BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2697

Length=878
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009627985.1|  PREDICTED: peroxisomal membrane protein PEX1...    189   4e-52   Nicotiana tomentosiformis
ref|XP_009800698.1|  PREDICTED: peroxisomal membrane protein PEX1...    189   5e-52   Nicotiana sylvestris
ref|XP_009795002.1|  PREDICTED: peroxisomal membrane protein PEX1...    181   9e-49   Nicotiana sylvestris
ref|XP_009795004.1|  PREDICTED: peroxisomal membrane protein PEX1...    180   1e-48   Nicotiana sylvestris
ref|XP_009629523.1|  PREDICTED: peroxisomal membrane protein PEX1...    179   3e-48   Nicotiana tomentosiformis
ref|XP_009629521.1|  PREDICTED: peroxisomal membrane protein PEX1...    179   3e-48   Nicotiana tomentosiformis
ref|XP_009795003.1|  PREDICTED: peroxisomal membrane protein PEX1...    177   1e-47   Nicotiana sylvestris
ref|XP_009629522.1|  PREDICTED: peroxisomal membrane protein PEX1...    176   4e-47   Nicotiana tomentosiformis
ref|XP_004241494.1|  PREDICTED: peroxisomal membrane protein PEX1...    171   4e-45   Solanum lycopersicum
ref|XP_010322553.1|  PREDICTED: peroxisomal membrane protein PEX1...    171   4e-45   Solanum lycopersicum
ref|XP_006347457.1|  PREDICTED: peroxisomal membrane protein PEX1...    167   8e-44   Solanum tuberosum [potatoes]
ref|XP_006347456.1|  PREDICTED: peroxisomal membrane protein PEX1...    167   9e-44   Solanum tuberosum [potatoes]
ref|XP_011071849.1|  PREDICTED: peroxisomal membrane protein PEX1...    159   7e-41   
ref|XP_011071848.1|  PREDICTED: peroxisomal membrane protein PEX1...    158   1e-40   Sesamum indicum [beniseed]
ref|XP_009627986.1|  PREDICTED: peroxisomal membrane protein PEX1...    153   7e-39   
ref|XP_012080068.1|  PREDICTED: peroxisomal membrane protein PEX14      148   5e-37   Jatropha curcas
gb|KDO69670.1|  hypothetical protein CISIN_1g009434mg                   137   1e-33   Citrus sinensis [apfelsine]
gb|KDO69669.1|  hypothetical protein CISIN_1g009434mg                   138   2e-33   Citrus sinensis [apfelsine]
ref|XP_007036213.1|  Peroxin 14, putative isoform 1                     138   2e-33   
gb|KDO69668.1|  hypothetical protein CISIN_1g009434mg                   138   2e-33   Citrus sinensis [apfelsine]
gb|KDO69667.1|  hypothetical protein CISIN_1g009434mg                   138   2e-33   Citrus sinensis [apfelsine]
ref|XP_006476775.1|  PREDICTED: peroxisomal membrane protein PEX1...    136   7e-33   Citrus sinensis [apfelsine]
ref|XP_004298942.1|  PREDICTED: peroxisomal membrane protein PEX14      134   2e-32   Fragaria vesca subsp. vesca
ref|XP_011044302.1|  PREDICTED: peroxisomal membrane protein PEX1...    134   4e-32   Populus euphratica
ref|XP_010101211.1|  Peroxisomal membrane protein PEX14                 134   4e-32   Morus notabilis
ref|XP_011044300.1|  PREDICTED: peroxisomal membrane protein PEX1...    134   4e-32   Populus euphratica
emb|CDP12402.1|  unnamed protein product                                133   6e-32   Coffea canephora [robusta coffee]
ref|XP_010243116.1|  PREDICTED: peroxisomal membrane protein PEX1...    133   8e-32   Nelumbo nucifera [Indian lotus]
ref|XP_010243114.1|  PREDICTED: peroxisomal membrane protein PEX1...    133   9e-32   
ref|XP_011101330.1|  PREDICTED: peroxisomal membrane protein PEX1...    132   1e-31   Sesamum indicum [beniseed]
ref|XP_011101332.1|  PREDICTED: peroxisomal membrane protein PEX1...    132   1e-31   Sesamum indicum [beniseed]
ref|XP_011101331.1|  PREDICTED: peroxisomal membrane protein PEX1...    132   1e-31   Sesamum indicum [beniseed]
ref|XP_011101329.1|  PREDICTED: peroxisomal membrane protein PEX1...    132   1e-31   Sesamum indicum [beniseed]
ref|XP_002511400.1|  conserved hypothetical protein                     129   2e-30   Ricinus communis
ref|XP_007209904.1|  hypothetical protein PRUPE_ppa004183mg             125   7e-29   Prunus persica
ref|XP_008239763.1|  PREDICTED: peroxisomal membrane protein PEX14      123   2e-28   Prunus mume [ume]
ref|XP_004236106.1|  PREDICTED: peroxisomal membrane protein PEX14      123   2e-28   Solanum lycopersicum
ref|XP_009363025.1|  PREDICTED: peroxisomal membrane protein PEX1...    121   1e-27   Pyrus x bretschneideri [bai li]
ref|XP_002282743.1|  PREDICTED: peroxisomal membrane protein PEX14      121   1e-27   Vitis vinifera
emb|CAN67215.1|  hypothetical protein VITISV_005839                     121   2e-27   Vitis vinifera
ref|XP_009363027.1|  PREDICTED: peroxisomal membrane protein PEX1...    120   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_009363026.1|  PREDICTED: peroxisomal membrane protein PEX1...    120   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_010027775.1|  PREDICTED: peroxisomal membrane protein PEX1...    120   2e-27   
ref|XP_010027759.1|  PREDICTED: peroxisomal membrane protein PEX1...    120   2e-27   Eucalyptus grandis [rose gum]
ref|XP_010027743.1|  PREDICTED: peroxisomal membrane protein PEX1...    120   2e-27   Eucalyptus grandis [rose gum]
ref|XP_010027734.1|  PREDICTED: peroxisomal membrane protein PEX1...    120   2e-27   
gb|EYU42567.1|  hypothetical protein MIMGU_mgv1a004473mg                120   2e-27   Erythranthe guttata [common monkey flower]
ref|XP_010027726.1|  PREDICTED: peroxisomal membrane protein PEX1...    120   3e-27   Eucalyptus grandis [rose gum]
ref|XP_010027751.1|  PREDICTED: peroxisomal membrane protein PEX1...    120   3e-27   
ref|XP_010027767.1|  PREDICTED: peroxisomal membrane protein PEX1...    120   3e-27   
ref|XP_010027717.1|  PREDICTED: peroxisomal membrane protein PEX1...    120   3e-27   Eucalyptus grandis [rose gum]
gb|KCW83383.1|  hypothetical protein EUGRSUZ_B00317                     120   3e-27   Eucalyptus grandis [rose gum]
ref|XP_011001542.1|  PREDICTED: peroxisomal membrane protein PEX1...    119   6e-27   Populus euphratica
ref|XP_006374519.1|  hypothetical protein POPTR_0015s08730g             116   3e-26   
ref|XP_006374518.1|  hypothetical protein POPTR_0015s08730g             116   5e-26   Populus trichocarpa [western balsam poplar]
ref|XP_002321598.2|  hypothetical protein POPTR_0015s08730g             116   6e-26   Populus trichocarpa [western balsam poplar]
ref|XP_007155427.1|  hypothetical protein PHAVU_003G200200g             115   2e-25   Phaseolus vulgaris [French bean]
ref|XP_008393032.1|  PREDICTED: peroxisomal membrane protein PEX1...    112   1e-24   
ref|XP_010243117.1|  PREDICTED: peroxisomal membrane protein PEX1...    112   2e-24   Nelumbo nucifera [Indian lotus]
ref|XP_011028566.1|  PREDICTED: peroxisomal membrane protein PEX1...    111   2e-24   Populus euphratica
ref|XP_011028564.1|  PREDICTED: peroxisomal membrane protein PEX1...    111   4e-24   Populus euphratica
ref|XP_011028565.1|  PREDICTED: peroxisomal membrane protein PEX1...    111   5e-24   Populus euphratica
ref|XP_006345195.1|  PREDICTED: peroxisomal membrane protein PEX1...    108   4e-23   
ref|XP_004508866.1|  PREDICTED: peroxisomal membrane protein PEX1...    108   5e-23   Cicer arietinum [garbanzo]
gb|AES91161.2|  peroxisomal membrane PEX14-like protein, putative       108   5e-23   Medicago truncatula
ref|XP_003608964.1|  Peroxisomal membrane protein PEX14                 108   5e-23   
ref|XP_008374437.1|  PREDICTED: peroxisomal membrane protein PEX1...    103   2e-21   Malus domestica [apple tree]
ref|XP_008374436.1|  PREDICTED: peroxisomal membrane protein PEX1...    103   2e-21   Malus domestica [apple tree]
gb|KJB53151.1|  hypothetical protein B456_008G295200                    100   1e-20   Gossypium raimondii
gb|KJB53147.1|  hypothetical protein B456_008G295200                    100   3e-20   Gossypium raimondii
gb|KJB53150.1|  hypothetical protein B456_008G295200                    100   4e-20   Gossypium raimondii
gb|KJB53148.1|  hypothetical protein B456_008G295200                  99.4    5e-20   Gossypium raimondii
gb|KHG28313.1|  Peroxisomal membrane PEX14 -like protein              99.8    5e-20   Gossypium arboreum [tree cotton]
ref|XP_007155425.1|  hypothetical protein PHAVU_003G200200g           99.0    8e-20   Phaseolus vulgaris [French bean]
ref|XP_004138109.1|  PREDICTED: peroxisomal membrane protein PEX14    89.0    2e-16   Cucumis sativus [cucumbers]
gb|KJB53149.1|  hypothetical protein B456_008G295200                  88.6    2e-16   Gossypium raimondii
ref|XP_007155424.1|  hypothetical protein PHAVU_003G200200g           88.6    3e-16   Phaseolus vulgaris [French bean]
ref|XP_008464562.1|  PREDICTED: peroxisomal membrane protein PEX1...  87.4    7e-16   
ref|XP_008464561.1|  PREDICTED: peroxisomal membrane protein PEX1...  87.4    8e-16   Cucumis melo [Oriental melon]
ref|XP_010678761.1|  PREDICTED: peroxisomal membrane protein PEX1...  86.3    2e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010678760.1|  PREDICTED: peroxisomal membrane protein PEX1...  86.3    2e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|KHN19307.1|  Peroxisomal membrane protein PEX14                    83.2    2e-14   Glycine soja [wild soybean]
gb|ACU21367.1|  unknown                                               83.2    2e-14   Glycine max [soybeans]
ref|XP_010546025.1|  PREDICTED: peroxisomal membrane protein PEX14    83.2    2e-14   Tarenaya hassleriana [spider flower]
ref|XP_006439814.1|  hypothetical protein CICLE_v10024320mg           82.4    2e-14   
gb|KHN18459.1|  Peroxisomal membrane protein PEX14                    82.8    2e-14   Glycine soja [wild soybean]
ref|XP_006600647.1|  PREDICTED: peroxisomal membrane protein PEX1...  82.8    3e-14   Glycine max [soybeans]
ref|XP_008806902.1|  PREDICTED: peroxisomal membrane protein PEX1...  70.5    3e-10   Phoenix dactylifera
ref|XP_006600648.1|  PREDICTED: peroxisomal membrane protein PEX1...  70.1    4e-10   Glycine max [soybeans]
gb|KHN34311.1|  Peroxisomal membrane protein PEX14                    67.0    4e-09   Glycine soja [wild soybean]
ref|XP_006579567.1|  PREDICTED: peroxisomal membrane protein PEX1...  67.0    4e-09   
ref|XP_008464563.1|  PREDICTED: peroxisomal membrane protein PEX1...  65.1    2e-08   Cucumis melo [Oriental melon]
ref|XP_007044650.1|  Peroxin 14-like protein isoform 1                64.7    2e-08   
ref|XP_010924260.1|  PREDICTED: peroxisomal membrane protein PEX1...  62.8    1e-07   Elaeis guineensis
emb|CDY00328.1|  BnaA06g22290D                                        62.8    1e-07   
ref|XP_009151402.1|  PREDICTED: peroxisomal membrane protein PEX14    62.4    1e-07   Brassica rapa
emb|CDX78267.1|  BnaA09g34620D                                        60.5    5e-07   
emb|CDY56742.1|  BnaC09g50920D                                        60.5    5e-07   Brassica napus [oilseed rape]
emb|CDY16758.1|  BnaA09g06240D                                        60.5    7e-07   Brassica napus [oilseed rape]
ref|XP_009112035.1|  PREDICTED: peroxisomal membrane protein PEX1...  60.5    7e-07   Brassica rapa
ref|XP_009395025.1|  PREDICTED: peroxisomal membrane protein PEX1...  60.1    9e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009112034.1|  PREDICTED: peroxisomal membrane protein PEX1...  59.7    1e-06   Brassica rapa
ref|XP_006394350.1|  hypothetical protein EUTSA_v10004017mg           59.7    1e-06   Eutrema salsugineum [saltwater cress]
ref|XP_006394349.1|  hypothetical protein EUTSA_v10004017mg           59.7    1e-06   Eutrema salsugineum [saltwater cress]
gb|EPS72063.1|  hypothetical protein M569_02693                       59.7    1e-06   Genlisea aurea
gb|EYU17665.1|  hypothetical protein MIMGU_mgv1a006851mg              59.3    1e-06   Erythranthe guttata [common monkey flower]
gb|KFK28009.1|  hypothetical protein AALP_AA8G459800                  59.3    2e-06   Arabis alpina [alpine rockcress]
emb|CDX84355.1|  BnaC03g51450D                                        57.8    5e-06   
ref|XP_010444137.1|  PREDICTED: peroxisomal membrane protein PEX1...  56.2    2e-05   Camelina sativa [gold-of-pleasure]
gb|KHG09973.1|  Peroxisomal membrane PEX14 -like protein              55.1    3e-05   Gossypium arboreum [tree cotton]
ref|XP_006280321.1|  hypothetical protein CARUB_v10026243mg           55.1    4e-05   Capsella rubella
ref|XP_006655625.1|  PREDICTED: uncharacterized protein LOC102718840  53.5    9e-05   
gb|AAM65879.1|  unknown                                               52.4    1e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010459346.1|  PREDICTED: peroxisomal membrane protein PEX14    53.1    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_002864820.1|  hypothetical protein ARALYDRAFT_496464           53.1    2e-04   
ref|XP_010550656.1|  PREDICTED: peroxisomal membrane protein PEX1...  53.1    2e-04   Tarenaya hassleriana [spider flower]
ref|XP_010483994.1|  PREDICTED: peroxisomal membrane protein PEX1...  52.8    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010550658.1|  PREDICTED: peroxisomal membrane protein PEX1...  52.4    2e-04   Tarenaya hassleriana [spider flower]
ref|NP_001132489.1|  uncharacterized protein LOC100193948             50.4    3e-04   Zea mays [maize]
gb|AFW79301.1|  hypothetical protein ZEAMMB73_066847                  50.1    3e-04   
emb|CAC14740.1|  peroxin Pex14                                        52.0    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001152579.1|  peroxin Pex14                                    50.1    4e-04   
ref|XP_004961124.1|  PREDICTED: peroxisomal membrane protein PEX1...  51.6    4e-04   
ref|XP_004961125.1|  PREDICTED: peroxisomal membrane protein PEX1...  51.6    4e-04   
ref|NP_201087.3|  peroxin 14                                          52.0    4e-04   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB17667.1|  PEX14                                                52.0    4e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008351828.1|  PREDICTED: uncharacterized protein LOC103415263  51.6    4e-04   
ref|XP_008647421.1|  PREDICTED: uncharacterized protein LOC100193...  50.8    5e-04   Zea mays [maize]
ref|XP_002440305.1|  hypothetical protein SORBIDRAFT_09g029470        51.2    5e-04   Sorghum bicolor [broomcorn]
ref|XP_004961126.1|  PREDICTED: peroxisomal membrane protein PEX1...  50.8    5e-04   
ref|XP_008647420.1|  PREDICTED: uncharacterized protein LOC100193...  50.8    5e-04   Zea mays [maize]
ref|XP_008647419.1|  PREDICTED: uncharacterized protein LOC100193...  50.8    5e-04   
ref|XP_004961123.1|  PREDICTED: peroxisomal membrane protein PEX1...  51.2    6e-04   
gb|AAM20492.1|  putative protein                                      51.2    6e-04   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003565861.2|  PREDICTED: peroxisomal membrane protein PEX1...  50.4    6e-04   Brachypodium distachyon [annual false brome]
ref|XP_010230993.1|  PREDICTED: peroxisomal membrane protein PEX1...  50.4    6e-04   Brachypodium distachyon [annual false brome]



>ref|XP_009627985.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X1 [Nicotiana 
tomentosiformis]
Length=530

 Score =   189 bits (481),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 152/232 (66%), Positives = 179/232 (77%), Gaps = 10/232 (4%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrsss--pptsveppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q YANG +D DARSVRS S          PHPKSYM+IM M+QRGE+P N+RDINDQP
Sbjct  294  SRQSYANGELDVDARSVRSLSPPASVEPSVAPHPKSYMDIMAMIQRGEKPSNIRDINDQP  353

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWW  514
            PNPN P+PEP V PKPKPWE+GQ+QNSS N +QSQGSGD   +G+Q NN  NG SS PWW
Sbjct  354  PNPNHPVPEPRVGPKPKPWEIGQSQNSSGNLLQSQGSGDGLNYGYQ-NNPMNGDSSMPWW  412

Query  513  QRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSL  334
            QRKNARITEIE+ +EQ+FG  +  P   RP  RSWVPPQPPPVAMAEAAAAIRQPKK+  
Sbjct  413  QRKNARITEIEAVNEQRFGS-TAPPAEVRPVQRSWVPPQPPPVAMAEAAAAIRQPKKTLF  471

Query  333  PKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG------VTQTPLAN  196
             K++LTDD+L+ RS+EISDDL+RITKISESGGF E NG      +++ P+ N
Sbjct  472  QKEKLTDDELMARSTEISDDLQRITKISESGGFAEVNGSSSAQQLSEAPITN  523



>ref|XP_009800698.1| PREDICTED: peroxisomal membrane protein PEX14-like [Nicotiana 
sylvestris]
Length=521

 Score =   189 bits (480),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 152/232 (66%), Positives = 179/232 (77%), Gaps = 10/232 (4%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrsss--pptsveppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q YANG +D DA SVRS S          PHPKSYM+IM M+QRGE+P N+RDIND+P
Sbjct  285  SRQSYANGELDVDAHSVRSLSPPASVEPSVAPHPKSYMDIMAMIQRGEKPSNIRDINDEP  344

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWW  514
            PNPN P+PEP V PKPKPWE+GQ+QNSS N +QSQGSGD S +G+Q NN  NG SSTPWW
Sbjct  345  PNPNPPVPEPRVGPKPKPWEIGQSQNSSRNLLQSQGSGDGSNYGYQ-NNPMNGDSSTPWW  403

Query  513  QRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSL  334
            QRKNARITEIE+ +EQKFG  + + T  RP  RSWVPPQPPPV MAEAAAAIRQPKK+  
Sbjct  404  QRKNARITEIEAVNEQKFGSTAPL-TEVRPVQRSWVPPQPPPVVMAEAAAAIRQPKKTLF  462

Query  333  PKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG------VTQTPLAN  196
             K++LTDD+L+ RSSEISDDL+RITKISESGG  E NG      +++ P+ N
Sbjct  463  QKEKLTDDELMARSSEISDDLQRITKISESGGLTEVNGSSSAQQLSEAPITN  514



>ref|XP_009795002.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X1 
[Nicotiana sylvestris]
Length=523

 Score =   181 bits (458),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 153/230 (67%), Positives = 178/230 (77%), Gaps = 10/230 (4%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrsss--pptsveppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q Y NG VD DARSVRS S          PHPKSYMEIM MVQRGE+P N+RDINDQP
Sbjct  287  SRQSYLNGKVDGDARSVRSLSPPASVEPSVAPHPKSYMEIMAMVQRGEKPSNIRDINDQP  346

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWW  514
            PNPNQP+P+P VAPKPKPWEVGQ Q++S+N +QSQGSGD   +G+QD N  NG SS  WW
Sbjct  347  PNPNQPVPDPRVAPKPKPWEVGQIQSNSTNLLQSQGSGDGLNYGYQD-NLTNGDSSAAWW  405

Query  513  QRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSL  334
            QR+NARITEIE+E EQ FG P+  P  ERP  RSWVPPQPPPVAMAEAAAAIRQPKK   
Sbjct  406  QRRNARITEIETEGEQNFGSPTA-PVQERPIQRSWVPPQPPPVAMAEAAAAIRQPKKPVF  464

Query  333  PKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG------VTQTPL  202
              +QLTDDQL+ RSSEI+D+L+R+T+ISESGG  EANG      +++TP+
Sbjct  465  QNEQLTDDQLMARSSEITDELQRVTRISESGGAPEANGSSSALQISETPI  514



>ref|XP_009795004.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X3 
[Nicotiana sylvestris]
Length=521

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 153/230 (67%), Positives = 178/230 (77%), Gaps = 10/230 (4%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrsss--pptsveppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q Y NG VD DARSVRS S          PHPKSYMEIM MVQRGE+P N+RDINDQP
Sbjct  285  SRQSYLNGKVDGDARSVRSLSPPASVEPSVAPHPKSYMEIMAMVQRGEKPSNIRDINDQP  344

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWW  514
            PNPNQP+P+P VAPKPKPWEVGQ Q++S+N +QSQGSGD   +G+QD N  NG SS  WW
Sbjct  345  PNPNQPVPDPRVAPKPKPWEVGQIQSNSTNLLQSQGSGDGLNYGYQD-NLTNGDSSAAWW  403

Query  513  QRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSL  334
            QR+NARITEIE+E EQ FG P+  P  ERP  RSWVPPQPPPVAMAEAAAAIRQPKK   
Sbjct  404  QRRNARITEIETEGEQNFGSPTA-PVQERPIQRSWVPPQPPPVAMAEAAAAIRQPKKPVF  462

Query  333  PKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG------VTQTPL  202
              +QLTDDQL+ RSSEI+D+L+R+T+ISESGG  EANG      +++TP+
Sbjct  463  QNEQLTDDQLMARSSEITDELQRVTRISESGGAPEANGSSSALQISETPI  512



>ref|XP_009629523.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X3 
[Nicotiana tomentosiformis]
Length=521

