sbjct  76   QIRRPFLKE----NSQLSDLPAPWFIYAFFCAGAITCFVSLTGHIAAELSNSFCLSCYSV  131

Query  763  lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
            L I L+L +   A  +FFD  W+++IP D TG  D I  F+ DN  I KWV+LG V+LE 
Sbjct  132  LQIFLLLAQFAVAGALFFDRHWREDIPEDPTGELDKIQNFVLDNLDICKWVSLGVVILEV  191

Query  583  LMFLLALVVRAANRPAD--YDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRP  410
            L    A ++RA +  A   YDSDD+Y+  PR   R+P+ + +   P          ++RP
Sbjct  192  LGLFFAFILRAISSNARRYYDSDDDYMA-PRSAPRRPVADRQANQPPLAAGSGAATETRP  250

Query  409  SRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             R+DAWS RMREKYGLDT+EFT NPSES R         E++ RCTIM
Sbjct  251  -RSDAWSIRMREKYGLDTTEFTSNPSESMRLSNQTPAAEEQQSRCTIM  297



>dbj|BAD94952.1| hypothetical protein [Arabidopsis thaliana]
Length=95

 Score =   152 bits (383),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 83/97 (86%), Gaps = 2/97 (2%)
 Frame = -1

Query  556  RAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMR  377
            RAAN PA+YDSDDEY+  PRQQIRQP +N RQ APVTGVPVA TLD RPSR+D WSARMR
Sbjct  1    RAANTPAEYDSDDEYLA-PRQQIRQPFIN-RQAAPVTGVPVAPTLDQRPSRSDPWSARMR  58

Query  376  EKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            EKYGLDTSEFTYNPSES+R+Q    QP EE+GRCTIM
Sbjct  59   EKYGLDTSEFTYNPSESHRFQQMPAQPNEEKGRCTIM  95



>gb|ACL54399.1| unknown [Zea mays]
 gb|AFW87793.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
 gb|AFW87794.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
Length=129

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 100/131 (76%), Gaps = 3/131 (2%)
 Frame = -1

Query  655  IYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDDEYIG-GPRQQIRQP  479
            +Y+FL++NW+I +WVALG VV EA++ LLAL VRA N+PA+YDSDDE I  G    IRQP
Sbjct  1    MYDFLKENWEIARWVALGVVVFEAVLLLLALAVRAMNKPAEYDSDDEIIAIGRSPTIRQP  60

Query  478  LMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQ  299
            L++  Q  P TGVPV  TLD R SRNDAWS RMREKYGLDTS+FTYNPS+ +RYQ     
Sbjct  61   LIHT-QNVPATGVPVP-TLDQRASRNDAWSQRMREKYGLDTSQFTYNPSDPSRYQQNGTP  118

Query  298  PAEERGRCTIM  266
             AEER RCTIM
Sbjct  119  RAEERSRCTIM  129



>ref|XP_008354195.1| PREDICTED: tobamovirus multiplication protein 2A-like [Malus 
domestica]
Length=111

 Score =   147 bits (371),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 72/98 (73%), Positives = 80/98 (82%), Gaps = 2/98 (2%)
 Frame = -1

Query  556  RAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSR-PSRNDAWSARM  380
            RAANRPA+YDSDDE I  PRQQIRQPL++NR   P TGVPVAG LD R P+RNDAWS RM
Sbjct  15   RAANRPAEYDSDDELIA-PRQQIRQPLISNRPAVPATGVPVAGALDQRTPNRNDAWSTRM  73

Query  379  REKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            REKYGLDT+EFTYNPSES+R+Q    QP EER RC +M
Sbjct  74   REKYGLDTAEFTYNPSESHRFQQVAAQPQEERSRCIVM  111



>ref|XP_001762411.1| predicted protein [Physcomitrella patens]
 gb|EDQ72878.1| predicted protein [Physcomitrella patens]
Length=298

 Score =   151 bits (381),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 116/303 (38%), Positives = 167/303 (55%), Gaps = 24/303 (8%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPP--SSGEL-  947
             M+C+G ++C+LKL+NFL+TL G  M+ Y +++  E+ +  P   +  +  P   S G++ 
Sbjct  1     MSCQGFIQCILKLINFLVTLVGALMIVYSLWMLKEWSSFGPHDQETLVNAPALLSGGDIS  60

Query  946   -----VQL---------GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCI  809
                  VQL          RP+L            LP  WF+Y F G G +   +S  G I
Sbjct  61    MSSDGVQLTEGFMVEPIARPLLKE----GLYISKLPAPWFIYAFFGAGAITCFVSLTGHI  116

Query  808   GASTRNGcclscysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNW  629
              A   N  CLSCYSVL ILL+L +   A  +FFD  W+++IP D TG  D + EF+ +N 
Sbjct  117   AAELSNSFCLSCYSVLQILLLLAQFAVAGALFFDRHWREDIPEDPTGELDKVQEFVLNNL  176

Query  628   KIVKWVALGAVVLEALMFLLALVVRAANRPA--DYDSDDEYIGGPRQQIRQPLMNNRQQA  455
              I KWV+LG VVLEAL    A ++R+ +  A  DYDSD++Y+   R   R+P+++ +   
Sbjct  177   DICKWVSLGVVVLEALGLFFAFILRSISSSARRDYDSDEDYMVA-RSAPRRPVVDRQANQ  235

Query  454   PVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRC  275
             P          ++RP R+DAWS RMREKYGLDT+EF+ N  +  R         E++ RC
Sbjct  236   PPPASGSGAATEARPPRSDAWSTRMREKYGLDTTEFSSNSPDMRRLPNQTPGAEEQQSRC  295

Query  274   TIM  266
              IM
Sbjct  296   IIM  298



>ref|XP_008373605.1| PREDICTED: tobamovirus multiplication protein 2A-like [Malus 
domestica]
Length=109

 Score =   145 bits (365),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 74/98 (76%), Positives = 78/98 (80%), Gaps = 4/98 (4%)
 Frame = -1

Query  556  RAANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRP-SRNDAWSARM  380
            RAANRPA+YDSDDE I  PRQQIRQPL+ NRQ  P TG PVAGTLD RP SRNDAWS RM
Sbjct  15   RAANRPAEYDSDDELIA-PRQQIRQPLIANRQAVPATGAPVAGTLDQRPPSRNDAWSTRM  73

Query  379  REKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            REKYGLDT+EFTYNPSES R    + QP EER RC IM
Sbjct  74   REKYGLDTAEFTYNPSESQRQ--VSAQPQEERSRCIIM  109



>gb|ADE76479.1| unknown [Picea sitchensis]
Length=312

 Score =   147 bits (370),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 101/255 (40%), Positives = 137/255 (54%), Gaps = 19/255 (7%)
 Frame = -1

Query  1003  HSPSGDDHPIPFP-------PSSGELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIG  845
             HS  G    +PF            +  +LG+     V+ A+    +LP  WF+Y  +GIG
Sbjct  68    HSSVGQQLEVPFSNPQTIARADQLQFRKLGQHSFDIVAGADLDVHSLPAPWFIYTCLGIG  127

Query  844   VLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWKKEIPTDRTGN  665
             +++ VI+C G + A   NG CL CYS L++LLILVE    A IF +  W+K+IP D TG 
Sbjct  128   IIVCVITCIGHVAAEIANGFCLCCYSTLIVLLILVEAALVADIFLNHNWEKDIPNDPTGE  187

Query  664   FDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADYDSDDEYIGGPRQQ  491
             F+   EF+E N  I KWVAL  V+++A   LLA ++RA  + R  DYDSDD      R  
Sbjct  188   FENTKEFIEHNIDICKWVALTVVIIQAFSLLLATILRAMVSTRRPDYDSDDGDYISSRGT  247

Query  490   IRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQP  311
               QPL++   + P    PV G   +R    DAWS RMREKY L+ +EFT++ +E N   P
Sbjct  248   SHQPLLSQGSETP--SGPVTG--KNRSKSRDAWSKRMREKYALNPNEFTFSSTEPNITDP  303

Query  310   TNVQPAEERGRCTIM  266
                       RC IM
Sbjct  304   NT------ESRCAIM  312



>ref|XP_006854320.1| PREDICTED: tetraspanin-20 [Amborella trichopoda]
 ref|XP_011627035.1| PREDICTED: tetraspanin-20 [Amborella trichopoda]
 gb|ERN15787.1| hypothetical protein AMTR_s00039p00118150 [Amborella trichopoda]
Length=313

 Score =   139 bits (350),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 93/213 (44%), Positives = 128/213 (60%), Gaps = 12/213 (6%)
 Frame = -1

Query  895  FDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFI  716
            F+ LP  WF+Y F+GIG+LL +I+C G I A   NGCCL  Y+ L  +LILVE      I
Sbjct  110  FETLPAPWFIYSFMGIGILLCLITCIGHIAAEALNGCCLCSYTTLTTILILVEAALVGDI  169

Query  715  FFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLE--ALMFLLALVVRAANR  542
             F++ W K++P D TG FD +  F+EDN +I +WV L  + ++  +L+  L L    + R
Sbjct  170  LFNDHWDKDLPYDPTGEFDTLKSFVEDNIEICQWVGLTLICIQALSLLLALILRAMVSTR  229

Query  541  PADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGL  362
              DYDSDD+Y G  R   +QP +N   Q       ++G  D +  R DAWSARMREKYGL
Sbjct  230  WVDYDSDDDY-GVGRINYQQPFLN--HQGGQNSTLISG--DIKNIRTDAWSARMREKYGL  284

Query  361  DTSEFTYNPSESNRYQPTNVQPAEE-RGRCTIM  266
            + +EF YN  E++    T ++  EE +GRC IM
Sbjct  285  NPNEFAYNSIEAS----TGMRNGEENQGRCIIM  313



>gb|KDO40489.1| hypothetical protein CISIN_1g038963mg [Citrus sinensis]
Length=117

 Score =   133 bits (334),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 81/112 (72%), Positives = 92/112 (82%), Gaps = 7/112 (6%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  944
             MAC+GCLECLLKLLNFLLT+ GL MVGYGIYLFVEYK    SG   P+     SG+   V
Sbjct  1     MACRGCLECLLKLLNFLLTIVGLAMVGYGIYLFVEYKRADNSGTVSPV-----SGDEGFV  55

Query  943   QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNG  788
             QLGRPML+AVSLA++IFD LPK WF+YLFIG+GV+LFVISC GCIGA+TRNG
Sbjct  56    QLGRPMLMAVSLADSIFDKLPKAWFIYLFIGVGVVLFVISCVGCIGATTRNG  107



>gb|KEH42419.1| tetraspanin family protein [Medicago truncatula]
Length=249

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/214 (40%), Positives = 129/214 (60%), Gaps = 12/214 (6%)
 Frame = -1

Query  985  DHPIPFPPSSGELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIG  806
            DH  P PP     + L  P   +    ++I  NLP  WF+Y F+ +G+L+  I+ FGCI 
Sbjct  40   DHFTPQPPLPH--LSLSLPRSFSPQFTSDI--NLPAPWFIYAFMCVGILVCCIAFFGCIA  95

Query  805  ASTRNGcclscysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWK  626
            A   NGCCL  Y+VL+ +L+L+E    AFI  D +W++++P D TG    I  F+EDN  
Sbjct  96   AEIINGCCLCFYTVLITVLVLLEAALVAFIAIDRQWQEDLPVDPTGQLASIRSFIEDNQD  155

Query  625  IVKWVALGAVVLEALMFLLALVVRA--ANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAP  452
            I +WV +  +V++AL  L+AL++RA  + R AD+D ++EY    R + R+PL+N+ Q   
Sbjct  156  ISRWVGIAVLVVQALSLLVALILRATVSTRRADFDDEEEY--DVRGRSREPLLNH-QSGQ  212

Query  451  VTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSE  350
             +G+      D R + +D WS+RMREKYGL+  +
Sbjct  213  TSGISKG---DIRGNLSDVWSSRMREKYGLNNGD  243



>gb|ACJ84998.1| unknown [Medicago truncatula]
Length=249

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 85/214 (40%), Positives = 129/214 (60%), Gaps = 12/214 (6%)
 Frame = -1

Query  985  DHPIPFPPSSGELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIG  806
            DH  P PP     + L  P   +    ++I  NLP  WF+Y F+ +G+L+  I+ FGCI 
Sbjct  40   DHFTPQPPLPH--LSLSLPRSFSPQFTSDI--NLPAPWFIYAFMCVGILVCCIAFFGCIA  95

Query  805  ASTRNGcclscysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWK  626
            A   NGCCL  Y+VL+ +L+L+E    AFI  D +W++++P D TG    I  F+EDN  
Sbjct  96   AEIINGCCLCFYTVLITVLVLLEAALVAFIAIDRQWQEDLPVDPTGQLASIRSFIEDNQD  155

Query  625  IVKWVALGAVVLEALMFLLALVVRA--ANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAP  452
            I +WV +  +V++AL  L+AL++RA  + R AD+D ++EY    R + R+PL+N+ Q   
Sbjct  156  ISRWVGIAVLVVQALSLLVALILRATVSTRRADFDDEEEY--DVRGRSREPLLNH-QSGQ  212

Query  451  VTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSE  350
             +G+      D R + +D WS+RMREKYGL+  +
Sbjct  213  TSGISKG---DIRGNLSDVWSSRMREKYGLNNGD  243



>gb|KDO36654.1| hypothetical protein CISIN_1g033543mg [Citrus sinensis]
 gb|KDO36655.1| hypothetical protein CISIN_1g033543mg [Citrus sinensis]
Length=117

 Score =   127 bits (318),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 81/112 (72%), Positives = 91/112 (81%), Gaps = 7/112 (6%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE--LV  944
             MAC+GCLECLLKLLNFLLTLAGL MVGYGIYLFVEYK     G   P+     SG+   V
Sbjct  1     MACRGCLECLLKLLNFLLTLAGLAMVGYGIYLFVEYKRVDNLGTVSPV-----SGDEGFV  55

Query  943   QLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNG  788
             QLGRPML+AVSLA++IFD LPK WF+YLFIG+GV+LFVISC GCI A+TRNG
Sbjct  56    QLGRPMLMAVSLADSIFDKLPKAWFIYLFIGVGVVLFVISCVGCISATTRNG  107



>ref|XP_002984277.1| hypothetical protein SELMODRAFT_229009 [Selaginella moellendorffii]
 gb|EFJ14787.1| hypothetical protein SELMODRAFT_229009 [Selaginella moellendorffii]
Length=258

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 105/289 (36%), Positives = 156/289 (54%), Gaps = 36/289 (12%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             M C+GCL+ ++KLLN LL + GLGM+ Y +++  +   H    DD     P    EL   
Sbjct  1     MKCRGCLQIVVKLLNLLLFVIGLGMILYSVWMLNQLHKHGDD-DDGLNSLPVVRSEL---  56

Query  937   GRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlv  758
                 L A++ ++ I  +LP  WF+Y F+G+G+ + +IS  G + A   +GCCL C SV +
Sbjct  57    ----LGAMANSSRIELSLPVPWFVYAFMGVGIFVCIISFSGYVAAEAASGCCLCCSSVFL  112

Query  757   illilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALM  578
              + +L++   AA IFFD+ W+++ P D TG    I +F+E N +  KW+ L  V++E L 
Sbjct  113   GIFLLLQAALAATIFFDKSWERDFPKDPTGEIHSIRKFVEKNAEFCKWIGLSVVIVEVLS  172

Query  577   FLLALVVRAA----NRPADYDSDDEYIGGP-RQQIRQPLMNNRQQAPVTGVPVAGTLDSR  413
              L  +++RA     NR + YDSDD+Y+  P R  +R      RQ +P             
Sbjct  173   LLFGMILRAVIGDFNR-SGYDSDDDYVRPPTRSNVR------RQGSP-------------  212

Query  412   PSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
             P  +   S ++R+KY     EF+Y PSES R    N  P E R RCTIM
Sbjct  213   PELSSTRSTKLRDKYA---GEFSYTPSESRRLLQQNGAPEESRSRCTIM  258



>gb|EMT27731.1| hypothetical protein F775_29713 [Aegilops tauschii]
Length=281

 Score =   130 bits (328),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 96/146 (66%), Gaps = 14/146 (10%)
 Frame = -1

Query  688  IPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDDEYI  509
            IP D+TGNFDMIY FL++NW+  KWVALGAVV EAL+F +AL+V++ N+  DYDSDDEYI
Sbjct  35   IPVDKTGNFDMIYSFLKENWRTAKWVALGAVVFEALLFTVALIVQSGNQD-DYDSDDEYI  93

Query  508  GGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKY--GLDTSEFT---  344
             GPR  +RQPL+ N+Q A    VP    LD RP RNDAWS RMR+K   G D S  T   
Sbjct  94   -GPRSGVRQPLV-NKQTATDPRVP---NLDYRPIRNDAWSQRMRDKVSTGDDISRRTKKQ  148

Query  343  -YNPSESNRYQPTNVQPAEERGRCTI  269
             +NP    R   ++V  +E    C I
Sbjct  149  MHNPLMLGRC--SSVPVSEFTASCAI  172



>gb|AFK47805.1| unknown [Medicago truncatula]
Length=249

 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 84/214 (39%), Positives = 129/214 (60%), Gaps = 12/214 (6%)
 Frame = -1

Query  985  DHPIPFPPSSGELVQLGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIG  806
            DH  P PP     + L  P   +    ++I  NLP  WF+Y F+ +G+L+  I+ FGCI 
Sbjct  40   DHFTPQPPLPH--LSLSLPRSFSPQFTSDI--NLPAPWFIYAFMCVGILVCCIAFFGCIA  95

Query  805  ASTRNGcclscysvlvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWK  626
            A   NGCCL  Y+VL+ +L+L+E    AFI  D +W++++P D TG    I  F+ED+  
Sbjct  96   AEIINGCCLCFYTVLITVLVLLEAALVAFIAIDRQWQEDLPVDPTGQLASIRSFIEDDQD  155

Query  625  IVKWVALGAVVLEALMFLLALVVRA--ANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAP  452
            I +WV +  +V++AL  L+AL++RA  + R AD+D ++EY    R + R+PL+N+ Q   
Sbjct  156  ISRWVGIAVLVVQALSLLVALILRATVSTRRADFDDEEEY--DVRGRSREPLLNH-QSGQ  212

Query  451  VTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSE  350
             +G+      D R + +D WS+RMREKYGL+  +
Sbjct  213  TSGISKG---DIRGNLSDVWSSRMREKYGLNNGD  243



>ref|XP_008235542.1| PREDICTED: tetraspanin-18-like [Prunus mume]
Length=285

 Score =   130 bits (326),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/194 (41%), Positives = 119/194 (61%), Gaps = 10/194 (5%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
             LP  WF+Y F+G+GVL+  I+  GCI A + NGCCL  Y++L+ +L L+E    AFI  
Sbjct  99   KLPAPWFIYTFMGLGVLICCITFIGCIAAESINGCCLCFYTILITVLTLLEAALVAFIAI  158

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVR--AANRPA  536
            D RW+K++P D TG  D +  F++DN  I +W  L  ++L+AL  LLA+V+R   +   A
Sbjct  159  DHRWEKDLPFDPTGELDSLRSFVQDNIDICRWAGLAVIILQALSLLLAMVLRGMVSTWKA  218

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDT  356
            DYD +D+Y    R + R+PL+NN Q +  +G       D R + +D WS+R+R+KYGL+ 
Sbjct  219  DYDVEDDY--DFRGRTREPLLNN-QLSQASGSTKG---DGRGTHSDIWSSRIRDKYGLNA  272

Query  355  SEFTYNPSESNRYQ  314
                 N S S++ +
Sbjct  273  --VNQNASASSKSK  284



>ref|XP_002972445.1| hypothetical protein SELMODRAFT_228108 [Selaginella moellendorffii]
 gb|EFJ26531.1| hypothetical protein SELMODRAFT_228108 [Selaginella moellendorffii]
Length=260

