BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2664

Length=883
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006346222.1|  PREDICTED: polyadenylate-binding protein RBP...    233   9e-70   Solanum tuberosum [potatoes]
ref|XP_009600135.1|  PREDICTED: polyadenylate-binding protein RBP45     229   3e-68   Nicotiana tomentosiformis
sp|Q9LEB4.1|RBP45_NICPL  RecName: Full=Polyadenylate-binding prot...    228   1e-67   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009795696.1|  PREDICTED: polyadenylate-binding protein RBP45     228   1e-67   Nicotiana sylvestris
ref|XP_004244127.1|  PREDICTED: polyadenylate-binding protein RBP45     228   1e-67   Solanum lycopersicum
ref|XP_011097972.1|  PREDICTED: polyadenylate-binding protein RBP...    208   2e-60   
emb|CDP05748.1|  unnamed protein product                                202   1e-58   Coffea canephora [robusta coffee]
ref|XP_002280601.1|  PREDICTED: polyadenylate-binding protein RBP...    203   5e-58   Vitis vinifera
ref|XP_006452314.1|  hypothetical protein CICLE_v10008440mg             199   4e-57   
ref|XP_006452313.1|  hypothetical protein CICLE_v10008440mg             199   4e-57   Citrus clementina [clementine]
emb|CAN83958.1|  hypothetical protein VITISV_039907                     197   7e-56   Vitis vinifera
ref|XP_010911059.1|  PREDICTED: polyadenylate-binding protein RBP...    191   3e-55   
ref|XP_008806741.1|  PREDICTED: polyadenylate-binding protein RBP45     193   3e-54   Phoenix dactylifera
ref|XP_010062999.1|  PREDICTED: polyadenylate-binding protein RBP45C    187   5e-53   Eucalyptus grandis [rose gum]
ref|XP_010276065.1|  PREDICTED: polyadenylate-binding protein RBP...    186   1e-52   Nelumbo nucifera [Indian lotus]
ref|XP_010276064.1|  PREDICTED: polyadenylate-binding protein RBP...    186   1e-52   Nelumbo nucifera [Indian lotus]
ref|XP_002522953.1|  nuclear acid binding protein, putative             186   8e-52   Ricinus communis
gb|EYU33637.1|  hypothetical protein MIMGU_mgv1a007175mg                186   1e-51   Erythranthe guttata [common monkey flower]
ref|XP_010278708.1|  PREDICTED: polyadenylate-binding protein RBP...    181   2e-51   Nelumbo nucifera [Indian lotus]
emb|CBI26626.3|  unnamed protein product                                179   4e-51   Vitis vinifera
ref|XP_010278711.1|  PREDICTED: polyadenylate-binding protein RBP...    180   5e-51   Nelumbo nucifera [Indian lotus]
ref|XP_010240455.1|  PREDICTED: polyadenylate-binding protein RBP...    182   3e-50   Brachypodium distachyon [annual false brome]
ref|XP_008349306.1|  PREDICTED: polyadenylate-binding protein RBP...    177   3e-50   
ref|XP_009406503.1|  PREDICTED: polyadenylate-binding protein RBP...    182   6e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406502.1|  PREDICTED: polyadenylate-binding protein RBP...    182   8e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007153936.1|  hypothetical protein PHAVU_003G077700g             177   9e-50   Phaseolus vulgaris [French bean]
ref|XP_003580589.1|  PREDICTED: polyadenylate-binding protein RBP...    181   1e-49   Brachypodium distachyon [annual false brome]
dbj|BAE71244.1|  putative DNA binding protein                           178   3e-49   Trifolium pratense [peavine clover]
ref|XP_004486120.1|  PREDICTED: polyadenylate-binding protein RBP...    176   4e-49   Cicer arietinum [garbanzo]
ref|XP_003549897.1|  PREDICTED: polyadenylate-binding protein RBP...    176   4e-49   Glycine max [soybeans]
ref|XP_011096085.1|  PREDICTED: polyadenylate-binding protein RBP...    175   4e-49   Sesamum indicum [beniseed]
ref|XP_007211969.1|  hypothetical protein PRUPE_ppa006617mg             172   5e-49   Prunus persica
ref|XP_003529629.1|  PREDICTED: polyadenylate-binding protein RBP45     174   6e-49   Glycine max [soybeans]
dbj|BAD05744.1|  putative RNA Binding Protein 45                        174   1e-48   Oryza sativa Japonica Group [Japonica rice]