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 171/218 (78%), Gaps = 4/218 (2%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrsss--pptsveppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q Y NG VD DARSVRS S          PHPKSYMEIM MVQRGE+P N+RDINDQP
Sbjct  286  SRQSYLNGKVDGDARSVRSLSPPASVEPSVAPHPKSYMEIMAMVQRGEKPSNIRDINDQP  345

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWW  514
            PNPNQP+P+P V PKPKPWEVGQ Q++S+N +QSQGSGD   +G+QD N  NG SS  WW
Sbjct  346  PNPNQPVPDPRVVPKPKPWEVGQIQSNSTNLLQSQGSGDGLNYGYQD-NLTNGDSSASWW  404

Query  513  QRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSL  334
            QRKNARITEIE+E EQ FG P+  P  ERP  RSWVPPQPPPVAMAEAAAAIRQPKK   
Sbjct  405  QRKNARITEIETEGEQNFGSPAA-PVQERPIQRSWVPPQPPPVAMAEAAAAIRQPKKPMF  463

Query  333  PKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
              +QLTDDQL+ RSSEI+D+L+R+T+ISESGG  EANG
Sbjct  464  QNEQLTDDQLMARSSEITDELQRVTRISESGGAPEANG  501



>ref|XP_009629521.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X1 
[Nicotiana tomentosiformis]
Length=523

 Score =   179 bits (454),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 171/218 (78%), Gaps = 4/218 (2%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrsss--pptsveppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q Y NG VD DARSVRS S          PHPKSYMEIM MVQRGE+P N+RDINDQP
Sbjct  288  SRQSYLNGKVDGDARSVRSLSPPASVEPSVAPHPKSYMEIMAMVQRGEKPSNIRDINDQP  347

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWW  514
            PNPNQP+P+P V PKPKPWEVGQ Q++S+N +QSQGSGD   +G+QD N  NG SS  WW
Sbjct  348  PNPNQPVPDPRVVPKPKPWEVGQIQSNSTNLLQSQGSGDGLNYGYQD-NLTNGDSSASWW  406

Query  513  QRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSL  334
            QRKNARITEIE+E EQ FG P+  P  ERP  RSWVPPQPPPVAMAEAAAAIRQPKK   
Sbjct  407  QRKNARITEIETEGEQNFGSPAA-PVQERPIQRSWVPPQPPPVAMAEAAAAIRQPKKPMF  465

Query  333  PKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
              +QLTDDQL+ RSSEI+D+L+R+T+ISESGG  EANG
Sbjct  466  QNEQLTDDQLMARSSEITDELQRVTRISESGGAPEANG  503



>ref|XP_009795003.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X2 
[Nicotiana sylvestris]
Length=522

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 151/226 (67%), Positives = 175/226 (77%), Gaps = 10/226 (4%)
 Frame = -3

Query  855  YANGXVDTDARsvrsss--pptsveppphpkSYMEIMEMVQRGERPPNMRdindqppnpn  682
            Y NG VD DARSVRS S          PHPKSYMEIM MVQRGE+P N+RDINDQPPNPN
Sbjct  290  YLNGKVDGDARSVRSLSPPASVEPSVAPHPKSYMEIMAMVQRGEKPSNIRDINDQPPNPN  349

Query  681  qpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWWQRKN  502
            QP+P+P VAPKPKPWEVGQ Q++S+N +QSQGSGD   +G+QD N  NG SS  WWQR+N
Sbjct  350  QPVPDPRVAPKPKPWEVGQIQSNSTNLLQSQGSGDGLNYGYQD-NLTNGDSSAAWWQRRN  408

Query  501  ARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSLPKDQ  322
            ARITEIE+E EQ FG P+  P  ERP  RSWVPPQPPPVAMAEAAAAIRQPKK     +Q
Sbjct  409  ARITEIETEGEQNFGSPTA-PVQERPIQRSWVPPQPPPVAMAEAAAAIRQPKKPVFQNEQ  467

Query  321  LTDDQLLGRSSEISDDLERITKISESGGFGEANG------VTQTPL  202
            LTDDQL+ RSSEI+D+L+R+T+ISESGG  EANG      +++TP+
Sbjct  468  LTDDQLMARSSEITDELQRVTRISESGGAPEANGSSSALQISETPI  513



>ref|XP_009629522.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X2 
[Nicotiana tomentosiformis]
Length=522

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 149/216 (69%), Positives = 169/216 (78%), Gaps = 4/216 (2%)
 Frame = -3

Query  861  QXYANGXVDTDARsvrsss--pptsveppphpkSYMEIMEMVQRGERPPNMRdindqppn  688
            + Y NG VD DARSVRS S          PHPKSYMEIM MVQRGE+P N+RDINDQPPN
Sbjct  289  RSYLNGKVDGDARSVRSLSPPASVEPSVAPHPKSYMEIMAMVQRGEKPSNIRDINDQPPN  348

Query  687  pnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWWQR  508
            PNQP+P+P V PKPKPWEVGQ Q++S+N +QSQGSGD   +G+QD N  NG SS  WWQR
Sbjct  349  PNQPVPDPRVVPKPKPWEVGQIQSNSTNLLQSQGSGDGLNYGYQD-NLTNGDSSASWWQR  407

Query  507  KNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSLPK  328
            KNARITEIE+E EQ FG P+  P  ERP  RSWVPPQPPPVAMAEAAAAIRQPKK     
Sbjct  408  KNARITEIETEGEQNFGSPAA-PVQERPIQRSWVPPQPPPVAMAEAAAAIRQPKKPMFQN  466

Query  327  DQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
            +QLTDDQL+ RSSEI+D+L+R+T+ISESGG  EANG
Sbjct  467  EQLTDDQLMARSSEITDELQRVTRISESGGAPEANG  502



>ref|XP_004241494.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X2 
[Solanum lycopersicum]
Length=525

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 172/218 (79%), Gaps = 9/218 (4%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrsss--pptsveppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q YANG V+ DA SVRS S          PHPKSYMEIM MVQRGE+PPN+RDINDQP
Sbjct  293  SRQSYANGKVNGDAHSVRSLSPPASVEPSAAPHPKSYMEIMAMVQRGEKPPNIRDINDQP  352

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWW  514
            PNPNQP+P+  VA KPKPWEVGQ+QN+S NF+QSQGSGD   +G+QDN   NG +S PWW
Sbjct  353  PNPNQPVPD-RVAAKPKPWEVGQSQNNS-NFLQSQGSGDGLNYGYQDN-LTNGDNSAPWW  409

Query  513  QRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSL  334
            QRKNARITEIE+E EQ FG P+  P  ERP  RSWVPPQPPPVAMAEAAAAIRQPKKS+ 
Sbjct  410  QRKNARITEIEAEGEQNFGSPAA-PVQERPIQRSWVPPQPPPVAMAEAAAAIRQPKKSAS  468

Query  333  PKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
              +QLTDDQLL RS   SD+L+R+T+ISESGG  EANG
Sbjct  469  QNEQLTDDQLLARS---SDELQRVTRISESGGAPEANG  503



>ref|XP_010322553.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X1 
[Solanum lycopersicum]
Length=527

 Score =   171 bits (432),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 152/218 (70%), Positives = 172/218 (79%), Gaps = 9/218 (4%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrsss--pptsveppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q YANG V+ DA SVRS S          PHPKSYMEIM MVQRGE+PPN+RDINDQP
Sbjct  295  SRQSYANGKVNGDAHSVRSLSPPASVEPSAAPHPKSYMEIMAMVQRGEKPPNIRDINDQP  354

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWW  514
            PNPNQP+P+  VA KPKPWEVGQ+QN+S NF+QSQGSGD   +G+QDN   NG +S PWW
Sbjct  355  PNPNQPVPD-RVAAKPKPWEVGQSQNNS-NFLQSQGSGDGLNYGYQDN-LTNGDNSAPWW  411

Query  513  QRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSL  334
            QRKNARITEIE+E EQ FG P+  P  ERP  RSWVPPQPPPVAMAEAAAAIRQPKKS+ 
Sbjct  412  QRKNARITEIEAEGEQNFGSPAA-PVQERPIQRSWVPPQPPPVAMAEAAAAIRQPKKSAS  470

Query  333  PKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
              +QLTDDQLL RS   SD+L+R+T+ISESGG  EANG
Sbjct  471  QNEQLTDDQLLARS---SDELQRVTRISESGGAPEANG  505



>ref|XP_006347457.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X2 
[Solanum tuberosum]
Length=525

 Score =   167 bits (423),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 170/218 (78%), Gaps = 9/218 (4%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrsss--pptsveppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q YANG  + DA SVRS S          PHPKSYMEIM MVQRGE+P N+RDINDQP
Sbjct  293  SRQSYANGKANGDAHSVRSLSPPASVEPSAAPHPKSYMEIMAMVQRGEKPSNIRDINDQP  352

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWW  514
            PNPNQP+P+  VA KPKPWEVGQ+QN+S NF+QSQGSGD   +G+QDN   NG SS PWW
Sbjct  353  PNPNQPVPD-RVAAKPKPWEVGQSQNNS-NFLQSQGSGDGLNYGYQDN-LTNGDSSAPWW  409

Query  513  QRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSL  334
            QRKNARITEIE+E EQ FG P+  P  ERP  RSWVPPQPPPVAMAEAAAAIRQPKKS+ 
Sbjct  410  QRKNARITEIETEAEQNFGSPAA-PVQERPIQRSWVPPQPPPVAMAEAAAAIRQPKKSAS  468

Query  333  PKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
              +QLTDDQLL RS   SD+L+R+T+ISESGG  EANG
Sbjct  469  QNEQLTDDQLLARS---SDELQRVTRISESGGTPEANG  503



>ref|XP_006347456.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X1 
[Solanum tuberosum]
Length=527

 Score =   167 bits (423),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 151/218 (69%), Positives = 170/218 (78%), Gaps = 9/218 (4%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrsss--pptsveppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q YANG  + DA SVRS S          PHPKSYMEIM MVQRGE+P N+RDINDQP
Sbjct  295  SRQSYANGKANGDAHSVRSLSPPASVEPSAAPHPKSYMEIMAMVQRGEKPSNIRDINDQP  354

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWW  514
            PNPNQP+P+  VA KPKPWEVGQ+QN+S NF+QSQGSGD   +G+QDN   NG SS PWW
Sbjct  355  PNPNQPVPD-RVAAKPKPWEVGQSQNNS-NFLQSQGSGDGLNYGYQDN-LTNGDSSAPWW  411

Query  513  QRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSL  334
            QRKNARITEIE+E EQ FG P+  P  ERP  RSWVPPQPPPVAMAEAAAAIRQPKKS+ 
Sbjct  412  QRKNARITEIETEAEQNFGSPAA-PVQERPIQRSWVPPQPPPVAMAEAAAAIRQPKKSAS  470

Query  333  PKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
              +QLTDDQLL RS   SD+L+R+T+ISESGG  EANG
Sbjct  471  QNEQLTDDQLLARS---SDELQRVTRISESGGTPEANG  505



>ref|XP_011071849.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X2 
[Sesamum indicum]
Length=516

 Score =   159 bits (401),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 167/218 (77%), Gaps = 4/218 (2%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsveppp--hpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q Y NG  DTD+ SVRS SPP+S EP    HPKSYMEIM M+QRGE+P N+R+IND P
Sbjct  280  SRQPYVNGKADTDSHSVRSLSPPSSAEPSVPPHPKSYMEIMAMIQRGEKPSNIREINDAP  339

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWW  514
            PNPNQP+  P +AP+PKPWEVGQ Q+SS N   +Q S ++S + + D NQ NG  + PWW
Sbjct  340  PNPNQPVSNPRLAPRPKPWEVGQAQSSSVNAYPTQESSNSSAYEYPD-NQLNGDDAAPWW  398

Query  513  QRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSL  334
            QRKN RITEIE+ +EQK G  S V TNE+P  RSWVPPQPPPV M EAAAAIRQPKK+S 
Sbjct  399  QRKNVRITEIEAGEEQKRGS-SNVLTNEQPARRSWVPPQPPPVVMPEAAAAIRQPKKASY  457

Query  333  PKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
              +QLTDDQLL R+++ +D+L+RITK SESGG  EANG
Sbjct  458  QTEQLTDDQLLARAADGTDELQRITKFSESGGALEANG  495



>ref|XP_011071848.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X1 
[Sesamum indicum]
Length=530

 Score =   158 bits (400),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 167/218 (77%), Gaps = 4/218 (2%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsveppp--hpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q Y NG  DTD+ SVRS SPP+S EP    HPKSYMEIM M+QRGE+P N+R+IND P
Sbjct  294  SRQPYVNGKADTDSHSVRSLSPPSSAEPSVPPHPKSYMEIMAMIQRGEKPSNIREINDAP  353

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWW  514
            PNPNQP+  P +AP+PKPWEVGQ Q+SS N   +Q S ++S + + D NQ NG  + PWW
Sbjct  354  PNPNQPVSNPRLAPRPKPWEVGQAQSSSVNAYPTQESSNSSAYEYPD-NQLNGDDAAPWW  412

Query  513  QRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSL  334
            QRKN RITEIE+ +EQK G  S V TNE+P  RSWVPPQPPPV M EAAAAIRQPKK+S 
Sbjct  413  QRKNVRITEIEAGEEQKRGS-SNVLTNEQPARRSWVPPQPPPVVMPEAAAAIRQPKKASY  471

Query  333  PKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
              +QLTDDQLL R+++ +D+L+RITK SESGG  EANG
Sbjct  472  QTEQLTDDQLLARAADGTDELQRITKFSESGGALEANG  509



>ref|XP_009627986.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X2 [Nicotiana 
tomentosiformis]
Length=492

 Score =   153 bits (386),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 123/234 (53%), Positives = 145/234 (62%), Gaps = 52/234 (22%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqppn  688
            S+Q YANG +D DARSV                          R   PP           
Sbjct  294  SRQSYANGELDVDARSV--------------------------RSLSPP-----------  316

Query  687  pnqpiPEPLVAPKPK----PWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTP  520
                  EP VAP PK    PWE+GQ+QNSS N +QSQGSGD   +G+Q NN  NG SS P
Sbjct  317  ---ASVEPSVAPHPKSYMDPWEIGQSQNSSGNLLQSQGSGDGLNYGYQ-NNPMNGDSSMP  372

Query  519  WWQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKS  340
            WWQRKNARITEIE+ +EQ+FG  +  P   RP  RSWVPPQPPPVAMAEAAAAIRQPKK+
Sbjct  373  WWQRKNARITEIEAVNEQRFGS-TAPPAEVRPVQRSWVPPQPPPVAMAEAAAAIRQPKKT  431

Query  339  SLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG------VTQTPLAN  196
               K++LTDD+L+ RS+EISDDL+RITKISESGGF E NG      +++ P+ N
Sbjct  432  LFQKEKLTDDELMARSTEISDDLQRITKISESGGFAEVNGSSSAQQLSEAPITN  485



>ref|XP_012080068.1| PREDICTED: peroxisomal membrane protein PEX14 [Jatropha curcas]
 gb|KDP31101.1| hypothetical protein JCGZ_11477 [Jatropha curcas]
Length=537

 Score =   148 bits (373),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 120/220 (55%), Positives = 146/220 (66%), Gaps = 7/220 (3%)
 Frame = -3

Query  864  QQXYANGXVDTDARsvrsss--pptsveppphpkSYMEIMEMVQRGERPPNMRdindqpp  691
            +Q Y NG  D+D RSVRSSS          PHPKSYMEIM MVQRGERPPN+RDINDQPP
Sbjct  299  KQTYVNGKADSDLRSVRSSSPPTSAEPSVAPHPKSYMEIMAMVQRGERPPNIRDINDQPP  358

Query  690  npnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNN---QFNGSSSTP  520
            NPNQ I  P +AP+ KPWEVGQ+Q + S  +Q Q +G+      Q+N    QF+G ++TP
Sbjct  359  NPNQQISNPRLAPRNKPWEVGQSQTNLSQVLQPQVNGEGLNTKIQENGVTYQFDGENTTP  418

Query  519  WWQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKS  340
            WWQRKNARITEIE+EDE K  GP    TNE+ P +    P  PP      AA   +  K 
Sbjct  419  WWQRKNARITEIENEDELK-TGPYSARTNEQ-PIQRAWVPPQPPPVAMPEAAEAIRRPKP  476

Query  339  SLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
            S+ K+QL DDQ +  S++ +D+L+RITKISESGG  E NG
Sbjct  477  SVQKEQLADDQPVSHSTDATDELQRITKISESGGAVEING  516



>gb|KDO69670.1| hypothetical protein CISIN_1g009434mg [Citrus sinensis]
Length=381

 Score =   137 bits (345),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 155/220 (70%), Gaps = 8/220 (4%)
 Frame = -3

Query  864  QQXYANGXVDTDARsvrsssppt--sveppphpkSYMEIMEMVQRGERPPNMRdindqpp  691
            +Q YANG  D D +SVRSSSPP        PHPKSYMEIM MVQRGE+PPN+RDIND PP
Sbjct  147  KQPYANGKADFDMQSVRSSSPPAPGEPSVAPHPKSYMEIMAMVQRGEKPPNIRDINDLPP  206

Query  690  npnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQD---NNQFNGSSSTP  520
            NPNQ +P P +APK KPWEVGQ QN+S   IQSQ S +   F  QD   N+Q +  SS P
Sbjct  207  NPNQQLPNPRLAPKAKPWEVGQAQNASGQVIQSQVSAEGLNFKVQDNGLNHQSDDDSSVP  266

Query  519  WWQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKS  340
            WWQRKN +ITE+  EDE K  GP  V TNE P  R+WVPPQPPPV M EAA AIR+PK S
Sbjct  267  WWQRKNVKITEV-GEDEIK-AGPYSVRTNEPPVQRTWVPPQPPPVVMPEAAEAIRRPKPS  324

Query  339  SLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
              P +Q T  QL  ++SE++D+L+RITKISE+GG  E  G
Sbjct  325  G-PTEQSTSHQLASQTSEVTDELQRITKISEAGGIEEIKG  363



>gb|KDO69669.1| hypothetical protein CISIN_1g009434mg [Citrus sinensis]
Length=535

 Score =   138 bits (348),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 155/220 (70%), Gaps = 8/220 (4%)
 Frame = -3

Query  864  QQXYANGXVDTDARsvrsssppt--sveppphpkSYMEIMEMVQRGERPPNMRdindqpp  691
            +Q YANG  D D +SVRSSSPP        PHPKSYMEIM MVQRGE+PPN+RDIND PP
Sbjct  301  KQPYANGKADFDMQSVRSSSPPAPGEPSVAPHPKSYMEIMAMVQRGEKPPNIRDINDLPP  360

Query  690  npnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQD---NNQFNGSSSTP  520
            NPNQ +P P +APK KPWEVGQ QN+S   IQSQ S +   F  QD   N+Q +  SS P
Sbjct  361  NPNQQLPNPRLAPKAKPWEVGQAQNASGQVIQSQVSAEGLNFKVQDNGLNHQSDDDSSVP  420

Query  519  WWQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKS  340
            WWQRKN +ITE+  EDE K  GP  V TNE P  R+WVPPQPPPV M EAA AIR+PK S
Sbjct  421  WWQRKNVKITEV-GEDEIK-AGPYSVRTNEPPVQRTWVPPQPPPVVMPEAAEAIRRPKPS  478

Query  339  SLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
              P +Q T  QL  ++SE++D+L+RITKISE+GG  E  G
Sbjct  479  G-PTEQSTSHQLASQTSEVTDELQRITKISEAGGIEEIKG  517



>ref|XP_007036213.1| Peroxin 14, putative isoform 1 [Theobroma cacao]
 ref|XP_007036215.1| Peroxin 14, putative isoform 1 [Theobroma cacao]
 gb|EOY20714.1| Peroxin 14, putative isoform 1 [Theobroma cacao]
 gb|EOY20716.1| Peroxin 14, putative isoform 1 [Theobroma cacao]
Length=531

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 131/223 (59%), Positives = 154/223 (69%), Gaps = 12/223 (5%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqppn  688
            ++Q YANG VD D RSVRS+SPP S EPP     YMEIM MVQRGE+P N+R+IND PPN
Sbjct  294  TKQSYANGRVDADVRSVRSASPPASAEPPHPKS-YMEIMAMVQRGEKPSNIREINDMPPN  352

Query  687  pnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQ---FNGSSSTPW  517
            PNQ    P +AP+ KPWE    QN SS  +QSQGSG+      QDN      +  SSTPW
Sbjct  353  PNQQPSNPRIAPRTKPWE---AQNGSSQVLQSQGSGEGLIQKVQDNGLNYLVDDESSTPW  409

Query  516  WQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSS  337
            WQRKN RITE+E+EDE K  GP GV TNE P  R+WVPPQPPPVAM EAA AIR+PK S+
Sbjct  410  WQRKNVRITEVENEDELK-AGPYGVKTNEPPVQRTWVPPQPPPVAMPEAAEAIRRPKSSA  468

Query  336  L----PKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
            L     +++L +DQ + R  E +D+L RITKISES G  E NG
Sbjct  469  LKEAAKQEELAEDQSVARPLEATDELNRITKISESAGAVEING  511



>gb|KDO69668.1| hypothetical protein CISIN_1g009434mg [Citrus sinensis]
Length=534

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 155/220 (70%), Gaps = 8/220 (4%)
 Frame = -3

Query  864  QQXYANGXVDTDARsvrsssppt--sveppphpkSYMEIMEMVQRGERPPNMRdindqpp  691
            +Q YANG  D D +SVRSSSPP        PHPKSYMEIM MVQRGE+PPN+RDIND PP
Sbjct  300  KQPYANGKADFDMQSVRSSSPPAPGEPSVAPHPKSYMEIMAMVQRGEKPPNIRDINDLPP  359

Query  690  npnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQD---NNQFNGSSSTP  520
            NPNQ +P P +APK KPWEVGQ QN+S   IQSQ S +   F  QD   N+Q +  SS P
Sbjct  360  NPNQQLPNPRLAPKAKPWEVGQAQNASGQVIQSQVSAEGLNFKVQDNGLNHQSDDDSSVP  419

Query  519  WWQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKS  340
            WWQRKN +ITE+  EDE K  GP  V TNE P  R+WVPPQPPPV M EAA AIR+PK S
Sbjct  420  WWQRKNVKITEV-GEDEIK-AGPYSVRTNEPPVQRTWVPPQPPPVVMPEAAEAIRRPKPS  477