 Score =   128 bits (321),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 104/290 (36%), Positives = 154/290 (53%), Gaps = 36/290 (12%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELV-Q  941
             M C+GCL+ ++KLLN LL + GLGM+ Y +++  +   H    DD     P    EL+  
Sbjct  1     MKCRGCLQIVVKLLNLLLFVIGLGMILYSVWMLNQLHKHGDD-DDGLNSLPVVRSELLGA  59

Query  940   LGRPMLVAVSLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvl  761
             +     + V L+      LP  WF+Y F+G+G+ + +IS  G + A   +GCCL C SV 
Sbjct  60    MANSSRIGVELS------LPVPWFVYAFMGVGIFVCIISFSGYVAAEAASGCCLCCSSVF  113

Query  760   villilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEAL  581
             + + +L++   AA IFFD+ W+++ P D TG    I +F+E N +  KW+ L  V++E L
Sbjct  114   LGIFLLLQAALAATIFFDKSWERDFPKDPTGEIHSIRKFVEKNAEFCKWIGLTVVIVEVL  173

Query  580   MFLLALVVRAA----NRPADYDSDDEYIGGP-RQQIRQPLMNNRQQAPVTGVPVAGTLDS  416
               L  +++RA     NR + YDSDD+Y+  P R  +R      RQ +P            
Sbjct  174   GLLFGMILRAVIGDFNR-SGYDSDDDYVRPPTRSNVR------RQGSP------------  214

Query  415   RPSRNDAWSARMREKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
              P  +   S ++R+KY     EF+Y PSES R    N  P E R RCTIM
Sbjct  215   -PELSSTRSTKLRDKYA---GEFSYTPSESRRLLQQNGAPEESRSRCTIM  260



>gb|EAZ06370.1| hypothetical protein OsI_28599 [Oryza sativa Indica Group]
 gb|EAZ42170.1| hypothetical protein OsJ_26734 [Oryza sativa Japonica Group]
Length=134

 Score =   124 bits (311),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 74/98 (76%), Gaps = 3/98 (3%)
 Frame = -1

Query  556  RAANRPADYDSDDEYIGGPRQ-QIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARM  380
            RA N+PA+YDSDDE I   R   IRQPL+++ Q  P TGVPVA TL+ R SRNDAWS RM
Sbjct  39   RAMNKPAEYDSDDEIIATSRSTSIRQPLIHS-QNVPATGVPVA-TLEQRASRNDAWSQRM  96

Query  379  REKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            REKYGLDTS+FTYNPS+ +RYQ     PAEER RC I+
Sbjct  97   REKYGLDTSQFTYNPSDPSRYQQNGAPPAEERNRCVIL  134



>ref|XP_012085178.1| PREDICTED: tetraspanin-18 [Jatropha curcas]
 gb|KDP26433.1| hypothetical protein JCGZ_17591 [Jatropha curcas]
Length=271

 Score =   127 bits (320),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 90/253 (36%), Positives = 132/253 (52%), Gaps = 40/253 (16%)
 Frame = -1

Query  1048  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELV-------QLGRPMLVAVSLANNIFD  890
              +V Y I++  ++ +H        +PFPPS   +        Q  R + +   LA    D
Sbjct  27    SVVLYSIWMLDQWNHH--------VPFPPSPHSIAPSPDSQSQSLRVLSLVADLAYGFDD  78

Query  889   ---------NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilve  737
                       LP  WF+Y F+G+G++L  I+  GCI A   NGCCL  Y++L IL IL+E
Sbjct  79    GLGLRLNSFELPAPWFIYSFMGVGIILCCITLIGCIAAEAINGCCLCFYTILKILFILIE  138

Query  736   LGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVV  557
                 AFI  D RW+K+IP D TG    +  F+EDN  I KWV +  + ++AL  LLA+++
Sbjct  139   AALVAFIAIDHRWQKDIPFDPTGELQTLKSFIEDNVDICKWVGITVLTVQALSLLLAMIL  198

Query  556   RA--ANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSAR  383
             RA  + R  D + +D+Y  G R +  +PL+N   Q             +  + +D WS R
Sbjct  199   RAMVSTRREDSECEDDYENG-RGRSWEPLLNQSGQ-------------TSGAHSDIWSTR  244

Query  382   MREKYGLDTSEFT  344
             MREKYGL++ E T
Sbjct  245   MREKYGLNSVEKT  257



>ref|XP_011083093.1| PREDICTED: tetraspanin-18 [Sesamum indicum]
Length=263

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 85/241 (35%), Positives = 135/241 (56%), Gaps = 24/241 (10%)
 Frame = -1

Query  1048  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLA---NNI---FDN  887
              MV Y  Y+  ++++    GD+ P P P      + L   ++  ++LA   N +   F +
Sbjct  27    AMVIYSAYMLSQWQHR---GDEFPPPAPSHDVSGIHLSADVVNHLNLALGDNALHVNFHS  83

Query  886   LPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFD  707
             LP  WF+Y F+GIGV++  I+C G I A + NGCCL  Y++L  + +L+E+G  A + FD
Sbjct  84    LPAPWFIYAFMGIGVIICCITCIGNIAAESINGCCLCSYALLTTVFLLLEVGLVALVAFD  143

Query  706   ERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPAD  533
               WKK++P D TG  D +  F+EDN  I+KWV +  ++++AL  L A ++R+  ++R  D
Sbjct  144   RHWKKDLPFDPTGELDNLMAFIEDNMDILKWVGIAILIIQALSLLFATILRSMVSSRDVD  203

Query  532   YDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTS  353
              D + EY        R+PL+  R  +   G P   +        D WS+RMR+KYGL+T 
Sbjct  204   DDIEAEY----DYSSREPLLIPR-PSQACGSPRGDS--------DIWSSRMRQKYGLNTG  250

Query  352   E  350
             +
Sbjct  251   D  251



>ref|XP_008372422.1| PREDICTED: tetraspanin-18-like [Malus domestica]
Length=287

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/192 (39%), Positives = 114/192 (59%), Gaps = 8/192 (4%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
             LP  WF+Y F+G+G+LL  ++  GCI A+  NGCCL  Y++LV +L L+E    AFI  
Sbjct  101  KLPAPWFIYSFMGLGILLCCVTFIGCIAAAAINGCCLCFYTILVTMLTLLEAALVAFILI  160

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPA  536
            D RW+K++P D TG  D    F+E+N  I +WV LG +V++ L  LL++ +R   +    
Sbjct  161  DRRWEKDLPFDPTGQLDSFRSFVEENIDICRWVGLGVIVIQVLSLLLSITLRGMLSTHKP  220

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDT  356
            DYD +D+Y    R + R+PL+  +QQ         G  D + + +D WS+R+R+KYGL +
Sbjct  221  DYDVEDDY--DARARTREPLL--KQQLNQASGSTKG--DGKGTHSDIWSSRIRDKYGLSS  274

Query  355  SEFTYNPSESNR  320
                 +PS  ++
Sbjct  275  LNQNASPSMQSK  286



>gb|KJB26070.1| hypothetical protein B456_004G223400 [Gossypium raimondii]
Length=295

 Score =   125 bits (315),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 79/204 (39%), Positives = 118/204 (58%), Gaps = 10/204 (5%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
             LP  WF+Y F+G+G++L  IS  GCI A + NGCCL  Y+++ I+LIL+E    AFI  
Sbjct  100  KLPAPWFIYSFLGVGIVLCCISLIGCIAAESINGCCLCFYTLIKIVLILIEASLVAFIAI  159

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPA  536
            D  W+K+IP D TG  D +  F+EDN  I KWV L  V+++ L  L+A+++RA  + R  
Sbjct  160  DRHWEKDIPFDPTGELDSLRSFIEDNIDICKWVGLSVVIIQVLALLVAVILRAMVSVRRR  219

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDT  356
              D +D+Y    R + R+PL+N   Q+  T     G  D R S +D W +R+REKYG+++
Sbjct  220  GIDDEDDY---ERGRTREPLLN--PQSNHTSTSAKG--DGRVSHSDFWGSRIREKYGMNS  272

Query  355  SEFTYNPSESNRYQPTNVQPAEER  284
             +  YN ++       N      +
Sbjct  273  GD-RYNSADKYDLLNQNASSTNSK  295



>ref|XP_010652447.1| PREDICTED: tetraspanin-18-like [Vitis vinifera]
 emb|CBI37235.3| unnamed protein product [Vitis vinifera]
Length=274

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 111/181 (61%), Gaps = 8/181 (4%)
 Frame = -1

Query  895  FDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFI  716
            F  LP  WF+Y F+G+G+++  I+C G I A   NGCCL  Y++L +LLIL+E G  AF+
Sbjct  94   FIKLPAPWFIYSFMGVGIVVCCITCIGHIAAEAINGCCLCFYTMLTVLLILLEAGLIAFV  153

Query  715  FFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANR  542
             FD  W+K++P D TG  +    F+E N  I KWV +  V ++AL  LLA+++RA  + R
Sbjct  154  AFDHHWEKDLPFDPTGELENFRSFIEGNIDICKWVGITVVSIQALSLLLAMILRAMVSTR  213

Query  541  PADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGL  362
              DYD +D+Y    R   R+PL+N   QA  T     G  D + +  + WS+RMREKYGL
Sbjct  214  KTDYDIEDDYTAAGRN--REPLLN--PQASQTSGSSKG--DGKGAYLETWSSRMREKYGL  267

Query  361  D  359
            +
Sbjct  268  N  268



>gb|AFW87792.1| hypothetical protein ZEAMMB73_665682 [Zea mays]
Length=113

 Score =   120 bits (300),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 72/98 (73%), Gaps = 3/98 (3%)
 Frame = -1

Query  556  RAANRPADYDSDDEYIG-GPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARM  380
            RA N+PA+YDSDDE I  G    IRQPL++  Q  P TGVPV  TLD R SRNDAWS RM
Sbjct  18   RAMNKPAEYDSDDEIIAIGRSPTIRQPLIHT-QNVPATGVPVP-TLDQRASRNDAWSQRM  75

Query  379  REKYGLDTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            REKYGLDTS+FTYNPS+ +RYQ      AEER RCTIM
Sbjct  76   REKYGLDTSQFTYNPSDPSRYQQNGTPRAEERSRCTIM  113



>ref|XP_007050068.1| Tetraspanin family protein, putative [Theobroma cacao]
 gb|EOX94225.1| Tetraspanin family protein, putative [Theobroma cacao]
Length=297

 Score =   125 bits (313),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 87/264 (33%), Positives = 147/264 (56%), Gaps = 33/264 (13%)
 Frame = -1

Query  1048  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL---GRPML--------------V  920
              ++ Y I++  ++ +H P    +P P  PS    + +    RP +              +
Sbjct  27    SIILYSIWMLDQWNHHVPI---YPPPIAPSPESFLSVHFNSRPEIGAEAARVFDDFVVGL  83

Query  919   AVSLANNI-FD----NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvi  755
             A  L N++ FD     LP  WF+Y F+G+G++L  I+  GCI A + NGCCL  Y++L I
Sbjct  84    ASGLDNSVGFDLSSVKLPAPWFIYSFMGVGIVLCCITFIGCIAAESVNGCCLCFYTLLKI  143

Query  754   llilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMF  575
             +LIL+E    AFI  D  W+K++P D TG  D +  F+EDN  + KWV +  V+++AL  
Sbjct  144   VLILIEAALVAFIAIDRHWEKDLPFDETGELDSLRSFIEDNIDLCKWVGISVVIVQALSL  203

Query  574   LLALVVRA--ANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRN  401
             L+A+++RA  ++   D D++D+Y    R +  +PL+N++     T    +   D + + +
Sbjct  204   LVAIILRAMVSSGRRDIDNEDDY-ENIRGRTWKPLLNSQSSHTST----SAKTDGKGTHS  258

Query  400   DAWSARMREKYGLDTSEFTYNPSE  329
             D W +R+REKYGL++ +  YN ++
Sbjct  259   DIWGSRIREKYGLNSGD-RYNSAD  281



>ref|XP_009371022.1| PREDICTED: tetraspanin-18-like [Pyrus x bretschneideri]
 ref|XP_009371028.1| PREDICTED: tetraspanin-18-like [Pyrus x bretschneideri]
Length=287

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/192 (38%), Positives = 113/192 (59%), Gaps = 8/192 (4%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
             LP  WF+Y F+G+G+LL  ++  GCI A+  NGCCL  Y++L+ +L L+E    AFI  
Sbjct  101  KLPAPWFIYSFMGLGILLCCVTFIGCIAAAAINGCCLCFYTILITMLTLLEAALVAFILI  160

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPA  536
            D RW+K++P D TG  D    F+E+N  I +WV LG + ++ L  LL++ +R   +    
Sbjct  161  DRRWEKDLPFDPTGQLDSFRSFVEENIDICRWVGLGVIAIQVLCVLLSITLRGLLSTHKP  220

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDT  356
            DYD +D+Y    R + R+PL+  +QQ         G  D + + +D WS+R+R+KYGL +
Sbjct  221  DYDIEDDY--DARARTREPLL--KQQLNQASGSNKG--DGKGTHSDIWSSRIRDKYGLSS  274

Query  355  SEFTYNPSESNR  320
                 +PS  ++
Sbjct  275  LNQNASPSMKSK  286



>ref|XP_008382665.1| PREDICTED: tetraspanin-18-like [Malus domestica]
Length=287

 Score =   122 bits (307),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 76/198 (38%), Positives = 116/198 (59%), Gaps = 18/198 (9%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
             LP  WF+Y F+G+G+LL  ++  GCI A+  NGCCL  Y++L+ +L L+E    AFI  
Sbjct  101  KLPAPWFIYSFMGLGILLCCVTFIGCIAATAINGCCLCFYTILITMLTLLEAALVAFILI  160

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVR---AANRP  539
            D RW+K++P D TG  D +  F+++N  I +WV L  +V++AL  LL++ +R   +  +P
Sbjct  161  DRRWEKDLPFDPTGQLDSLRSFVKENIDICRWVGLTVIVIQALSLLLSITLRGMLSICKP  220

Query  538  ADYDSDDEYIGGPRQQIRQPLMN---NRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKY  368
             DYD +D+     R + R+PL+N   N+      G       D R + +D WS+R+REKY
Sbjct  221  -DYDVEDD--SDARARTREPLLNQKLNQASGSTKG-------DGRGTHSDIWSSRIREKY  270

Query  367  GLDTSEFTYNPSESNRYQ  314
            GL  S    N S S + +
Sbjct  271  GL--SSLNENASASMKSK  286



>gb|KDP43415.1| hypothetical protein JCGZ_16702 [Jatropha curcas]
Length=229

 Score =   120 bits (302),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 111/171 (65%), Gaps = 7/171 (4%)
 Frame = -1

Query  1036  YGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRP-MLVAVSLANNIFDNLPKEWFLYL  860
             YGI+  V +KN   S   +      +S +  Q+  P  L+A+  ++ + + LP  WF+YL
Sbjct  29    YGIFCLVNWKNDRESHSHN------NSKKYEQIALPRALLAIEASSWLSNRLPVAWFIYL  82

Query  859   FIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWKKEIPT  680
              + IG  L VISCFGC+GA+TR+ CCL  YSVL++LL + +L AAAF+FF+   +K++P 
Sbjct  83    LLVIGASLIVISCFGCVGAATRSSCCLCTYSVLLVLLFIAQLVAAAFMFFNHNRQKDMPN  142

Query  679   DRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYD  527
             DR+G+F+  Y F   NWKI++WV + A+ L+ +  ++AL +R ANR  DY+
Sbjct  143   DRSGSFNSTYRFFTLNWKIIRWVIIAALALKVIGLVVALYLRYANRVNDYE  193



>ref|XP_011080147.1| PREDICTED: tetraspanin-18 [Sesamum indicum]
Length=270

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 108/189 (57%), Gaps = 9/189 (5%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
            +LP  WF+Y F+GIG+L+  I+C G +GA   NGCCL  Y+VL+ + IL E G  AFI  
Sbjct  84   SLPAPWFIYAFMGIGILVCCITCIGHVGAEAVNGCCLCFYTVLMTIFILFEAGLVAFIAL  143

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADY  530
            D  W+K+IP D TG  D ++ F+EDN  I  WV +  +V++ L  L A+++R+       
Sbjct  144  DHHWEKDIPFDPTGELDSLWTFIEDNVDIFTWVGITVIVIQVLSLLFAIILRSLVSGPRE  203

Query  529  DSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSE  350
            D D E   G R   R+PL+     AP +      T       +D WS+RMREKYGL++ E
Sbjct  204  DDDLEGDYGFRSSTREPLL-----APYSSQASGST----RGDSDIWSSRMREKYGLNSGE  254

Query  349  FTYNPSESN  323
              ++  + N
Sbjct  255  AKHSLLDQN  263



>ref|XP_002517938.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44456.1| conserved hypothetical protein [Ricinus communis]
Length=221

 Score =   119 bits (298),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 103/173 (60%), Gaps = 13/173 (8%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+Y F+G+GV L VI+C G + A T NGCCL  Y + V +L ++E G +A +F + 
Sbjct  54   PAPWFIYTFLGLGVTLCVITCVGHVAAETANGCCLYLYMLFVFVLFMLEAGVSADVFLNR  113

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  524
             W+K+ P D TG+F+   +F+  N++I KW+ L  V ++ L FLLAL+++A       DS
Sbjct  114  DWEKDFPKDPTGSFNQFKDFIRSNFEICKWMGLSIVSVQGLSFLLALILKALGPHQYCDS  173

Query  523  DDEYIGGPRQQIRQPLMNNRQQAP--VTGVPVAGTLDSRPSRNDAWSARMREK  371
            DDE+        R PL+NN    P  V G PV G      SRNDAWS R+ EK
Sbjct  174  DDEFTPD-----RVPLLNNAAIPPPYVVGSPVVG------SRNDAWSIRINEK  215



>ref|XP_009592671.1| PREDICTED: tetraspanin-20-like [Nicotiana tomentosiformis]
Length=251

 Score =   119 bits (297),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 82/245 (33%), Positives = 129/245 (53%), Gaps = 26/245 (11%)
 Frame = -1

Query  1048  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLANNIFDNLPKEWF  869
              ++ Y  Y+   +++H+        P P    E    G  ML   SL        P  WF
Sbjct  27    SIIIYSAYMLNHWQHHNN------FPPPNLDSESSNFGSIMLNKHSL--------PTPWF  72

Query  868   LYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWKKE  689
             LY F+GIGV+L  I+C G +GA   NGC L  YS+L+   +LVE+    FI  D +W+K+
Sbjct  73    LYAFMGIGVILCCITCIGHVGAEAVNGCFLCFYSLLMTAFVLVEISLVVFIALDRQWEKD  132

Query  688   IPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA----ANRPADYDSD  521
             +P D TG    +  F+E N  + KW+ +  ++++A   LLA+V+RA         D++ D
Sbjct  133   LPRDPTGELHNVRTFIEQNMDVCKWIGIAVIIIQASSLLLAIVLRALVSDHRINHDFEGD  192

Query  520   DEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTY  341
              + IG    + R+PL++ R  +  +G+  A   D+R   +D WS+RMREKY LD     +
Sbjct  193   YDVIG----RTREPLLDPR-LSQTSGLAKA---DARVGHSDIWSSRMREKYHLDGEARHH  244

Query  340   NPSES  326
              P+++
Sbjct  245   IPNQN  249



>ref|XP_009388438.1| PREDICTED: tetraspanin-20-like [Musa acuminata subsp. malaccensis]
Length=234

 Score =   117 bits (293),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 69/196 (35%), Positives = 116/196 (59%), Gaps = 11/196 (6%)
 Frame = -1