gb|KHN35750.1|  Polyadenylate-binding protein RBP45                     174   1e-48   Glycine soja [wild soybean]
ref|XP_009776429.1|  PREDICTED: polyadenylate-binding protein RBP...    172   1e-48   Nicotiana sylvestris
gb|EEE68172.1|  hypothetical protein OsJ_26296                          176   1e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003610417.1|  RNA-binding protein                                174   1e-48   Medicago truncatula
gb|AFK41944.1|  unknown                                                 174   2e-48   Medicago truncatula
ref|XP_010930147.1|  PREDICTED: polyadenylate-binding protein RBP45     177   2e-48   Elaeis guineensis
gb|AEW68341.1|  putative nuclear acid binding protein                   174   2e-48   Medicago sativa [alfalfa]
ref|XP_009418782.1|  PREDICTED: polyadenylate-binding protein RBP...    178   2e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009614215.1|  PREDICTED: polyadenylate-binding protein RBP...    171   3e-48   Nicotiana tomentosiformis
ref|XP_011096084.1|  PREDICTED: polyadenylate-binding protein RBP...    172   4e-48   Sesamum indicum [beniseed]
gb|AAG59664.1|AC084319_22  putative RNA binding protein                 176   5e-48   Oryza sativa Japonica Group [Japonica rice]
gb|EEC75600.1|  hypothetical protein OsI_12307                          176   5e-48   Oryza sativa Indica Group [Indian rice]
ref|XP_008792645.1|  PREDICTED: polyadenylate-binding protein RBP...    176   5e-48   Phoenix dactylifera
ref|XP_010923889.1|  PREDICTED: polyadenylate-binding protein RBP...    177   5e-48   
gb|ABF97193.1|  RNA recognition motif family protein, expressed         176   6e-48   Oryza sativa Japonica Group [Japonica rice]
gb|EEE61728.1|  hypothetical protein OsJ_16246                          174   7e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009776437.1|  PREDICTED: polyadenylate-binding protein RBP...    169   8e-48   Nicotiana sylvestris
dbj|BAK03410.1|  predicted protein                                      174   1e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006652855.1|  PREDICTED: polyadenylate-binding protein RBP...    174   1e-47   Oryza brachyantha
ref|XP_009420609.1|  PREDICTED: polyadenylate-binding protein RBP45     176   1e-47   
ref|XP_009412453.1|  PREDICTED: polyadenylate-binding protein RBP45     173   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001050516.1|  Os03g0569900                                       176   1e-47   
ref|XP_006659900.1|  PREDICTED: polyadenylate-binding protein RBP...    171   2e-47   
gb|EAY95645.1|  hypothetical protein OsI_17510                          173   2e-47   Oryza sativa Indica Group [Indian rice]
ref|NP_001053941.1|  Os04g0625800                                       173   2e-47   
gb|KEH36836.1|  polyadenylate-binding protein RBP47B                    172   2e-47   Medicago truncatula
ref|XP_008676816.1|  PREDICTED: uncharacterized protein LOC100273...    172   4e-47   Zea mays [maize]
ref|XP_010092144.1|  Polyadenylate-binding protein RBP45                176   6e-47   
ref|XP_004232721.1|  PREDICTED: polyadenylate-binding protein RBP45     168   6e-47   Solanum lycopersicum
ref|XP_009789022.1|  PREDICTED: polyadenylate-binding protein RBP...    168   6e-47   Nicotiana sylvestris
gb|AFW61056.1|  hypothetical protein ZEAMMB73_234884                    171   6e-47   
ref|NP_001141359.1|  uncharacterized protein LOC100273450               171   7e-47   Zea mays [maize]
ref|XP_006348103.1|  PREDICTED: polyadenylate-binding protein RBP...    167   9e-47   Solanum tuberosum [potatoes]
ref|XP_008441150.1|  PREDICTED: polyadenylate-binding protein RBP...    167   9e-47   Cucumis melo [Oriental melon]
ref|XP_008224810.1|  PREDICTED: polyadenylate-binding protein RBP...    164   9e-47   Prunus mume [ume]
emb|CAE04743.3|  OSJNBb0060E08.6                                        173   1e-46   Oryza sativa Japonica Group [Japonica rice]