Query  339  SLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
              P +Q T  QL  ++SE++D+L+RITKISE+GG  E  G
Sbjct  478  G-PTEQSTSHQLASQTSEVTDELQRITKISEAGGIEEIKG  516



>gb|KDO69667.1| hypothetical protein CISIN_1g009434mg [Citrus sinensis]
Length=532

 Score =   138 bits (347),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 155/220 (70%), Gaps = 8/220 (4%)
 Frame = -3

Query  864  QQXYANGXVDTDARsvrsssppt--sveppphpkSYMEIMEMVQRGERPPNMRdindqpp  691
            +Q YANG  D D +SVRSSSPP        PHPKSYMEIM MVQRGE+PPN+RDIND PP
Sbjct  298  KQPYANGKADFDMQSVRSSSPPAPGEPSVAPHPKSYMEIMAMVQRGEKPPNIRDINDLPP  357

Query  690  npnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQD---NNQFNGSSSTP  520
            NPNQ +P P +APK KPWEVGQ QN+S   IQSQ S +   F  QD   N+Q +  SS P
Sbjct  358  NPNQQLPNPRLAPKAKPWEVGQAQNASGQVIQSQVSAEGLNFKVQDNGLNHQSDDDSSVP  417

Query  519  WWQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKS  340
            WWQRKN +ITE+  EDE K  GP  V TNE P  R+WVPPQPPPV M EAA AIR+PK S
Sbjct  418  WWQRKNVKITEV-GEDEIK-AGPYSVRTNEPPVQRTWVPPQPPPVVMPEAAEAIRRPKPS  475

Query  339  SLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
              P +Q T  QL  ++SE++D+L+RITKISE+GG  E  G
Sbjct  476  G-PTEQSTSHQLASQTSEVTDELQRITKISEAGGIEEIKG  514



>ref|XP_006476775.1| PREDICTED: peroxisomal membrane protein PEX14-like [Citrus sinensis]
Length=534

 Score =   136 bits (343),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 154/220 (70%), Gaps = 8/220 (4%)
 Frame = -3

Query  864  QQXYANGXVDTDARsvrsssppt--sveppphpkSYMEIMEMVQRGERPPNMRdindqpp  691
            +Q YANG  D D +SVRSSSPP        PHPKSYMEIM MVQRGE+PPN+RDIND PP
Sbjct  300  KQPYANGKADFDMQSVRSSSPPAPGEPSVAPHPKSYMEIMAMVQRGEKPPNIRDINDLPP  359

Query  690  npnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQD---NNQFNGSSSTP  520
            NPNQ +P P +APK KPWEVGQ Q +S   IQSQ S +   F  QD   N+Q +  SS P
Sbjct  360  NPNQQLPNPRLAPKAKPWEVGQAQIASGQVIQSQVSAEGLNFKVQDNGLNHQSDDDSSVP  419

Query  519  WWQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKS  340
            WWQRKN +ITE+  EDE K  GP GV TNE P  R+WVPPQPPPV M EAA AIR+PK S
Sbjct  420  WWQRKNVKITEV-GEDEIK-AGPYGVRTNEPPVQRTWVPPQPPPVVMPEAAEAIRRPKPS  477

Query  339  SLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
              P +Q T  QL  ++SE++D+L+RITKISE GG  E  G
Sbjct  478  G-PTEQSTSHQLASQASEVADELQRITKISEVGGIEEIKG  516



>ref|XP_004298942.1| PREDICTED: peroxisomal membrane protein PEX14 [Fragaria vesca 
subsp. vesca]
Length=520

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 113/229 (49%), Positives = 143/229 (62%), Gaps = 9/229 (4%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsv--eppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q Y NG  + D  SV+S S P SV     PH KSYMEIM MVQRGE+PPN+R+I+D P
Sbjct  279  SKQQYVNGKAEYDMHSVQSFSAPASVEPSTAPHSKSYMEIMAMVQRGEKPPNVREIDDLP  338

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDN--NQFNGSSSTP  520
            PNPNQP   P +AP+ KPWE+GQTQN+SS   QSQ SG+A     QDN  N  NG SS P
Sbjct  339  PNPNQPPSNPRLAPRAKPWELGQTQNNSSQVYQSQTSGEAFSSSMQDNGLNYLNGDSSVP  398

Query  519  WWQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKS  340
            WWQRK   ITEIE+EDE K      V    R P +    P  PP      AA   +  K 
Sbjct  399  WWQRKTPSITEIENEDEIKAASSQVV----RQPVQRAWVPPQPPPVAMPEAAEAIRRPKP  454

Query  339  SLPKDQLTDDQLLGR-SSEISDDLERITKISESGGFGEANGVTQTPLAN  196
            S+ ++ L +DQL+   SS+++D+L+R+TKISESGG  + N  +   ++N
Sbjct  455  SVQRESLGNDQLVAHSSSDVTDELQRVTKISESGGALDMNNGSAAEISN  503



>ref|XP_011044302.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X2 
[Populus euphratica]
 ref|XP_011001541.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X2 
[Populus euphratica]
Length=534

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 138/184 (75%), Gaps = 4/184 (2%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIMEMV+RGERP N+RDINDQPPNP+Q I  P +AP+ KPWEVGQ QN+SS   QSQ 
Sbjct  329  YMEIMEMVRRGERPGNIRDINDQPPNPSQQISNPRIAPRTKPWEVGQVQNNSSQVPQSQV  388

Query  585  SGDASGFGFQDNN--QFNGSSSTPWWQRKNARITEIESEDEQKFGGPSGVPTNERppprs  412
            S +       DN   QF+G S+TPWWQRKNARI EI++EDE K  GP G   N++P  R+
Sbjct  389  SEEDLNSKVLDNGIYQFDGESTTPWWQRKNARIAEIDNEDEVK-AGPYGGQNNQQPVRRT  447

Query  411  wvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGFG  232
            WVPP+PPPV MAEAA AIR+PK+ S+ K+QL DD+ +   ++ +D+L+RITKISESGG  
Sbjct  448  WVPPRPPPVVMAEAAEAIRRPKQ-SIQKEQLEDDRSVSHPTDTADELQRITKISESGGAV  506

Query  231  EANG  220
            E NG
Sbjct  507  EING  510



>ref|XP_010101211.1| Peroxisomal membrane protein PEX14 [Morus notabilis]
 gb|EXB87885.1| Peroxisomal membrane protein PEX14 [Morus notabilis]
Length=541

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 113/220 (51%), Positives = 136/220 (62%), Gaps = 7/220 (3%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrsss--pptsveppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            S++ YANG  D D+RSVRS+S          PHPKSYMEIM MVQRGE+PPN+R+IND P
Sbjct  304  SKRPYANGKADYDSRSVRSASPPAAAEPSVAPHPKSYMEIMAMVQRGEKPPNVREINDSP  363

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNN---QFNGSSST  523
            PNPNQ +  P +AP+ KPWEVGQ QN SS   QSQ S +      QDN      NG SS 
Sbjct  364  PNPNQQLSNPRLAPRAKPWEVGQAQNYSSQVTQSQASSEGVYSNVQDNGINYSSNGDSSV  423

Query  522  PWWQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKK  343
            PWWQR+N RITEIE+EDE K G  S   T    P R    P  PP      AA   +  K
Sbjct  424  PWWQRRNPRITEIENEDEFKSGSYSTQTT--EVPVRRAWVPPQPPPVQMAEAAEAIRRPK  481

Query  342  SSLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEAN  223
             S+ K+   DDQL   S+ ++D+L+R+TK+SESGG  E N
Sbjct  482  PSVQKESSDDDQLEASSAGVTDELQRVTKVSESGGAVEIN  521



>ref|XP_011044300.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X1 
[Populus euphratica]
 ref|XP_011044301.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X1 
[Populus euphratica]
 ref|XP_011001539.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X1 
[Populus euphratica]
 ref|XP_011001540.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X1 
[Populus euphratica]
Length=535

 Score =   134 bits (337),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 112/184 (61%), Positives = 138/184 (75%), Gaps = 4/184 (2%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIMEMV+RGERP N+RDINDQPPNP+Q I  P +AP+ KPWEVGQ QN+SS   QSQ 
Sbjct  330  YMEIMEMVRRGERPGNIRDINDQPPNPSQQISNPRIAPRTKPWEVGQVQNNSSQVPQSQV  389

Query  585  SGDASGFGFQDNN--QFNGSSSTPWWQRKNARITEIESEDEQKFGGPSGVPTNERppprs  412
            S +       DN   QF+G S+TPWWQRKNARI EI++EDE K  GP G   N++P  R+
Sbjct  390  SEEDLNSKVLDNGIYQFDGESTTPWWQRKNARIAEIDNEDEVK-AGPYGGQNNQQPVRRT  448

Query  411  wvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGFG  232
            WVPP+PPPV MAEAA AIR+PK+ S+ K+QL DD+ +   ++ +D+L+RITKISESGG  
Sbjct  449  WVPPRPPPVVMAEAAEAIRRPKQ-SIQKEQLEDDRSVSHPTDTADELQRITKISESGGAV  507

Query  231  EANG  220
            E NG
Sbjct  508  EING  511



>emb|CDP12402.1| unnamed protein product [Coffea canephora]
Length=533

 Score =   133 bits (335),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 139/218 (64%), Positives = 162/218 (74%), Gaps = 7/218 (3%)
 Frame = -3

Query  867  SQQXYANGXVD--TDARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q Y+NG VD   D+    S SP       PHPKSYMEIM MVQRGERP N+R+INDQP
Sbjct  300  SRQPYSNGKVDNRIDSVISSSPSPSVEPSAAPHPKSYMEIMAMVQRGERPSNIREINDQP  359

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWW  514
            PNP+QP+P P + PKPKPWEVGQ+Q+SS +  Q Q S +    G Q   Q N   S PWW
Sbjct  360  PNPSQPVPNPRLVPKPKPWEVGQSQSSSGSGFQYQESSNGFTSGSQ-TIQLNADGSVPWW  418

Query  513  QRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSL  334
            Q+KNARITEIES+DEQ     S V  +E+P  RSWVPPQPPPVAMAEAAAAIRQPKK  L
Sbjct  419  QQKNARITEIESDDEQNIR--SSV-ASEKPVQRSWVPPQPPPVAMAEAAAAIRQPKKPLL  475

Query  333  PKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
             K+QLTDDQLLGR+SE++D+L+RITKISE+GG  EANG
Sbjct  476  QKEQLTDDQLLGRASEVTDELQRITKISEAGGL-EANG  512



>ref|XP_010243116.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X2 [Nelumbo 
nucifera]
Length=545

 Score =   133 bits (335),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 122/184 (66%), Gaps = 3/184 (2%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIM MVQRGE+PP +++IND PPNPNQP   P +AP+ KPWEVGQ QNSSS  +QSQ 
Sbjct  341  YMEIMAMVQRGEKPPGIKEINDLPPNPNQPPSNPRLAPRMKPWEVGQAQNSSSYTLQSQT  400

Query  585  SGDASGFGFQDN---NQFNGSSSTPWWQRKNARITEIESEDEQKFGGPSGVPTNERpppr  415
            SG+ S +  +DN   +Q NG SS PWWQRKN RI+EIE E++Q+      VP     P +
Sbjct  401  SGENSSYKVEDNGSASQLNGYSSEPWWQRKNVRISEIEDENDQRIASYGIVPVANERPVQ  460

Query  414  swvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGF  235
                P  PP      AAA  +  KS + K+Q ++DQ++ RSS+  D+L+RITK+SE GG 
Sbjct  461  RTWVPPQPPPVSMPEAAAAIRQPKSIIQKEQPSNDQVMERSSDEVDELQRITKLSELGGE  520

Query  234  GEAN  223
             + N
Sbjct  521  VDLN  524



>ref|XP_010243114.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010243115.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X1 [Nelumbo 
nucifera]
Length=549

 Score =   133 bits (335),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 94/184 (51%), Positives = 122/184 (66%), Gaps = 3/184 (2%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIM MVQRGE+PP +++IND PPNPNQP   P +AP+ KPWEVGQ QNSSS  +QSQ 
Sbjct  345  YMEIMAMVQRGEKPPGIKEINDLPPNPNQPPSNPRLAPRMKPWEVGQAQNSSSYTLQSQT  404

Query  585  SGDASGFGFQDN---NQFNGSSSTPWWQRKNARITEIESEDEQKFGGPSGVPTNERpppr  415
            SG+ S +  +DN   +Q NG SS PWWQRKN RI+EIE E++Q+      VP     P +
Sbjct  405  SGENSSYKVEDNGSASQLNGYSSEPWWQRKNVRISEIEDENDQRIASYGIVPVANERPVQ  464

Query  414  swvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGF  235
                P  PP      AAA  +  KS + K+Q ++DQ++ RSS+  D+L+RITK+SE GG 
Sbjct  465  RTWVPPQPPPVSMPEAAAAIRQPKSIIQKEQPSNDQVMERSSDEVDELQRITKLSELGGE  524

Query  234  GEAN  223
             + N
Sbjct  525  VDLN  528



>ref|XP_011101330.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X2 
[Sesamum indicum]
Length=528

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 135/184 (73%), Gaps = 2/184 (1%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIM M+QRGERP N+++IND PPNPNQP+  P +AP+PKPWEV Q Q +S+N +Q+Q 
Sbjct  330  YMEIMTMIQRGERPSNIKEINDTPPNPNQPLSNPRLAPRPKPWEVSQPQTNSTNILQTQE  389

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEIESEDEQKFGGPSGVPTNERppprswv  406
            S  +S + F  +N  +G  +  WWQRKN RITE+E+ +E+K G  S V  NE+   RSWV
Sbjct  390  SSKSSNYKF-PSNPLSGGDAALWWQRKNVRITELEAGNEKKPGS-SNVLGNEQSAKRSWV  447

Query  405  ppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEA  226
            PPQPPPV M EAAA IRQPKK S  K+Q TD+QLL  S +++D+L RIT+I E+GG  EA
Sbjct  448  PPQPPPVVMPEAAAVIRQPKKPSYQKEQTTDNQLLAPSPDVTDELPRITRIPEAGGSTEA  507

Query  225  NGVT  214
            NG T
Sbjct  508  NGKT  511



>ref|XP_011101332.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X4 
[Sesamum indicum]
Length=521

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 135/184 (73%), Gaps = 2/184 (1%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIM M+QRGERP N+++IND PPNPNQP+  P +AP+PKPWEV Q Q +S+N +Q+Q 
Sbjct  323  YMEIMTMIQRGERPSNIKEINDTPPNPNQPLSNPRLAPRPKPWEVSQPQTNSTNILQTQE  382

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEIESEDEQKFGGPSGVPTNERppprswv  406
            S  +S + F  +N  +G  +  WWQRKN RITE+E+ +E+K G  S V  NE+   RSWV
Sbjct  383  SSKSSNYKF-PSNPLSGGDAALWWQRKNVRITELEAGNEKKPGS-SNVLGNEQSAKRSWV  440

Query  405  ppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEA  226
            PPQPPPV M EAAA IRQPKK S  K+Q TD+QLL  S +++D+L RIT+I E+GG  EA
Sbjct  441  PPQPPPVVMPEAAAVIRQPKKPSYQKEQTTDNQLLAPSPDVTDELPRITRIPEAGGSTEA  500

Query  225  NGVT  214
            NG T
Sbjct  501  NGKT  504



>ref|XP_011101331.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X3 
[Sesamum indicum]
Length=522

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 135/184 (73%), Gaps = 2/184 (1%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIM M+QRGERP N+++IND PPNPNQP+  P +AP+PKPWEV Q Q +S+N +Q+Q 
Sbjct  324  YMEIMTMIQRGERPSNIKEINDTPPNPNQPLSNPRLAPRPKPWEVSQPQTNSTNILQTQE  383

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEIESEDEQKFGGPSGVPTNERppprswv  406
            S  +S + F  +N  +G  +  WWQRKN RITE+E+ +E+K G  S V  NE+   RSWV
Sbjct  384  SSKSSNYKF-PSNPLSGGDAALWWQRKNVRITELEAGNEKKPGS-SNVLGNEQSAKRSWV  441

Query  405  ppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEA  226
            PPQPPPV M EAAA IRQPKK S  K+Q TD+QLL  S +++D+L RIT+I E+GG  EA
Sbjct  442  PPQPPPVVMPEAAAVIRQPKKPSYQKEQTTDNQLLAPSPDVTDELPRITRIPEAGGSTEA  501

Query  225  NGVT  214
            NG T
Sbjct  502  NGKT  505



>ref|XP_011101329.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X1 
[Sesamum indicum]
Length=529

 Score =   132 bits (333),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 106/184 (58%), Positives = 135/184 (73%), Gaps = 2/184 (1%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIM M+QRGERP N+++IND PPNPNQP+  P +AP+PKPWEV Q Q +S+N +Q+Q 
Sbjct  331  YMEIMTMIQRGERPSNIKEINDTPPNPNQPLSNPRLAPRPKPWEVSQPQTNSTNILQTQE  390

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEIESEDEQKFGGPSGVPTNERppprswv  406
            S  +S + F  +N  +G  +  WWQRKN RITE+E+ +E+K G  S V  NE+   RSWV
Sbjct  391  SSKSSNYKF-PSNPLSGGDAALWWQRKNVRITELEAGNEKKPGS-SNVLGNEQSAKRSWV  448

Query  405  ppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEA  226
            PPQPPPV M EAAA IRQPKK S  K+Q TD+QLL  S +++D+L RIT+I E+GG  EA
Sbjct  449  PPQPPPVVMPEAAAVIRQPKKPSYQKEQTTDNQLLAPSPDVTDELPRITRIPEAGGSTEA  508

Query  225  NGVT  214
            NG T
Sbjct  509  NGKT  512



>ref|XP_002511400.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52002.1| conserved hypothetical protein [Ricinus communis]
Length=535

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 111/212 (52%), Positives = 141/212 (67%), Gaps = 7/212 (3%)
 Frame = -3

Query  864  QQXYANGXVDTDARsvrsss--pptsveppphpkSYMEIMEMVQRGERPPNMRdindqpp  691
            +Q Y NG V++D+R+VRSSS          PHPKSYMEIM MVQRGERPPN+RD+NDQPP
Sbjct  297  KQTYVNGKVESDSRAVRSSSPPTAAEPTVAPHPKSYMEIMAMVQRGERPPNIRDVNDQPP  356

Query  690  npnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNN---QFNGSSSTP  520
            NPNQ I  P +AP+ KPWE GQ Q+S S  +QSQ +G+ S    QDN    QF+G S+ P
Sbjct  357  NPNQKISNPNIAPRTKPWESGQFQSSPSPVLQSQANGEGSDSKAQDNGVTYQFDGESTVP  416

Query  519  WWQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKS  340
            WWQRKNARITEIE+EDE K  GP G  +NE+ P R    P  PP      AA   +  K 
Sbjct  417  WWQRKNARITEIENEDEVK-AGPYGTQSNEQ-PVRRAWVPPQPPPVAMAEAAEAIRRPKP  474

Query  339  SLPKDQLTDDQLLGRSSEISDDLERITKISES  244
            S+ K+Q  ++Q     ++ +D+L++ITKI+ES
Sbjct  475  SVQKEQSGEEQSKSLQTDATDELQKITKIAES  506



>ref|XP_007209904.1| hypothetical protein PRUPE_ppa004183mg [Prunus persica]
 gb|EMJ11103.1| hypothetical protein PRUPE_ppa004183mg [Prunus persica]
Length=525

 Score =   125 bits (313),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 115/224 (51%), Positives = 141/224 (63%), Gaps = 11/224 (5%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsv--eppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q YANG  + D RSV+SSS P SV     PHPKSYM+IM MVQRGE+PPN++DI+D P
Sbjct  290  SKQQYANGKAEYDVRSVQSSSAPASVEPSAAPHPKSYMDIMAMVQRGEKPPNVKDIDDLP  349

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNN---QFNGSSST  523
            PNPNQ +  P +AP+ KPWEVGQ QN+SS   QSQ S +      QDN    Q NG  + 
Sbjct  350  PNPNQQLSNPRLAPRAKPWEVGQAQNNSSQVFQSQVSSEGLNSSIQDNGLDYQSNGDGTV  409

Query  522  PWWQRKNARITEIESEDEQKFGGPSGVPTNERppprswvp--pqpppvamaeaaaairqP  349
            PWWQRKNARITEIE+E      G  G  T+E P         P  PP     AAA   + 
Sbjct  410  PWWQRKNARITEIENEVN---AGSFGARTSELPVQPVQRTWVPPQPPPVAMAAAAEAIRR  466

Query  348  KKSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGE-ANG  220
             K  + K+QL +D  +   S++SD+L+RITKISESGG  E +NG
Sbjct  467  PKPPVQKEQLGNDLPVAPPSDVSDELQRITKISESGGALELSNG  510



>ref|XP_008239763.1| PREDICTED: peroxisomal membrane protein PEX14 [Prunus mume]
Length=527

 Score =   123 bits (309),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 111/224 (50%), Positives = 138/224 (62%), Gaps = 11/224 (5%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrsssp--ptsveppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q YANG  + D RSV+SSS          PHPKSYM+IM MVQRGE+PPN++DI+D P
Sbjct  292  SKQQYANGKAEYDVRSVQSSSAPPSVEPSAVPHPKSYMDIMAMVQRGEKPPNVKDIDDLP  351

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQD---NNQFNGSSST  523
            PNPNQ +  P +AP+ KPWEVGQ QN+SS   QSQ S +      QD   + Q NG  + 
Sbjct  352  PNPNQQLSNPRLAPRAKPWEVGQAQNNSSQVFQSQVSSEGLNSSIQDSGLDYQSNGDGTV  411

Query  522  PWWQRKNARITEIESEDEQKFGGPSGVPTNERppprswvp--pqpppvamaeaaaairqP  349
            PWWQRKNARITEIE+E      G  G  T+E P         P  PP     AAA   + 
Sbjct  412  PWWQRKNARITEIENEVN---AGSFGARTSELPVQPVQRTWVPPQPPPVAMAAAAEAIRR  468

Query  348  KKSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGE-ANG  220
             K  + K+QL +D  +   S++SD+L+RITKISESGG  E +NG
Sbjct  469  PKPPVQKEQLGNDLPVAHPSDVSDELQRITKISESGGALELSNG  512



>ref|XP_004236106.1| PREDICTED: peroxisomal membrane protein PEX14 [Solanum lycopersicum]
 ref|XP_010318908.1| PREDICTED: peroxisomal membrane protein PEX14 [Solanum lycopersicum]
Length=470