Query  892  DNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIF  713
            ++LP  WF+ + +G+G+ L +I+  G + A   NGCCL  Y++L   LI++E+     + 
Sbjct  48   EHLPAPWFVCVSMGVGICLCLITFIGHVAAEAINGCCLCFYTMLSTTLIILEVILVGGLV  107

Query  712  FDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRP  539
             ++ W++++P D TG    +  F+EDN    KWVALG ++++AL  LLA+V+RA   +R 
Sbjct  108  LNKHWEEDLPYDSTGELKRVRTFIEDNMDTCKWVALGVIIIQALSLLLAMVLRAMIPSRR  167

Query  538  ADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLD  359
             +YDSD++++      IR+PL+N +   P T      ++D++   +D W +RMR KYGL+
Sbjct  168  MEYDSDEDFV-----VIRRPLLNPQGGPPYT----TNSIDNKGLHSDIWGSRMRHKYGLN  218

Query  358  TSEFTYNPSESNRYQP  311
              E T N  +     P
Sbjct  219  QGELTCNTVDPATQCP  234



>ref|XP_010936082.1| PREDICTED: tetraspanin-20-like [Elaeis guineensis]
Length=248

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 76/212 (36%), Positives = 124/212 (58%), Gaps = 13/212 (6%)
 Frame = -1

Query  895  FDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFI  716
             + LP  WF+   +G GVLL +I+  G I A   NGCCL  ++VL I+LIL+E    + +
Sbjct  48   LEGLPAPWFICAIMGAGVLLCLIAFTGHIAAEVVNGCCLCFFAVLTIILILLEATLVSIL  107

Query  715  FFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NR  542
             FD+ W++ +P D T        F+++N  I KWVA+  +V++AL  LLA+++RA    R
Sbjct  108  VFDKHWEENLPYDSTEELKRFCAFIKENMDICKWVAVTVIVIQALSLLLAMILRAMVPAR  167

Query  541  PADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGL  362
              DYDSD++++      IR+PL++ +  +      V G    +   +D WS++MR+KYGL
Sbjct  168  RVDYDSDEDFV-----VIRRPLLDPQGGSSYASTSVGG----KGFHSDFWSSQMRQKYGL  218

Query  361  DTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            + SEF+YN  +     P+    ++ R +C+I+
Sbjct  219  NQSEFSYNGVDQK--APSANGNSDNRKQCSIL  248



>ref|XP_009342640.1| PREDICTED: tetraspanin-19 [Pyrus x bretschneideri]
Length=220

 Score =   116 bits (291),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 101/173 (58%), Gaps = 13/173 (8%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+Y F+GIG+ L VI+C G I A T NGCCL  Y V + LL ++E G  A IF + 
Sbjct  56   PTPWFIYTFLGIGITLLVITCSGHIAADTANGCCLYLYMVFIFLLFMLEAGVTADIFLNR  115

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  524
             W+++ P D TG FD   EF+  N+ I KW+ L  V ++ L  LLA++++A      YDS
Sbjct  116  DWEEDFPDDPTGRFDQFKEFVRSNFDICKWIGLSIVCVQGLSLLLAMILKALGPHPYYDS  175

Query  523  DDEYIGGPRQQIRQPLMNNRQQAP--VTGVPVAGTLDSRPSRNDAWSARMREK  371
            DD+YI       R PL+NN    P  V G PV G      S++D+W+ R+ +K
Sbjct  176  DDDYIPE-----RVPLLNNAVLPPPYVVGDPVYG------SKSDSWNIRINDK  217



>ref|XP_010038335.1| PREDICTED: tetraspanin-20 [Eucalyptus grandis]
 gb|KCW50153.1| hypothetical protein EUGRSUZ_K03588 [Eucalyptus grandis]
Length=292

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 73/180 (41%), Positives = 111/180 (62%), Gaps = 7/180 (4%)
 Frame = -1

Query  886  LPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFD  707
            LP  WF+Y F+G+G++L  +S  GCI A   NGCCL  Y++LV +L+L+E    AFI  D
Sbjct  101  LPAPWFIYSFMGLGIVLCCVSLIGCIAAEALNGCCLCFYTLLVSVLLLLEAALVAFIAID  160

Query  706  ERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRP--AD  533
             RW++ +P+D TG  D +  F+E N ++ KW+ +  VV++AL  LL+ V+RA   P  AD
Sbjct  161  HRWEQILPSDPTGELDSLRSFIESNIEMCKWIGIAVVVIQALSLLLSFVLRALASPRRAD  220

Query  532  YDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTS  353
            YD  D+Y      + R+PL+N++  +  +G   +   D+R      WS+ +REKYGL+ S
Sbjct  221  YDGLDDY-DNVEGRTREPLLNHK-SSTTSG---SAKSDARGGHTGIWSSLVREKYGLNNS  275



>ref|XP_010672322.1| PREDICTED: tobamovirus multiplication protein 2A-like [Beta vulgaris 
subsp. vulgaris]
Length=215

 Score =   115 bits (288),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 94/158 (59%), Gaps = 13/158 (8%)
 Frame = -1

Query  871  FLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWKK  692
            F+Y+FIG+GV+LFVISC GCIGAST++GCCLS   + +        G  AF+FFD  W  
Sbjct  22   FIYMFIGVGVVLFVISCVGCIGASTKDGCCLSTILLEL--------GCVAFVFFDRNWND  73

Query  691  EIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDDEY  512
            EIPTD+ GNFDMI +FLE++W I KWV L  VVLE       ++    N  A+ D D+E 
Sbjct  74   EIPTDKIGNFDMINDFLEEHWSIAKWVLLRIVVLEVRSIQELVMRNFENLQAESD-DNEP  132

Query  511  IGGPRQQIRQPLM--NN--RQQAPVTGVPVAGTLDSRP  410
               P+   R+ LM  +N  RQQ  +       +L SR 
Sbjct  133  ESEPKVVRREHLMMLDNGLRQQKKIVVSLKKKSLWSRK  170



>ref|XP_008229174.1| PREDICTED: tetraspanin-19 [Prunus mume]
Length=218

 Score =   114 bits (286),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 101/173 (58%), Gaps = 13/173 (8%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+Y  +G+G+ L VI+C G I A T NGCCL  Y V V  L+++E G AA IF + 
Sbjct  54   PIPWFIYSILGLGITLCVITCSGHIAADTANGCCLYSYMVFVFFLLMLEAGVAADIFLNH  113

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  524
             W+++ P D TG FD   EF+  N+ I KW+ L  V ++ L  LLA++++A      YDS
Sbjct  114  DWEEDFPDDPTGRFDQFKEFVRSNFDICKWIGLSIVCVQGLSLLLAMILKALGPHQYYDS  173

Query  523  DDEYIGGPRQQIRQPLMNNRQQAP--VTGVPVAGTLDSRPSRNDAWSARMREK  371
            DDEY+  P    R PL+ N    P  V G PV G      S+NDAW+ R+ +K
Sbjct  174  DDEYV--PE---RVPLLKNAVLPPPYVIGDPVYG------SKNDAWNIRINDK  215



>ref|XP_006350290.1| PREDICTED: tetraspanin-20-like isoform X1 [Solanum tuberosum]
Length=259

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 70/180 (39%), Positives = 110/180 (61%), Gaps = 8/180 (4%)
 Frame = -1

Query  892  DNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIF  713
            ++LP  WF+Y F+GIGV+L  I+C G +GA   NGCCL  YS+L++  +L+E+   AFI 
Sbjct  73   NSLPAPWFIYAFMGIGVILCCITCIGHVGAEAVNGCCLCFYSLLMMTFVLLEVSLVAFIA  132

Query  712  FDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRP  539
             D  W+K++PTD TG    +  F++ N  + KW+ +  VV++A    LA+V+R   ++  
Sbjct  133  IDHHWEKDLPTDPTGELHSLRTFIQQNMDVCKWIGIVVVVIQAFSLFLAVVLRTLVSSPK  192

Query  538  ADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLD  359
             +YD + +Y    R   R+PL++ R  +  +G+      D+R   +D WS+RMREKY LD
Sbjct  193  LNYDMEGDYDVVGRT--REPLLDPR-LSQTSGLAKG---DARGGHSDIWSSRMREKYHLD  246



>ref|XP_004247113.1| PREDICTED: tetraspanin-20 [Solanum lycopersicum]
Length=259

 Score =   115 bits (287),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/190 (36%), Positives = 113/190 (59%), Gaps = 11/190 (6%)
 Frame = -1

Query  892  DNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIF  713
            ++LP  WF+Y F+GIGV+L  I+C G +GA   NGCCL  YS+L++ L+L+E+   AF+ 
Sbjct  74   NSLPAPWFIYAFMGIGVILCCITCIGHVGAEAVNGCCLCFYSLLMMTLVLLEVSLVAFVA  133

Query  712  FDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVR---AANR  542
             D  W+K++PTD TG    +  F++ N  + KW+ +  +V++A    LA+V+R   ++ +
Sbjct  134  IDHHWEKDLPTDPTGELHSLRIFIQQNMDVCKWIGIVVIVIQAFSLFLAVVLRTLVSSPK  193

Query  541  PADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGL  362
              D + D + +G    + R+PL++ R    ++        D+R   +D WS+RMREKY L
Sbjct  194  LNDMEGDYDVVG----RTREPLLDPR----ISQTSGLAKGDARGGHSDIWSSRMREKYHL  245

Query  361  DTSEFTYNPS  332
            D     + P+
Sbjct  246  DGEAIHHIPN  255



>ref|XP_007217759.1| hypothetical protein PRUPE_ppa011228mg [Prunus persica]
 gb|EMJ18958.1| hypothetical protein PRUPE_ppa011228mg [Prunus persica]
Length=218

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 101/173 (58%), Gaps = 13/173 (8%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+Y  +G+G+ L VI+C G I A T NGCCL  Y V V LL+++E G AA IF + 
Sbjct  54   PIPWFIYSILGLGITLCVITCSGHIAADTANGCCLYSYMVFVFLLLMLEAGVAADIFLNH  113

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  524
             W+++ P D TG FD   EF+  N+ I KW+ L  V ++ L  LLA++++A      YDS
Sbjct  114  DWEEDFPDDPTGRFDQFKEFVRLNFDICKWIGLSIVCVQGLSLLLAMILKALGPHQYYDS  173

Query  523  DDEYIGGPRQQIRQPLMNNRQQAP--VTGVPVAGTLDSRPSRNDAWSARMREK  371
            DDEY+       R PL+ N    P  V G PV G      S+NDAW+ R+ +K
Sbjct  174  DDEYVTE-----RVPLLKNAVLPPPYVIGDPVYG------SKNDAWNIRINDK  215



>ref|XP_006408938.1| hypothetical protein EUTSA_v10002082mg [Eutrema salsugineum]
 gb|ESQ50391.1| hypothetical protein EUTSA_v10002082mg [Eutrema salsugineum]
Length=250

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 85/239 (36%), Positives = 126/239 (53%), Gaps = 18/239 (8%)
 Frame = -1

Query  1048  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPMLVAVSLANNIFDNLPKEWF  869
              ++ Y I++  +Y  H P      +  PPS    V L    +V  S  N    +LP  WF
Sbjct  27    SIIIYSIWMLDQYHRHVP------VDPPPSLKNPVDLTASFVVGSSGFNLRSLDLPAPWF  80

Query  868   LYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWKKE  689
             +Y F+ +G+L+ +++  G I A   NGCCL  YS+L  LLIL+E    AFI  D  W+K+
Sbjct  81    IYSFMAVGILVCIVTIIGFIAAEAINGCCLCFYSILKTLLILLEAALVAFIAIDRHWEKD  140

Query  688   IPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDDEY-  512
             +P D TG  + +  F+E+N  I KWV +  V ++ L  LLA+V+RA   P   + DDE  
Sbjct  141   LPYDPTGELNSLRVFIEENIDICKWVGIAVVAVQLLSLLLAMVLRAMVSPGRPELDDEED  200

Query  511   IGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSEFTYNP  335
                PR +   PL+ ++      G          PS+ + WS+R+REKYGL+ S+   NP
Sbjct  201   YENPRSRAWDPLLGSQGNQASAG----------PSKIENWSSRIREKYGLNQSQ-AVNP  248



>ref|XP_004495030.1| PREDICTED: tetraspanin-20-like [Cicer arietinum]
Length=251

 Score =   112 bits (281),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 72/181 (40%), Positives = 108/181 (60%), Gaps = 6/181 (3%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
            NLP  WF+Y F+ +G+L+  IS  GCI A   NGCCL  Y++L+ +L+L+E     F+  
Sbjct  70   NLPPPWFIYAFMCVGILVCCISFLGCIAAEIINGCCLCFYTLLITVLVLLEATLVGFVAI  129

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADY  530
            D +W++++P D TG  D +  F+EDN  I KWV +  +V++ L  LLA+++RA       
Sbjct  130  DHQWQEDLPVDPTGQLDSLRSFIEDNQNICKWVGIIVLVIQTLSLLLAIILRATVSTRRE  189

Query  529  DSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTL-DSRPSRNDAWSARMREKYGLDTS  353
            D DDE     R + R+PL+N     P +G     +  D R + +D WS+RMREKYGL+  
Sbjct  190  DFDDEEQDDVRGRSREPLLN-----PHSGQTSGSSKGDIRGNHSDVWSSRMREKYGLNNG  244

Query  352  E  350
            +
Sbjct  245  D  245



>ref|XP_008789493.1| PREDICTED: tetraspanin-18 isoform X1 [Phoenix dactylifera]
Length=223

 Score =   111 bits (278),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 111/187 (59%), Gaps = 15/187 (8%)
 Frame = -1

Query  895  FDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFI  716
             + LP  WF+   + +GVLL +++  G + A   NGCCL C++VL+ +LIL+E      +
Sbjct  48   LEGLPAPWFICAMMAVGVLLCLVAFTGHVAAGVVNGCCLCCFAVLITILILLEAALVGVL  107

Query  715  FFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NR  542
             FD+ W++++P D TG    +  F+E+N  I KWVAL  +V++AL  LLA+++RA    R
Sbjct  108  MFDKHWEEDLPYDSTGELKSLCAFIEENMDICKWVALTVIVIQALSLLLAVILRATVPAR  167

Query  541  PADYDSDDEYIGGPRQQIRQPLMNNRQ--QAPVTGVPVAGTLDSRPSRNDAWSARMREKY  368
              DYDSD++ I   R     PL+N +     P T V      D +   +D WS++MR+KY
Sbjct  168  RVDYDSDEDLIVSTR-----PLLNAQGGPSYPTTSV------DGKGFHSDFWSSQMRQKY  216

Query  367  GLDTSEF  347
            GL+ S+F
Sbjct  217  GLNQSKF  223



>ref|XP_008342920.1| PREDICTED: tetraspanin-19-like isoform X1 [Malus domestica]
Length=168

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 101/169 (60%), Gaps = 8/169 (5%)
 Frame = -1

Query  871  FLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWKK  692
            F+Y F+G+G+ L VI+C G I A T NGCCL  Y V V LL ++E G  A IF +  W++
Sbjct  3    FIYTFLGLGITLLVITCSGHIAADTANGCCLYLYMVFVFLLFMLEAGVTADIFLNRDWEE  62

Query  691  EIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDDEY  512
            + P D TG FD   EF+  N+ I KW+ L  V ++ L  LLA++++A      YDSDDEY
Sbjct  63   DFPDDPTGRFDQFKEFVRSNFDICKWIGLSIVCVQGLSLLLAMILKALGPHPYYDSDDEY  122

Query  511  IGGPRQQIRQPLMNNRQQAP--VTGVPVAGTLDSRPSRNDAWSARMREK  371
            I  P    R PL+ N    P  V G PV G+ +   S++D+W+ R+ +K
Sbjct  123  I--PE---RVPLLKNAVLPPPYVVGDPVYGS-NVYGSKSDSWNIRINDK  165



>ref|XP_007144435.1| hypothetical protein PHAVU_007G155900g [Phaseolus vulgaris]
 ref|XP_007144436.1| hypothetical protein PHAVU_007G155900g [Phaseolus vulgaris]
 gb|ESW16429.1| hypothetical protein PHAVU_007G155900g [Phaseolus vulgaris]
 gb|ESW16430.1| hypothetical protein PHAVU_007G155900g [Phaseolus vulgaris]
Length=243

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 74/181 (41%), Positives = 110/181 (61%), Gaps = 10/181 (6%)
 Frame = -1

Query  895  FDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFI  716
            F  LP  WF+Y F+G+G+L+  IS  GCI A   NGCCL  Y++L+ +L+++E     FI
Sbjct  60   FIVLPAPWFIYAFLGVGILVLCISFLGCIAAEMINGCCLCFYTLLIAVLLMLEASLVGFI  119

Query  715  FFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLE--ALMFLLALVVRAANR  542
              D  W+K+IP D TG  D +  F+EDN  I  WV +  +V++  +L+  L L    + R
Sbjct  120  ALDSDWEKDIPLDPTGKLDELRIFIEDNIDICTWVGITVLVVQALSLLLALILRATVSTR  179

Query  541  PADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPV-AGTLDSRPSRNDAWSARMREKYG  365
             AD+D ++E  G  R++  +PL+N     P +G P  +G  D+R + +D WS+RMREKYG
Sbjct  180  EADFDFENE--GDARRRSWEPLLN-----PQSGQPSGSGKGDNRGNHSDIWSSRMREKYG  232

Query  364  L  362
            L
Sbjct  233  L  233



>gb|ADE77737.1| unknown [Picea sitchensis]
Length=236

 Score =   110 bits (274),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 110/189 (58%), Gaps = 9/189 (5%)
 Frame = -1

Query  937  GRPMLVAVSLANNIF--DNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
            GRP L   S   +++   +LP  WF+Y F+G+G+ L  I+C G + A T NG CLSCY +
Sbjct  54   GRPFLGLGSSFGHMYISADLPPPWFIYTFLGMGIFLCFITCSGHVAAETANGHCLSCYML  113

Query  763  lvillilveLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEA  584
             V LL++ E G  A +FF++ W+++ P D TG FD +  FL +N+ I KWV L  ++L+ 
Sbjct  114  FVGLLLITEAGVTADVFFNKNWEEDFPDDPTGQFDQVKNFLRENFDICKWVGLTVLILQV  173

Query  583  LMFLLALVVRAANRPADYDSDDEYIGGP-RQQIRQPLMNNRQQAPVTGVPVAGTLDSRPS  407
            L  LLA+++RA       D D +    P R  +RQP +  +   P T  P     +SRPS
Sbjct  174  LSVLLAMILRAVGPFTGNDDDSDDDYVPSRLDLRQPFL--KSSIPQTTAPP----ESRPS  227

Query  406  RNDAWSARM  380
            +ND WS R+
Sbjct  228  QNDGWSRRL  236



>ref|XP_008448284.1| PREDICTED: tetraspanin-19 [Cucumis melo]
 ref|XP_008448285.1| PREDICTED: tetraspanin-19 [Cucumis melo]
Length=215

 Score =   108 bits (271),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 99/174 (57%), Gaps = 14/174 (8%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+Y F+G+G+LL VI+C G I A T NGCCL  Y +L+ ++I+VE G    +F + 
Sbjct  53   PIPWFMYSFLGLGILLCVITCLGHIAAETANGCCLHLYMLLLFMVIMVEAGVTTDVFLNR  112

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  524
             W ++ P D +G FD    F++ N+ I KW+ +  V ++ L  LLA+V++A      Y+S
Sbjct  113  DWAEDFPKDPSGCFDQFKHFIKSNFNICKWIGISTVSIQGLSLLLAMVLKAIGSRRYYES  172

Query  523  DDEYIGGPRQQIRQPLMNNRQQAPVTGV---PVAGTLDSRPSRNDAWSARMREK  371
            DDEY   P    R P + N   +P T V   PV       PS+ND W+ R  ++
Sbjct  173  DDEY--APE---RLPFLKNALHSPTTCVIGDPVF------PSKNDTWNKRTDDE  215