gb|KHN33037.1|  Polyadenylate-binding protein RBP45                     170   1e-46   Glycine soja [wild soybean]
ref|XP_003573391.1|  PREDICTED: polyadenylate-binding protein RBP...    173   2e-46   Brachypodium distachyon [annual false brome]
ref|XP_010101438.1|  Polyadenylate-binding protein RBP45B               165   2e-46   
ref|XP_004507695.1|  PREDICTED: polyadenylate-binding protein RBP...    172   2e-46   Cicer arietinum [garbanzo]
ref|XP_009595795.1|  PREDICTED: polyadenylate-binding protein RBP...    166   2e-46   Nicotiana tomentosiformis
ref|XP_004982540.1|  PREDICTED: polyadenylate-binding protein RBP...    172   2e-46   Setaria italica
ref|XP_011652720.1|  PREDICTED: polyadenylate-binding protein RBP...    165   2e-46   Cucumis sativus [cucumbers]
gb|KHN37596.1|  Polyadenylate-binding protein RBP45B                    167   3e-46   Glycine soja [wild soybean]
ref|XP_011628461.1|  PREDICTED: polyadenylate-binding protein RBP...    164   3e-46   Amborella trichopoda
ref|XP_011628460.1|  PREDICTED: polyadenylate-binding protein RBP...    164   3e-46   Amborella trichopoda
ref|XP_006468021.1|  PREDICTED: polyadenylate-binding protein RBP...    162   3e-46   Citrus sinensis [apfelsine]
ref|XP_008441138.1|  PREDICTED: polyadenylate-binding protein RBP...    165   3e-46   Cucumis melo [Oriental melon]
ref|XP_006449038.1|  hypothetical protein CICLE_v10015407mg             162   3e-46   Citrus clementina [clementine]
ref|XP_003546146.1|  PREDICTED: polyadenylate-binding protein RBP...    168   4e-46   Glycine max [soybeans]
ref|XP_002518499.1|  nuclear acid binding protein, putative             166   4e-46   Ricinus communis
ref|XP_004972673.1|  PREDICTED: polyadenylate-binding protein RBP...    168   5e-46   
ref|XP_004972674.1|  PREDICTED: polyadenylate-binding protein RBP...    168   5e-46   Setaria italica
ref|XP_008441142.1|  PREDICTED: polyadenylate-binding protein RBP...    164   6e-46   Cucumis melo [Oriental melon]
ref|XP_010327241.1|  PREDICTED: polyadenylate-binding protein RBP...    163   6e-46   Solanum lycopersicum
ref|XP_002447134.1|  hypothetical protein SORBIDRAFT_06g029180          168   8e-46   
gb|EMS60206.1|  RNA-binding post-transcriptional regulator csx1         168   9e-46   Triticum urartu
ref|XP_008441163.1|  PREDICTED: polyadenylate-binding protein RBP...    163   1e-45   Cucumis melo [Oriental melon]
ref|XP_004976877.1|  PREDICTED: polyadenylate-binding protein RBP...    168   1e-45   Setaria italica
ref|XP_011652705.1|  PREDICTED: polyadenylate-binding protein RBP...    163   1e-45   Cucumis sativus [cucumbers]
ref|XP_008441139.1|  PREDICTED: polyadenylate-binding protein RBP...    163   1e-45   Cucumis melo [Oriental melon]
ref|XP_004248403.1|  PREDICTED: polyadenylate-binding protein RBP...    162   1e-45   Solanum lycopersicum
ref|XP_007020874.1|  RNA-binding family protein                         160   2e-45   
gb|EMS52025.1|  RNA-binding post-transcriptional regulator csx1         166   2e-45   Triticum urartu
ref|XP_010675694.1|  PREDICTED: polyadenylate-binding protein RBP45     169   2e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011652716.1|  PREDICTED: polyadenylate-binding protein RBP...    162   2e-45   Cucumis sativus [cucumbers]
ref|XP_006352617.1|  PREDICTED: polyadenylate-binding protein RBP...    163   2e-45   Solanum tuberosum [potatoes]
ref|NP_001168324.1|  hypothetical protein                               169   2e-45   Zea mays [maize]
ref|XP_006283830.1|  hypothetical protein CARUB_v10004931mg             162   2e-45   Capsella rubella
ref|XP_004145109.1|  PREDICTED: polyadenylate-binding protein RBP...    161   4e-45   Cucumis sativus [cucumbers]
ref|XP_008661406.1|  PREDICTED: uncharacterized protein LOC100193...    166   4e-45   
ref|XP_006352618.1|  PREDICTED: polyadenylate-binding protein RBP...    162   4e-45   Solanum tuberosum [potatoes]