 Score =   123 bits (308),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 100/164 (61%), Positives = 117/164 (71%), Gaps = 15/164 (9%)
 Frame = -3

Query  666  PLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWWQRKNARITE  487
            P   PKPKPWE+GQ QNSS +F QSQGSGD   + +QD       SSTPWWQRK+ RIT 
Sbjct  308  PRFGPKPKPWEIGQNQNSSRSFFQSQGSGDGLNYEYQD-------SSTPWWQRKSGRITV  360

Query  486  IESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSLPKDQLTDDQ  307
             E+E+E+KFG  +  PT  RP  RSWVPPQPPPVAMAEAAAAIRQPKKS L K++LT D+
Sbjct  361  TEAENEEKFGY-TAAPTEVRPVQRSWVPPQPPPVAMAEAAAAIRQPKKSLLQKEKLTSDE  419

Query  306  LLGRSSEIS-DDLERITKISESGGFGEANG------VTQTPLAN  196
            L   SSE+S DDL+RITKISESGG  E N       ++ TP+ N
Sbjct  420  LRASSSEMSDDDLQRITKISESGGLTETNRSGFGQQLSGTPITN  463



>ref|XP_009363025.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X1 [Pyrus 
x bretschneideri]
Length=519

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 155/222 (70%), Gaps = 16/222 (7%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqppn  688
            S+Q Y NG  + D RSV+SSS   SVEP PHPKSYM+IM MVQRGE+PPN++DI D PPN
Sbjct  278  SKQQYVNGKAEYDVRSVQSSSAAASVEPAPHPKSYMDIMAMVQRGEKPPNVKDIGDLPPN  337

Query  687  pnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNN---QFNGSSSTPW  517
            PNQ +  P + P+ KPWEVG  QN+ S  +QSQ S D+     QDN    Q NG S+  W
Sbjct  338  PNQQLSNPRLVPRAKPWEVGLAQNNPSQVLQSQVSSDSLNSSIQDNGLNYQSNGDSTVSW  397

Query  516  W--QRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKK  343
            W  Q+KN+RITEIESE     GGP GV T+E+P  R+WVPPQPPPVAMA AA AIRQP K
Sbjct  398  WQQQQKNSRITEIESEVN---GGPYGVRTSEQPVQRTWVPPQPPPVAMAAAAEAIRQP-K  453

Query  342  SSLPKDQLTDDQLLGRSSEI-------SDDLERITKISESGG  238
             S+ K+QL +D  + R SE+       +D+L+R+TKI+ESGG
Sbjct  454  PSVQKEQLGNDLPIARPSEVTNGPSEAADELQRVTKIAESGG  495



>ref|XP_002282743.1| PREDICTED: peroxisomal membrane protein PEX14 [Vitis vinifera]
 emb|CBI15030.3| unnamed protein product [Vitis vinifera]
Length=523

 Score =   121 bits (303),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 121/182 (66%), Gaps = 7/182 (4%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            Y+EIM MVQRGE+PPN+RDIND PPNPNQP+  P +AP+ KPWEVGQ Q S+ +  QSQ 
Sbjct  328  YLEIMAMVQRGEKPPNIRDINDLPPNPNQPLSNPRLAPRTKPWEVGQVQYSAGHAYQSQV  387

Query  585  SGDASGFGFQDNN---QFNGSSSTPWWQRKNARITEIESEDEQKFGGPSGVPTNERpppr  415
            +G+      QDN    Q NG SST WWQ+KNARITEIE+EDE +    S   +NE+ P +
Sbjct  388  TGEGFNSRAQDNGVGYQLNGDSST-WWQQKNARITEIETEDEPRTA--SYTASNEQ-PIQ  443

Query  414  swvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGF  235
                P  PP      AAA  +  KSS+ ++ L +DQ + R S+  D+L+RITKISESGG 
Sbjct  444  RTWVPPQPPPIAMPEAAAAIRQPKSSIQRESLVNDQSVSRPSDEIDELQRITKISESGGV  503

Query  234  GE  229
             E
Sbjct  504  VE  505



>emb|CAN67215.1| hypothetical protein VITISV_005839 [Vitis vinifera]
Length=523

 Score =   121 bits (303),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 121/182 (66%), Gaps = 7/182 (4%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            Y+EIM MVQRGE+PPN+RDIND PPNPNQP+  P +AP+ KPWEVGQ Q S+ +  QSQ 
Sbjct  328  YLEIMAMVQRGEKPPNIRDINDLPPNPNQPLSNPRLAPRTKPWEVGQVQYSAGHAYQSQV  387

Query  585  SGDASGFGFQDNN---QFNGSSSTPWWQRKNARITEIESEDEQKFGGPSGVPTNERpppr  415
            +G+      QDN    Q NG SST WWQ+KNARITEIE+EDE +    S   +NE+ P +
Sbjct  388  TGEGFNSRAQDNGVGYQLNGDSST-WWQQKNARITEIETEDEPRTA--SYTASNEQ-PIQ  443

Query  414  swvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGF  235
                P  PP      AAA  +  KSS+ ++ L +DQ + R S+  D+L+RITKISESGG 
Sbjct  444  RTWVPPQPPPIAMPEAAAAIRQPKSSIQRESLVNDQSVSRPSDEIDELQRITKISESGGV  503

Query  234  GE  229
             E
Sbjct  504  VE  505



>ref|XP_009363027.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X3 [Pyrus 
x bretschneideri]
Length=518

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 155/222 (70%), Gaps = 16/222 (7%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqppn  688
            S+Q Y NG  + D RSV+SSS   SVEP PHPKSYM+IM MVQRGE+PPN++DI D PPN
Sbjct  277  SKQQYVNGKAEYDVRSVQSSSAAASVEPAPHPKSYMDIMAMVQRGEKPPNVKDIGDLPPN  336

Query  687  pnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNN---QFNGSSSTPW  517
            PNQ +  P + P+ KPWEVG  QN+ S  +QSQ S D+     QDN    Q NG S+  W
Sbjct  337  PNQQLSNPRLVPRAKPWEVGLAQNNPSQVLQSQVSSDSLNSSIQDNGLNYQSNGDSTVSW  396

Query  516  W--QRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKK  343
            W  Q+KN+RITEIESE     GGP GV T+E+P  R+WVPPQPPPVAMA AA AIRQP K
Sbjct  397  WQQQQKNSRITEIESEVN---GGPYGVRTSEQPVQRTWVPPQPPPVAMAAAAEAIRQP-K  452

Query  342  SSLPKDQLTDDQLLGRSSEI-------SDDLERITKISESGG  238
             S+ K+QL +D  + R SE+       +D+L+R+TKI+ESGG
Sbjct  453  PSVQKEQLGNDLPIARPSEVTNGPSEAADELQRVTKIAESGG  494



>ref|XP_009363026.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X2 [Pyrus 
x bretschneideri]
Length=518

 Score =   120 bits (302),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 126/222 (57%), Positives = 155/222 (70%), Gaps = 16/222 (7%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqppn  688
            S+Q Y NG  + D RSV+SSS   SVEP PHPKSYM+IM MVQRGE+PPN++DI D PPN
Sbjct  277  SKQQYVNGKAEYDVRSVQSSSAAASVEPAPHPKSYMDIMAMVQRGEKPPNVKDIGDLPPN  336

Query  687  pnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNN---QFNGSSSTPW  517
            PNQ +  P + P+ KPWEVG  QN+ S  +QSQ S D+     QDN    Q NG S+  W
Sbjct  337  PNQQLSNPRLVPRAKPWEVGLAQNNPSQVLQSQVSSDSLNSSIQDNGLNYQSNGDSTVSW  396

Query  516  W--QRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKK  343
            W  Q+KN+RITEIESE     GGP GV T+E+P  R+WVPPQPPPVAMA AA AIRQP K
Sbjct  397  WQQQQKNSRITEIESEVN---GGPYGVRTSEQPVQRTWVPPQPPPVAMAAAAEAIRQP-K  452

Query  342  SSLPKDQLTDDQLLGRSSEI-------SDDLERITKISESGG  238
             S+ K+QL +D  + R SE+       +D+L+R+TKI+ESGG
Sbjct  453  PSVQKEQLGNDLPIARPSEVTNGPSEAADELQRVTKIAESGG  494



>ref|XP_010027775.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X8 [Eucalyptus 
grandis]
Length=507

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 116/182 (64%), Gaps = 20/182 (11%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIM MVQRGERPPN++DIND PPNP+Q IP P +AP+ KPWE  QTQN+SSN  Q Q 
Sbjct  319  YMEIMAMVQRGERPPNVKDINDSPPNPHQQIPNPRLAPRAKPWETIQTQNNSSNVYQYQS  378

Query  585  SGDASGFGFQDN---NQFNGSSSTPWWQRKNARITEIESEDEQKFGGP---SGVPTNERp  424
            S +A  +  QDN   +Q NG +S PWWQRKNARITEI+ +++ K G P   + VP     
Sbjct  379  SAEAWNYNAQDNGIIDQSNGDASAPWWQRKNARITEIDHDEDLKTGQPVQRAWVPPQ---  435

Query  423  pprswvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISES  244
                      PP      AA   +  K +  K+Q + D+   RSS+++D+L++ITK SES
Sbjct  436  ----------PPPIAMAEAAEAIRRPKPAAQKEQ-SSDETASRSSDVTDELQKITKFSES  484

Query  243  GG  238
            GG
Sbjct  485  GG  486



>ref|XP_010027759.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X6 [Eucalyptus 
grandis]
Length=512

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 116/182 (64%), Gaps = 20/182 (11%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIM MVQRGERPPN++DIND PPNP+Q IP P +AP+ KPWE  QTQN+SSN  Q Q 
Sbjct  324  YMEIMAMVQRGERPPNVKDINDSPPNPHQQIPNPRLAPRAKPWETIQTQNNSSNVYQYQS  383

Query  585  SGDASGFGFQDN---NQFNGSSSTPWWQRKNARITEIESEDEQKFGGP---SGVPTNERp  424
            S +A  +  QDN   +Q NG +S PWWQRKNARITEI+ +++ K G P   + VP     
Sbjct  384  SAEAWNYNAQDNGIIDQSNGDASAPWWQRKNARITEIDHDEDLKTGQPVQRAWVP-----  438

Query  423  pprswvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISES  244
                      PP      AA   +  K +  K+Q + D+   RSS+++D+L++ITK SES
Sbjct  439  --------PQPPPIAMAEAAEAIRRPKPAAQKEQ-SSDETASRSSDVTDELQKITKFSES  489

Query  243  GG  238
            GG
Sbjct  490  GG  491



>ref|XP_010027743.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X4 [Eucalyptus 
grandis]
Length=513

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 116/182 (64%), Gaps = 20/182 (11%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIM MVQRGERPPN++DIND PPNP+Q IP P +AP+ KPWE  QTQN+SSN  Q Q 
Sbjct  325  YMEIMAMVQRGERPPNVKDINDSPPNPHQQIPNPRLAPRAKPWETIQTQNNSSNVYQYQS  384

Query  585  SGDASGFGFQDN---NQFNGSSSTPWWQRKNARITEIESEDEQKFGGP---SGVPTNERp  424
            S +A  +  QDN   +Q NG +S PWWQRKNARITEI+ +++ K G P   + VP     
Sbjct  385  SAEAWNYNAQDNGIIDQSNGDASAPWWQRKNARITEIDHDEDLKTGQPVQRAWVP-----  439

Query  423  pprswvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISES  244
                      PP      AA   +  K +  K+Q + D+   RSS+++D+L++ITK SES
Sbjct  440  --------PQPPPIAMAEAAEAIRRPKPAAQKEQ-SSDETASRSSDVTDELQKITKFSES  490

Query  243  GG  238
            GG
Sbjct  491  GG  492



>ref|XP_010027734.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X3 [Eucalyptus 
grandis]
Length=517

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 116/182 (64%), Gaps = 20/182 (11%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIM MVQRGERPPN++DIND PPNP+Q IP P +AP+ KPWE  QTQN+SSN  Q Q 
Sbjct  329  YMEIMAMVQRGERPPNVKDINDSPPNPHQQIPNPRLAPRAKPWETIQTQNNSSNVYQYQS  388

Query  585  SGDASGFGFQDN---NQFNGSSSTPWWQRKNARITEIESEDEQKFGGP---SGVPTNERp  424
            S +A  +  QDN   +Q NG +S PWWQRKNARITEI+ +++ K G P   + VP     
Sbjct  389  SAEAWNYNAQDNGIIDQSNGDASAPWWQRKNARITEIDHDEDLKTGQPVQRAWVPPQ---  445

Query  423  pprswvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISES  244
                      PP      AA   +  K +  K+Q + D+   RSS+++D+L++ITK SES
Sbjct  446  ----------PPPIAMAEAAEAIRRPKPAAQKEQ-SSDETASRSSDVTDELQKITKFSES  494

Query  243  GG  238
            GG
Sbjct  495  GG  496



>gb|EYU42567.1| hypothetical protein MIMGU_mgv1a004473mg [Erythranthe guttata]
Length=525

 Score =   120 bits (301),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 122/220 (55%), Positives = 150/220 (68%), Gaps = 22/220 (10%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrsss--pptsveppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q YANG  DTD+RSVRS S   P      PHPKSYM+IM M+QRGE+P N+R+IND P
Sbjct  292  SRQPYANGRADTDSRSVRSLSPPAPVEPSAAPHPKSYMDIMAMIQRGEKPSNIREINDAP  351

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNG--SSSTP  520
            PNP+QP+  P +AP+ KPWE   +QNS+ N   +Q S +AS + FQD NQ NG  ++++ 
Sbjct  352  PNPSQPLSNPRLAPRLKPWE---SQNSAPNNYPAQDSINASNYDFQD-NQMNGDNAAASS  407

Query  519  WWQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppq-----pppvamaeaaaair  355
            WWQ+KNARITEIE+        P+    NER PP            PPPV M EAAAAIR
Sbjct  408  WWQQKNARITEIET--------PNTTMVNERGPPAIQRSSSWVPPQPPPVVMPEAAAAIR  459

Query  354  qPKKSSLPKDQLTDDQLLGRSS-EISDDLERITKISESGG  238
            QPKKS    +QLTDDQLL RSS + +D+L+RITKISESGG
Sbjct  460  QPKKSPYQMEQLTDDQLLARSSADANDELQRITKISESGG  499



>ref|XP_010027726.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X2 [Eucalyptus 
grandis]
Length=518

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 116/182 (64%), Gaps = 20/182 (11%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIM MVQRGERPPN++DIND PPNP+Q IP P +AP+ KPWE  QTQN+SSN  Q Q 
Sbjct  330  YMEIMAMVQRGERPPNVKDINDSPPNPHQQIPNPRLAPRAKPWETIQTQNNSSNVYQYQS  389

Query  585  SGDASGFGFQDN---NQFNGSSSTPWWQRKNARITEIESEDEQKFGGP---SGVPTNERp  424
            S +A  +  QDN   +Q NG +S PWWQRKNARITEI+ +++ K G P   + VP     
Sbjct  390  SAEAWNYNAQDNGIIDQSNGDASAPWWQRKNARITEIDHDEDLKTGQPVQRAWVPPQ---  446

Query  423  pprswvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISES  244
                      PP      AA   +  K +  K+Q + D+   RSS+++D+L++ITK SES
Sbjct  447  ----------PPPIAMAEAAEAIRRPKPAAQKEQ-SSDETASRSSDVTDELQKITKFSES  495

Query  243  GG  238
            GG
Sbjct  496  GG  497



>ref|XP_010027751.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X5 [Eucalyptus 
grandis]
Length=513

 Score =   120 bits (301),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 116/182 (64%), Gaps = 20/182 (11%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIM MVQRGERPPN++DIND PPNP+Q IP P +AP+ KPWE  QTQN+SSN  Q Q 
Sbjct  325  YMEIMAMVQRGERPPNVKDINDSPPNPHQQIPNPRLAPRAKPWETIQTQNNSSNVYQYQS  384

Query  585  SGDASGFGFQDN---NQFNGSSSTPWWQRKNARITEIESEDEQKFGGP---SGVPTNERp  424
            S +A  +  QDN   +Q NG +S PWWQRKNARITEI+ +++ K G P   + VP     
Sbjct  385  SAEAWNYNAQDNGIIDQSNGDASAPWWQRKNARITEIDHDEDLKTGQPVQRAWVPPQ---  441

Query  423  pprswvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISES  244
                      PP      AA   +  K +  K+Q + D+   RSS+++D+L++ITK SES
Sbjct  442  ----------PPPIAMAEAAEAIRRPKPAAQKEQ-SSDETASRSSDVTDELQKITKFSES  490

Query  243  GG  238
            GG
Sbjct  491  GG  492



>ref|XP_010027767.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X7 [Eucalyptus 
grandis]
Length=512

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 116/182 (64%), Gaps = 20/182 (11%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIM MVQRGERPPN++DIND PPNP+Q IP P +AP+ KPWE  QTQN+SSN  Q Q 
Sbjct  324  YMEIMAMVQRGERPPNVKDINDSPPNPHQQIPNPRLAPRAKPWETIQTQNNSSNVYQYQS  383

Query  585  SGDASGFGFQDN---NQFNGSSSTPWWQRKNARITEIESEDEQKFGGP---SGVPTNERp  424
            S +A  +  QDN   +Q NG +S PWWQRKNARITEI+ +++ K G P   + VP     
Sbjct  384  SAEAWNYNAQDNGIIDQSNGDASAPWWQRKNARITEIDHDEDLKTGQPVQRAWVPPQ---  440

Query  423  pprswvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISES  244
                      PP      AA   +  K +  K+Q + D+   RSS+++D+L++ITK SES
Sbjct  441  ----------PPPIAMAEAAEAIRRPKPAAQKEQ-SSDETASRSSDVTDELQKITKFSES  489

Query  243  GG  238
            GG
Sbjct  490  GG  491



>ref|XP_010027717.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X1 [Eucalyptus 
grandis]
Length=519

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 116/182 (64%), Gaps = 20/182 (11%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIM MVQRGERPPN++DIND PPNP+Q IP P +AP+ KPWE  QTQN+SSN  Q Q 
Sbjct  331  YMEIMAMVQRGERPPNVKDINDSPPNPHQQIPNPRLAPRAKPWETIQTQNNSSNVYQYQS  390

Query  585  SGDASGFGFQDN---NQFNGSSSTPWWQRKNARITEIESEDEQKFGGP---SGVPTNERp  424
            S +A  +  QDN   +Q NG +S PWWQRKNARITEI+ +++ K G P   + VP     
Sbjct  391  SAEAWNYNAQDNGIIDQSNGDASAPWWQRKNARITEIDHDEDLKTGQPVQRAWVPPQ---  447

Query  423  pprswvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISES  244
                      PP      AA   +  K +  K+Q + D+   RSS+++D+L++ITK SES
Sbjct  448  ----------PPPIAMAEAAEAIRRPKPAAQKEQ-SSDETASRSSDVTDELQKITKFSES  496

Query  243  GG  238
            GG
Sbjct  497  GG  498



>gb|KCW83383.1| hypothetical protein EUGRSUZ_B00317 [Eucalyptus grandis]
Length=522

 Score =   120 bits (300),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 90/182 (49%), Positives = 116/182 (64%), Gaps = 20/182 (11%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIM MVQRGERPPN++DIND PPNP+Q IP P +AP+ KPWE  QTQN+SSN  Q Q 
Sbjct  334  YMEIMAMVQRGERPPNVKDINDSPPNPHQQIPNPRLAPRAKPWETIQTQNNSSNVYQYQS  393

Query  585  SGDASGFGFQDN---NQFNGSSSTPWWQRKNARITEIESEDEQKFGGP---SGVPTNERp  424
            S +A  +  QDN   +Q NG +S PWWQRKNARITEI+ +++ K G P   + VP     
Sbjct  394  SAEAWNYNAQDNGIIDQSNGDASAPWWQRKNARITEIDHDEDLKTGQPVQRAWVP-----  448

Query  423  pprswvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISES  244
                      PP      AA   +  K +  K+Q + D+   RSS+++D+L++ITK SES
Sbjct  449  --------PQPPPIAMAEAAEAIRRPKPAAQKEQ-SSDETASRSSDVTDELQKITKFSES  499

Query  243  GG  238
            GG
Sbjct  500  GG  501



>ref|XP_011001542.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X3 
[Populus euphratica]
Length=512

 Score =   119 bits (298),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 97/184 (53%), Positives = 120/184 (65%), Gaps = 27/184 (15%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIMEMV+RGERP N+R                       PWEVGQ QN+SS   QSQ 
Sbjct  330  YMEIMEMVRRGERPGNIR-----------------------PWEVGQVQNNSSQVPQSQV  366

Query  585  SGDASGFGFQDNN--QFNGSSSTPWWQRKNARITEIESEDEQKFGGPSGVPTNERppprs  412
            S +       DN   QF+G S+TPWWQRKNARI EI++EDE K  GP G   N++P  R+
Sbjct  367  SEEDLNSKVLDNGIYQFDGESTTPWWQRKNARIAEIDNEDEVK-AGPYGGQNNQQPVRRT  425

Query  411  wvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGFG  232
            WVPP+PPPV MAEAA AIR+PK+ S+ K+QL DD+ +   ++ +D+L+RITKISESGG  
Sbjct  426  WVPPRPPPVVMAEAAEAIRRPKQ-SIQKEQLEDDRSVSHPTDTADELQRITKISESGGAV  484

Query  231  EANG  220
            E NG
Sbjct  485  EING  488



>ref|XP_006374519.1| hypothetical protein POPTR_0015s08730g [Populus trichocarpa]
 gb|ERP52316.1| hypothetical protein POPTR_0015s08730g [Populus trichocarpa]
Length=385

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 150/219 (68%), Gaps = 8/219 (4%)
 Frame = -3

Query  864  QQXYANGXVDTDARsvrsss--pptsveppphpkSYMEIMEMVQRGERPPNMRdindqpp  691
            +Q + NG  + D RS RSSS           HPKS+MEIM+  QRGE+P N+RDINDQPP
Sbjct  151  KQTFTNGKAEFDLRSGRSSSQPMSAQASVAAHPKSFMEIMD--QRGEKPANIRDINDQPP  208

Query  690  npnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDN--NQFNGSSSTPW  517
            NP Q I  P +A + KPWEVG+ QN+SS  ++SQ   +      QD+  +Q +G S+ PW
Sbjct  209  NPYQQISNPRIASRTKPWEVGRAQNNSSQVLESQVGREGLNSNVQDSGVDQLDGESTEPW  268