>ref|XP_006443683.1| hypothetical protein CICLE_v10021447mg [Citrus clementina]
 ref|XP_006480169.1| PREDICTED: tetraspanin-20-like [Citrus sinensis]
 gb|ESR56923.1| hypothetical protein CICLE_v10021447mg [Citrus clementina]
Length=293

 Score =   110 bits (274),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 120/195 (62%), Gaps = 23/195 (12%)
 Frame = -1

Query  886  LPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFD  707
            LP  WF+Y F+G+G+L+  I+  GCI A   +GCCL  Y++L I+L L+E    AFI  D
Sbjct  114  LPAPWFIYSFMGVGILVCCIALIGCIAAEAISGCCLCFYAILKIILFLLEAALVAFIAID  173

Query  706  ERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPAD  533
             RW+K++P D TG  D +  F+EDN  I KWV +  V+++AL  LLA+++RA  + R  +
Sbjct  174  RRWEKDLPFDPTGELDSLRSFIEDNVDICKWVGITVVIVQALSLLLAIILRAMVSTRRTN  233

Query  532  YDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLD--  359
            +D +D+Y    R +IR+PL++   Q P+             + +D WS+R+REKYGL+  
Sbjct  234  FDEEDDY-ESERVRIREPLIH---QQPI-------------AHSDIWSSRIREKYGLNGG  276

Query  358  TSEFTY--NPSESNR  320
              ++T+  NPS S +
Sbjct  277  GEQYTFGNNPSASMK  291



>gb|EMS68191.1| hypothetical protein TRIUR3_27411 [Triticum urartu]
Length=150

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 62/110 (56%), Positives = 76/110 (69%), Gaps = 12/110 (11%)
 Frame = -1

Query  646  FLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDDEYIGGPRQQIRQPLMNN  467
            FL++NW+  KWVALGAVV EAL+F +AL+V++ N+  DYDSDDEYI GPR  +RQPL+ N
Sbjct  22   FLKENWRTAKWVALGAVVFEALLFTVALIVQSGNQD-DYDSDDEYI-GPRSGVRQPLV-N  78

Query  466  RQQAPVTGVPVAGTLDSRPSRNDAWSARMREKY--GLDTSEFT----YNP  335
            +Q A    VP    LD RP RNDAWS RMR+K   G D S  T    +NP
Sbjct  79   KQTATDPRVP---NLDYRPIRNDAWSQRMRDKVSTGHDISRRTKKQMHNP  125



>gb|KDO65807.1| hypothetical protein CISIN_1g022738mg [Citrus sinensis]
Length=293

 Score =   109 bits (273),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 78/195 (40%), Positives = 120/195 (62%), Gaps = 23/195 (12%)
 Frame = -1

Query  886  LPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFD  707
            LP  WF+Y F+G+G+L+  I+  GCI A   +GCCL  Y++L I+L L+E    AFI  D
Sbjct  114  LPAPWFIYSFMGVGILVCCIALIGCIAAEAISGCCLCFYAILKIILFLLEAALVAFIAID  173

Query  706  ERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPAD  533
             RW+K++P D TG  D +  F+EDN  I KWV +  V+++AL  LLA+++RA  + R  +
Sbjct  174  RRWEKDLPFDPTGELDSLRSFIEDNVDICKWVGITVVIVQALSLLLAIILRAMVSTRRTN  233

Query  532  YDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLD--  359
            +D +D+Y    R +IR+PL++   Q P+             + +D WS+R+REKYGL+  
Sbjct  234  FDEEDDY-ESERIRIREPLIH---QQPI-------------AHSDIWSSRIREKYGLNGG  276

Query  358  TSEFTY--NPSESNR  320
              ++T+  NPS S +
Sbjct  277  GEQYTFGNNPSASMK  291



>ref|XP_009765194.1| PREDICTED: tetraspanin-20-like [Nicotiana sylvestris]
Length=251

 Score =   108 bits (271),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 67/192 (35%), Positives = 114/192 (59%), Gaps = 12/192 (6%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
            +L   WF+Y F+GIGV+L  I+C G +GA   NGC L  YS+L+   +LVE+    FI  
Sbjct  66   SLTAPWFIYAFMGIGVILCCITCIGHVGAEAVNGCFLCFYSLLMTAFVLVEISLVVFIAL  125

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPA  536
            D +W+K++P D TG    +  F+  N  + KW+ +  ++++A   LLA+V+RA  ++   
Sbjct  126  DRQWEKDLPRDPTGELHSLRTFIVQNMDVCKWIGIAVIIIQASSLLLAIVLRALLSDHSI  185

Query  535  DYDSDDEY--IGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGL  362
            ++D + +Y  IG    + R+PL++ R  +  +G+  A   D++   +D WS+RM+EKY L
Sbjct  186  NHDMERDYDVIG----RTREPLLDPR-LSQTSGLAKA---DAKVGHSDIWSSRMKEKYHL  237

Query  361  DTSEFTYNPSES  326
            D     + P+++
Sbjct  238  DGEARHHIPNQN  249



>ref|XP_007201868.1| hypothetical protein PRUPE_ppa009611mg [Prunus persica]
 gb|EMJ03067.1| hypothetical protein PRUPE_ppa009611mg [Prunus persica]
Length=285

 Score =   109 bits (272),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 79/178 (44%), Positives = 113/178 (63%), Gaps = 8/178 (4%)
 Frame = -1

Query  886  LPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFD  707
            LP  WF+Y F+G+GVL+  I+  GCI A + NGCCL  Y++L+ +L L+E    AFI  D
Sbjct  100  LPAPWFIYSFMGLGVLICCITFIGCIAAESINGCCLCFYTILITVLALLEAALVAFIAID  159

Query  706  ERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPAD  533
             RW+K++P D TG  D +  F++DN  I KW  L  +VL+AL  LLALV+R   +   AD
Sbjct  160  HRWEKDLPFDPTGELDSLRSFVQDNIDICKWAGLAVIVLQALSLLLALVLRGMVSTHKAD  219

Query  532  YDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLD  359
            YD +D+Y    R + R+PL+NN Q +  +G       D R + +D WS+R+R+KYGL+
Sbjct  220  YDVEDDY--DFRGRTREPLLNN-QLSQASGSTKG---DGRGTHSDIWSSRIRDKYGLN  271



>ref|XP_004140033.2| PREDICTED: tetraspanin-19 [Cucumis sativus]
 gb|KGN46747.1| hypothetical protein Csa_6G128570 [Cucumis sativus]
Length=215

 Score =   107 bits (268),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 68/176 (39%), Positives = 99/176 (56%), Gaps = 14/176 (8%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
            N P  WF Y F+G+G+LL VI+C G I A T NGCCL  Y +L+ ++I+VE G    +F 
Sbjct  51   NDPIPWFTYSFLGLGILLCVITCLGHIAAETANGCCLHLYMLLLFMVIMVEAGVTTDVFL  110

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADY  530
            +  W ++ P D +G FD    F++ N+ I KW+ +  V ++ L  LLA+V++A      Y
Sbjct  111  NRDWAEDFPKDPSGCFDQFKHFIKSNFNICKWIGISTVSIQGLSLLLAMVLKAIGSRRYY  170

Query  529  DSDDEYIGGPRQQIRQPLMNNRQQAP---VTGVPVAGTLDSRPSRNDAWSARMREK  371
            +SDDEY   P    R P + N   +P   V G PV       PS+ND W+ +  +K
Sbjct  171  ESDDEY--APE---RLPFLKNTLHSPTACVIGDPVF------PSKNDTWNKQTEDK  215



>ref|XP_004966578.1| PREDICTED: tetraspanin-18-like [Setaria italica]
Length=251

 Score =   108 bits (269),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/193 (37%), Positives = 112/193 (58%), Gaps = 11/193 (6%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF  L +  G+   ++   G + A    GCCL  Y++  + ++L+E   AA +  +E
Sbjct  67   PGLWFPSLVMAAGLFYCILLLAGYLAAEINTGCCLCFYTIPAMAMMLLEAALAAHLTINE  126

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  530
             W +++P DRTG    +  F+ +N  + KWVAL     +AL   LA+++RA  + R  DY
Sbjct  127  HWIQDLPDDRTGELHNLLSFIHNNLDLCKWVALAIFATQALSLFLAMILRAMLSARTMDY  186

Query  529  DSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSE  350
            DSD++++      IR+PL+    QAP   +P   T+D+R  R D WS+RMR+KYGL+TS+
Sbjct  187  DSDEDFV-----VIRRPLL--VAQAPPPYLPT--TVDTRGFRPDLWSSRMRQKYGLNTSD  237

Query  349  FTYNPSESNRYQP  311
            +TYN  ++N   P
Sbjct  238  YTYNTVDANAAPP  250



>gb|KJB22617.1| hypothetical protein B456_004G057900 [Gossypium raimondii]
 gb|KJB22618.1| hypothetical protein B456_004G057900 [Gossypium raimondii]
Length=287

 Score =   108 bits (270),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 110/187 (59%), Gaps = 8/187 (4%)
 Frame = -1

Query  886  LPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFD  707
            LP  WF+Y F+GIG+ +  I+  GCI A + NGCCL  Y++L I+L+L+E    AFI  D
Sbjct  104  LPAPWFIYSFMGIGITICCIALIGCIAAESINGCCLCFYTLLKIILVLIEAALVAFIAID  163

Query  706  ERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA---ANRPA  536
              W+K++P D TG  D    F+EDN  I KWV +  V+++AL  L+A+++RA   A R  
Sbjct  164  RSWEKDLPFDPTGEIDNFRSFVEDNIDICKWVGISVVIIQALAMLVAIILRAMVSARRRD  223

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDT  356
              D D++     R +  +PL+N +     T    +   D R SR+D W +++REK+GL +
Sbjct  224  IDDEDEDDYESIRGRTWEPLLNPQSSHSST----SAKGDGRGSRSDVWGSQIREKFGLQS  279

Query  355  SEFTYNP  335
             +  YN 
Sbjct  280  GD-KYNS  285



>ref|XP_004290026.1| PREDICTED: tetraspanin-18-like [Fragaria vesca subsp. vesca]
Length=287

 Score =   107 bits (267),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 75/191 (39%), Positives = 107/191 (56%), Gaps = 9/191 (5%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
            NLP  WF+Y F+G+G LL  I+  GCI A + N CCL  YS+L+ +L L E    AFI  
Sbjct  95   NLPAPWFIYSFMGVGALLLCITFIGCIAAESINRCCLCFYSLLITVLALAEAALVAFIAI  154

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPA  536
            D  W K++P D TG  +    F+E N  I +WV +  V ++AL  LLA+++R   +   A
Sbjct  155  DHHWDKDLPVDPTGELESFQSFIEKNIDICRWVGIAVVGIQALSLLLAIILRGMISTHKA  214

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDT  356
            DYD +DEY    R + ++PL+N           V    D R + +D WS+R+R+KYGL +
Sbjct  215  DYDVEDEY--DARGRTQEPLLNQHLSQASGSTKV----DGRGTHSDIWSSRIRDKYGLSS  268

Query  355  SEFTYNPSESN  323
             +  YN    N
Sbjct  269  GD-KYNSVNQN  278



>gb|KCW89519.1| hypothetical protein EUGRSUZ_A01807 [Eucalyptus grandis]
Length=219

 Score =   105 bits (263),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 96/171 (56%), Gaps = 9/171 (5%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+Y F+ +GV L VI+C G I A T NGCCL  Y + + LL+++E      IF + 
Sbjct  51   PAPWFIYTFLCLGVTLCVITCSGHIAAETANGCCLYLYMLFIFLLLILEAAVTVDIFLNR  110

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  524
             W+++ P D TGN  ++ EF+  N+++ KW+ L  V ++ L  LLA+V++      +YDS
Sbjct  111  EWEEDFPEDLTGNLSLLKEFVRSNFEMCKWIGLSIVSIQGLCILLAMVLKVLGPHQNYDS  170

Query  523  DDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREK  371
            DDE+        R PL+ N    P    P A    +  S++D WS R+ EK
Sbjct  171  DDEF-----STDRVPLLKNATVPP----PYAVADPAYGSKSDGWSIRINEK  212



>ref|XP_010051830.1| PREDICTED: tetraspanin-19 [Eucalyptus grandis]
Length=215

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 64/171 (37%), Positives = 96/171 (56%), Gaps = 9/171 (5%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+Y F+ +GV L VI+C G I A T NGCCL  Y + + LL+++E      IF + 
Sbjct  51   PAPWFIYTFLCLGVTLCVITCSGHIAAETANGCCLYLYMLFIFLLLILEAAVTVDIFLNR  110

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  524
             W+++ P D TGN  ++ EF+  N+++ KW+ L  V ++ L  LLA+V++      +YDS
Sbjct  111  EWEEDFPEDLTGNLSLLKEFVRSNFEMCKWIGLSIVSIQGLCILLAMVLKVLGPHQNYDS  170

Query  523  DDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREK  371
            DDE+        R PL+ N    P    P A    +  S++D WS R+ EK
Sbjct  171  DDEF-----STDRVPLLKNATVPP----PYAVADPAYGSKSDGWSIRINEK  212



>ref|XP_001763914.1| predicted protein [Physcomitrella patens]
 gb|EDQ71318.1| predicted protein [Physcomitrella patens]
Length=284

 Score =   107 bits (266),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 111/293 (38%), Positives = 159/293 (54%), Gaps = 18/293 (6%)
 Frame = -1

Query  1117  MACKGClecllkllnflltlagLGMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQL  938
             M+C+G L+C+LK +NFL+TL G  M+ Y +++  E+   S +G +   P   S   ++  
Sbjct  1     MSCQGFLQCILKSINFLVTLVGTFMIIYSLWMLREWS--SVAGHE---PRSSSFALVLSS  55

Query  937   GRPMLVAVSLAN--NIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysv  764
             G P L +       + F  L K+ F+Y+F+  G +   +S  G + A  +N  CLSCYSV
Sbjct  56    GIPALSSWGFNEFEDDFAKLGKKRFIYVFLCAGAITCFVSLTGHVAAELKNSFCLSCYSV  115

Query  763   lvillilveLGAAAFIFFDERWKKE-IPTDRTGNFDM-IYEFLEDNWKIVKWVALGAVVL  590
             L ++LIL +    A +FFD  W+ + +   R G     I+E++ED    ++   +   V+
Sbjct  116   LQVVLILAQFAVIAALFFDRHWRDDHLVYVRCGVLSRSIWEWIEDYLDCLRLSLMNFSVV  175

Query  589   EALMFLLALVVRAANRPAD--YDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVP-VAGTLD  419
               + F  A V+RA    A   YDSD++YI   R   RQP   NRQ       P  A  ++
Sbjct  176   LGIFF--AFVLRAVTVSAQRGYDSDEDYIAA-RSAGRQP-GGNRQVNQANPAPGSAAAVE  231

Query  418   SRPSRNDAWSARMREKYGLDTSEFTYNPSESNR-YQPTNV-QPAEERGRCTIM  266
             +R  R DAWS RMREKYGLDTSEFT  PSES R  QP     P E++  CTIM
Sbjct  232   ARAPRLDAWSTRMREKYGLDTSEFTSKPSESRRPLQPNQTPGPVEQQNFCTIM  284



>ref|XP_009775665.1| PREDICTED: tetraspanin-19 [Nicotiana sylvestris]
Length=222

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 103/176 (59%), Gaps = 16/176 (9%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+Y  +G+G+ L V++C G I A T +GCCL  Y V V LL+++E      +F + 
Sbjct  55   PAPWFIYSTLGLGITLCVVTCSGHIAAETASGCCLYIYMVFVFLLLMIEAAVTVDVFLNR  114

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPAD---  533
             W+++ P D TGNFD +  FL++N+ I KWV L  V ++A+  LLA++++A     +   
Sbjct  115  NWEEDFPEDTTGNFDELKHFLKENFDICKWVGLSVVTVQAVSILLAMILKALGPHPERYH  174

Query  532  YDSDDEYIGGPRQQIRQPLMNNRQQAP--VTGVPVAGTLDSRPSRNDAWSARMREK  371
            Y+SDD+YI       R PL+ N   +P  V G PV G      S+NDAW+ R+  K
Sbjct  175  YESDDDYIPD-----RVPLLKNYVPSPSYVVGDPVYG------SKNDAWNIRINSK  219



>ref|XP_009591228.1| PREDICTED: tetraspanin-19 [Nicotiana tomentosiformis]
Length=222

 Score =   105 bits (262),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 69/176 (39%), Positives = 102/176 (58%), Gaps = 16/176 (9%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+Y  +G+G+ L V++C G I A T +GCCL  Y V V LL+++E      +F + 
Sbjct  55   PAPWFIYSTLGLGITLCVVTCSGHIAAETASGCCLYIYMVFVFLLLMIEAAVTVDVFLNR  114

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPAD---  533
             W+++ P D TGNFD +  FL++N+ I KWV L  V ++ L  LLA++++A     +   
Sbjct  115  NWEEDFPEDTTGNFDELKHFLKENFDICKWVGLSVVTVQGLTILLAMILKALGPHPERYH  174

Query  532  YDSDDEYIGGPRQQIRQPLMNNRQQAP--VTGVPVAGTLDSRPSRNDAWSARMREK  371
            Y+SDD+YI       R PL+ N   +P  V G PV G      S+NDAW+ R+  K
Sbjct  175  YESDDDYIPD-----RVPLLKNYVPSPSCVVGDPVYG------SKNDAWNIRINSK  219



>gb|KFK40448.1| hypothetical protein AALP_AA3G374400 [Arabis alpina]
Length=219

 Score =   105 bits (261),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 103/175 (59%), Gaps = 15/175 (9%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+Y F+G+G +L V++C G I A T NGCCL  Y   ++LLI++E G  A IF + 
Sbjct  53   PVPWFIYAFLGLGAILCVVTCAGHIAAETVNGCCLYLYMGFIVLLIMIEGGVVADIFLNR  112

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  524
             WKK+ P D +G F    +F+E N+KI KW+ LG V ++ L  LLA++++A      YDS
Sbjct  113  DWKKDFPEDPSGAFHQFSKFIESNFKICKWIGLGIVCVQGLSVLLAMLLKALGPHRHYDS  172

Query  523  DDEYIGGPRQQIRQPLMNNRQQAP---VTGVPVAGTLDSRPSRNDAWSA-RMREK  371
            DDEY        R  L+ + +Q+P   V G P+ G      S+  A++A R+ E+
Sbjct  173  DDEY-----DVSRVALLRDARQSPSPYVVGEPMYG------SKRGAYTAVRINER  216



>gb|EEC81360.1| hypothetical protein OsI_24555 [Oryza sativa Indica Group]
Length=242

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 110/189 (58%), Gaps = 11/189 (6%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+   +  G+   ++   GC+ A   + C L  Y++L ++++L+E   AA +FF++
Sbjct  58   PDLWFVCALMAAGLFYCLLLLAGCVAAEINSPCFLCFYTILAVVMMLLEAALAADLFFNK  117

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  530
             W +++P DRTG  D +  F++ N  + KW AL  V  +AL  LLA ++R+  +   ADY
Sbjct  118  HWIQDLPYDRTGELDNLLSFIQTNLDLCKWAALAIVATQALSLLLATILRSMLSTPSADY  177

Query  529  DSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSE  350
            DSD++++      IR+PL+   Q AP     +  T D+R    D WS+RMR KYGL++S 
Sbjct  178  DSDEDFV-----VIRRPLLVA-QGAPAY---LPTTADTRGFHPDLWSSRMRHKYGLNSSN  228

Query  349  FTYNPSESN  323
            +TYN  + N
Sbjct  229  YTYNTLDPN  237



>ref|NP_001058664.1| Os06g0731400 [Oryza sativa Japonica Group]
 dbj|BAD62493.1| senescence-associated protein-like [Oryza sativa Japonica Group]
 dbj|BAF20578.1| Os06g0731400 [Oryza sativa Japonica Group]
 dbj|BAG89447.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66406.1| hypothetical protein OsJ_22750 [Oryza sativa Japonica Group]
Length=242