ref|XP_002464324.1|  hypothetical protein SORBIDRAFT_01g016170          168   5e-45   Sorghum bicolor [broomcorn]
gb|EMT04468.1|  RNA-binding post-transcriptional regulator csx1         165   5e-45   
ref|NP_001131852.1|  uncharacterized protein LOC100193230               165   7e-45   Zea mays [maize]
gb|AFW59516.1|  hypothetical protein ZEAMMB73_768040                    165   7e-45   
gb|KJB13666.1|  hypothetical protein B456_002G088100                    160   9e-45   Gossypium raimondii
gb|KJB13665.1|  hypothetical protein B456_002G088100                    160   9e-45   Gossypium raimondii
gb|KJB13664.1|  hypothetical protein B456_002G088100                    160   1e-44   Gossypium raimondii
ref|XP_006449039.1|  hypothetical protein CICLE_v10015407mg             157   1e-44   Citrus clementina [clementine]
ref|XP_011030800.1|  PREDICTED: polyadenylate-binding protein RBP...    167   1e-44   Populus euphratica
ref|XP_006468022.1|  PREDICTED: polyadenylate-binding protein RBP...    157   1e-44   Citrus sinensis [apfelsine]
ref|XP_002316998.2|  RNA-binding protein 45                             167   1e-44   Populus trichocarpa [western balsam poplar]
ref|XP_007147735.1|  hypothetical protein PHAVU_006G150400g             161   1e-44   Phaseolus vulgaris [French bean]
ref|XP_011010322.1|  PREDICTED: polyadenylate-binding protein RBP...    167   1e-44   Populus euphratica
ref|XP_004145107.1|  PREDICTED: polyadenylate-binding protein RBP...    159   1e-44   Cucumis sativus [cucumbers]
ref|XP_011010320.1|  PREDICTED: polyadenylate-binding protein RBP...    167   1e-44   Populus euphratica
ref|XP_006370698.1|  hypothetical protein POPTR_0001s45000g             167   1e-44   
ref|XP_002867529.1|  hypothetical protein ARALYDRAFT_913848             158   3e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_010545222.1|  PREDICTED: polyadenylate-binding protein RBP...    159   3e-44   Tarenaya hassleriana [spider flower]
ref|XP_008226922.1|  PREDICTED: polyadenylate-binding protein RBP45C    159   3e-44   Prunus mume [ume]
gb|KCW76953.1|  hypothetical protein EUGRSUZ_D01313                     162   4e-44   Eucalyptus grandis [rose gum]
ref|XP_006413118.1|  hypothetical protein EUTSA_v10025342mg             158   4e-44   Eutrema salsugineum [saltwater cress]
ref|XP_009137630.1|  PREDICTED: polyadenylate-binding protein RBP...    159   4e-44   Brassica rapa
gb|AGV54881.1|  RNA-binding post-transcriptional regulator csx1-l...    160   4e-44   Phaseolus vulgaris [French bean]
emb|CDY46671.1|  BnaA03g48370D                                          159   4e-44   Brassica napus [oilseed rape]
ref|XP_010448802.1|  PREDICTED: polyadenylate-binding protein RBP...    158   4e-44   Camelina sativa [gold-of-pleasure]
ref|XP_010052832.1|  PREDICTED: polyadenylate-binding protein RBP...    162   4e-44   Eucalyptus grandis [rose gum]
ref|XP_010443072.1|  PREDICTED: polyadenylate-binding protein RBP...    159   5e-44   Camelina sativa [gold-of-pleasure]
gb|KHG22988.1|  Polyadenylate-binding RBP45C -like protein              156   7e-44   Gossypium arboreum [tree cotton]
ref|XP_009142977.1|  PREDICTED: polyadenylate-binding protein RBP...    158   7e-44   Brassica rapa
ref|XP_004295261.2|  PREDICTED: polyadenylate-binding protein RBP45B    154   7e-44   Fragaria vesca subsp. vesca
ref|XP_007213954.1|  hypothetical protein PRUPE_ppa006577mg             158   1e-43   Prunus persica
ref|XP_003542872.1|  PREDICTED: polyadenylate-binding protein RBP...    159   1e-43   Glycine max [soybeans]
gb|KHG01774.1|  Polyadenylate-binding RBP45C -like protein              156   2e-43   Gossypium arboreum [tree cotton]
ref|XP_012070803.1|  PREDICTED: polyadenylate-binding protein RBP45C    164   2e-43   Jatropha curcas
ref|XP_009772574.1|  PREDICTED: polyadenylate-binding protein RBP...    157   2e-43   Nicotiana sylvestris
ref|XP_009772575.1|  PREDICTED: polyadenylate-binding protein RBP...    157   2e-43   Nicotiana sylvestris