Query  516  WQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSS  337
            WQ+KNARITEIE+ DE K  GP G PT+E+P  R+WVPPQPPPV M EAA AIR+PK+ S
Sbjct  269  WQQKNARITEIENGDEIK-AGPFGAPTSEQPVRRAWVPPQPPPVVMPEAAEAIRRPKQ-S  326

Query  336  LPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
            + K+Q  DDQ +    + +D+L+RITKISESGG  E NG
Sbjct  327  IQKEQSEDDQSVSHPIDTADELQRITKISESGGAVEING  365



>ref|XP_006374518.1| hypothetical protein POPTR_0015s08730g [Populus trichocarpa]
 gb|ERP52315.1| hypothetical protein POPTR_0015s08730g [Populus trichocarpa]
Length=527

 Score =   116 bits (291),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 147/219 (67%), Gaps = 8/219 (4%)
 Frame = -3

Query  864  QQXYANGXVDTDARs--vrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqpp  691
            +Q + NG  + D RS    S           HPKS+MEIM+  QRGE+P N+RDINDQPP
Sbjct  293  KQTFTNGKAEFDLRSGRSSSQPMSAQASVAAHPKSFMEIMD--QRGEKPANIRDINDQPP  350

Query  690  npnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDN--NQFNGSSSTPW  517
            NP Q I  P +A + KPWEVG+ QN+SS  ++SQ   +      QD+  +Q +G S+ PW
Sbjct  351  NPYQQISNPRIASRTKPWEVGRAQNNSSQVLESQVGREGLNSNVQDSGVDQLDGESTEPW  410

Query  516  WQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSS  337
            WQ+KNARITEIE+ DE K  GP G PT+E+P  R+WVPPQPPPV M EAA AIR+PK+ S
Sbjct  411  WQQKNARITEIENGDEIK-AGPFGAPTSEQPVRRAWVPPQPPPVVMPEAAEAIRRPKQ-S  468

Query  336  LPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
            + K+Q  DDQ +    + +D+L+RITKISESGG  E NG
Sbjct  469  IQKEQSEDDQSVSHPIDTADELQRITKISESGGAVEING  507



>ref|XP_002321598.2| hypothetical protein POPTR_0015s08730g [Populus trichocarpa]
 gb|EEF05725.2| hypothetical protein POPTR_0015s08730g [Populus trichocarpa]
Length=528

 Score =   116 bits (291),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 115/219 (53%), Positives = 147/219 (67%), Gaps = 8/219 (4%)
 Frame = -3

Query  864  QQXYANGXVDTDARs--vrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqpp  691
            +Q + NG  + D RS    S           HPKS+MEIM+  QRGE+P N+RDINDQPP
Sbjct  294  KQTFTNGKAEFDLRSGRSSSQPMSAQASVAAHPKSFMEIMD--QRGEKPANIRDINDQPP  351

Query  690  npnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDN--NQFNGSSSTPW  517
            NP Q I  P +A + KPWEVG+ QN+SS  ++SQ   +      QD+  +Q +G S+ PW
Sbjct  352  NPYQQISNPRIASRTKPWEVGRAQNNSSQVLESQVGREGLNSNVQDSGVDQLDGESTEPW  411

Query  516  WQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSS  337
            WQ+KNARITEIE+ DE K  GP G PT+E+P  R+WVPPQPPPV M EAA AIR+PK+ S
Sbjct  412  WQQKNARITEIENGDEIK-AGPFGAPTSEQPVRRAWVPPQPPPVVMPEAAEAIRRPKQ-S  469

Query  336  LPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
            + K+Q  DDQ +    + +D+L+RITKISESGG  E NG
Sbjct  470  IQKEQSEDDQSVSHPIDTADELQRITKISESGGAVEING  508



>ref|XP_007155427.1| hypothetical protein PHAVU_003G200200g [Phaseolus vulgaris]
 gb|ESW27421.1| hypothetical protein PHAVU_003G200200g [Phaseolus vulgaris]
Length=521

 Score =   115 bits (287),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 109/212 (51%), Positives = 145/212 (68%), Gaps = 4/212 (2%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrsss--pptsveppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q   NG  D D RSVRSSS           HPKSYMEIM MVQRGE+P N+RDI+D P
Sbjct  285  SKQLIVNGKADHDLRSVRSSSPPASVEPSSGLHPKSYMEIMAMVQRGEKPSNIRDISDLP  344

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWW  514
            PNP+Q    PL+ P+ KPWEVGQ Q++S+  +QSQ +G+      QD +  NG    PWW
Sbjct  345  PNPSQQPSNPLLVPRSKPWEVGQVQSTSTQMLQSQVNGEDLNTKTQDTSLVNGDDPLPWW  404

Query  513  QRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSL  334
            QRKN RITEI++E+E   G P    ++++P  R WVPPQPPP+AMA AA AIR+PK+ + 
Sbjct  405  QRKNVRITEIDNENESN-GVPFAAASSQQPVQRVWVPPQPPPIAMAGAAEAIRRPKQVAQ  463

Query  333  PKDQLTDDQLLGRSSEISDDLERITKISESGG  238
             K+Q++D+Q +  SS+ SDD++R++K+ ES G
Sbjct  464  -KEQMSDNQSVAHSSDSSDDVQRVSKLLESEG  494



>ref|XP_008393032.1| PREDICTED: peroxisomal membrane protein PEX14-like [Malus domestica]
Length=525

 Score =   112 bits (281),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 140/226 (62%), Gaps = 17/226 (8%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqppn  688
            S+Q Y NG  + D RSV+SSS   SVEP PHPKSYM+IM MVQRGE+PPN++D +D  PN
Sbjct  283  SKQQYVNGKAEYDVRSVQSSSAAASVEPAPHPKSYMDIMAMVQRGEKPPNVKDXDDXXPN  342

Query  687  pnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNN---QFNGSSSTPW  517
            PNQ +  P +AP+ KPWEVGQ QN+ S  +QSQ S D      QDN    Q NG S+ PW
Sbjct  343  PNQQLSNPRLAPRAKPWEVGQAQNNPSQXLQSQVSXDXLNSSIQDNGLNYQSNGDSTVPW  402

Query  516  W---QRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPK  346
            W   Q+ N+RITEIE+E     GG  GV T+E+ P +    P  PP     AAA   +  
Sbjct  403  WQQQQQXNSRITEIENEVN---GGSYGVRTSEQ-PVQRTWVPPQPPPVAMAAAAEAIRRP  458

Query  345  KSSLPKDQLTDDQLLGRSSEIS-------DDLERITKISESGGFGE  229
            K S+ K+QL +D  +   SE +       D+L+R+TK++ESGG  E
Sbjct  459  KPSVQKEQLGNDLPIAHPSEATNGPSXGADELQRVTKLAESGGESE  504



>ref|XP_010243117.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X3 [Nelumbo 
nucifera]
Length=511

 Score =   112 bits (279),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 73/151 (48%), Positives = 94/151 (62%), Gaps = 7/151 (5%)
 Frame = -3

Query  669  EPLVAPKPK----PWEVGQTQNSSSNFIQSQGSGDASGFGFQDN---NQFNGSSSTPWWQ  511
            EP VAP PK    PWEVGQ QNSSS  +QSQ SG+ S +  +DN   +Q NG SS PWWQ
Sbjct  335  EPSVAPHPKSYMEPWEVGQAQNSSSYTLQSQTSGENSSYKVEDNGSASQLNGYSSEPWWQ  394

Query  510  RKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSLP  331
            RKN RI+EIE E++Q+      VP     P +    P  PP      AAA  +  KS + 
Sbjct  395  RKNVRISEIEDENDQRIASYGIVPVANERPVQRTWVPPQPPPVSMPEAAAAIRQPKSIIQ  454

Query  330  KDQLTDDQLLGRSSEISDDLERITKISESGG  238
            K+Q ++DQ++ RSS+  D+L+RITK+SE GG
Sbjct  455  KEQPSNDQVMERSSDEVDELQRITKLSELGG  485



>ref|XP_011028566.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X3 [Populus 
euphratica]
Length=479

 Score =   111 bits (278),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 147/219 (67%), Gaps = 8/219 (4%)
 Frame = -3

Query  864  QQXYANGXVDTDARsvrssspptsve--ppphpkSYMEIMEMVQRGERPPNMRdindqpp  691
            +Q Y NG  + D RS RSSS   S +     H KSYMEIME  QRGE+P N+RDINDQ P
Sbjct  245  KQTYTNGKAEFDLRSGRSSSQSMSAQASVAAHRKSYMEIME--QRGEKPANIRDINDQLP  302

Query  690  npnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDN--NQFNGSSSTPW  517
            NP Q I  P +A   KPWEVG+ QN+SS  ++SQ   ++      D+  +Q +G S  P 
Sbjct  303  NPYQQISNPRIASITKPWEVGRAQNNSSQVLESQVGRESLNSNVHDSGVDQLDGKSMEPR  362

Query  516  WQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSS  337
            WQ+KNARITEIE+ DE K  GP GV T+E+P  R+WVPPQPPPV M EAA AIR+PK+ S
Sbjct  363  WQQKNARITEIENGDETK-AGPFGVQTSEQPVRRAWVPPQPPPVVMPEAAEAIRRPKQ-S  420

Query  336  LPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
            + K+Q  DDQ +    + +D+L+RITKISESGG  E NG
Sbjct  421  IQKEQSEDDQSVSHPIDTADELQRITKISESGGAVEING  459



>ref|XP_011028564.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X1 [Populus 
euphratica]
Length=528

 Score =   111 bits (278),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 147/219 (67%), Gaps = 8/219 (4%)
 Frame = -3

Query  864  QQXYANGXVDTDARsvrssspptsve--ppphpkSYMEIMEMVQRGERPPNMRdindqpp  691
            +Q Y NG  + D RS RSSS   S +     H KSYMEIME  QRGE+P N+RDINDQ P
Sbjct  294  KQTYTNGKAEFDLRSGRSSSQSMSAQASVAAHRKSYMEIME--QRGEKPANIRDINDQLP  351

Query  690  npnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDN--NQFNGSSSTPW  517
            NP Q I  P +A   KPWEVG+ QN+SS  ++SQ   ++      D+  +Q +G S  P 
Sbjct  352  NPYQQISNPRIASITKPWEVGRAQNNSSQVLESQVGRESLNSNVHDSGVDQLDGKSMEPR  411

Query  516  WQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSS  337
            WQ+KNARITEIE+ DE K  GP GV T+E+P  R+WVPPQPPPV M EAA AIR+PK+ S
Sbjct  412  WQQKNARITEIENGDETK-AGPFGVQTSEQPVRRAWVPPQPPPVVMPEAAEAIRRPKQ-S  469

Query  336  LPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
            + K+Q  DDQ +    + +D+L+RITKISESGG  E NG
Sbjct  470  IQKEQSEDDQSVSHPIDTADELQRITKISESGGAVEING  508



>ref|XP_011028565.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X2 [Populus 
euphratica]
Length=527

 Score =   111 bits (277),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 118/219 (54%), Positives = 147/219 (67%), Gaps = 8/219 (4%)
 Frame = -3

Query  864  QQXYANGXVDTDARsvrssspptsve--ppphpkSYMEIMEMVQRGERPPNMRdindqpp  691
            +Q Y NG  + D RS RSSS   S +     H KSYMEIME  QRGE+P N+RDINDQ P
Sbjct  293  KQTYTNGKAEFDLRSGRSSSQSMSAQASVAAHRKSYMEIME--QRGEKPANIRDINDQLP  350

Query  690  npnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDN--NQFNGSSSTPW  517
            NP Q I  P +A   KPWEVG+ QN+SS  ++SQ   ++      D+  +Q +G S  P 
Sbjct  351  NPYQQISNPRIASITKPWEVGRAQNNSSQVLESQVGRESLNSNVHDSGVDQLDGKSMEPR  410

Query  516  WQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSS  337
            WQ+KNARITEIE+ DE K  GP GV T+E+P  R+WVPPQPPPV M EAA AIR+PK+ S
Sbjct  411  WQQKNARITEIENGDETK-AGPFGVQTSEQPVRRAWVPPQPPPVVMPEAAEAIRRPKQ-S  468

Query  336  LPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
            + K+Q  DDQ +    + +D+L+RITKISESGG  E NG
Sbjct  469  IQKEQSEDDQSVSHPIDTADELQRITKISESGGAVEING  507



>ref|XP_006345195.1| PREDICTED: peroxisomal membrane protein PEX14-like [Solanum tuberosum]
Length=536

 Score =   108 bits (270),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 103/140 (74%), Gaps = 8/140 (6%)
 Frame = -3

Query  639  WEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWWQRKNARITEIESEDEQKF  460
            WE+GQ QNSS +F+QSQGSGD   + +QD       SSTPWWQRK+ RIT  E+E+++KF
Sbjct  384  WEIGQNQNSSRSFLQSQGSGDGLNYEYQD-------SSTPWWQRKSGRITVTEAENKEKF  436

Query  459  GGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEIS  280
            G  +  PT  +P  RSWVPPQPPPVAM EAAAAIRQPKK    K++LT D+L   SSEIS
Sbjct  437  GY-TPAPTEVQPVQRSWVPPQPPPVAMTEAAAAIRQPKKPLFQKEKLTGDELKAHSSEIS  495

Query  279  DDLERITKISESGGFGEANG  220
            DD++RIT I+ESGG  E NG
Sbjct  496  DDVQRITTITESGGLTETNG  515



>ref|XP_004508866.1| PREDICTED: peroxisomal membrane protein PEX14-like [Cicer arietinum]
Length=522

 Score =   108 bits (270),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 115/218 (53%), Positives = 149/218 (68%), Gaps = 5/218 (2%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsvepp--phpkSYMEIMEMVQRGERPPNMRdindqp  694
            S++  ANG  D D RS RS SPP  VEP   PHPKSYMEIM MVQRGE+P N+RDIND P
Sbjct  285  SKRLIANGKTDYDLRSGRSLSPPAPVEPSGPPHPKSYMEIMAMVQRGEKPSNIRDINDLP  344

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWW  514
            PNP+Q   +P + PK KPWE GQ QN+SS   Q Q +G+ S    QD  Q NG    PWW
Sbjct  345  PNPSQQPSDPRILPKSKPWETGQVQNTSSQLFQPQANGEESNIKVQDITQSNGDDPMPWW  404

Query  513  QRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSL  334
            Q+KN RI EI  E+ +  G P G  ++++P  R WVPPQPPP+AMAEAA AIR+PK+ ++
Sbjct  405  QKKNVRIREI--EENESSGAPYGTASSQQPLQRVWVPPQPPPIAMAEAAEAIRRPKQ-AV  461

Query  333  PKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANG  220
             K+Q++++Q + +SS+IS ++  I K +ES G   +NG
Sbjct  462  QKEQVSENQSVAQSSDISGEVNGIPKPAESEGVERSNG  499



>gb|AES91161.2| peroxisomal membrane PEX14-like protein, putative [Medicago truncatula]
Length=523

 Score =   108 bits (270),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 150/219 (68%), Gaps = 7/219 (3%)
 Frame = -3

Query  864  QQXYANGXVDTDARsvrssspptsvepp--phpkSYMEIMEMVQRGERPPNMRdindqpp  691
            +Q  ANG  D D RSVRS SPP  VEP   PHPKSYMEIM MVQRGE+P N+R+IND PP
Sbjct  292  KQLVANGKADYDLRSVRSLSPPAPVEPSGPPHPKSYMEIMAMVQRGEKPSNIREINDLPP  351

Query  690  npnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWWQ  511
            NP+Q   +P + P+ KPWE+GQ QN+SS   Q Q +G+ S    QD  Q NG   TPWWQ
Sbjct  352  NPSQQPSDPRILPRSKPWEIGQVQNTSSQVFQPQANGEESYIKVQDTTQSNGDDPTPWWQ  411

Query  510  RKNARITEIESEDEQKF-GGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSL  334
            +KN RI EI   DE ++ G P+G  ++++P  R WVPPQPPP+AMA AA AIR+PK+ ++
Sbjct  412  KKNVRIREI---DEIEYNGAPNGSASSQQPLQRVWVPPQPPPIAMAGAAEAIRRPKQ-AV  467

Query  333  PKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANGV  217
             K+Q +D+Q + +SS+IS+    I K SES G  E + V
Sbjct  468  QKEQASDNQSVVQSSDISNGEHEIPKPSESEGAVEGSNV  506



>ref|XP_003608964.1| Peroxisomal membrane protein PEX14 [Medicago truncatula]
Length=523

 Score =   108 bits (269),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 117/219 (53%), Positives = 150/219 (68%), Gaps = 7/219 (3%)
 Frame = -3

Query  864  QQXYANGXVDTDARsvrssspptsvepp--phpkSYMEIMEMVQRGERPPNMRdindqpp  691
            +Q  ANG  D D RSVRS SPP  VEP   PHPKSYMEIM MVQRGE+P N+R+IND PP
Sbjct  292  KQLVANGKADYDLRSVRSLSPPAPVEPSGPPHPKSYMEIMAMVQRGEKPSNIREINDLPP  351

Query  690  npnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWWQ  511
            NP+Q   +P + P+ KPWE+GQ QN+SS   Q Q +G+ S    QD  Q NG   TPWWQ
Sbjct  352  NPSQQPSDPRILPRSKPWEIGQVQNTSSQVFQPQANGEESYIKVQDTTQSNGDDPTPWWQ  411

Query  510  RKNARITEIESEDEQKF-GGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSL  334
            +KN RI EI   DE ++ G P+G  ++++P  R WVPPQPPP+AMA AA AIR+PK+ ++
Sbjct  412  KKNVRIREI---DEIEYNGAPNGSASSQQPLQRVWVPPQPPPIAMAGAAEAIRRPKQ-AV  467

Query  333  PKDQLTDDQLLGRSSEISDDLERITKISESGGFGEANGV  217
             K+Q +D+Q + +SS+IS+    I K SES G  E + V
Sbjct  468  QKEQASDNQSVVQSSDISNGEHEIPKPSESEGAVEGSNV  506



>ref|XP_008374437.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X2 
[Malus domestica]
Length=530

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 136/230 (59%), Gaps = 20/230 (9%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsv--eppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q Y NG  + D RSV+SS+   S+     PHPKSYM+IM MVQRGE+PPN++DI+D P
Sbjct  283  SKQQYVNGKAEYDVRSVQSSTAAASMEPSAAPHPKSYMDIMAMVQRGEKPPNVKDIDDSP  342

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDN--NQF-NGSSST  523
            PNPNQ +  P +AP+ KPWEVGQ QN+SS  +QSQ S +      QDN  N   NG S+ 
Sbjct  343  PNPNQQLSNPRLAPRAKPWEVGQAQNNSSQVLQSQVSSEGLNSSIQDNGLNYLSNGDSTV  402

Query  522  PWW---QRKNARITEIESEDEQKFGGPSGVPTNERppprswvp--pqpppvamaeaaaai  358
              W   QRKN RITEI++E     GG  G+ T E+P         P  PP     AAA  
Sbjct  403  SRWQQQQRKNPRITEIDNEVN---GGSYGIRTREQPVQPVQRTWVPPQPPPVAMAAAAEA  459

Query  357  rqPKKSSLPKDQLTDDQLLGRSSEI-------SDDLERITKISESGGFGE  229
             +  K  + K+QL +D      SE+       +D+L+RITKI+ESGG  E
Sbjct  460  IRRPKPPVQKEQLGNDLPFSHPSEVTDGPSQGTDELQRITKIAESGGAPE  509



>ref|XP_008374436.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X1 
[Malus domestica]
Length=530

 Score =   103 bits (258),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 106/230 (46%), Positives = 136/230 (59%), Gaps = 20/230 (9%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsv--eppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q Y NG  + D RSV+SS+   S+     PHPKSYM+IM MVQRGE+PPN++DI+D P
Sbjct  283  SKQQYVNGKAEYDVRSVQSSTAAASMEPSAAPHPKSYMDIMAMVQRGEKPPNVKDIDDSP  342

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDN--NQF-NGSSST  523
            PNPNQ +  P +AP+ KPWEVGQ QN+SS  +QSQ S +      QDN  N   NG S+ 
Sbjct  343  PNPNQQLSNPRLAPRAKPWEVGQAQNNSSQVLQSQVSSEGLNSSIQDNGLNYLSNGDSTV  402

Query  522  PWW---QRKNARITEIESEDEQKFGGPSGVPTNERppprswvp--pqpppvamaeaaaai  358
              W   QRKN RITEI++E     GG  G+ T E+P         P  PP     AAA  
Sbjct  403  SRWQQQQRKNPRITEIDNEVN---GGSYGIRTREQPVQPVQRTWVPPQPPPVAMAAAAEA  459

Query  357  rqPKKSSLPKDQLTDDQLLGRSSEI-------SDDLERITKISESGGFGE  229
             +  K  + K+QL +D      SE+       +D+L+RITKI+ESGG  E
Sbjct  460  IRRPKPPVQKEQLGNDLPFSHPSEVTDGPSQGTDELQRITKIAESGGAPE  509



>gb|KJB53151.1| hypothetical protein B456_008G295200 [Gossypium raimondii]
Length=416

 Score =   100 bits (248),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 128/221 (58%), Gaps = 14/221 (6%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqppn  688
            ++Q Y NG VD D      SS P     PPHPKSYMEIM M+QRGE+P N+R++ND PPN
Sbjct  183  TKQTYPNGKVDIDV-LSARSSSPPVSAEPPHPKSYMEIMAMIQRGEKPSNIREVNDMPPN  241

Query  687  pnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQ---FNGSSSTPW  517
            PNQ I  P + P+ KPWE    QN SS  +QSQ S  A G   QDN      +  SSTPW
Sbjct  242  PNQQISNPRITPRSKPWE---AQNGSSQVLQSQRS--AEGLNRQDNGLNYLVDDESSTPW  296

Query  516  WQRKNARITEIESEDEQKF---GGPSGVPTNERppprswvppqpppvamaeaaaairqPK  346
            WQRKN RITEIE+E+E +     GP GV T +        P  PP      A A  R   
Sbjct  297  WQRKNVRITEIENENENEVKAAAGPYGVRTEQPVQRTWVPPQPPPVAIPEAAEAIRRPKP  356

Query  345  KSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEAN  223
             +S  K+Q  D+Q +   +E  D+L+RITKISESGG  E N
Sbjct  357  LAS--KEQSADEQSMVHPAEPIDELQRITKISESGGSVEMN  395



>gb|KJB53147.1| hypothetical protein B456_008G295200 [Gossypium raimondii]
Length=528