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/189 (36%), Positives = 110/189 (58%), Gaps = 11/189 (6%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+   +  G+   ++   GC+ A   + C L  Y++L ++++L+E   AA +FF++
Sbjct  58   PDLWFVCALMAAGLFYCLLLLAGCVAAEINSPCFLCFYTILAVVMMLLEAALAADLFFNK  117

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  530
             W +++P DRTG  D +  F++ N  + KW AL  V  +AL  LLA ++R+  +   ADY
Sbjct  118  HWIQDLPYDRTGELDNLLSFIQTNLDLCKWAALAIVATQALSLLLATILRSMLSTPSADY  177

Query  529  DSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSE  350
            DSD++++      IR+PL+   Q AP     +  T D+R    D WS+RMR KYGL++S 
Sbjct  178  DSDEDFV-----VIRRPLLVA-QGAPAY---LPTTADTRGFHPDLWSSRMRHKYGLNSSN  228

Query  349  FTYNPSESN  323
            +TYN  + N
Sbjct  229  YTYNTLDPN  237



>emb|CDY31986.1| BnaA07g00090D [Brassica napus]
Length=267

 Score =   105 bits (262),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 87/257 (34%), Positives = 134/257 (52%), Gaps = 37/257 (14%)
 Frame = -1

Query  1048  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGE---LVQLGRPM------LVAVSLANNI  896
              ++ Y I++  +Y  H P         PP+S     + ++  P+      + +V L ++ 
Sbjct  27    SIIIYSIWMLDQYHRHVPVD-------PPTSSSGLGIAKVSEPLNNPPALMASVVLGSSG  79

Query  895   FDN---------LPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillil  743
              D+         LP  WF+Y F+ +GVL+ +++  G I A   NGCCL  YS+L  LLIL
Sbjct  80    GDHHGFNLRSLDLPAPWFIYSFMAVGVLVCIVTIIGFIAAEAINGCCLCFYSILKTLLIL  139

Query  742   veLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLAL  563
             +E    AFI  D +W+K++P D TG  + +  F+EDN  I KWV    VV++ L  LLA+
Sbjct  140   LEAALVAFIAIDRQWEKDLPYDPTGELNSLRAFIEDNIDICKWVGAAVVVVQLLSLLLAM  199

Query  562   VVRAANRPADYDSDDEY-IGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSA  386
             V+RA   P   + DDE     PR +   PL+ ++      G          PS+++ WS+
Sbjct  200   VLRAMVSPKRPELDDEEDFENPRSRAWDPLLGSQANQASAG----------PSKSENWSS  249

Query  385   RMREKYGLDTSEFTYNP  335
             R+REKYGL+ S+   NP
Sbjct  250   RIREKYGLNQSQ-AVNP  265



>ref|XP_010489078.1| PREDICTED: tetraspanin-18-like [Camelina sativa]
Length=270

 Score =   105 bits (261),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 81/252 (32%), Positives = 129/252 (51%), Gaps = 26/252 (10%)
 Frame = -1

Query  1045  MVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLGRPM------LVAVSLANNIFDN-  887
             ++ Y I++  EY  H P  D  P+    S  E+ ++  P+      + ++ L ++  D+ 
Sbjct  28    IIIYSIWMLHEYNRHLPV-DPPPVASSSSGIEIPKVSEPLKNPIDFMASIVLGSSGGDHG  86

Query  886   -------LPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGA  728
                    LP  WF+Y F+ +G+L+ +++  G I A   NGCCL  YS+L  LLIL+E   
Sbjct  87    FNLRSLDLPAPWFIYSFMAVGILVCIVTFIGFIAAEAINGCCLCFYSILKTLLILLEAAL  146

Query  727   AAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA-  551
              A+I  D  W+K++P D TG    +  F+E+N  I KWV +  V ++ L  LLA+V+RA 
Sbjct  147   VAYIAIDRHWEKDLPYDPTGELSSLRAFIEENIDICKWVGIAVVAVQLLSLLLAMVLRAM  206

Query  550   ANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREK  371
              + P     ++E    PR +   PL+           P         S+ + WS+R+REK
Sbjct  207   VSTPKPELDEEEGYENPRVRAYDPLLG----------PQGNQASGGSSKIENWSSRIREK  256

Query  370   YGLDTSEFTYNP  335
             YGL+ S+   NP
Sbjct  257   YGLNQSQAAVNP  268



>ref|XP_002263228.1| PREDICTED: tetraspanin-19 [Vitis vinifera]
 emb|CBI28766.3| unnamed protein product [Vitis vinifera]
Length=212

 Score =   103 bits (258),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 95/172 (55%), Gaps = 13/172 (8%)
 Frame = -1

Query  874  WFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWK  695
            WF+Y F+G+G  L + +CFG   A T NGCCL  Y + +  L+++E G  A +F +  W+
Sbjct  51   WFIYTFLGLGATLCLFTCFGHAAAETANGCCLYVYMMYIFFLLILEAGVTADVFLNHDWE  110

Query  694  KEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDDE  515
            ++ P D TG+F     F+  N++I KW+ L  + ++ L  LLA+V++A      YDSDDE
Sbjct  111  EDFPEDPTGSFHEFKNFVRSNFEICKWIGLSILFVQGLSILLAMVLKALGPHQYYDSDDE  170

Query  514  YIGGPRQQIRQPLMNNRQQAP--VTGVPVAGTLDSRPSRNDAWSARMREKYG  365
            Y        R PL+ N    P  V G P +G      SR DA+  R+ EK G
Sbjct  171  Y-----APTRAPLLRNAVHPPPYVAGDPFSG------SRTDAYGKRINEKTG  211



>gb|KHN05904.1| hypothetical protein glysoja_026492 [Glycine soja]
Length=244

 Score =   104 bits (259),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 79/196 (40%), Positives = 111/196 (57%), Gaps = 17/196 (9%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
            NLP  WF+Y F+G G+L+  IS  GCI A   NGCCL  YS+LV++L+L+E     FI  
Sbjct  63   NLPAPWFIYNFMGFGILVLCISFLGCIAAEMINGCCLCFYSILVVVLLLLEASLVGFIAL  122

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLE--ALMFLLALVVRAANRPA  536
            D  W+K+IP D TG  D +  F+EDN     WV +  +V++  +L+  L L    ++R A
Sbjct  123  DSDWEKDIPFDPTGQLDELRAFIEDNIDTCTWVGIAVLVIQALSLLLALILRATVSSRRA  182

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTL-DSRPSRNDAWSARMREKYGLD  359
            D+D +D Y    R +  +PL+N     P  G P   +  D+  + +D WSARMREKYGL 
Sbjct  183  DFDYEDGY--DVRGRSWEPLLN-----PQPGQPSGSSKGDNSGNHSDFWSARMREKYGL-  234

Query  358  TSEFTYNPSESNRYQP  311
                  N  + + YQP
Sbjct  235  ------NHGDKSSYQP  244



>ref|XP_004152011.1| PREDICTED: tetraspanin-18-like [Cucumis sativus]
 gb|KGN58325.1| hypothetical protein Csa_3G622440 [Cucumis sativus]
Length=280

 Score =   104 bits (260),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 77/191 (40%), Positives = 114/191 (60%), Gaps = 17/191 (9%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
             LP  WF+Y F+G GVLL  I+  GCI A   +GCCL  Y++L++L I+VE+G  AFI  
Sbjct  104  KLPAPWFIYSFMGFGVLLCCITLVGCIAAEAISGCCLCFYNMLIMLFIIVEVGLVAFIAI  163

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPA  536
            D  W+K++P D TG  D +  F+EDN  + KW+ +  +  +AL  LLA+++R+  + R  
Sbjct  164  DRSWEKDLPLDPTGELDELRHFIEDNINLSKWIGIVVISTQALSLLLAIILRSMVSTRKT  223

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDT  356
            +YD+++E   G R + R+PL+N          P A    +  +  D W ARMREKYGL+ 
Sbjct  224  EYDTEEEV--GVRDRTREPLLN----------PPAN--QAAGAHFDLWGARMREKYGLNN  269

Query  355  SEFTYNPSESN  323
            S+  YN S  +
Sbjct  270  SD-RYNSSNQS  279



>ref|XP_010540868.1| PREDICTED: tetraspanin-19 [Tarenaya hassleriana]
Length=214

 Score =   103 bits (256),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 98/172 (57%), Gaps = 11/172 (6%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+Y+F+G+G  L VI+C G I A T NGCCL  Y   + LL+++E G  A IF + 
Sbjct  53   PVPWFIYVFLGLGASLCVITCAGHIAAETVNGCCLYLYMGFIFLLLMLEGGVVADIFLNR  112

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  524
             WK++ P D +G F  + EF+E N++I KW+ L  V ++ L  LLA++++A      Y+S
Sbjct  113  EWKEDFPEDPSGAFHQLTEFIESNFEICKWIGLSVVCVQGLTVLLAMLLKALGPHQRYES  172

Query  523  DDEYIGGPRQQIRQPLMNNRQQAP-VTGVPVAGTLDSRPSRNDAWSARMREK  371
            DDEY G     ++    + R   P V G PV G      ++  AW+ R+ + 
Sbjct  173  DDEYDGSSVALLQ----DGRHPPPYVVGEPVYG------AKAGAWTIRINDH  214



>ref|XP_010495917.1| PREDICTED: tetraspanin-18-like [Camelina sativa]
Length=270

 Score =   103 bits (258),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 83/253 (33%), Positives = 130/253 (51%), Gaps = 28/253 (11%)
 Frame = -1

Query  1045  MVGYGIYLFVEYKNHSPSGDDHPIPFPPSSG-ELVQLGRPM------LVAVSLANNIFDN  887
             ++ Y I++  EY  H P   D P     SSG E+ ++  P+      + ++ L ++  D+
Sbjct  28    IIIYSIWMLHEYNRHLPV--DPPPAASSSSGIEIPKVSEPLKNPIDYMASIVLGSSGGDH  85

Query  886   --------LPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLG  731
                     LP  WF+Y F+ +G+L+ +++  G I A   NGCCL  YS+L  LLIL+E  
Sbjct  86    GFNLRSLDLPAPWFIYSFMAVGILVCIVTFIGFIAAEAINGCCLCFYSILKTLLILLEAA  145

Query  730   AAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA  551
               A+I  D  W+K++P D TG    +  F+E+N  I KWV +  V ++ L  LLA+V+RA
Sbjct  146   LVAYIAIDRHWEKDLPYDPTGELSTLRAFIEENIDICKWVGIAVVAVQLLSLLLAMVLRA  205

Query  550   -ANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMRE  374
               + P     ++E    PR +   PL+           P         S+ + WS+R+RE
Sbjct  206   MVSTPKPELDEEEGYENPRVRAYDPLLG----------PQGNQASGGSSKIENWSSRIRE  255

Query  373   KYGLDTSEFTYNP  335
             KYGL+ S+   NP
Sbjct  256   KYGLNQSQAAVNP  268



>ref|XP_002437655.1| hypothetical protein SORBIDRAFT_10g031310 [Sorghum bicolor]
 gb|EER89022.1| hypothetical protein SORBIDRAFT_10g031310 [Sorghum bicolor]
Length=251

 Score =   103 bits (257),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 83/134 (62%), Gaps = 11/134 (8%)
 Frame = -1

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPA  536
            +E W +++P DRTG    +  F+ +N  + KW AL     +AL  LLA+++RA  + R  
Sbjct  125  NEHWVQDLPEDRTGELHNLLSFIHNNLDLCKWAALAIFATQALSLLLAMILRAMLSARIV  184

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDT  356
            DYDSD++++      IR+PL+    QAP   +P   T+D+R +R D WS+ +R KYGL+T
Sbjct  185  DYDSDEDFV-----VIRRPLLVT--QAPAPYLPT--TVDARGARPDLWSSTLRHKYGLNT  235

Query  355  SEFTYNPSESNRYQ  314
            S++TYN  ++N  Q
Sbjct  236  SDYTYNTMDANAAQ  249



>ref|XP_008447349.1| PREDICTED: tetraspanin-18 [Cucumis melo]
Length=280

 Score =   104 bits (259),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 76/191 (40%), Positives = 114/191 (60%), Gaps = 17/191 (9%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
             LP  WF+Y F+G GVLL  I+  GCI A   +GCCL  Y++L++L I+VE+   AFI  
Sbjct  104  KLPAPWFIYSFMGFGVLLCCITLVGCIAAEAISGCCLCFYNMLIMLFIIVEVALVAFIAI  163

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPA  536
            D RW+K++P D TG  D + +F+EDN  + KW+ +  +  +AL  LLA+++R+  + R  
Sbjct  164  DRRWEKDLPLDPTGELDELRQFIEDNINLSKWIGIVVISTQALSLLLAIILRSMVSTRKT  223

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDT  356
            +YD+++E   G R + R+PL+N          P A    +  +  D W ARMREKYG + 
Sbjct  224  EYDTEEEV--GVRDRTREPLLN----------PPAN--QAAGAHFDLWGARMREKYGFNN  269

Query  355  SEFTYNPSESN  323
            S+  YN S  +
Sbjct  270  SD-RYNSSNQS  279



>ref|XP_003542449.1| PREDICTED: tetraspanin-18-like isoform X1 [Glycine max]
Length=245

 Score =   103 bits (256),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 111/190 (58%), Gaps = 12/190 (6%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
            NLP  WF+Y F+G+G+L+  IS  GCI A   NGCCL  Y++LV +L+L+E     FI  
Sbjct  63   NLPAPWFIYDFMGLGILVLCISFLGCIAAEMINGCCLCFYTILVAVLLLLEASLVGFIAL  122

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLE--ALMFLLALVVRAANRPA  536
            D  W+K+IP D TG  D +  F+EDN  I  WV +  +V++  +L+  L L    + R A
Sbjct  123  DSDWEKDIPLDPTGQLDELRAFIEDNIDICTWVGIAVLVVQALSLLLALILRATVSARRA  182

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTL-DSRPSRNDAWSARMREKYGLD  359
            D+D +D Y    R +  +PL+N     P  G P   +  D+  + +D WS+RMR+KYGL+
Sbjct  183  DFDYEDGY--DVRGRSWEPLLN-----PQPGQPSGSSKGDNSGNHSDFWSSRMRQKYGLN  235

Query  358  T--SEFTYNP  335
                +++Y P
Sbjct  236  HGGDKYSYQP  245



>ref|XP_012088302.1| PREDICTED: tetraspanin-19 [Jatropha curcas]
 gb|KDP24147.1| hypothetical protein JCGZ_25804 [Jatropha curcas]
Length=220

 Score =   102 bits (255),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 103/170 (61%), Gaps = 13/170 (8%)
 Frame = -1

Query  874  WFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWK  695
            WF+Y F+G+GV L VI+C G + A T NGCCL  Y + V LL ++E G  A +F +  W+
Sbjct  56   WFIYTFLGVGVTLCVITCLGHVAAETANGCCLYLYMLFVFLLFMLEAGVTADVFLNRDWE  115

Query  694  KEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDDE  515
            ++ P D TG+F+   +F+  N+++ KW+ L  V ++ L FLLAL+++A      YDSDDE
Sbjct  116  QDFPKDPTGSFNQFKDFIRSNFEMCKWIGLSIVSVQGLSFLLALLLKALGPHQYYDSDDE  175

Query  514  YIGGPRQQIRQPLMNNRQQAP--VTGVPVAGTLDSRPSRNDAWSARMREK  371
            Y   P    R PL+NN    P  V G PV G      S++D+WS R+ EK
Sbjct  176  Y--APD---RVPLLNNAVIPPPYVVGNPVVG------SKSDSWSVRINEK  214



>ref|XP_008381481.1| PREDICTED: tetraspanin-19-like [Malus domestica]
Length=203

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 94/168 (56%), Gaps = 13/168 (8%)
 Frame = -1

Query  877  EWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERW  698
             WF+Y F+G+G+ L V +C G I A+T NGCCL  Y   V LL ++E G  A IF +  W
Sbjct  45   SWFIYTFLGLGITLLVTTCSGHIAAATANGCCLYLYMXFVFLLFMLEAGVTADIFLNRDW  104

Query  697  KKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDD  518
            +++ P D TG FD   EF+  N  I KW+ L    ++ L  LLA++++A      YD DD
Sbjct  105  EEDFPVDPTGRFDQFKEFVRSNLDICKWIGLSIACVQGLSLLLAMILKALGPHPYYDGDD  164

Query  517  EYIGGPRQQIRQPLMNNRQQAP--VTGVPVAGTLDSRPSRNDAWSARM  380
            EY+  P    R PL+ +    P  V G PV G      S++D+W+ R+
Sbjct  165  EYV--PE---RVPLLKSAVLPPPYVVGDPVYG------SKSDSWNIRI  201



>ref|XP_008381480.1| PREDICTED: tetraspanin-19-like [Malus domestica]
Length=203

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 94/168 (56%), Gaps = 13/168 (8%)
 Frame = -1

Query  877  EWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERW  698
             WF+Y F+G+G+ L V +C G I A+T NGCCL  Y   V LL ++E G  A IF +  W
Sbjct  45   SWFIYTFLGLGITLLVTTCSGHIAAATANGCCLYLYMXFVFLLFMLEAGVTADIFLNRDW  104

Query  697  KKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDSDD  518
            +++ P D TG FD   EF+  N  I KW+ L    ++ L  LLA++++A      YD DD
Sbjct  105  EEDFPVDPTGRFDQFKEFVRSNLDICKWIGLSIACVQGLSLLLAMILKALGPHPYYDGDD  164

Query  517  EYIGGPRQQIRQPLMNNRQQAP--VTGVPVAGTLDSRPSRNDAWSARM  380
            EY+  P    R PL+ +    P  V G PV G      S++D+W+ R+
Sbjct  165  EYV--PE---RVPLLKSAVLPPPYVVGDPVYG------SKSDSWNIRI  201



>ref|XP_008789494.1| PREDICTED: tetraspanin-18 isoform X2 [Phoenix dactylifera]
Length=222

 Score =   102 bits (253),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 108/186 (58%), Gaps = 16/186 (9%)
 Frame = -1

Query  895  FDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFI  716
             + LP  WF+   + +GVLL +++  G + A   NGCCL C++VL+ +LIL+E      +
Sbjct  48   LEGLPAPWFICAMMAVGVLLCLVAFTGHVAAGVVNGCCLCCFAVLITILILLEAALVGVL  107

Query  715  FFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NR  542
             FD+ W++++P D TG    +  F+E+N  I KWVAL  +V++AL  LLA+++RA    R
Sbjct  108  MFDKHWEEDLPYDSTGELKSLCAFIEENMDICKWVALTVIVIQALSLLLAVILRATVPAR  167

Query  541  PADYDSDDEYIGGPRQQIRQPLMNNRQ--QAPVTGVPVAGTLDSRPSRNDAWSARMREKY  368
              DYDSD++ I   R     PL+N +     P T V      D +   +D WS++MR+K 
Sbjct  168  RVDYDSDEDLIVSTR-----PLLNAQGGPSYPTTSV------DGKGFHSDFWSSQMRQK-  215

Query  367  GLDTSE  350
            GL T +
Sbjct  216  GLQTVK  221



>gb|KHG12596.1| Diacylglycerol kinase eta [Gossypium arboreum]
Length=288

 Score =   103 bits (256),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 71/187 (38%), Positives = 108/187 (58%), Gaps = 8/187 (4%)
 Frame = -1

Query  886  LPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFD  707
            LP  WF+Y F+GIG+ +  ++  GCI A + NGCCL  Y++L I+L+L+E    AFI  D
Sbjct  102  LPAPWFIYSFMGIGITICCVALIGCIAAESINGCCLCFYTLLKIILVLIEAALVAFIAID  161