 Score =   100 bits (248),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 128/221 (58%), Gaps = 14/221 (6%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqppn  688
            ++Q Y NG VD D      SS P     PPHPKSYMEIM M+QRGE+P N+R++ND PPN
Sbjct  295  TKQTYPNGKVDIDV-LSARSSSPPVSAEPPHPKSYMEIMAMIQRGEKPSNIREVNDMPPN  353

Query  687  pnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQ---FNGSSSTPW  517
            PNQ I  P + P+ KPWE    QN SS  +QSQ S  A G   QDN      +  SSTPW
Sbjct  354  PNQQISNPRITPRSKPWE---AQNGSSQVLQSQRS--AEGLNRQDNGLNYLVDDESSTPW  408

Query  516  WQRKNARITEIESEDEQKF---GGPSGVPTNERppprswvppqpppvamaeaaaairqPK  346
            WQRKN RITEIE+E+E +     GP GV T +        P  PP      A A  R   
Sbjct  409  WQRKNVRITEIENENENEVKAAAGPYGVRTEQPVQRTWVPPQPPPVAIPEAAEAIRRPKP  468

Query  345  KSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEAN  223
             +S  K+Q  D+Q +   +E  D+L+RITKISESGG  E N
Sbjct  469  LAS--KEQSADEQSMVHPAEPIDELQRITKISESGGSVEMN  507



>gb|KJB53150.1| hypothetical protein B456_008G295200 [Gossypium raimondii]
Length=529

 Score =   100 bits (248),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 128/221 (58%), Gaps = 14/221 (6%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqppn  688
            ++Q Y NG VD D      SS P     PPHPKSYMEIM M+QRGE+P N+R++ND PPN
Sbjct  296  TKQTYPNGKVDIDV-LSARSSSPPVSAEPPHPKSYMEIMAMIQRGEKPSNIREVNDMPPN  354

Query  687  pnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQ---FNGSSSTPW  517
            PNQ I  P + P+ KPWE    QN SS  +QSQ S  A G   QDN      +  SSTPW
Sbjct  355  PNQQISNPRITPRSKPWE---AQNGSSQVLQSQRS--AEGLNRQDNGLNYLVDDESSTPW  409

Query  516  WQRKNARITEIESEDEQKF---GGPSGVPTNERppprswvppqpppvamaeaaaairqPK  346
            WQRKN RITEIE+E+E +     GP GV T +        P  PP      A A  R   
Sbjct  410  WQRKNVRITEIENENENEVKAAAGPYGVRTEQPVQRTWVPPQPPPVAIPEAAEAIRRPKP  469

Query  345  KSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEAN  223
             +S  K+Q  D+Q +   +E  D+L+RITKISESGG  E N
Sbjct  470  LAS--KEQSADEQSMVHPAEPIDELQRITKISESGGSVEMN  508



>gb|KJB53148.1| hypothetical protein B456_008G295200 [Gossypium raimondii]
Length=470

 Score = 99.4 bits (246),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 128/221 (58%), Gaps = 14/221 (6%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqppn  688
            ++Q Y NG VD D      SS P     PPHPKSYMEIM M+QRGE+P N+R++ND PPN
Sbjct  237  TKQTYPNGKVDIDV-LSARSSSPPVSAEPPHPKSYMEIMAMIQRGEKPSNIREVNDMPPN  295

Query  687  pnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQ---FNGSSSTPW  517
            PNQ I  P + P+ KPWE    QN SS  +QSQ S  A G   QDN      +  SSTPW
Sbjct  296  PNQQISNPRITPRSKPWE---AQNGSSQVLQSQRS--AEGLNRQDNGLNYLVDDESSTPW  350

Query  516  WQRKNARITEIESEDEQKF---GGPSGVPTNERppprswvppqpppvamaeaaaairqPK  346
            WQRKN RITEIE+E+E +     GP GV T +        P  PP      A A  R   
Sbjct  351  WQRKNVRITEIENENENEVKAAAGPYGVRTEQPVQRTWVPPQPPPVAIPEAAEAIRRPKP  410

Query  345  KSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEAN  223
             +S  K+Q  D+Q +   +E  D+L+RITKISESGG  E N
Sbjct  411  LAS--KEQSADEQSMVHPAEPIDELQRITKISESGGSVEMN  449



>gb|KHG28313.1| Peroxisomal membrane PEX14 -like protein [Gossypium arboreum]
Length=528

 Score = 99.8 bits (247),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 107/221 (48%), Positives = 127/221 (57%), Gaps = 14/221 (6%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqppn  688
            ++Q Y NG VD D      SS P     PPHPKSYMEIM M+QRGE+P N+R++ND PPN
Sbjct  295  TKQTYPNGKVDIDV-LSARSSSPPVSAEPPHPKSYMEIMAMIQRGEKPSNIREVNDMPPN  353

Query  687  pnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQ---FNGSSSTPW  517
            PNQ I  P + P+ KPWE    QN SS  +QSQ S  A G   QDN      +  SSTPW
Sbjct  354  PNQQISNPRITPRSKPWE---AQNGSSQVLQSQRS--AEGLNRQDNGLNYLVDDESSTPW  408

Query  516  WQRKNARITEIESEDEQKF---GGPSGVPTNERppprswvppqpppvamaeaaaairqPK  346
            WQRKN RITEIE+E+E +     GP GV T +        P  PP      A A  R   
Sbjct  409  WQRKNVRITEIENENENEVKAAAGPYGVRTEQPVQRTWVPPQPPPVAIPEAAEAIRRPKP  468

Query  345  KSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGEAN  223
             +S  K+Q  D+Q     SE  D+L+RITKISESGG  E N
Sbjct  469  LAS--KEQSADEQSTVHPSEPIDELQRITKISESGGSVEMN  507



>ref|XP_007155425.1| hypothetical protein PHAVU_003G200200g [Phaseolus vulgaris]
 gb|ESW27419.1| hypothetical protein PHAVU_003G200200g [Phaseolus vulgaris]
Length=498

 Score = 99.0 bits (245),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 97/212 (46%), Positives = 129/212 (61%), Gaps = 27/212 (13%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrsss--pptsveppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            S+Q   NG  D D RSVRSSS           HPKSYMEIM MVQRGE+P N+R      
Sbjct  285  SKQLIVNGKADHDLRSVRSSSPPASVEPSSGLHPKSYMEIMAMVQRGEKPSNIR------  338

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWW  514
                             PWEVGQ Q++S+  +QSQ +G+      QD +  NG    PWW
Sbjct  339  -----------------PWEVGQVQSTSTQMLQSQVNGEDLNTKTQDTSLVNGDDPLPWW  381

Query  513  QRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSL  334
            QRKN RITEI++E+E   G P    ++++P  R WVPPQPPP+AMA AA AIR+PK+ + 
Sbjct  382  QRKNVRITEIDNENESN-GVPFAAASSQQPVQRVWVPPQPPPIAMAGAAEAIRRPKQVA-  439

Query  333  PKDQLTDDQLLGRSSEISDDLERITKISESGG  238
             K+Q++D+Q +  SS+ SDD++R++K+ ES G
Sbjct  440  QKEQMSDNQSVAHSSDSSDDVQRVSKLLESEG  471



>ref|XP_004138109.1| PREDICTED: peroxisomal membrane protein PEX14 [Cucumis sativus]
 gb|KGN63582.1| hypothetical protein Csa_1G004940 [Cucumis sativus]
Length=521

 Score = 89.0 bits (219),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 89/213 (42%), Positives = 122/213 (57%), Gaps = 11/213 (5%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqppn  688
            S+Q Y+NG VD   +    ++P      P     YMEIM M+QRGE+P N+RDI+D PPN
Sbjct  293  SKQPYSNGKVDPSLQPATFATPAEPSVAPHPKS-YMEIMAMIQRGEKPSNIRDIDDLPPN  351

Query  687  pnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQF---NGSSSTPW  517
            PNQP   P +AP+ KPWEVG TQN+   F QSQ   D S      NN     N + S PW
Sbjct  352  PNQPPTNPRLAPRAKPWEVG-TQNNPGFFPQSQ--EDTSLNSLVQNNGVTYENDNGSVPW  408

Query  516  WQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSS  337
            WQ++N   TEI++ +E K G  +G+  +   P +    P  PP      AA   +  K +
Sbjct  409  WQKRNVNTTEIDN-NELKAGSSNGL--SAEKPVQRAWVPPQPPPVALPEAAEAIRRPKPT  465

Query  336  LPKDQLTDDQLLGRSSEISDDLERITKISESGG  238
            + K+Q TD+Q L  +  ++D+L++ TKISESGG
Sbjct  466  IQKEQFTDEQ-LATTPNVTDELQKATKISESGG  497



>gb|KJB53149.1| hypothetical protein B456_008G295200 [Gossypium raimondii]
Length=494

 Score = 88.6 bits (218),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 87/185 (47%), Positives = 108/185 (58%), Gaps = 13/185 (7%)
 Frame = -3

Query  759  EIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSG  580
            +IM M+QRGE+P N+R++ND PPNPNQ I  P + P+ KPWE    QN SS  +QSQ S 
Sbjct  296  KIMAMIQRGEKPSNIREVNDMPPNPNQQISNPRITPRSKPWE---AQNGSSQVLQSQRS-  351

Query  579  DASGFGFQDNNQ---FNGSSSTPWWQRKNARITEIESEDEQKF---GGPSGVPTNERppp  418
             A G   QDN      +  SSTPWWQRKN RITEIE+E+E +     GP GV T +    
Sbjct  352  -AEGLNRQDNGLNYLVDDESSTPWWQRKNVRITEIENENENEVKAAAGPYGVRTEQPVQR  410

Query  417  rswvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISESGG  238
                P  PP      A A  R    +S  K+Q  D+Q +   +E  D+L+RITKISESGG
Sbjct  411  TWVPPQPPPVAIPEAAEAIRRPKPLAS--KEQSADEQSMVHPAEPIDELQRITKISESGG  468

Query  237  FGEAN  223
              E N
Sbjct  469  SVEMN  473



>ref|XP_007155424.1| hypothetical protein PHAVU_003G200200g [Phaseolus vulgaris]
 gb|ESW27418.1| hypothetical protein PHAVU_003G200200g [Phaseolus vulgaris]
Length=506

 Score = 88.6 bits (218),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 101/143 (71%), Gaps = 2/143 (1%)
 Frame = -3

Query  666  PLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWWQRKNARITE  487
            PL+ P+ KPWEVGQ Q++S+  +QSQ +G+      QD +  NG    PWWQRKN RITE
Sbjct  339  PLLVPRSKPWEVGQVQSTSTQMLQSQVNGEDLNTKTQDTSLVNGDDPLPWWQRKNVRITE  398

Query  486  IESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSLPKDQLTDDQ  307
            I++E+E   G P    ++++P  R WVPPQPPP+AMA AA AIR+PK+ +  K+Q++D+Q
Sbjct  399  IDNENESN-GVPFAAASSQQPVQRVWVPPQPPPIAMAGAAEAIRRPKQVAQ-KEQMSDNQ  456

Query  306  LLGRSSEISDDLERITKISESGG  238
             +  SS+ SDD++R++K+ ES G
Sbjct  457  SVAHSSDSSDDVQRVSKLLESEG  479



>ref|XP_008464562.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X2 [Cucumis 
melo]
Length=521

 Score = 87.4 bits (215),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 124/213 (58%), Gaps = 11/213 (5%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqppn  688
            S+Q Y+NG VD   +    ++P      P     Y EIM M+QRGE+P N+RDI+D PPN
Sbjct  293  SKQPYSNGKVDPSLQPATFATPVEPSVAPHPKS-YTEIMAMIQRGEKPSNIRDIDDSPPN  351

Query  687  pnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQF---NGSSSTPW  517
            PNQP   P +AP+ KPWEVG TQN+   F QSQ   DAS      NN     N ++S PW
Sbjct  352  PNQPPSNPRLAPRAKPWEVG-TQNNPGFFPQSQ--EDASLNSLVQNNGVTYENDNASVPW  408

Query  516  WQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSS  337
            WQ++N   TEI++ +E K G  +G+  +   P +    P  PP      AA   +  K +
Sbjct  409  WQKRNINTTEIDN-NELKVGSSNGL--SAEKPVQRAWVPPQPPPVALPEAAEAIRRPKPT  465

Query  336  LPKDQLTDDQLLGRSSEISDDLERITKISESGG  238
            + K+Q TD+QL  + + ++D+L++ TKISE+GG
Sbjct  466  IQKEQFTDEQLATQPN-VTDELQKATKISEAGG  497



>ref|XP_008464561.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X1 [Cucumis 
melo]
Length=523

 Score = 87.4 bits (215),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 88/213 (41%), Positives = 124/213 (58%), Gaps = 11/213 (5%)
 Frame = -3

Query  867  SQQXYANGXVDTDARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqppn  688
            S+Q Y+NG VD   +    ++P      P     Y EIM M+QRGE+P N+RDI+D PPN
Sbjct  295  SKQPYSNGKVDPSLQPATFATPVEPSVAPHPKS-YTEIMAMIQRGEKPSNIRDIDDSPPN  353

Query  687  pnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQF---NGSSSTPW  517
            PNQP   P +AP+ KPWEVG TQN+   F QSQ   DAS      NN     N ++S PW
Sbjct  354  PNQPPSNPRLAPRAKPWEVG-TQNNPGFFPQSQ--EDASLNSLVQNNGVTYENDNASVPW  410

Query  516  WQRKNARITEIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSS  337
            WQ++N   TEI++ +E K G  +G+  +   P +    P  PP      AA   +  K +
Sbjct  411  WQKRNINTTEIDN-NELKVGSSNGL--SAEKPVQRAWVPPQPPPVALPEAAEAIRRPKPT  467

Query  336  LPKDQLTDDQLLGRSSEISDDLERITKISESGG  238
            + K+Q TD+QL  + + ++D+L++ TKISE+GG
Sbjct  468  IQKEQFTDEQLATQPN-VTDELQKATKISEAGG  499



>ref|XP_010678761.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=528

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 112/192 (58%), Gaps = 18/192 (9%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            Y EIM MVQRGERPPN+RDI+D+ PNPNQPI  P +APK KPWE GQT +SSS    SQ 
Sbjct  325  YAEIMAMVQRGERPPNVRDIDDRAPNPNQPISNPSLAPKAKPWEAGQTGSSSSFASPSQF  384

Query  585  SGDASGFGFQDNN---QFNGSSSTPWWQRKNARITEIESEDEQKFG-GPSGV----PTNE  430
            +        QDN    Q+N  S    WQ+KNARI+EIE+ D QKFG G SG     PT  
Sbjct  385  TTGGVNIT-QDNGATYQYNNDSFASSWQQKNARISEIENGDSQKFGSGSSGTVNIGPTQR  443

Query  429  RppprswvppqpppvamaeaaaairqPKKSSLPKD-QLTDDQLLGR-SSEISDDLERITK  256
            R          P P  ++   AA+   +  S PKD  L  ++   +  +   ++L+RIT+
Sbjct  444  R-------WVPPTPPPVSMPEAAVAIRQPKSTPKDVNLKAEEAAAQPVTNGLEELQRITQ  496

Query  255  ISESGGFGEANG  220
            ISESGG  E NG
Sbjct  497  ISESGGQVEMNG  508



>ref|XP_010678760.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=530

 Score = 86.3 bits (212),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 90/192 (47%), Positives = 112/192 (58%), Gaps = 18/192 (9%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            Y EIM MVQRGERPPN+RDI+D+ PNPNQPI  P +APK KPWE GQT +SSS    SQ 
Sbjct  327  YAEIMAMVQRGERPPNVRDIDDRAPNPNQPISNPSLAPKAKPWEAGQTGSSSSFASPSQF  386

Query  585  SGDASGFGFQDNN---QFNGSSSTPWWQRKNARITEIESEDEQKFG-GPSGV----PTNE  430
            +        QDN    Q+N  S    WQ+KNARI+EIE+ D QKFG G SG     PT  
Sbjct  387  TTGGVNIT-QDNGATYQYNNDSFASSWQQKNARISEIENGDSQKFGSGSSGTVNIGPTQR  445

Query  429  RppprswvppqpppvamaeaaaairqPKKSSLPKD-QLTDDQLLGR-SSEISDDLERITK  256
            R          P P  ++   AA+   +  S PKD  L  ++   +  +   ++L+RIT+
Sbjct  446  R-------WVPPTPPPVSMPEAAVAIRQPKSTPKDVNLKAEEAAAQPVTNGLEELQRITQ  498

Query  255  ISESGGFGEANG  220
            ISESGG  E NG
Sbjct  499  ISESGGQVEMNG  510



>gb|KHN19307.1| Peroxisomal membrane protein PEX14 [Glycine soja]
Length=501

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 67/107 (63%), Gaps = 10/107 (9%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIM M+QRGE+P N+R+I+D  PNP Q    P +AP+ KPWEV Q QN+S+  +  Q 
Sbjct  320  YMEIMAMIQRGEKPSNIREIDDSAPNPYQQPSNPRLAPRAKPWEVSQVQNTSTQVLPYQV  379

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEIESEDEQKFGGPSG  445
            +G       QD    NG ++ PWWQ KN RI EI++E E   G P+ 
Sbjct  380  NGK-----IQD----NGDNTVPWWQTKNVRIKEIDNEIEYN-GAPAA  416



>gb|ACU21367.1| unknown [Glycine max]
Length=503

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 67/107 (63%), Gaps = 10/107 (9%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIM M+QRGE+P N+R+I+D  PNP Q    P +AP+ KPWEV Q QN+S+  +  Q 
Sbjct  322  YMEIMAMIQRGEKPSNIREIDDSAPNPYQQPSNPRLAPRAKPWEVSQVQNTSTQVLPYQV  381

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEIESEDEQKFGGPSG  445
            +G       QD    NG ++ PWWQ KN RI EI++E E   G P+ 
Sbjct  382  NGK-----IQD----NGDNTVPWWQTKNVRIKEIDNEIEYN-GAPAA  418



>ref|XP_010546025.1| PREDICTED: peroxisomal membrane protein PEX14 [Tarenaya hassleriana]
Length=516

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 90/219 (41%), Positives = 114/219 (52%), Gaps = 28/219 (13%)
 Frame = -3

Query  867  SQQXYANGXVDTDARs--vrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqp  694
            +++ YANG  D D RS    S         PPHPKSYMEIM M+QRGE+PPN+RDIND P
Sbjct  296  TRRPYANGSADYDNRSGRSASPPARVDPAVPPHPKSYMEIMAMIQRGEKPPNIRDINDMP  355

Query  693  pnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWW  514
            PNPNQ    P +AP+ KPW+ GQ Q+ S N                        SS PWW
Sbjct  356  PNPNQQPSNPRIAPRAKPWDSGQVQDESFN---------------------PDRSSAPWW  394

Query  513  QRKNARITEIESE-----DEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqP  349
            QRKN RITE  +E       Q   G    P  ++       PP       AEA    +QP
Sbjct  395  QRKNPRITEPGNETGSFGSYQSETGTKEQPAIQQRAWVPPQPPPVVMAEAAEAIRRPKQP  454

Query  348  KKSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGFG  232
              + + ++   DDQ    SS ++D+L++ITK+SESGG G
Sbjct  455  PPAKVDQEAAGDDQTGSSSSGVTDELQKITKVSESGGEG  493



>ref|XP_006439814.1| hypothetical protein CICLE_v10024320mg, partial [Citrus clementina]
 gb|ESR53054.1| hypothetical protein CICLE_v10024320mg, partial [Citrus clementina]
Length=419

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 84/120 (70%), Gaps = 5/120 (4%)
 Frame = -3

Query  864  QQXYANGXVDTDARsvrsssppts--veppphpkSYMEIMEMVQRGERPPNMRdindqpp  691
            +Q YANG  D D RSVRSSSPP +      PHPKSYMEIM MVQRGE+PPN+RDIND PP
Sbjct  300  KQPYANGKADFDMRSVRSSSPPAAGEPTVAPHPKSYMEIMAMVQRGEKPPNIRDINDLPP  359

Query  690  npnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQD---NNQFNGSSSTP  520
            NP+Q +P P +APK KPWEVGQ QN+S   IQSQ S +   F  QD   N+Q +  SS P
Sbjct  360  NPSQQLPNPRLAPKAKPWEVGQAQNASGQVIQSQVSAEGLNFKVQDNGLNHQSDDDSSVP  419



>gb|KHN18459.1| Peroxisomal membrane protein PEX14 [Glycine soja]
Length=496

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 103/179 (58%), Gaps = 25/179 (14%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            Y EIM MVQRGE+  N+R                       PWEV Q Q++S+  +QSQ 
Sbjct  319  YAEIMAMVQRGEKSSNIR-----------------------PWEVSQVQSTSTQMLQSQV  355

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEIESEDEQKFGGPSGVPTNERppprswv  406
            +G+      QD    NG  S PWWQRKN RI EI++E+E   G P    +N++P  R WV
Sbjct  356  NGEDLNTKAQDTPLVNGDDSLPWWQRKNVRIREIDNENESN-GVPYASASNQQPVQRVWV  414

Query  405  ppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGE  229
            PPQPPP+AM EAA AIR+PK ++  K+Q++D+Q +  S + SDD+    K+ ES G  E
Sbjct  415  PPQPPPIAMPEAAEAIRRPKPAA-QKEQVSDNQSVAHSLDSSDDVHMAPKLLESEGAVE  472



>ref|XP_006600647.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X1 
[Glycine max]
Length=496

 Score = 82.8 bits (203),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 103/179 (58%), Gaps = 25/179 (14%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            Y EIM MVQRGE+  N+R                       PWEV Q Q++S+  +QSQ 
Sbjct  319  YAEIMAMVQRGEKSSNIR-----------------------PWEVSQVQSTSTQMLQSQV  355

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEIESEDEQKFGGPSGVPTNERppprswv  406
            +G+      QD    NG  S PWWQRKN RI EI++E+E   G P    +N++P  R WV
Sbjct  356  NGEDLNTKAQDTPLVNGDDSLPWWQRKNVRIREIDNENESN-GVPYASASNQQPVQRVWV  414

Query  405  ppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSEISDDLERITKISESGGFGE  229
            PPQPPP+AM EAA AIR+PK ++  K+Q++D+Q +  S + SDD+    K+ ES G  E
Sbjct  415  PPQPPPIAMPEAAEAIRRPKPAA-QKEQVSDNQSVAHSLDSSDDVHMAPKLLESEGAVE  472



>ref|XP_008806902.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X1 
[Phoenix dactylifera]
Length=554