Query  706  ERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA---ANRPA  536
              W+K++P D TG  D    F+EDN  I KWV +  V+++AL  L+A+++RA   A R  
Sbjct  162  RSWEKDLPFDPTGEIDSFRSFVEDNVDICKWVGISVVIIQALAMLVAIILRAMVSARRRD  221

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKY-GLD  359
              D D++     R +  +PL+N +     T    +   D R +R+D W +++REK  GLD
Sbjct  222  IDDEDEDDYESIRGRTWEPLLNPQSSHSST----SAKGDGRGTRSDVWGSQIREKVIGLD  277

Query  358  TSEFTYN  338
             +    N
Sbjct  278  FAVLLCN  284



>ref|XP_003563209.1| PREDICTED: tetraspanin-18-like isoform X1 [Brachypodium distachyon]
Length=241

 Score =   102 bits (253),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/193 (34%), Positives = 109/193 (56%), Gaps = 11/193 (6%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF    +  G+    +   G + A   +GCCL  Y+ L + ++LVE   A+ IF ++
Sbjct  57   PDLWFACAVMAAGLFYCALLLAGYVAAEINSGCCLCFYTALAMAMMLVEAAFASQIFLNQ  116

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  530
            +W +++P DRTG  + +  F+++N  + KW A+  +  +AL   LA+V+RA  +    DY
Sbjct  117  QWIQDLPYDRTGELNNLVSFVQNNLDVCKWAAIATLATQALSLFLAMVLRAMVSTTNVDY  176

Query  529  DSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSE  350
            DSD++++      IR+PL+   Q AP     +  T D+     D WS+RMR+KYGL++S+
Sbjct  177  DSDEDFV-----VIRRPLL-LAQGAPAY---LPTTTDATGVHPDLWSSRMRQKYGLNSSD  227

Query  349  FTYNPSESNRYQP  311
            +TYN  + N   P
Sbjct  228  YTYNTLDQNAVPP  240



>ref|XP_006409011.1| hypothetical protein EUTSA_v10002095mg [Eutrema salsugineum]
 gb|ESQ50464.1| hypothetical protein EUTSA_v10002095mg [Eutrema salsugineum]
Length=217

 Score =   101 bits (251),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 99/172 (58%), Gaps = 11/172 (6%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+Y F+G+G +L V++C G I A T NGCCL  Y   ++LLI+VE G  A IF + 
Sbjct  53   PAPWFIYAFLGLGAILSVVTCAGHIAAETVNGCCLYLYMGFIVLLIMVEGGVVADIFLNR  112

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  524
             WK++ P D +G F    +F+E N+KI +W+ L  V ++ +  LLA++++A      YDS
Sbjct  113  DWKEDFPEDPSGAFHQFSKFIESNFKICRWIGLSIVCVQGVSVLLAMLLKALGPHRHYDS  172

Query  523  DDEYIGGPRQQIRQPLMNNRQQAP-VTGVPVAGTLDSRPSRNDAWSARMREK  371
            DDEY     +     L + RQ  P V G P+ G      ++ ++W  R+ E+
Sbjct  173  DDEY----NESTVALLRDARQPPPYVVGEPIYG------AKPESWRVRINER  214



>ref|XP_010684825.1| PREDICTED: tetraspanin-20 [Beta vulgaris subsp. vulgaris]
Length=323

 Score =   103 bits (256),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 80/206 (39%), Positives = 115/206 (56%), Gaps = 18/206 (9%)
 Frame = -1

Query  913  SLANNIFDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveL  734
            S A+  F   P  WF+Y  + +GVLL  +SC G I A   NGCCL  Y +L ILLI+VE 
Sbjct  126  SFAHLHFIQFPAPWFIYFLMVVGVLLCCMSCIGHIAAEGFNGCCLCFYILLAILLIVVEA  185

Query  733  GAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVR  554
               A+I  D+ W K++P D TG  + +  F+E+N  I KW+ L  + ++AL  LL+LV+R
Sbjct  186  ALVAYIAIDQHWDKDLPYDPTGELEKLRSFVEENVDICKWLGLTLLTVQALSLLLSLVLR  245

Query  553  AANRPADYDSDDE---YIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSAR  383
            A       DSD E    + G R  IR+PL+N++    VT        + R + +D W+ R
Sbjct  246  AMISSQRKDSDAEDNDVVAGDR--IREPLLNSQSNQSVTTKS-----EGRGTFSDIWTTR  298

Query  382  MREKYGLDTSEFTYNPSESNRYQPTN  305
            +R+KYGL+        +ES+R Q  N
Sbjct  299  IRQKYGLN--------NESSRNQSLN  316



>ref|XP_010933200.1| PREDICTED: tetraspanin-18-like [Elaeis guineensis]
Length=238

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 68/193 (35%), Positives = 114/193 (59%), Gaps = 13/193 (7%)
 Frame = -1

Query  892  DNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIF  713
            + LP  WF+   + +GVLL +++  G + A   NGCCL C++VL+ +LIL+E    + + 
Sbjct  49   EGLPAPWFICSMMAVGVLLCLVAFTGHVAAEVVNGCCLCCFAVLITILILLEAALVSDLV  108

Query  712  FDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVR--AANRP  539
            F++ W++++P D TG    +  F+E N  I KWVA+  +V++AL  LLA+++R  A+ R 
Sbjct  109  FNKHWEEDLPHDATGQLKSLRAFIEANIGICKWVAVTVLVVQALSLLLAVILRGMASPRS  168

Query  538  ADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGT-LDSRPSRNDAWSARMREKYGL  362
             DYDSD+E+       +R+PL+N     P  G   A T  D+    +D W++R+++KY  
Sbjct  169  VDYDSDEEFF-----TVRKPLLN-----PQGGPTFASTSFDNTVVSSDTWNSRIKQKYVF  218

Query  361  DTSEFTYNPSESN  323
              S+ + N  + N
Sbjct  219  GQSQLSDNAMDPN  231



>emb|CDY65849.1| BnaCnng48870D [Brassica napus]
Length=269

 Score =   102 bits (253),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 108/186 (58%), Gaps = 12/186 (6%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
            +LP  WF+Y F+ +GVL+ +++  G I A   NGCCL  YS+L  LLIL+E    AFI  
Sbjct  93   DLPAPWFIYSFMAVGVLVCIVTIIGFIAAEAINGCCLCFYSILKTLLILLEAALVAFIAI  152

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADY  530
            D +W+K++P D TG  + +  F+EDN  I KWV    +V++ L  LLA+V+RA   P   
Sbjct  153  DRQWEKDLPYDPTGELNSLRAFIEDNIDICKWVGAAVLVVQLLSLLLAMVLRAMVSPKRP  212

Query  529  D-SDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTS  353
            +  D+E    PR +   PL+ ++      G          PS+++ WS+R+REKYGL+ S
Sbjct  213  ELGDEEDFENPRSRAWDPLLGSQANQASAG----------PSKSENWSSRIREKYGLNQS  262

Query  352  EFTYNP  335
            +   NP
Sbjct  263  Q-AVNP  267



>ref|XP_006298516.1| hypothetical protein CARUB_v10014594mg [Capsella rubella]
 gb|EOA31414.1| hypothetical protein CARUB_v10014594mg [Capsella rubella]
Length=219

 Score =   100 bits (250),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 100/174 (57%), Gaps = 13/174 (7%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+Y F+G+G +L V++C G I A T NGCCL  Y   ++LL++VE G  A IF + 
Sbjct  53   PVPWFIYSFLGLGAILCVVTCAGHIAAETVNGCCLYLYMGFIVLLVMVEGGVVADIFLNR  112

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADY  530
             WK++ P D +G F    +F+E N+KI KW+ L  V ++AL  LLA++++A   +    Y
Sbjct  113  DWKEDFPEDPSGAFHHFSKFIESNFKICKWIGLAIVCIQALSVLLAMLLKALGPHPHRHY  172

Query  529  DSDDEYIGGPRQQIRQPLMNNRQQAP-VTGVPVAGTLDSRPSRNDAWSARMREK  371
            DSDDEY           L + RQ  P V G P+ G      ++  AW+ R+ E+
Sbjct  173  DSDDEY----NVSTVALLQDARQPPPYVVGEPMYG------AKPGAWTVRINER  216



>ref|XP_006443681.1| hypothetical protein CICLE_v10021447mg [Citrus clementina]
 gb|ESR56921.1| hypothetical protein CICLE_v10021447mg [Citrus clementina]
Length=290

 Score =   102 bits (253),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 107/175 (61%), Gaps = 19/175 (11%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
             LP  WF+Y F+G+G+L+  I+  GCI A   +GCCL  Y++L I+L L+E    AFI  
Sbjct  113  ELPAPWFIYSFMGVGILVCCIALIGCIAAEAISGCCLCFYAILKIILFLLEAALVAFIAI  172

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPA  536
            D RW+K++P D TG  D +  F+EDN  I KWV +  V+++AL  LLA+++RA  + R  
Sbjct  173  DRRWEKDLPFDPTGELDSLRSFIEDNVDICKWVGITVVIVQALSLLLAIILRAMVSTRRT  232

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREK  371
            ++D +D+Y    R +IR+PL++   Q P+             + +D WS+R+REK
Sbjct  233  NFDEEDDY-ESERVRIREPLIH---QQPI-------------AHSDIWSSRIREK  270



>ref|XP_001762323.1| predicted protein [Physcomitrella patens]
 gb|EDQ72790.1| predicted protein, partial [Physcomitrella patens]
Length=134

 Score = 98.2 bits (243),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 62/140 (44%), Positives = 88/140 (63%), Gaps = 10/140 (7%)
 Frame = -1

Query  871  FLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWKK  692
            F+Y F+G+G++  +I+C G I A T +  CLSCY  L ILLI+ +L  A ++FFD+ W++
Sbjct  1    FIYAFLGVGIVTLLITCTGHIAAETSHNFCLSCYLCLQILLIVAQLILAGYLFFDKHWRQ  60

Query  691  EIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA----ANRPADYDS  524
            ++P D TG  D + +F+  N  I KWVALG +++EAL    A+ +RA    A RP  YDS
Sbjct  61   DLPDDPTGQLDKVEDFVGKNLTICKWVALGVLIIEALGLFFAMTLRAISADARRPG-YDS  119

Query  523  DDEYIGGPRQQIRQPLMNNR  464
            DDE         RQPL+N R
Sbjct  120  DDEL-----APTRQPLLNTR  134



>ref|XP_002885992.1| hypothetical protein ARALYDRAFT_480447 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62251.1| hypothetical protein ARALYDRAFT_480447 [Arabidopsis lyrata subsp. 
lyrata]
Length=270

 Score =   101 bits (252),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 84/250 (34%), Positives = 132/250 (53%), Gaps = 31/250 (12%)
 Frame = -1

Query  1048  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELV--QLGRPM------LVAVSLANNIF  893
              ++ Y I++  EY  H P   D P     SSG  +   +  P+      + ++ L +N  
Sbjct  27    SIIIYSIWMLHEYNRHLPV--DPPPAASSSSGTEIATSISEPLKNPIEFMASIVLGSNGG  84

Query  892   DN--------LPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilve  737
             D+        LP  WF+Y F+ +G+L+ +++  G I A   NGCCL  YS+L  LLIL+E
Sbjct  85    DHGFNLRSLDLPAPWFIYSFMAVGILVCIVTFIGFIAAEAINGCCLCFYSILKTLLILLE  144

Query  736   LGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVV  557
                 A+I  D  W+K++P D TG    +  F+E+N  I KWV +  V ++ L  LLA+V+
Sbjct  145   AALVAYIAIDRHWEKDLPYDPTGELSSLRAFIEENIDICKWVGIAVVAVQLLSLLLAMVL  204

Query  556   RA-ANRPADYDSDDEYIGGPRQQIRQPLMNNR-QQAPVTGVPVAGTLDSRPSRNDAWSAR  383
             RA  + P     ++E    PR +   PL+ ++  QAP      AG+     S+ + WS+R
Sbjct  205   RAMVSTPKPELDEEEDYENPRSRTWDPLLGSQGNQAP------AGS-----SKIENWSSR  253

Query  382   MREKYGLDTS  353
             +RE+YGL+ S
Sbjct  254   IRERYGLNQS  263



>emb|CDM86191.1| unnamed protein product [Triticum aestivum]
Length=246

 Score =   100 bits (250),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 110/194 (57%), Gaps = 12/194 (6%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF    +  G+L   I   G + A T +GCCL  Y+ L ++++L+E   A  I  +E
Sbjct  61   PDLWFACAVMAAGLLYCAILLAGYVAAETSSGCCLCFYTGLAMVMMLLEAAVAGRILLNE  120

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRP--ADY  530
             W +++P DRTG  + +  F+ +N  + KW AL     +AL   LA+V+RA   P  +DY
Sbjct  121  HWIQDLPYDRTGELENLVSFVNNNLDLCKWAALATFATQALSLFLAMVLRAMVSPTSSDY  180

Query  529  DSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTS-  353
            DSD++++      IR+PL+   Q AP + +P   T D R    + WS+ MR+KYGL++S 
Sbjct  181  DSDEDFV-----VIRRPLL-IAQGAP-SYLPT--TADPRGGHPNLWSSSMRQKYGLNSSG  231

Query  352  EFTYNPSESNRYQP  311
            ++TYN  + N  +P
Sbjct  232  DYTYNTLDQNAVRP  245



>gb|KDO65809.1| hypothetical protein CISIN_1g022738mg [Citrus sinensis]
Length=290

 Score =   101 bits (252),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 107/175 (61%), Gaps = 19/175 (11%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
             LP  WF+Y F+G+G+L+  I+  GCI A   +GCCL  Y++L I+L L+E    AFI  
Sbjct  113  ELPAPWFIYSFMGVGILVCCIALIGCIAAEAISGCCLCFYAILKIILFLLEAALVAFIAI  172

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPA  536
            D RW+K++P D TG  D +  F+EDN  I KWV +  V+++AL  LLA+++RA  + R  
Sbjct  173  DRRWEKDLPFDPTGELDSLRSFIEDNVDICKWVGITVVIVQALSLLLAIILRAMVSTRRT  232

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREK  371
            ++D +D+Y    R +IR+PL++   Q P+             + +D WS+R+REK
Sbjct  233  NFDEEDDY-ESERIRIREPLIH---QQPI-------------AHSDIWSSRIREK  270



>ref|XP_002884219.1| hypothetical protein ARALYDRAFT_480909 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60478.1| hypothetical protein ARALYDRAFT_480909 [Arabidopsis lyrata subsp. 
lyrata]
Length=219

 Score =   100 bits (248),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 69/174 (40%), Positives = 99/174 (57%), Gaps = 13/174 (7%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+Y F+G+G +L V++C G I A T NGCCL  Y   ++LL++VE G  A IF + 
Sbjct  53   PVPWFIYSFLGLGAILCVVTCAGHIAAETVNGCCLYLYMGFIVLLVMVEGGVVADIFLNR  112

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAAN-RP-ADY  530
             WKK+ P D +G F    +F+E N+KI KW+ L  V ++ L  LLA++++A    P   Y
Sbjct  113  DWKKDFPEDPSGAFHQFSKFIESNFKICKWIGLSIVCVQGLSVLLAMLLKALGPHPYRHY  172

Query  529  DSDDEYIGGPRQQIRQPLMNNRQQAP-VTGVPVAGTLDSRPSRNDAWSARMREK  371
            DSDDEY           L + RQ  P V G P+ G      ++  AW+ R+ E+
Sbjct  173  DSDDEY----NVSTVALLQDGRQLPPYVVGEPMYG------AKPGAWTVRINER  216



>ref|XP_010488999.1| PREDICTED: tetraspanin-19-like [Camelina sativa]
Length=219

 Score =   100 bits (248),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 68/174 (39%), Positives = 98/174 (56%), Gaps = 13/174 (7%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+Y F+G+G +L +++C G I A T NGCCL  Y   ++LL++VE G  A IF + 
Sbjct  53   PLPWFIYSFLGLGAILCLVTCAGHIAAETVNGCCLYMYMGFIVLLVMVEGGVVADIFLNR  112

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADY  530
             WK++ P D TG F    EF+E N+KI KW+ L  V ++ L  LLA++++A   +    Y
Sbjct  113  DWKQDFPEDPTGAFHHFSEFIESNFKICKWIGLAIVCVQGLSVLLAMLLKALGPHPHRHY  172

Query  529  DSDDEYIGGPRQQIRQPLMNNRQQAP-VTGVPVAGTLDSRPSRNDAWSARMREK  371
            DSDDEY           L + RQ  P V G P+ G       +  AW+ R+ E+
Sbjct  173  DSDDEY----NVSTVALLQDARQPPPYVVGEPMYG------PKPGAWTVRINER  216



>ref|XP_006357492.1| PREDICTED: tetraspanin-19-like [Solanum tuberosum]
Length=222

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 64/178 (36%), Positives = 100/178 (56%), Gaps = 16/178 (9%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+Y  +G+G+ L +++C G I A T NGCCL  Y V V LL+++E      +F + 
Sbjct  55   PAPWFIYATLGLGITLSIVTCSGHIAAETANGCCLYIYMVFVFLLLMIEAAVTVDVFLNR  114

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA---ANRPAD  533
             W+++ P D TGNFD +  F++DN+ I KW+ L  V ++ L  LLA++++A         
Sbjct  115  NWQEDFPKDTTGNFDELKHFVKDNFDICKWIGLSVVTVQGLTILLAMILKALGPHQERCY  174

Query  532  YDSDDEYIGGPRQQIRQPLMNNR--QQAPVTGVPVAGTLDSRPSRNDAWSARMREKYG  365
            Y+SDD+Y+       R PL+ +     + V G P+ G       +NDAW+ R+  K G
Sbjct  175  YESDDDYMPD-----RVPLLKSYVPSSSYVVGDPMYG------PKNDAWNIRINSKVG  221



>ref|XP_010416099.1| PREDICTED: tetraspanin-18 [Camelina sativa]
Length=271

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 84/256 (33%), Positives = 130/256 (51%), Gaps = 33/256 (13%)
 Frame = -1

Query  1045  MVGYGIYLFVEYKNHSPSGDDHPIPFPPSSGELVQLG----RPM------LVAVSLANNI  896
             ++ Y I++  EY  H P   D P     SSG  +++G     P+      + ++ L +N 
Sbjct  28    IIIYSIWMLHEYNRHLPV--DPPPAASSSSG--IEIGTIVSEPLKNPIDYMASILLGSNG  83

Query  895   FDN--------LPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilv  740
              D+        LP  WF+Y F+ +G+L+ +++  G I A   NGCCL  YS+L  LLIL+
Sbjct  84    GDHGFNLRSLDLPAPWFIYSFMAVGILVCIVTFIGFIAAEAINGCCLCFYSILKTLLILL  143

Query  739   eLGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALV  560
             E    A+I  D  W+K++P D TG    +  F+E+N  I KWV +  V ++ L  LLA+V
Sbjct  144   EAALVAYIAIDRHWEKDLPYDPTGEISSLRAFIEENIDICKWVGIAVVAVQLLSLLLAMV  203

Query  559   VRA-ANRPADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSAR  383
             +RA  + P     ++E    PR +   PL+           P         S+ + WS+R
Sbjct  204   LRAMVSTPKPELDEEEGYENPRVRAYDPLLG----------PQGNQASGGSSKIENWSSR  253

Query  382   MREKYGLDTSEFTYNP  335
             +REKYGL+ S+   NP
Sbjct  254   IREKYGLNQSQAAVNP  269



>emb|CDY35218.1| BnaA01g08130D [Brassica napus]
Length=273

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 102/182 (56%), Gaps = 13/182 (7%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
            +LP  WF+Y F+ IG+L+ +++  G I A   NGCCL  YS+L  L+I++E     FI  
Sbjct  97   DLPAPWFIYCFMAIGILVCIVTIIGFIAAEAINGCCLCFYSILKTLVIILEAALVGFIAI  156

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPA  536
            D  W+K++P D TG    +  F+E N  I KWV +G V ++ L  LLA+V+RA  + R +
Sbjct  157  DRHWEKDLPYDPTGELTSLRAFIEANIDICKWVGVGVVAVQLLSLLLAMVLRAMVSPRQS  216

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDT  356
            D D +D+Y   P  + R+ L+           P A    S  S  D W +R+REKYGL+ 
Sbjct  217  DLDDEDDY-ENPINRARENLL----------APQANQTSSGSSNIDNWRSRIREKYGLNN  265

Query  355  SE  350
             +
Sbjct  266  GQ  267



>ref|XP_010243645.1| PREDICTED: tetraspanin-18 [Nelumbo nucifera]
Length=301

 Score =   101 bits (251),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 80/211 (38%), Positives = 123/211 (58%), Gaps = 9/211 (4%)
 Frame = -1

Query  895  FDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFI  716
             + LP  WF+Y F+G+G+LL  I+C G I A + NGCCL  Y++L  +LIL+E    AFI
Sbjct  99   LNKLPAPWFIYSFMGVGILLCSITCIGHIAAESVNGCCLCFYTLLKTILILLEAALVAFI  158

Query  715  FFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA-ANRP  539
             F   W+KE+P D TG  D +  F+ +N  I KWV +  V ++AL  LLAL+++A  +  
Sbjct  159  VFVHSWEKELPYDPTGELDNLRSFILNNIDICKWVGITMVTIQALSLLLALILQAMVSTR  218

Query  538  ADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLD  359
                  D+     R + RQPL+ N Q +  TG   + +++S+ + +D WS RMREKYGL+
Sbjct  219  RRDYDSDDDYAIIRGRTRQPLL-NPQISQTTG---STSVNSKGTHSDIWSTRMREKYGLN  274

Query  358  TSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
            +++      + N    + +   E + RC+IM
Sbjct  275  STDAKCGLLDQN----SPLTSGENQKRCSIM  301



>ref|XP_009129299.1| PREDICTED: tetraspanin-20 [Brassica rapa]
Length=273

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 102/182 (56%), Gaps = 13/182 (7%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
            +LP  WF+Y F+ IG+L+ +++  G I A   NGCCL  YS+L  L+I++E     FI  
Sbjct  97   DLPAPWFIYCFMAIGILVCIVTIIGFIAAEAINGCCLCFYSILKTLVIILEAALVGFIAI  156

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPA  536
            D  W+K++P D TG    +  F+E N  I KWV +G V ++ L  LLA+V+RA  + R +
Sbjct  157  DRHWEKDLPYDPTGELTSLRAFIEANIDICKWVGVGVVAVQLLSLLLAMVLRAMVSPRQS  216

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDT  356
            D D +D+Y   P  + R+ L+           P A    S  S  D W +R+REKYGL+ 
Sbjct  217  DLDDEDDY-ENPINRARENLL----------APQANQTSSGSSNIDNWRSRIREKYGLNN  265

Query  355  SE  350
             +
Sbjct  266  GQ  267



>emb|CDY06872.1| BnaC01g09710D [Brassica napus]
Length=273

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 69/182 (38%), Positives = 102/182 (56%), Gaps = 13/182 (7%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
            +LP  WF+Y F+ IG+L+ +++  G I A   NGCCL  YS+L  L+I++E     FI  
Sbjct  97   DLPAPWFIYCFMAIGILVCIVTIIGFIAAEAINGCCLCFYSILKTLVIILEAALVGFIAI  156

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPA  536
            D  W+K++P D TG    +  F+E N  I KWV +G V ++ L  LLA+V+RA  + R +
Sbjct  157  DRHWEKDLPYDPTGELTSLRAFIEANIDICKWVGVGVVAIQLLSLLLAMVLRAMVSPRQS  216

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDT  356
            D D +D+Y   P  + R+ L+           P A    S  S  D W +R+REKYGL+ 
Sbjct  217  DLDDEDDY-ENPINRARENLL----------APQANQTSSGSSNIDNWRSRIREKYGLNN  265

Query  355  SE  350
             +
Sbjct  266  GQ  267



>ref|XP_002301831.1| hypothetical protein POPTR_0002s25480g [Populus trichocarpa]
 gb|ABK93408.1| unknown [Populus trichocarpa]
 gb|EEE81104.1| hypothetical protein POPTR_0002s25480g [Populus trichocarpa]
Length=281

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 108/182 (59%), Gaps = 15/182 (8%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
             LP  WF+Y F+G+GV+L  I+  GCI A + NGCCL  Y++L I+ IL+E    AFI  
Sbjct  97   QLPAPWFIYSFMGVGVILCCITFIGCIAAESINGCCLCFYTILKIVFILLEAALVAFIAI  156

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPA  536
            D RW+K++P D TG    +  F+E+N  I KWV +  ++++AL  LLA+++RA  + R  
Sbjct  157  DRRWEKDLPFDPTGELQSLRIFVEENVDICKWVGITVLIIQALALLLAMILRAMVSTRRN  216

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDT  356
            ++D DD      R + R+PL+N   Q    G           + +D W++RMREKYGL T
Sbjct  217  EFDEDD--FENVRGRTREPLLNQSGQTFSPG-----------THSDIWTSRMREKYGLST  263

Query  355  SE  350
             +
Sbjct  264  GD  265



>ref|XP_006443682.1| hypothetical protein CICLE_v10021447mg [Citrus clementina]
 gb|ESR56922.1| hypothetical protein CICLE_v10021447mg [Citrus clementina]
Length=278

 Score =   100 bits (250),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 107/175 (61%), Gaps = 19/175 (11%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
             LP  WF+Y F+G+G+L+  I+  GCI A   +GCCL  Y++L I+L L+E    AFI  
Sbjct  113  ELPAPWFIYSFMGVGILVCCIALIGCIAAEAISGCCLCFYAILKIILFLLEAALVAFIAI  172

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPA  536
            D RW+K++P D TG  D +  F+EDN  I KWV +  V+++AL  LLA+++RA  + R  
Sbjct  173  DRRWEKDLPFDPTGELDSLRSFIEDNVDICKWVGITVVIVQALSLLLAIILRAMVSTRRT  232

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREK  371
            ++D +D+Y    R +IR+PL++   Q P+             + +D WS+R+REK
Sbjct  233  NFDEEDDY-ESERVRIREPLIH---QQPI-------------AHSDIWSSRIREK  270



>gb|ABK93560.1| unknown [Populus trichocarpa]
Length=281

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 108/182 (59%), Gaps = 15/182 (8%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
             LP  WF+Y F+G+GV+L  I+  GCI A + NGCCL  Y++L I+ IL+E    AFI  
Sbjct  97   QLPAPWFIYSFMGVGVILCCITFIGCIAAESINGCCLCFYTILKIVFILLEAALVAFIAI  156

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPA  536
            D RW+K++P D TG    +  F+E+N  I KWV +  ++++AL  LLA+++RA  + R  
Sbjct  157  DRRWEKDLPFDPTGELQSLRIFVEENVDICKWVGITVLIIQALALLLAMILRAMVSTRRN  216

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDT  356
            ++D DD      R + R+PL+N   Q    G           + +D W++RMREKYGL T
Sbjct  217  EFDEDD--FENVRGRTREPLLNQSGQTFSPG-----------THSDIWTSRMREKYGLST  263

Query  355  SE  350
             +
Sbjct  264  GD  265



>gb|KDO65808.1| hypothetical protein CISIN_1g022738mg [Citrus sinensis]
Length=277

 Score =   100 bits (250),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 107/175 (61%), Gaps = 19/175 (11%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
             LP  WF+Y F+G+G+L+  I+  GCI A   +GCCL  Y++L I+L L+E    AFI  
Sbjct  113  ELPAPWFIYSFMGVGILVCCIALIGCIAAEAISGCCLCFYAILKIILFLLEAALVAFIAI  172

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPA  536
            D RW+K++P D TG  D +  F+EDN  I KWV +  V+++AL  LLA+++RA  + R  
Sbjct  173  DRRWEKDLPFDPTGELDSLRSFIEDNVDICKWVGITVVIVQALSLLLAIILRAMVSTRRT  232

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREK  371
            ++D +D+Y    R +IR+PL++   Q P+             + +D WS+R+REK
Sbjct  233  NFDEEDDY-ESERIRIREPLIH---QQPI-------------AHSDIWSSRIREK  270



>ref|NP_973493.1| tetraspanin family protein [Arabidopsis thaliana]
 gb|AEC07064.1| tetraspanin family protein [Arabidopsis thaliana]
Length=180

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 97/173 (56%), Gaps = 13/173 (8%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+Y F+G+G +L V++C G I A T NGCCL  Y   ++LL +VE G  A IF + 
Sbjct  12   PVPWFIYSFLGLGAILCVVTCAGHIAAETVNGCCLYLYMGFIVLLTMVEGGVVADIFLNR  71

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADY  530
             WKK+ P D +G F    +F+E N+KI KW+ L  V ++ L  L+A++++A   +    Y
Sbjct  72   DWKKDFPEDPSGAFHQFSKFIESNFKICKWIGLSIVCVQGLSVLIAMLLKALGPHPHRHY  131

Query  529  DSDDEYIGGPRQQIRQPLMNNRQQAP-VTGVPVAGTLDSRPSRNDAWSARMRE  374
            DSDDEY           L + RQ  P V G P+ G      ++  AW+ R+ +
Sbjct  132  DSDDEY----NVSTVALLQDARQPPPYVVGEPMYG------AKPGAWTVRLMK  174



>ref|XP_012091581.1| PREDICTED: tetraspanin-19-like [Jatropha curcas]
Length=239

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/197 (37%), Positives = 105/197 (53%), Gaps = 22/197 (11%)
 Frame = -1

Query  874  WFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWK  695
            WF+Y F+ IGV +  I+C G I A + N  CLSCY+V++ +L L+E   AA I  +  W+
Sbjct  58   WFIYTFLSIGVSMCFITCLGHISADSSNSFCLSCYTVIIFVLFLLESAIAADILLNSAWE  117

Query  694  KEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA----NRPADYD  527
            K++P D TG F    EF+E N+ + KW+ L  V+ +    L A+ +RA     N P++YD
Sbjct  118  KDLPEDPTGRFHDFKEFVESNFDVFKWIGLLIVLAQGCCILFAMALRAVRVNYNGPSNYD  177

Query  526  SDDEYIGGPRQQIRQPLMNNRQQAP---VTGVPVAGTLDSRPSRNDAWSARMREKYGLDT  356
            SDDEY        R PL+N   Q P   V G P         S+ND+W+ +  + +    
Sbjct  178  SDDEYTAA-----RLPLLNKHLQTPSYVVNGDP------HLASKNDSWNTKETDSFVKRI  226

Query  355  SEFTYNPSESNRYQPTN  305
            +  TY   E N  + TN
Sbjct  227  AS-TY---EENNKKATN  239



>ref|XP_006656530.1| PREDICTED: tetraspanin-18-like [Oryza brachyantha]
Length=243

 Score =   100 bits (248),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/189 (35%), Positives = 111/189 (59%), Gaps = 11/189 (6%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+   +  G+   ++   GC+ A   + C L  Y++LV++++L+E   AA +FF++
Sbjct  59   PDLWFVCALMAAGLFYCLLLLAGCVAAEINSACFLCFYTILVVIMMLLEAAVAADLFFNK  118

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPADY  530
             W +++P DRTG  + +  F++ N  + KW A+  V  +A   LLA ++R   +   ADY
Sbjct  119  NWIQDLPYDRTGELNNLLSFIQSNLDLCKWAAVAIVAAQAFSLLLATILRTMVSTLRADY  178

Query  529  DSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDTSE  350
            DSD++++      IR+PL+   Q AP     +  T+DSR    D WS+RMR+KYGL++S 
Sbjct  179  DSDEDFV-----VIRRPLL-VAQGAPAY---LPTTVDSRGFHPDLWSSRMRQKYGLNSSS  229

Query  349  FTYNPSESN  323
            +TYN  + N
Sbjct  230  YTYNTLDPN  238



>gb|EYU26161.1| hypothetical protein MIMGU_mgv1a013675mg [Erythranthe guttata]
Length=213

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 65/173 (38%), Positives = 100/173 (58%), Gaps = 12/173 (7%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+Y  +G+GV L VI+C G + A T NGCCL  Y V V ++ ++E    A +F + 
Sbjct  48   PIPWFVYTTLGLGVTLCVITCSGHVAAETVNGCCLYIYMVFVFMIFVLEAAVTADVFLNH  107

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPAD--Y  530
             W+++ P D +GN D + +F++DN+ I KW+ L  + L+AL  LLA++++A     +  Y
Sbjct  108  SWQEDFPADPSGNLDHLKDFIKDNFDICKWIGLMVLALQALSMLLAMILKALGPHPERYY  167

Query  529  DSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREK  371
            +SDDEY+       R PL+ N    P T V    T  +   +NDAW+ R+  K
Sbjct  168  ESDDEYLPD-----RVPLLKN-YVPPQTYV----TEPAYAVKNDAWNIRINSK  210



>dbj|BAD62494.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAG99901.1| unnamed protein product [Oryza sativa Japonica Group]
Length=141

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 80/133 (60%), Gaps = 11/133 (8%)
 Frame = -1

Query  715  FFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANR  542
            FF++ W +++P DRTG  D +  F++ N  + KW AL  V  +AL  LLA ++R+  +  
Sbjct  13   FFNKHWIQDLPYDRTGELDNLLSFIQTNLDLCKWAALAIVATQALSLLLATILRSMLSTP  72

Query  541  PADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGL  362
             ADYDSD++++      IR+PL+   Q AP     +  T D+R    D WS+RMR KYGL
Sbjct  73   SADYDSDEDFV-----VIRRPLL-VAQGAPAY---LPTTADTRGFHPDLWSSRMRHKYGL  123

Query  361  DTSEFTYNPSESN  323
            ++S +TYN  + N
Sbjct  124  NSSNYTYNTLDPN  136



>ref|XP_006594069.1| PREDICTED: tetraspanin-18-like isoform X2 [Glycine max]
Length=227

 Score = 99.4 bits (246),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 108/187 (58%), Gaps = 12/187 (6%)
 Frame = -1

Query  880  KEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDER  701
              WF+Y F+G+G+L+  IS  GCI A   NGCCL  Y++LV +L+L+E     FI  D  
Sbjct  48   SHWFIYDFMGLGILVLCISFLGCIAAEMINGCCLCFYTILVAVLLLLEASLVGFIALDSD  107

Query  700  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLE--ALMFLLALVVRAANRPADYD  527
            W+K+IP D TG  D +  F+EDN  I  WV +  +V++  +L+  L L    + R AD+D
Sbjct  108  WEKDIPLDPTGQLDELRAFIEDNIDICTWVGIAVLVVQALSLLLALILRATVSARRADFD  167

Query  526  SDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTL-DSRPSRNDAWSARMREKYGLDT--  356
             +D Y    R +  +PL+N     P  G P   +  D+  + +D WS+RMR+KYGL+   
Sbjct  168  YEDGY--DVRGRSWEPLLN-----PQPGQPSGSSKGDNSGNHSDFWSSRMRQKYGLNHGG  220

Query  355  SEFTYNP  335
             +++Y P
Sbjct  221  DKYSYQP  227



>ref|XP_010935654.1| PREDICTED: tetraspanin-19-like [Elaeis guineensis]
Length=212

 Score = 98.6 bits (244),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 99/171 (58%), Gaps = 14/171 (8%)
 Frame = -1

Query  874  WFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWK  695
            WF+Y F+G+G+ L +I+C G I A T NGCCLSCY V V LL+L+E      IF +  W+
Sbjct  50   WFIYTFLGLGIFLCLITCSGLIAAETANGCCLSCYMVFVFLLVLLEAAITVDIFLNRNWE  109

Query  694  KEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADYDSD  521
            ++ P D TG FD + +F+  N+++ KW+ L  V  +AL   LA+V+RA   +  + YDSD
Sbjct  110  EDFPEDTTGKFDELKDFVRSNFEMCKWIGLLVVAAQALSIFLAIVLRALGPDHGSYYDSD  169

Query  520  DEYIGGPRQQIRQPLMNNR-QQAPVTGVPVAGTLDSRPSRNDAWSARMREK  371
            D+ +       R PL+ N+    P T  P   T      + D+W+ R+ EK
Sbjct  170  DDIVPA-----RLPLLRNQVHHTPYTAEPNLST------KKDSWNVRIPEK  209



>ref|XP_004243344.1| PREDICTED: tetraspanin-19 [Solanum lycopersicum]
Length=222

 Score = 99.0 bits (245),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 100/178 (56%), Gaps = 16/178 (9%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
            ++P  WF+Y  +G+G+ L +++C G I A T NGCCL  Y V V LL+++E      +F 
Sbjct  53   DVPAPWFIYATLGLGITLSIVTCSGHIAAETANGCCLYIYMVFVFLLLMIEAAVTVDVFL  112

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA---ANRP  539
            +  W+++ P D TGNFD +  F++DN+ I KW+ L  V ++ L  L A++++A       
Sbjct  113  NRNWQEDFPEDTTGNFDELKHFVKDNFDICKWIGLSVVTVQGLTILFAMILKALGPHQER  172

Query  538  ADYDSDDEYIGGPRQQIRQPLMNNR--QQAPVTGVPVAGTLDSRPSRNDAWSARMREK  371
              Y+SDD+YI       R PL+ +     + V G P+ G       +NDAW+ R+  K
Sbjct  173  CYYESDDDYIPD-----RVPLLKSYVPSSSYVVGDPMYG------PKNDAWNIRINSK  219



>ref|XP_006412912.1| hypothetical protein EUTSA_v10025947mg [Eutrema salsugineum]
 gb|ESQ54365.1| hypothetical protein EUTSA_v10025947mg [Eutrema salsugineum]
Length=278

 Score = 99.8 bits (247),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 66/177 (37%), Positives = 99/177 (56%), Gaps = 13/177 (7%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
            +LP  WF+Y F+ IG+L+ +++  G I A   NGCCL  YS+L  LLI++E     FI  
Sbjct  102  DLPAPWFIYSFMAIGILVCIVTIIGFIAAEAINGCCLCFYSILKTLLIILEAALVGFIAI  161

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPA  536
            D  W+K++P D TG    +  F+E N  I KWV +  V ++ L  L+A+V+RA  + R +
Sbjct  162  DRHWEKDLPYDPTGELTSLRAFIEANIDICKWVGIVVVAVQLLSLLMAMVLRAMVSPRQS  221

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYG  365
            ++D +D+Y   P  + R+ L+           P A    S  S  D W +R+REKYG
Sbjct  222  EFDDEDDY-ENPMSRARENLLG----------PQANQTSSGSSNIDNWRSRIREKYG  267



>ref|XP_006298317.1| hypothetical protein CARUB_v10014382mg [Capsella rubella]
 gb|EOA31215.1| hypothetical protein CARUB_v10014382mg [Capsella rubella]
Length=271

 Score = 99.4 bits (246),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 86/251 (34%), Positives = 135/251 (54%), Gaps = 30/251 (12%)
 Frame = -1

Query  1048  GMVGYGIYLFVEYKNHSPSGDDHPIPFPPSSG-ELVQLGRPMLVAVSLANNI--------  896
              ++ Y I++  EY  H P  D  P+    SSG E+V++  P+   +    +I        
Sbjct  27    SIIIYSIWMLHEYNRHLPV-DPPPVASSSSSGVEIVKVSEPLKNPIDFMASIVLGWANGP  85

Query  895   ---FD----NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilve  737
                F+    +LP  WF+Y F+ +G+L+ +++  G I A   NGCCL  YSVL  LLIL+E
Sbjct  86    DHGFNLRSLDLPAPWFIYSFMAVGILVCIVTFIGFIAAEAINGCCLCFYSVLKTLLILLE  145