 Score = 70.5 bits (171),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 55/105 (52%), Positives = 71/105 (68%), Gaps = 5/105 (5%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNF-IQSQ  589
            ++EIMEMVQRGE+PPN+++I+D PPNPNQPIP PL+AP+ KPWE  Q       + + SQ
Sbjct  343  FIEIMEMVQRGEKPPNIKEIDDMPPNPNQPIPSPLMAPRVKPWECTQQAQQRPIYGLHSQ  402

Query  588  GSGD-ASGFGFQDNNQFNGSS---STPWWQRKNARITEIESEDEQ  466
             S    S    +DN+Q  G S   S P W+RK  RITEIESE ++
Sbjct  403  ASSQGVSSKVKEDNSQQYGRSSDGSEPSWRRKTVRITEIESEADE  447



>ref|XP_006600648.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X2 
[Glycine max]
Length=481

 Score = 70.1 bits (170),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 90/139 (65%), Gaps = 2/139 (1%)
 Frame = -3

Query  645  KPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWWQRKNARITEIESEDEQ  466
            +PWEV Q Q++S+  +QSQ +G+      QD    NG  S PWWQRKN RI EI++E+E 
Sbjct  321  EPWEVSQVQSTSTQMLQSQVNGEDLNTKAQDTPLVNGDDSLPWWQRKNVRIREIDNENES  380

Query  465  KFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRSSE  286
              G P    +N++P  R WVPPQPPP+AM EAA AIR+PK ++  K+Q++D+Q +  S +
Sbjct  381  N-GVPYASASNQQPVQRVWVPPQPPPIAMPEAAEAIRRPKPAA-QKEQVSDNQSVAHSLD  438

Query  285  ISDDLERITKISESGGFGE  229
             SDD+    K+ ES G  E
Sbjct  439  SSDDVHMAPKLLESEGAVE  457



>gb|KHN34311.1| Peroxisomal membrane protein PEX14 [Glycine soja]
Length=484

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 85/182 (47%), Gaps = 27/182 (15%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            Y EIM MVQRGE+  N+                       K  EV Q Q++S+  +QSQ 
Sbjct  303  YAEIMAMVQRGEKSSNI-----------------------KHREVSQVQSTSTQMLQSQV  339

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEIESEDEQKFGGPSGVPTNERppprswv  406
            +G+       D    NG    PWWQRKN RI EI++E+E   G P+G  ++++P  +   
Sbjct  340  NGEDLNTKALDAPLLNGDDPLPWWQRKNVRIREIDNENESN-GVPNGAASSQQPIQQPVQ  398

Query  405  ppqpppvamaeaaaairqPKKSSLP---KDQLTDDQLLGRSSEISDDLERITKISESGGF  235
                PP     A     +  +   P   K+Q++D+Q +  S + SDD+    K+ ES G 
Sbjct  399  RVWVPPQPPPIAMPEAAEAIRRPKPAAQKEQMSDNQSVAHSLDGSDDVHMDPKLLESEGA  458

Query  234  GE  229
             E
Sbjct  459  VE  460



>ref|XP_006579567.1| PREDICTED: peroxisomal membrane protein PEX14-like [Glycine max]
Length=500

 Score = 67.0 bits (162),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 58/182 (32%), Positives = 85/182 (47%), Gaps = 27/182 (15%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            Y EIM MVQRGE+  N+                       K  EV Q Q++S+  +QSQ 
Sbjct  319  YAEIMAMVQRGEKSSNI-----------------------KHREVSQVQSTSTQMLQSQV  355

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEIESEDEQKFGGPSGVPTNERppprswv  406
            +G+       D    NG    PWWQRKN RI EI++E+E   G P+G  ++++P  +   
Sbjct  356  NGEDLNTKALDAPLLNGDDPLPWWQRKNVRIREIDNENESN-GVPNGAASSQQPIQQPVQ  414

Query  405  ppqpppvamaeaaaairqPKKSSLP---KDQLTDDQLLGRSSEISDDLERITKISESGGF  235
                PP     A     +  +   P   K+Q++D+Q +  S + SDD+    K+ ES G 
Sbjct  415  RVWVPPQPPPIAMPEAAEAIRRPKPAAQKEQMSDNQSVAHSLDGSDDVHMDPKLLESEGA  474

Query  234  GE  229
             E
Sbjct  475  VE  476



>ref|XP_008464563.1| PREDICTED: peroxisomal membrane protein PEX14 isoform X3 [Cucumis 
melo]
Length=508

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 83/144 (58%), Gaps = 10/144 (7%)
 Frame = -3

Query  660  VAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQF---NGSSSTPWWQRKNARIT  490
            +AP+ KPWEVG TQN+   F QSQ   DAS      NN     N ++S PWWQ++N   T
Sbjct  348  LAPRAKPWEVG-TQNNPGFFPQSQE--DASLNSLVQNNGVTYENDNASVPWWQKRNINTT  404

Query  489  EIESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSLPKDQLTDD  310
            EI++ +E K G  +G+  +   P +    P  PP      AA   +  K ++ K+Q TD+
Sbjct  405  EIDN-NELKVGSSNGL--SAEKPVQRAWVPPQPPPVALPEAAEAIRRPKPTIQKEQFTDE  461

Query  309  QLLGRSSEISDDLERITKISESGG  238
            QL  + + ++D+L++ TKISE+GG
Sbjct  462  QLATQPN-VTDELQKATKISEAGG  484



>ref|XP_007044650.1| Peroxin 14-like protein isoform 1 [Theobroma cacao]
 gb|EOY00482.1| Peroxin 14-like protein isoform 1 [Theobroma cacao]
Length=398

 Score = 64.7 bits (156),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 62/96 (65%), Gaps = 12/96 (13%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEI+ M+QRGE+PP ++DI+D PPNP+QP+P P + P+ KPWE+ Q+QN    F  ++ 
Sbjct  292  YMEILAMIQRGEKPPGIKDIDDSPPNPDQPLPNPSITPRIKPWEMAQSQN---KFGYTRD  348

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEIES  478
             G A         Q NG ++ PWW+R N    EIE+
Sbjct  349  KGSA---------QLNGENAQPWWRRDNTNAREIEA  375



>ref|XP_010924260.1| PREDICTED: peroxisomal membrane protein PEX14-like [Elaeis guineensis]
Length=552

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 70/107 (65%), Gaps = 6/107 (6%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVG-QTQNSSSNFIQSQ  589
            + EIMEMVQRGE+PPN+++IND PPNPNQPIP PL+AP+ KPWE   Q Q    + +QSQ
Sbjct  341  FFEIMEMVQRGEKPPNIKEINDMPPNPNQPIPRPLMAPRVKPWECTQQAQQRPIDGLQSQ  400

Query  588  GSGD-ASGFGFQDNNQFNG---SSSTPWWQRKNARITEIESE-DEQK  463
             S    S    +DN+Q  G     S    +RK  RITEIESE DE K
Sbjct  401  ASSQGVSSEVKEDNSQRYGRFSDGSEVLGRRKTVRITEIESEADEPK  447



>emb|CDY00328.1| BnaA06g22290D [Brassica napus]
Length=518

 Score = 62.8 bits (151),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 90/186 (48%), Gaps = 33/186 (18%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YM+IM M+QRGE+P N+R+IND PPNPNQ +  P +APK KPW+ GQ             
Sbjct  341  YMDIMSMIQRGEKPSNIREINDMPPNPNQQLSNPRIAPKSKPWDYGQAP-----------  389

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEI--ESEDEQKFGGPSGVPTNERppprs  412
                     QD N  NG    PWWQ+KN R T+   E+   +  G  +   T E      
Sbjct  390  ---------QDENA-NG----PWWQQKNPRSTDFGYETTASRSIGIQNETNTMEPAALPR  435

Query  411  wvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRS---SEISDDLERITKISESG  241
                 PP       A A    ++   PK Q   DQ    S   S +SD+L++ITK SE+G
Sbjct  436  QRSWVPPQPPPVVMAEAAEAIRR---PKPQAKIDQEAAASDDQSGVSDELQKITKFSETG  492

Query  240  GFGEAN  223
            G G  N
Sbjct  493  GDGSGN  498



>ref|XP_009151402.1| PREDICTED: peroxisomal membrane protein PEX14 [Brassica rapa]
Length=518

 Score = 62.4 bits (150),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 70/186 (38%), Positives = 90/186 (48%), Gaps = 33/186 (18%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YM+IM M+QRGE+P N+R+IND PPNPNQ +  P +APK KPW+ GQ             
Sbjct  341  YMDIMSMIQRGEKPSNIREINDMPPNPNQQLSNPRIAPKSKPWDYGQAP-----------  389

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEI--ESEDEQKFGGPSGVPTNERppprs  412
                     QD N  NG    PWWQ+KN R T+   E+   +  G  +   T E      
Sbjct  390  ---------QDENA-NG----PWWQQKNPRSTDFGYETTASRSIGIQNETNTMEPAALPR  435

Query  411  wvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRS---SEISDDLERITKISESG  241
                 PP       A A    ++   PK Q   DQ    S   S +SD+L++ITK SE+G
Sbjct  436  QRSWVPPQPPPVVMAEAAEAIRR---PKPQAKIDQEAAASDDQSGVSDELQKITKFSETG  492

Query  240  GFGEAN  223
            G G  N
Sbjct  493  GDGSGN  498



>emb|CDX78267.1| BnaA09g34620D [Brassica napus]
Length=339

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 111/220 (50%), Gaps = 41/220 (19%)
 Frame = -3

Query  855  YANGX-VDTD---ARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqppn  688
            YANG  +D D   ARS    +PP     PPHPKSYM+IM M+QRGE+P N+R+IND PPN
Sbjct  126  YANGSNIDYDSRSARSTSPPAPPADSSQPPHPKSYMDIMSMIQRGEKPSNIREINDMPPN  185

Query  687  pnqpiPEPLVAPKPKPWEVGQT-QNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWWQ  511
            PNQ +P P +APK KPW+ GQ  Q+ SSN                           PWWQ
Sbjct  186  PNQQLPNPRIAPKAKPWDYGQPPQDESSN--------------------------GPWWQ  219

Query  510  RKNARITEI--ESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSS  337
            +KN R  +   E+   +  G  +   T E    +      PP         A    ++  
Sbjct  220  QKNPRSADFGYETTTARSIGIRNETSTTEPAAIQKQRSWVPPQPPPVVMPEAAEAIRR--  277

Query  336  LPKDQLTDDQ-LLGRSSE----ISDDLERITKISESGGFG  232
             PK Q   DQ ++  +S+    +SD+L+++TK SESGG G
Sbjct  278  -PKPQAKIDQEVVAAASDDQSGVSDELQKVTKFSESGGDG  316



>emb|CDY56742.1| BnaC09g50920D [Brassica napus]
Length=504

 Score = 60.5 bits (145),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 111/220 (50%), Gaps = 41/220 (19%)
 Frame = -3

Query  855  YANGX-VDTD---ARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqppn  688
            YANG  VD D   ARS    +PP     PPHPKSYM+IM M+QRGE+P N+R+IND PPN
Sbjct  291  YANGSNVDYDTRSARSTSPPAPPADSSQPPHPKSYMDIMSMIQRGEKPSNIREINDMPPN  350

Query  687  pnqpiPEPLVAPKPKPWEVGQT-QNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWWQ  511
            PNQ +P P +APK KPW+ GQ  Q+ SSN                           PWWQ
Sbjct  351  PNQQLPNPRIAPKAKPWDYGQPPQDESSN--------------------------GPWWQ  384

Query  510  RKNARITEI--ESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSS  337
            +KN R  +   E+   +  G  +   T E    +      PP         A    ++  
Sbjct  385  QKNPRSADFGYETTTARSIGIRNETSTTEPAAIQKQRSWVPPQPPPVVMPEAAEAIRR--  442

Query  336  LPKDQLTDDQ-LLGRSSE----ISDDLERITKISESGGFG  232
             PK Q   DQ ++  +S+    +SD+L+++TK SESGG G
Sbjct  443  -PKPQAKIDQEVVAAASDDQSGVSDELQKVTKFSESGGDG  481



>emb|CDY16758.1| BnaA09g06240D [Brassica napus]
Length=491

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 83/220 (38%), Positives = 111/220 (50%), Gaps = 41/220 (19%)
 Frame = -3

Query  855  YANGX-VDTD---ARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqppn  688
            YANG  +D D   ARS    +PP     PPHPKSYM+IM M+QRGE+P N+R+IND PPN
Sbjct  278  YANGSNIDYDSRSARSTSPPAPPADSSQPPHPKSYMDIMSMIQRGEKPSNIREINDMPPN  337

Query  687  pnqpiPEPLVAPKPKPWEVGQT-QNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWWQ  511
            PNQ +P P +APK KPW+ GQ  Q+ SSN                           PWWQ
Sbjct  338  PNQQLPNPRIAPKAKPWDYGQPPQDESSN--------------------------GPWWQ  371

Query  510  RKNARITEI--ESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSS  337
            +KN R  +   E+   +  G  +   T E    +      PP         A    ++  
Sbjct  372  QKNPRSADFGYETTTARSIGIQNETSTTEPAAIQKQRSWVPPQPPPVVMPEAAEAIRR--  429

Query  336  LPKDQLTDDQ-LLGRSSE----ISDDLERITKISESGGFG  232
             PK Q   DQ ++  +S+    +SD+L+++TK SESGG G
Sbjct  430  -PKPQAKIDQEVVAAASDDQSGVSDELQKVTKFSESGGDG  468



>ref|XP_009112035.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X2 
[Brassica rapa]
Length=488

 Score = 60.5 bits (145),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 110/219 (50%), Gaps = 39/219 (18%)
 Frame = -3

Query  855  YANGX-VDTD---ARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqppn  688
            YANG  VD D   ARS    +PP     PPHPKSYM+IM M+QRGE+P N+R+IND PPN
Sbjct  275  YANGSNVDYDTRSARSTSPPAPPADSSQPPHPKSYMDIMSMIQRGEKPSNIREINDMPPN  334

Query  687  pnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWWQR  508
            PNQ +P P +APK KPW+ GQ                      QD      SS  PWWQ+
Sbjct  335  PNQQLPNPRIAPKAKPWDYGQPP--------------------QDE-----SSKGPWWQQ  369

Query  507  KNARITEI--ESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSL  334
            KN R  +   E+   +  G  +   T E    +      PP         A    ++   
Sbjct  370  KNPRSADFGYETTTARSIGIRNETSTTEPAAIQKQRSWVPPQPPPVVMPEAAEAIRR---  426

Query  333  PKDQLTDDQ-LLGRSSE----ISDDLERITKISESGGFG  232
            PK Q   DQ ++  +S+    +SD+L+++TK SESGG G
Sbjct  427  PKPQAKIDQEVVAAASDDQSGVSDELQKVTKFSESGGDG  465



>ref|XP_009395025.1| PREDICTED: peroxisomal membrane protein PEX14-like [Musa acuminata 
subsp. malaccensis]
Length=513

 Score = 60.1 bits (144),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 38/107 (36%), Positives = 55/107 (51%), Gaps = 28/107 (26%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNF-IQSQ  589
            YMEI+EM+QRGE+PPN+                       KPWEV Q      ++   SQ
Sbjct  335  YMEIIEMIQRGEKPPNI-----------------------KPWEVTQQAEQRLSYGRHSQ  371

Query  588  GSGDASGFGFQD-NNQFNGSSST---PWWQRKNARITEIESEDEQKF  460
             +G       ++ N+Q NGS S    PWW++K  +I+E+E E E++F
Sbjct  372  ANGQGLNSEVRETNSQPNGSHSNGSEPWWRKKTIKISEVEPESEEQF  418



>ref|XP_009112034.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X1 
[Brassica rapa]
Length=489

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 110/220 (50%), Gaps = 40/220 (18%)
 Frame = -3

Query  855  YANGX-VDTD----ARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdindqpp  691
            YANG  VD D    ARS    +PP     PPHPKSYM+IM M+QRGE+P N+R+IND PP
Sbjct  275  YANGSNVDYDTRSAARSTSPPAPPADSSQPPHPKSYMDIMSMIQRGEKPSNIREINDMPP  334

Query  690  npnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWWQ  511
            NPNQ +P P +APK KPW+ GQ                      QD      SS  PWWQ
Sbjct  335  NPNQQLPNPRIAPKAKPWDYGQPP--------------------QDE-----SSKGPWWQ  369

Query  510  RKNARITEI--ESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSS  337
            +KN R  +   E+   +  G  +   T E    +      PP         A    ++  
Sbjct  370  QKNPRSADFGYETTTARSIGIRNETSTTEPAAIQKQRSWVPPQPPPVVMPEAAEAIRR--  427

Query  336  LPKDQLTDDQ-LLGRSSE----ISDDLERITKISESGGFG  232
             PK Q   DQ ++  +S+    +SD+L+++TK SESGG G
Sbjct  428  -PKPQAKIDQEVVAAASDDQSGVSDELQKVTKFSESGGDG  466



>ref|XP_006394350.1| hypothetical protein EUTSA_v10004017mg [Eutrema salsugineum]
 gb|ESQ31636.1| hypothetical protein EUTSA_v10004017mg [Eutrema salsugineum]
Length=515

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 110/220 (50%), Gaps = 36/220 (16%)
 Frame = -3

Query  867  SQQXYANGX-VDTDARsvrssspptsveppp--hpkSYMEIMEMVQRGERPPNMRdindq  697
            +++ YANG  VD D RS RS+SPP   +     HPKSYM+IM M+QRGE+P N+R+IND 
Sbjct  301  ARKPYANGSNVDYDTRSARSASPPAPADSSMPPHPKSYMDIMSMIQRGEKPSNIREINDM  360

Query  696  ppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPW  517
            PPNPNQ +  P +APK KPW+ GQ     S+                     NGS    W
Sbjct  361  PPNPNQQLSNPRIAPKTKPWDYGQAPQDDSS---------------------NGS----W  395

Query  516  WQRKNARITEI--ESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKK  343
            WQ+K  R T+   E+   +  G  +   T E    +      PP         A    ++
Sbjct  396  WQQKTPRSTDFGYETTASRSIGIQNETNTMEPAALQRQRSWVPPQPPPVVMPEAAEAIRR  455

Query  342  SSLPKDQLTDDQLLGRS---SEISDDLERITKISESGGFG  232
               PK Q   DQ    S   S +SD+L++ITK SESGG G
Sbjct  456  ---PKPQAKIDQDAAASDDQSGVSDELQKITKFSESGGDG  492



>ref|XP_006394349.1| hypothetical protein EUTSA_v10004017mg [Eutrema salsugineum]
 gb|ESQ31635.1| hypothetical protein EUTSA_v10004017mg [Eutrema salsugineum]
Length=511

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 84/220 (38%), Positives = 110/220 (50%), Gaps = 36/220 (16%)
 Frame = -3

Query  867  SQQXYANGX-VDTDARsvrssspptsveppp--hpkSYMEIMEMVQRGERPPNMRdindq  697
            +++ YANG  VD D RS RS+SPP   +     HPKSYM+IM M+QRGE+P N+R+IND 
Sbjct  297  ARKPYANGSNVDYDTRSARSASPPAPADSSMPPHPKSYMDIMSMIQRGEKPSNIREINDM  356

Query  696  ppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPW  517
            PPNPNQ +  P +APK KPW+ GQ     S+                     NGS    W
Sbjct  357  PPNPNQQLSNPRIAPKTKPWDYGQAPQDDSS---------------------NGS----W  391

Query  516  WQRKNARITEI--ESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKK  343
            WQ+K  R T+   E+   +  G  +   T E    +      PP         A    ++
Sbjct  392  WQQKTPRSTDFGYETTASRSIGIQNETNTMEPAALQRQRSWVPPQPPPVVMPEAAEAIRR  451

Query  342  SSLPKDQLTDDQLLGRS---SEISDDLERITKISESGGFG  232
               PK Q   DQ    S   S +SD+L++ITK SESGG G
Sbjct  452  ---PKPQAKIDQDAAASDDQSGVSDELQKITKFSESGGDG  488



>gb|EPS72063.1| hypothetical protein M569_02693, partial [Genlisea aurea]
Length=401

 Score = 59.7 bits (143),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 59/95 (62%), Gaps = 22/95 (23%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEI++MV RGE+P N+R+I+D PPNPNQP+  P VAP+PKPWE           ++   
Sbjct  277  YMEILDMVSRGEKPSNIREIDDAPPNPNQPVSNPRVAPRPKPWEE----------VEDIV  326

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEIE  481
             GD            + SS+ P+W+R+N RI+EIE
Sbjct  327  DGD------------DSSSAVPYWRRRNVRISEIE  349



>gb|EYU17665.1| hypothetical protein MIMGU_mgv1a006851mg [Erythranthe guttata]
Length=429

 Score = 59.3 bits (142),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 89/155 (57%), Gaps = 29/155 (19%)
 Frame = -3

Query  666  PLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWWQRKNARITE  487
            P + PK K WEVGQ Q +S+N +Q++G             Q N   ++ WWQRKN RIT+
Sbjct  300  PPLVPKSKSWEVGQPQVNSTNILQTRG------------KQSNAEEASSWWQRKNVRITD  347

Query  486  IESEDEQKFGGPSGVPTNERppprswvppqpppvamaeaaaairqPKKSSLPKDQ--LTD  313
                         G   NERP  RSWVPP+PPPVAM EAAAAIR   K S  +++  +  
Sbjct  348  -------------GNHNNERPVQRSWVPPRPPPVAMPEAAAAIRHRNKPSNDENEGKIIG  394

Query  312  DQLLGR--SSEISDDLERITKISESGGFGEANGVT  214
            DQL     S +++D+L+ ITKISESGG  E NG T
Sbjct  395  DQLRKSTPSPDVTDELQMITKISESGGPEEVNGET  429



>gb|KFK28009.1| hypothetical protein AALP_AA8G459800 [Arabis alpina]
Length=512

 Score = 59.3 bits (142),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 70/190 (37%), Positives = 92/190 (48%), Gaps = 35/190 (18%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YM+IM M+QRGE+P N+R+IND PPNPNQ I  P +APK KPW+ GQ     S+      
Sbjct  336  YMDIMSMIQRGEKPSNIREINDMPPNPNQQISNPRIAPKSKPWDYGQAPQDESS------  389

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEI--ESEDEQKFGGPSGVPTNERppprs  412
                           NGS    WWQ+KN R T+   E+   +     +   T E    + 
Sbjct  390  ---------------NGS----WWQQKNPRSTDFGYETTASRVISNQNETNTMEPAAFQR  430