Query  736   LGAAAFIFFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVV  557
                 A+I  D +W+K++P D TG    +  F+E+N  I KW+ +  V ++ L  LLA+V+
Sbjct  146   AALVAYIAIDRQWEKDLPYDPTGELISLRAFIEENIDICKWLGIAVVAVQLLSLLLAMVL  205

Query  556   RA-ANRPADYDSDDEYIGGPRQQIRQPLMNNR-QQAPVTGVPVAGTLDSRPSRNDAWSAR  383
             RA  + P     ++E    PR +   PL+  +  QAP      AG+     S+ + WS+R
Sbjct  206   RAMVSTPKPELDEEEDYENPRVRAWDPLLGPQGNQAP------AGS-----SKIENWSSR  254

Query  382   MREKYGLDTSE  350
             +REKYGL+ S+
Sbjct  255   IREKYGLNQSQ  265



>ref|XP_008796410.1| PREDICTED: tetraspanin-18-like isoform X1 [Phoenix dactylifera]
Length=244

 Score = 98.2 bits (243),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 72/212 (34%), Positives = 118/212 (56%), Gaps = 17/212 (8%)
 Frame = -1

Query  895  FDNLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFI  716
             + LP  WF+   +G GVLL +I+  G + A   NGCCL  ++VL I+LIL+E      +
Sbjct  48   LEGLPAPWFICAMMGAGVLLCLIAFTGHVAAEVVNGCCLCFFAVLAIVLILLEAALVGAL  107

Query  715  FFDERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANR  542
             FD+ W++++P D TG       F+++N  I KWVA+  +V++A   LLA+++RA  A R
Sbjct  108  VFDKHWEEDLPYDSTGELKRFCAFIKENMDICKWVAVTVIVIQAFSLLLAMILRAMVAAR  167

Query  541  PADYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGL  362
              DYDSD++++      IR+PL++  Q  P       G   S+   +D  S +MR+K   
Sbjct  168  RVDYDSDEDFV-----VIRRPLLDP-QGGPSYATTSVG---SKGIHSDFLSPQMRQK---  215

Query  361  DTSEFTYNPSESNRYQPTNVQPAEERGRCTIM  266
              SE +YN  +  +   +    ++ R +C+I+
Sbjct  216  --SELSYNGVD-QKTALSASSNSDNRKQCSIL  244



>ref|XP_008802328.1| PREDICTED: tetraspanin-19-like [Phoenix dactylifera]
Length=212

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 102/172 (59%), Gaps = 14/172 (8%)
 Frame = -1

Query  874  WFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWK  695
            WF+Y F+G+G+ L +I+C G I A T +G CLSCY V V LL+++E+   A IF +  W+
Sbjct  50   WFIYTFLGLGIFLCLITCSGHIAAETASGHCLSCYMVFVFLLVMLEVAITADIFLNRNWE  109

Query  694  KEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADYDSD  521
            ++ P D TG F  + +F+  N+++ KW+ L  V  +AL   LA+V+RA   +  + YDSD
Sbjct  110  EDFPEDPTGKFGELKDFVRSNFEMCKWIGLLVVAAQALSIFLAIVLRALGPDHGSYYDSD  169

Query  520  DEYIGGPRQQIRQPLMNNR-QQAPVTGVPVAGTLDSRPSRNDAWSARMREKY  368
            D+ +       R PL+ N+  + P T  P   T      +ND+W+ R+ E++
Sbjct  170  DDTVPA-----RLPLLRNQAHRTPYTAEPNLST------KNDSWNVRIHERF  210



>ref|NP_179667.2| tetraspanin family protein [Arabidopsis thaliana]
 sp|Q940P5.1|TET19_ARATH RecName: Full=Tetraspanin-19; AltName: Full=TOM2A homologous 
protein 3 [Arabidopsis thaliana]
 gb|AAL58930.1|AF462842_1 At2g20740/F5H14.29 [Arabidopsis thaliana]
 gb|AAL06877.1| At2g20740/F5H14.29 [Arabidopsis thaliana]
 gb|AAM19866.1| At2g20740/F5H14.29 [Arabidopsis thaliana]
 dbj|BAD43316.1| hypothetical protein [Arabidopsis thaliana]
 dbj|BAD43849.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC07065.1| tetraspanin family protein [Arabidopsis thaliana]
Length=221

 Score = 97.4 bits (241),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 97/173 (56%), Gaps = 13/173 (8%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+Y F+G+G +L V++C G I A T NGCCL  Y   ++LL +VE G  A IF + 
Sbjct  53   PVPWFIYSFLGLGAILCVVTCAGHIAAETVNGCCLYLYMGFIVLLTMVEGGVVADIFLNR  112

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADY  530
             WKK+ P D +G F    +F+E N+KI KW+ L  V ++ L  L+A++++A   +    Y
Sbjct  113  DWKKDFPEDPSGAFHQFSKFIESNFKICKWIGLSIVCVQGLSVLIAMLLKALGPHPHRHY  172

Query  529  DSDDEYIGGPRQQIRQPLMNNRQQAP-VTGVPVAGTLDSRPSRNDAWSARMRE  374
            DSDDEY           L + RQ  P V G P+ G      ++  AW+ R+ +
Sbjct  173  DSDDEY----NVSTVALLQDARQPPPYVVGEPMYG------AKPGAWTVRLMK  215



>ref|NP_001242107.1| uncharacterized protein LOC100816955 [Glycine max]
 gb|ACU17677.1| unknown [Glycine max]
Length=244

 Score = 97.8 bits (242),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 77/196 (39%), Positives = 109/196 (56%), Gaps = 17/196 (9%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
            NLP  WF+Y F+G G+L+  IS  GCI A   NGCCL  YS+LV++L+L+E     FI  
Sbjct  63   NLPAPWFIYNFMGFGILVLCISFLGCIAAEMINGCCLCFYSILVVVLLLLEASLVGFIAL  122

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLE--ALMFLLALVVRAANRPA  536
            D  W+K+IP D TG  D +  F+EDN     WV +  +V++  +L+  L L    ++R A
Sbjct  123  DSDWEKDIPFDPTGQLDELRAFIEDNIDTCTWVGIAVLVIQALSLLLALILRATVSSRRA  182

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTL-DSRPSRNDAWSARMREKYGLD  359
            D+D +D Y    R +  +PL+N     P  G P   +  D+  + +D  S RMREKYGL 
Sbjct  183  DFDYEDGY--DVRGRSWEPLLN-----PQPGQPSGSSKGDNSGNHSDFRSVRMREKYGL-  234

Query  358  TSEFTYNPSESNRYQP  311
                  N  + + YQP
Sbjct  235  ------NHGDKSSYQP  244



>gb|KHN48971.1| hypothetical protein glysoja_025348 [Glycine soja]
Length=296

 Score = 98.6 bits (244),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 72/187 (39%), Positives = 108/187 (58%), Gaps = 12/187 (6%)
 Frame = -1

Query  880  KEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDER  701
              WF+Y F+G+G+L+  IS  GCI A   NGCCL  Y++LV +L+L+E     FI  D  
Sbjct  117  SHWFIYDFMGLGILVLCISFLGCIAAEMINGCCLCFYTILVAVLLLLEASLVGFIALDSD  176

Query  700  WKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLE--ALMFLLALVVRAANRPADYD  527
            W+K+IP D TG  D +  F+EDN  I  WV +  +V++  +L+  L L    + R AD+D
Sbjct  177  WEKDIPLDPTGQLDELRAFIEDNIDICTWVGIAVLVVQALSLLLALILRATVSARRADFD  236

Query  526  SDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTL-DSRPSRNDAWSARMREKYGLDT--  356
             +D Y    R +  +PL+N     P  G P   +  D+  + +D WS+RMR+KYGL+   
Sbjct  237  YEDGY--DVRGRSWEPLLN-----PQPGQPSGSSKGDNSGNHSDFWSSRMRQKYGLNHGG  289

Query  355  SEFTYNP  335
             +++Y P
Sbjct  290  DKYSYQP  296



>ref|XP_011024533.1| PREDICTED: tetraspanin-20-like [Populus euphratica]
Length=281

 Score = 98.2 bits (243),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 72/182 (40%), Positives = 107/182 (59%), Gaps = 15/182 (8%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
             LP  WF+Y F+G+GV+L  I+  GCI A + NGCCL  Y++L I+ IL+E    AFI  
Sbjct  97   QLPAPWFIYSFMGVGVILCCITFIGCIAAESINGCCLCFYTILKIVFILLEAALVAFIAI  156

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPA  536
            D RW+K++P D TG    +  F+E+N  I KWV +  ++++AL  LLA+++RA  + R  
Sbjct  157  DRRWEKDLPFDPTGELQSLRIFVEENVDICKWVGITVLIIQALALLLAMILRAMVSTRRN  216

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDT  356
            ++  DD      R + R+PL+N   Q    G           + +D W++RMREKYGL T
Sbjct  217  EFGEDD--FENVRGRTREPLLNQSGQTFSPG-----------THSDIWTSRMREKYGLST  263

Query  355  SE  350
             +
Sbjct  264  GD  265



>ref|XP_010241967.1| PREDICTED: tetraspanin-19 isoform X3 [Nelumbo nucifera]
Length=183

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 96/172 (56%), Gaps = 15/172 (9%)
 Frame = -1

Query  874  WFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWK  695
            WF+Y F+GIG+ L V++C G I A T NG CL CY V VILL+L+E    A IF +  W+
Sbjct  23   WFIYAFLGIGITLCVLTCSGHIAAETANGHCLCCYMVFVILLLLLEAAVTADIFLNNHWE  82

Query  694  KEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADYDSD  521
            ++ P D TG F+   +F++ N+ I KW+ L  V  + L  LL++V+RA   ++ +  DSD
Sbjct  83   EDFPEDPTGEFNEFKDFIKSNFDICKWIGLFIVCTQGLSILLSMVLRALGPDQGSYCDSD  142

Query  520  DEYIGGPRQQIRQPLMNNRQQAP--VTGVPVAGTLDSRPSRNDAWSARMREK  371
            D+Y        R PL+ N    P  V G P          +ND W+ R  EK
Sbjct  143  DDYAPA-----RLPLLKNPVHPPPYVIGNP------QYAPKNDVWNVRTCEK  183



>ref|XP_011085968.1| PREDICTED: tetraspanin-19 [Sesamum indicum]
Length=214

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 96/172 (56%), Gaps = 15/172 (9%)
 Frame = -1

Query  874  WFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWK  695
            WF+Y  +G+GV L VI+C G I A T +GCCL  Y   V LL ++E    A +F +  W+
Sbjct  51   WFIYTILGLGVTLCVITCAGHIAAETASGCCLYLYMAFVFLLFVMEAAVTADVFLNHDWQ  110

Query  694  KEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPAD--YDSD  521
            ++ P D TG FD +  F++DN+ I KW+ LG V L+ +  LLA++++A     +  Y+SD
Sbjct  111  EDFPDDPTGYFDQLKNFIKDNFDICKWIGLGVVALQGISMLLAMILKALGPHPERYYESD  170

Query  520  DEYIGGPRQQIRQPLMNNRQ--QAPVTGVPVAGTLDSRPSRNDAWSARMREK  371
            D+Y+       R PL+ N    Q  V   P  G       ++DAW+ R+  K
Sbjct  171  DDYLPD-----RVPLLKNYVPPQPYVVSDPAYGV------KSDAWNIRINSK  211



>ref|XP_010940414.1| PREDICTED: tetraspanin-19-like [Elaeis guineensis]
Length=212

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/170 (38%), Positives = 96/170 (56%), Gaps = 13/170 (8%)
 Frame = -1

Query  874  WFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWK  695
            WF+Y F+G+G+ L +I+C G I A T NG CLSCY V V LL+++E    A IF +  W+
Sbjct  51   WFVYTFLGLGIFLCLITCSGHIAAETANGHCLSCYMVFVFLLVMLEAAVTADIFLNRNWE  110

Query  694  KEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADYDSD  521
            ++ P D TG FD +  F+  N+++ KW+ L  V  +AL   LA+V+RA   +  + YDSD
Sbjct  111  EDFPEDPTGKFDELKNFVRSNFEMCKWIGLLVVAAQALSIFLAMVLRALGPDSGSYYDSD  170

Query  520  DEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREK  371
            D+ +       R PL+ N+          + T++     ND W  R REK
Sbjct  171  DDIVPA-----RLPLLRNQVHH------TSYTVEPNLPNNDPWKVRNREK  209



>ref|NP_001236362.1| uncharacterized protein LOC100527459 [Glycine max]
 gb|ACU16551.1| unknown [Glycine max]
Length=212

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 85/139 (61%), Gaps = 5/139 (4%)
 Frame = -1

Query  883  PKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDE  704
            P  WF+Y+F+G+GV   VI+C G + A T NGCCL  Y V V+LLI++E      +F ++
Sbjct  54   PPPWFIYMFLGLGVAFCVITCLGHVAAETANGCCLHLYMVFVVLLIMLEAAVTVDVFVNQ  113

Query  703  RWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADYDS  524
             W+K+ P D +G+FD    F+  N+++ KWV L  V ++ L  LLA++++A      YDS
Sbjct  114  DWEKDFPKDPSGSFDQFKNFIRSNYEMCKWVGLSLVSVQGLSLLLAMILKALGPHQYYDS  173

Query  523  DDEYIGGPRQQIRQPLMNN  467
            DDEY   P    R PL+ N
Sbjct  174  DDEY--APD---RVPLLRN  187



>ref|XP_010241963.1| PREDICTED: tetraspanin-19 isoform X1 [Nelumbo nucifera]
 ref|XP_010241964.1| PREDICTED: tetraspanin-19 isoform X1 [Nelumbo nucifera]
 ref|XP_010241965.1| PREDICTED: tetraspanin-19 isoform X1 [Nelumbo nucifera]
Length=215

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 96/172 (56%), Gaps = 15/172 (9%)
 Frame = -1

Query  874  WFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFFDERWK  695
            WF+Y F+GIG+ L V++C G I A T NG CL CY V VILL+L+E    A IF +  W+
Sbjct  55   WFIYAFLGIGITLCVLTCSGHIAAETANGHCLCCYMVFVILLLLLEAAVTADIFLNNHWE  114

Query  694  KEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAA--NRPADYDSD  521
            ++ P D TG F+   +F++ N+ I KW+ L  V  + L  LL++V+RA   ++ +  DSD
Sbjct  115  EDFPEDPTGEFNEFKDFIKSNFDICKWIGLFIVCTQGLSILLSMVLRALGPDQGSYCDSD  174

Query  520  DEYIGGPRQQIRQPLMNNRQQAP--VTGVPVAGTLDSRPSRNDAWSARMREK  371
            D+Y        R PL+ N    P  V G P          +ND W+ R  EK
Sbjct  175  DDY-----APARLPLLKNPVHPPPYVIGNP------QYAPKNDVWNVRTCEK  215



>ref|XP_006580963.1| PREDICTED: uncharacterized protein LOC100527459 isoform X1 [Glycine 
max]
 ref|XP_006580964.1| PREDICTED: uncharacterized protein LOC100527459 isoform X2 [Glycine 
max]
Length=211

 Score = 95.5 bits (236),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 86/141 (61%), Gaps = 5/141 (4%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
            + P  WF+Y+F+G+GV   VI+C G + A T NGCCL  Y V V+LLI++E      +F 
Sbjct  52   DYPPPWFIYMFLGLGVAFCVITCLGHVAAETANGCCLYLYMVFVVLLIMLEAAVTVDVFV  111

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADY  530
            ++ W+K+ P D +G+FD    F+  N+++ KWV L  V ++ L  LLA++++A      Y
Sbjct  112  NQDWEKDFPKDPSGSFDQFKNFIRSNYEMCKWVGLSLVSVQGLSLLLAMILKALGPHQYY  171

Query  529  DSDDEYIGGPRQQIRQPLMNN  467
            DSDDEY   P    R PL+ N
Sbjct  172  DSDDEY--APD---RVPLLRN  187



>ref|XP_010526469.1| PREDICTED: tetraspanin-20 [Tarenaya hassleriana]
Length=271

 Score = 96.7 bits (239),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 69/194 (36%), Positives = 111/194 (57%), Gaps = 13/194 (7%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
            +LP  WF+Y F+G+G+L+ +++  G I A   NGCCL  YS+L  +LIL+E     FI  
Sbjct  89   DLPAPWFIYSFMGVGILVCIVTVIGFIAAEAINGCCLCFYSILKTVLILLEAALVGFIAI  148

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRA--ANRPA  536
            D  W+K++P D TG  D +  F+E+N  + KWV +  V ++ L  LLA+V+RA  + R +
Sbjct  149  DRHWEKDLPNDPTGELDSLRAFIEENIDVCKWVGIAVVAVQLLSLLLAMVLRAMVSTRTS  208

Query  535  DYDSDDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREKYGLDT  356
            + D ++E    P ++   PL+ ++      G           S+ D WS+RMREKYGL+ 
Sbjct  209  ELDEEEEDYENPGRRAWDPLLGSQANQASAGT----------SKIDNWSSRMREKYGLNN  258

Query  355  SEFTYNPSESNRYQ  314
               + +PS + + +
Sbjct  259  G-LSQSPSMNAKAK  271



>ref|XP_002521157.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF41308.1| conserved hypothetical protein [Ricinus communis]
Length=225

 Score = 95.1 bits (235),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 70/175 (40%), Positives = 103/175 (59%), Gaps = 14/175 (8%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
             LP  WF+Y F+G+G++L  I+  GCI A   NGCCL  YS+L  +LIL+E    AFI  
Sbjct  55   KLPAPWFIYSFMGVGIILCCITLIGCIAAEAINGCCLCFYSILKTVLILLEASLVAFIAI  114

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADY  530
            D RW+K++P D TG    +  F+E+N  I +W+ +  +V++AL  LLA+++RA       
Sbjct  115  DRRWEKDLPFDPTGELQSLRSFVEENVDICEWIGITVIVIQALSLLLAIILRALISTGRS  174

Query  529  DS--DDEYIGGPRQQIRQPLMNNRQQAPVTGVPVAGTLDSRPSRNDAWSARMREK  371
            DS  +D+Y  G R++  +PL+N   Q   +GV            +D WS+RMREK
Sbjct  175  DSEFEDDYESG-RRRTWEPLLNQSGQTSGSGV-----------HSDIWSSRMREK  217



>ref|XP_003539915.1| PREDICTED: tetraspanin-19-like isoform 1 [Glycine max]
 gb|KHN31976.1| hypothetical protein glysoja_025810 [Glycine soja]
Length=210

 Score = 94.4 bits (233),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 85/141 (60%), Gaps = 5/141 (4%)
 Frame = -1

Query  889  NLPKEWFLYLFIGIGVLLFVISCFGCIGASTRNGcclscysvlvillilveLGAAAFIFF  710
            + P  WF+Y F+G+GV   VI+C G + A T NGCCL  Y V V+LLI++E      +F 
Sbjct  52   DYPPPWFIYTFLGLGVAFCVITCLGHVAAETANGCCLYLYIVFVVLLIMLEAAVTVDVFV  111

Query  709  DERWKKEIPTDRTGNFDMIYEFLEDNWKIVKWVALGAVVLEALMFLLALVVRAANRPADY  530
            ++ W+K+ P D +G+FD    F+  N+++ KWV L  V ++ L  LLA++++A      Y
Sbjct  112  NQDWEKDFPKDPSGSFDQFKNFIRSNYEMCKWVGLSLVSVQGLSLLLAMILKALGPHQYY  171

Query  529  DSDDEYIGGPRQQIRQPLMNN  467
            DSDDEY   P    R PL+ N
Sbjct  172  DSDDEY--APD---RVPLLKN  187



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3967890708688