Query  411  wvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRS---SEISDDLERITKISESG  241
                 PP       A A    ++   PK Q   DQ    S   S +SD+L++ITK SESG
Sbjct  431  QRSWVPPQPPPVVMAEAAEAIRR---PKPQAKIDQETAASDDQSGVSDELQKITKFSESG  487

Query  240  GFGEANGVTQ  211
            G G  +G+ Q
Sbjct  488  GDG--SGIVQ  495



>emb|CDX84355.1| BnaC03g51450D [Brassica napus]
Length=515

 Score = 57.8 bits (138),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 88/186 (47%), Gaps = 33/186 (18%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YM+IM M+QRGE+P N+R+IND PPNPNQ +  P +APK KPW+ GQ             
Sbjct  338  YMDIMSMIQRGEKPSNIREINDMPPNPNQQLSNPRIAPKTKPWDYGQAP-----------  386

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEI--ESEDEQKFGGPSGVPTNERppprs  412
                     Q+ N  NG    PWWQ KN R  +   E+   +  G  +   T E      
Sbjct  387  ---------QEENA-NG----PWWQPKNPRSMDFGYETTASRSIGIQNETNTMEPAALPR  432

Query  411  wvppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGRS---SEISDDLERITKISESG  241
                 PP       A A    ++   PK Q   DQ    S   S +SD+L++ITK SE+G
Sbjct  433  QRSWVPPQPPPVVMAEAAEAIRR---PKPQAKIDQEAAASDDQSGVSDELQKITKFSETG  489

Query  240  GFGEAN  223
            G G  N
Sbjct  490  GDGSGN  495



>ref|XP_010444137.1| PREDICTED: peroxisomal membrane protein PEX14-like [Camelina 
sativa]
Length=514

 Score = 56.2 bits (134),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 63/186 (34%), Positives = 87/186 (47%), Gaps = 37/186 (20%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YM+IM M+QRGE+P N+R+IND PPNPNQP+  P +APK KPW+ GQ Q   S+      
Sbjct  335  YMDIMSMIQRGEKPSNIREINDMPPNPNQPLSNPRIAPKSKPWDNGQAQQDESS------  388

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEI--ESEDEQKFGGPSGVPTNERppprs  412
                           NG     WWQ+KN R T+   E+    +F        NE      
Sbjct  389  ---------------NGQ----WWQQKNPRSTDFGYETTTAARFTANQ----NETSTMEP  425

Query  411  wvppqpppvamaeaaaairqPKKSSL--PKDQLTDDQLLGRSSE----ISDDLERITKIS  250
                +       +    +      ++  PK     DQ    +S+    +SD+L++ITK S
Sbjct  426  AAFQRQRSWVPPQPPPVVMPEAAEAIRRPKPLAKIDQEAAAASDDQTGVSDELQKITKFS  485

Query  249  ESGGFG  232
            ESGG G
Sbjct  486  ESGGDG  491



>gb|KHG09973.1| Peroxisomal membrane PEX14 -like protein [Gossypium arboreum]
Length=380

 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 58/99 (59%), Gaps = 18/99 (18%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YME++  VQRGE+PP ++D +D PPNPNQP+P P + P+ +PWE+ Q QNS         
Sbjct  286  YMEVLAKVQRGEKPPGIKDTDDSPPNPNQPLPNPHITPRLQPWEIAQPQNS---------  336

Query  585  SGDASGFGFQDNNQF---NGSSSTPWWQRKNARITEIES  478
                  FG+  +  F   N  ++ PWW+R N  I  +E+
Sbjct  337  ------FGYCRDRGFSQPNRENALPWWKRNNTNIRGVEA  369



>ref|XP_006280321.1| hypothetical protein CARUB_v10026243mg [Capsella rubella]
 gb|EOA13219.1| hypothetical protein CARUB_v10026243mg [Capsella rubella]
Length=512

 Score = 55.1 bits (131),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 65/185 (35%), Positives = 87/185 (47%), Gaps = 36/185 (19%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YM+IM M+QRGE+P N+R+IND PPNPNQP+  P +APK KPW+ GQ             
Sbjct  333  YMDIMSMIQRGEKPSNIREINDMPPNPNQPLSNPRIAPKSKPWDYGQPP-----------  381

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEI--ESEDEQKFGGPSGVPTNERppprs  412
                     Q+ N  NG     WWQ+KN R T+   E+    +F        NE      
Sbjct  382  ---------QEENS-NGQ----WWQQKNPRSTDFGYETTTAARFTANQ----NETSTMEP  423

Query  411  wvppqpppvamaeaaaairqPKKSSL--PKDQLTDDQLLGRS---SEISDDLERITKISE  247
                +       +    +      ++  PK Q   DQ    S   S +SD+L++ITK SE
Sbjct  424  AAFQRQRSWVPPQPPPVVMPEAAEAIRRPKPQAKIDQDAAASDDQSGVSDELQKITKFSE  483

Query  246  SGGFG  232
            SGG G
Sbjct  484  SGGDG  488



>ref|XP_006655625.1| PREDICTED: uncharacterized protein LOC102718840 [Oryza brachyantha]
Length=358

 Score = 53.5 bits (127),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 44/81 (54%), Positives = 56/81 (69%), Gaps = 4/81 (5%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIMEM+QRGERP +++DIND PPNP+QPI E  +APKPKPWE+ Q Q SS+  ++SQ 
Sbjct  256  YMEIMEMIQRGERPDDIQDINDDPPNPDQPISESRMAPKPKPWEM-QGQESSNRELKSQS  314

Query  585  SGD---ASGFGFQDNNQFNGS  532
            +      S       NQF G+
Sbjct  315  TDTIELISEVQHDSTNQFTGT  335



>gb|AAM65879.1| unknown [Arabidopsis thaliana]
Length=252

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 73/132 (55%), Gaps = 29/132 (22%)
 Frame = -3

Query  867  SQQXYANGX-VDTD---ARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdind  700
            +++ Y NG  VD D   ARS    + P     PPHPKSYM+IM M+QRGE+P N+R+IND
Sbjct  36   ARKPYTNGSNVDYDTRSARSASPPAAPADSSAPPHPKSYMDIMSMIQRGEKPSNIREIND  95

Query  699  qppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTP  520
             PPNPNQP+ +P +APK KPW+ GQ     S+                     NG     
Sbjct  96   MPPNPNQPLSDPRIAPKSKPWDYGQAPQDESS---------------------NGQ----  130

Query  519  WWQRKNARITEI  484
            WWQ+KN R T+ 
Sbjct  131  WWQQKNPRSTDF  142



>ref|XP_010459346.1| PREDICTED: peroxisomal membrane protein PEX14 [Camelina sativa]
Length=511

 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 69/186 (37%), Positives = 92/186 (49%), Gaps = 38/186 (20%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YM+IM M+QRGE+P N+R+IND PPNPNQP+  P +APK KPW+  Q Q   S+      
Sbjct  333  YMDIMSMIQRGEKPSNIREINDMPPNPNQPLSNPRIAPKSKPWDNSQAQQDESS------  386

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEI--ESEDEQKF-GGPSGVPTNERpppr  415
                           NG     WWQ+KN R T+   E+    +F    +   T E    +
Sbjct  387  ---------------NGQ----WWQQKNPRSTDFGYETTTAARFTANQNETSTMEPAAFQ  427

Query  414  swvppqpppvamaeaaaairqPKK-SSLPK-DQ---LTDDQLLGRSSEISDDLERITKIS  250
                  PP       A A    ++   LPK DQ    +DDQ     + +SD+L++ITK S
Sbjct  428  RQRSWVPPQPPPVVMAEAAEAIRRPKPLPKMDQEAAASDDQ-----TGVSDELQKITKFS  482

Query  249  ESGGFG  232
            ESGG G
Sbjct  483  ESGGDG  488



>ref|XP_002864820.1| hypothetical protein ARALYDRAFT_496464 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41079.1| hypothetical protein ARALYDRAFT_496464 [Arabidopsis lyrata subsp. 
lyrata]
Length=515

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 44/106 (42%), Positives = 59/106 (56%), Gaps = 27/106 (25%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YM+IM M+QRGE+P N+R+IND PPNPNQP+ +P +APK KPW+ GQ +   S+      
Sbjct  333  YMDIMSMIQRGEKPSNIREINDMPPNPNQPLSDPRIAPKSKPWDYGQARQDESS------  386

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEI--ESEDEQKFGG  454
                           NG     WWQ+KN R T+   E+    +F G
Sbjct  387  ---------------NGQ----WWQQKNPRSTDFGYETTTAARFTG  413



>ref|XP_010550656.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X1 
[Tarenaya hassleriana]
 ref|XP_010550657.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X1 
[Tarenaya hassleriana]
Length=505

 Score = 53.1 bits (126),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 82/184 (45%), Gaps = 32/184 (17%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIM M+QRGE+P N+RDIND PPNPNQ    P +A + KPW+  Q Q+ S        
Sbjct  333  YMEIMAMIQRGEKPSNIRDINDMPPNPNQQPSNPRIASRAKPWDSAQVQDES--------  384

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEIESEDEQKFGGPSGVPTNERppprswv  406
                          FN   ST W Q KN R     +E    FG      + +  P     
Sbjct  385  --------------FNSDPSTKWLQPKNPRTVATATETS-SFGSHESETSAKEQPLVQKR  429

Query  405  ppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGR------SSEISDDLERITKISES  244
               PP         A    ++   PK Q   DQ  G       SS ++D+L++IT +SES
Sbjct  430  TWVPPQPPPVAMLEAAEAIRR---PKPQARVDQDEGHDLTRSGSSGVTDELQKITNVSES  486

Query  243  GGFG  232
            G  G
Sbjct  487  GDEG  490



>ref|XP_010483994.1| PREDICTED: peroxisomal membrane protein PEX14-like [Camelina 
sativa]
Length=513

 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 68/186 (37%), Positives = 91/186 (49%), Gaps = 38/186 (20%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YM+IM M+QRGE+P N+R+IND PPNPNQP+  P +APK KPW+  Q Q   S+      
Sbjct  335  YMDIMSMIQRGEKPSNIREINDMPPNPNQPLSNPRIAPKSKPWDNSQAQQDESS------  388

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEI--ESEDEQKF-GGPSGVPTNERpppr  415
                           NG     WWQ+KN R T+   E+    +F    +   T E    +
Sbjct  389  ---------------NGQ----WWQQKNPRSTDFGYETTTAARFTANQNETSTMEPAAFQ  429

Query  414  swvppqpppvamaeaaaairqPKK-SSLPK-DQ---LTDDQLLGRSSEISDDLERITKIS  250
                  PP         A    ++   LPK DQ    +DDQ     + +SD+L++ITK S
Sbjct  430  RQRSWVPPQPPPVVMPEAAEAIRRPKPLPKMDQEAAASDDQ-----TGVSDELQKITKFS  484

Query  249  ESGGFG  232
            ESGG G
Sbjct  485  ESGGDG  490



>ref|XP_010550658.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X2 
[Tarenaya hassleriana]
Length=410

 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 64/184 (35%), Positives = 82/184 (45%), Gaps = 32/184 (17%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQG  586
            YMEIM M+QRGE+P N+RDIND PPNPNQ    P +A + KPW+  Q Q+ S        
Sbjct  238  YMEIMAMIQRGEKPSNIRDINDMPPNPNQQPSNPRIASRAKPWDSAQVQDES--------  289

Query  585  SGDASGFGFQDNNQFNGSSSTPWWQRKNARITEIESEDEQKFGGPSGVPTNERppprswv  406
                          FN   ST W Q KN R     +E    FG      + +  P     
Sbjct  290  --------------FNSDPSTKWLQPKNPRTVATATETS-SFGSHESETSAKEQPLVQKR  334

Query  405  ppqpppvamaeaaaairqPKKSSLPKDQLTDDQLLGR------SSEISDDLERITKISES  244
               PP         A    ++   PK Q   DQ  G       SS ++D+L++IT +SES
Sbjct  335  TWVPPQPPPVAMLEAAEAIRR---PKPQARVDQDEGHDLTRSGSSGVTDELQKITNVSES  391

Query  243  GGFG  232
            G  G
Sbjct  392  GDEG  395



>ref|NP_001132489.1| uncharacterized protein LOC100193948 [Zea mays]
 gb|ACF81345.1| unknown [Zea mays]
 gb|AFW79300.1| hypothetical protein ZEAMMB73_066847 [Zea mays]
Length=161

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWE  634
            YMEIMEM+QRGERP +++DIND PPNP+QPI EP +APKPKPWE
Sbjct  48   YMEIMEMIQRGERPDDIQDINDDPPNPDQPISEPRMAPKPKPWE  91



>gb|AFW79301.1| hypothetical protein ZEAMMB73_066847 [Zea mays]
Length=148

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWE  634
            YMEIMEM+QRGERP +++DIND PPNP+QPI EP +APKPKPWE
Sbjct  35   YMEIMEMIQRGERPDDIQDINDDPPNPDQPISEPRMAPKPKPWE  78



>emb|CAC14740.1| peroxin Pex14 [Arabidopsis thaliana]
Length=507

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 73/132 (55%), Gaps = 29/132 (22%)
 Frame = -3

Query  867  SQQXYANGX-VDTD---ARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdind  700
            +++ Y NG  VD D   ARS    + P     PPHPKSYM+IM M+QRGE+P N+R+IND
Sbjct  291  ARKPYTNGSNVDYDTRSARSASPPAAPADSSAPPHPKSYMDIMSMIQRGEKPSNIREIND  350

Query  699  qppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTP  520
             PPNPNQP+ +P +APK KPW+ GQ     S+                     NG     
Sbjct  351  MPPNPNQPLSDPRIAPKSKPWDYGQAPQDESS---------------------NGQ----  385

Query  519  WWQRKNARITEI  484
            WWQ+KN R T+ 
Sbjct  386  WWQQKNPRSTDF  397



>ref|NP_001152579.1| peroxin Pex14 [Zea mays]
 gb|ACG48329.1| peroxin Pex14 [Zea mays]
Length=183

 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWE  634
            YMEIMEM+QRGERP +++DIND PPNP+QPI EP +APKPKPWE
Sbjct  71   YMEIMEMIQRGERPDDIQDINDDPPNPDQPISEPRMAPKPKPWE  114



>ref|XP_004961124.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X2 
[Setaria italica]
Length=305

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWE  634
            YMEIMEM+QRGERP +++DIND PPNP+QPI EP +APKPKPWE
Sbjct  196  YMEIMEMIQRGERPDDIQDINDDPPNPDQPISEPRMAPKPKPWE  239



>ref|XP_004961125.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X3 
[Setaria italica]
Length=304

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWE  634
            YMEIMEM+QRGERP +++DIND PPNP+QPI EP +APKPKPWE
Sbjct  195  YMEIMEMIQRGERPDDIQDINDDPPNPDQPISEPRMAPKPKPWE  238



>ref|NP_201087.3| peroxin 14 [Arabidopsis thaliana]
 sp|Q9FXT6.2|PEX14_ARATH RecName: Full=Peroxisomal membrane protein PEX14; AltName: Full=Peroxin-14; 
Short=AtPEX14; AltName: Full=Peroxisome biogenesis 
protein 14; AltName: Full=Pex14p; AltName: Full=Protein 
PEROXISOME DEFECTIVE 2 [Arabidopsis thaliana]
 dbj|BAB10850.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAB17668.1| AtPex14p [Arabidopsis thaliana]
 dbj|BAE99107.1| AtPex14p [Arabidopsis thaliana]
 gb|AED97660.1| peroxin 14 [Arabidopsis thaliana]
Length=507

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 73/132 (55%), Gaps = 29/132 (22%)
 Frame = -3

Query  867  SQQXYANGX-VDTD---ARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdind  700
            +++ Y NG  VD D   ARS    + P     PPHPKSYM+IM M+QRGE+P N+R+IND
Sbjct  291  ARKPYTNGSNVDYDTRSARSASPPAAPADSSAPPHPKSYMDIMSMIQRGEKPSNIREIND  350

Query  699  qppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTP  520
             PPNPNQP+ +P +APK KPW+ GQ     S+                     NG     
Sbjct  351  MPPNPNQPLSDPRIAPKSKPWDYGQAPQDESS---------------------NGQ----  385

Query  519  WWQRKNARITEI  484
            WWQ+KN R T+ 
Sbjct  386  WWQQKNPRSTDF  397



>dbj|BAB17667.1| PEX14 [Arabidopsis thaliana]
Length=507

 Score = 52.0 bits (123),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 73/132 (55%), Gaps = 29/132 (22%)
 Frame = -3

Query  867  SQQXYANGX-VDTD---ARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdind  700
            +++ Y NG  VD D   ARS    + P     PPHPKSYM+IM M+QRGE+P N+R+IND
Sbjct  291  ARKPYTNGSNVDYDTRSARSASPPAAPADSSAPPHPKSYMDIMSMIQRGEKPSNIREIND  350

Query  699  qppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTP  520
             PPNPNQP+ +P +APK KPW+ GQ     S+                     NG     
Sbjct  351  MPPNPNQPLSDPRIAPKSKPWDYGQAPQDESS---------------------NGQ----  385

Query  519  WWQRKNARITEI  484
            WWQ+KN R T+ 
Sbjct  386  WWQQKNPRSTDF  397



>ref|XP_008351828.1| PREDICTED: uncharacterized protein LOC103415263 [Malus domestica]
Length=381

 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 46/81 (57%), Gaps = 12/81 (15%)
 Frame = -3

Query  663  LVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTPWW--QRKNARIT  490
            LV PK  P +V Q+Q SS N      S   +G  +Q N    G S+ PWW  Q+KN+RIT
Sbjct  30   LVRPKTNPSQVLQSQVSSDNL---NSSIQDNGLNYQSN----GDSTVPWWQQQQKNSRIT  82

Query  489  EIESEDEQKFGGPSGVPTNER  427
            EIE+E     GG  GV T+E+
Sbjct  83   EIENEVN---GGSYGVRTSEQ  100



>ref|XP_008647421.1| PREDICTED: uncharacterized protein LOC100193948 isoform X3 [Zea 
mays]
 gb|AFW79299.1| hypothetical protein ZEAMMB73_066847 [Zea mays]
Length=249

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWE  634
            YMEIMEM+QRGERP +++DIND PPNP+QPI EP +APKPKPWE
Sbjct  136  YMEIMEMIQRGERPDDIQDINDDPPNPDQPISEPRMAPKPKPWE  179



>ref|XP_002440305.1| hypothetical protein SORBIDRAFT_09g029470 [Sorghum bicolor]
 gb|EES18735.1| hypothetical protein SORBIDRAFT_09g029470 [Sorghum bicolor]
Length=273

 Score = 51.2 bits (121),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 1/53 (2%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWEVGQTQNSSS  607
            YMEIMEM+QRGERP +++DIND PPNP+QPI EP +APKPKPWE  Q Q SS+
Sbjct  160  YMEIMEMIQRGERPDDIQDINDDPPNPDQPISEPRMAPKPKPWE-KQGQGSSA  211



>ref|XP_004961126.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X4 
[Setaria italica]
Length=278

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWE  634
            YMEIMEM+QRGERP +++DIND PPNP+QPI EP +APKPKPWE
Sbjct  169  YMEIMEMIQRGERPDDIQDINDDPPNPDQPISEPRMAPKPKPWE  212



>ref|XP_008647420.1| PREDICTED: uncharacterized protein LOC100193948 isoform X2 [Zea 
mays]
Length=272

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWE  634
            YMEIMEM+QRGERP +++DIND PPNP+QPI EP +APKPKPWE
Sbjct  159  YMEIMEMIQRGERPDDIQDINDDPPNPDQPISEPRMAPKPKPWE  202



>ref|XP_008647419.1| PREDICTED: uncharacterized protein LOC100193948 isoform X1 [Zea 
mays]
 gb|AFW79298.1| peroxin Pex14 [Zea mays]
Length=273

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWE  634
            YMEIMEM+QRGERP +++DIND PPNP+QPI EP +APKPKPWE
Sbjct  160  YMEIMEMIQRGERPDDIQDINDDPPNPDQPISEPRMAPKPKPWE  203



>ref|XP_004961123.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X1 
[Setaria italica]
Length=334

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 34/44 (77%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWE  634
            YMEIMEM+QRGERP +++DIND PPNP+QPI EP +APKPKPWE
Sbjct  225  YMEIMEMIQRGERPDDIQDINDDPPNPDQPISEPRMAPKPKPWE  268



>gb|AAM20492.1| putative protein [Arabidopsis thaliana]
 gb|AAO30072.1| putative protein [Arabidopsis thaliana]
Length=380

 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 73/132 (55%), Gaps = 29/132 (22%)
 Frame = -3

Query  867  SQQXYANGX-VDTD---ARsvrssspptsveppphpkSYMEIMEMVQRGERPPNMRdind  700
            +++ Y NG  VD D   ARS    + P     PPHPKSYM+IM M+QRGE+P N+R+IND
Sbjct  164  ARKPYTNGSNVDYDTRSARSASPPAAPADSSAPPHPKSYMDIMSMIQRGEKPSNIREIND  223

Query  699  qppnpnqpiPEPLVAPKPKPWEVGQTQNSSSNFIQSQGSGDASGFGFQDNNQFNGSSSTP  520
             PPNPNQP+ +P +APK KPW+ GQ     S+                     NG     
Sbjct  224  MPPNPNQPLSDPRIAPKSKPWDYGQAPQDESS---------------------NGQ----  258

Query  519  WWQRKNARITEI  484
            WWQ+KN R T+ 
Sbjct  259  WWQQKNPRSTDF  270



>ref|XP_003565861.2| PREDICTED: peroxisomal membrane protein PEX14-like isoform X2 
[Brachypodium distachyon]
Length=253

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWE  634
            YME+MEM+QRGERP +++DIND+PPNP+QPI EP +APKPKPWE
Sbjct  143  YMEVMEMIQRGERPDDIQDINDEPPNPDQPISEPRMAPKPKPWE  186



>ref|XP_010230993.1| PREDICTED: peroxisomal membrane protein PEX14-like isoform X1 
[Brachypodium distachyon]
Length=254

 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 41/44 (93%), Gaps = 0/44 (0%)
 Frame = -3

Query  765  YMEIMEMVQRGERPPNMRdindqppnpnqpiPEPLVAPKPKPWE  634
            YME+MEM+QRGERP +++DIND+PPNP+QPI EP +APKPKPWE
Sbjct  144  YMEVMEMIQRGERPDDIQDINDEPPNPDQPISEPRMAPKPKPWE  187



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1977341620752