gb|KDP39118.1|  hypothetical protein JCGZ_00875                         164   3e-43   Jatropha curcas
ref|XP_010546929.1|  PREDICTED: polyadenylate-binding protein RBP45B    151   3e-43   Tarenaya hassleriana [spider flower]
gb|KJB22074.1|  hypothetical protein B456_004G028000                    155   4e-43   Gossypium raimondii
emb|CDX92786.1|  BnaC07g40440D                                          155   4e-43   
ref|XP_010438672.1|  PREDICTED: polyadenylate-binding protein RBP45C    154   5e-43   Camelina sativa [gold-of-pleasure]
emb|CDY29263.1|  BnaC01g19150D                                          155   6e-43   Brassica napus [oilseed rape]
ref|XP_010433418.1|  PREDICTED: polyadenylate-binding protein RBP45C    154   7e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010448184.1|  PREDICTED: polyadenylate-binding protein RBP...    154   7e-43   Camelina sativa [gold-of-pleasure]
ref|XP_009631417.1|  PREDICTED: polyadenylate-binding protein RBP...    154   8e-43   
ref|NP_567764.1|  polyadenylate-binding protein RBP45C                  155   8e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010482899.1|  PREDICTED: polyadenylate-binding protein RBP...    154   1e-42   Camelina sativa [gold-of-pleasure]
emb|CAB36546.1|  putative DNA binding protein                           155   1e-42   Arabidopsis thaliana [mouse-ear cress]
gb|EYU27806.1|  hypothetical protein MIMGU_mgv1a007668mg                152   1e-42   Erythranthe guttata [common monkey flower]
gb|EPS64177.1|  hypothetical protein M569_10604                         157   1e-42   Genlisea aurea
emb|CDY14290.1|  BnaA08g14210D                                          153   1e-42   Brassica napus [oilseed rape]
emb|CDX89287.1|  BnaA01g16060D                                          154   1e-42   
emb|CDY66423.1|  BnaAnng22220D                                          152   1e-42   Brassica napus [oilseed rape]
ref|XP_009109155.1|  PREDICTED: polyadenylate-binding protein RBP...    153   1e-42   Brassica rapa
ref|XP_004507696.1|  PREDICTED: polyadenylate-binding protein RBP...    156   2e-42   
ref|XP_009631415.1|  PREDICTED: polyadenylate-binding protein RBP...    153   2e-42   Nicotiana tomentosiformis
emb|CAC85246.1|  salt tolerance protein 6                               152   2e-42   Beta vulgaris [beet]
ref|XP_009631416.1|  PREDICTED: polyadenylate-binding protein RBP...    152   3e-42   Nicotiana tomentosiformis
ref|XP_006280607.1|  hypothetical protein CARUB_v10026566mg             160   3e-42   Capsella rubella
ref|XP_004294372.1|  PREDICTED: polyadenylate-binding protein RBP45C    153   3e-42   Fragaria vesca subsp. vesca
ref|XP_010665562.1|  PREDICTED: polyadenylate-binding protein RBP...    151   4e-42   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010476096.1|  PREDICTED: polyadenylate-binding protein RBP...    151   4e-42   Camelina sativa [gold-of-pleasure]
gb|AAM64532.1|  putative DNA binding protein                            151   4e-42   Arabidopsis thaliana [mouse-ear cress]
gb|KJB81764.1|  hypothetical protein B456_013G160200                    152   4e-42   Gossypium raimondii
gb|AGV54456.1|  RNA-binding post-transcriptional regulator csx1-l...    154   4e-42   Phaseolus vulgaris [French bean]
ref|NP_172630.1|  polyadenylate-binding protein RBP45B                  151   4e-42   Arabidopsis thaliana [mouse-ear cress]
gb|EAZ27535.1|  hypothetical protein OsJ_11490                          154   4e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_012091367.1|  PREDICTED: polyadenylate-binding protein RBP...    151   4e-42   Jatropha curcas
ref|XP_010041417.1|  PREDICTED: polyadenylate-binding protein RBP...    155   5e-42   Eucalyptus grandis [rose gum]
gb|KJB81761.1|  hypothetical protein B456_013G160200                    151   5e-42   Gossypium raimondii
ref|XP_002305583.2|  RNA-binding protein 45                             149   6e-42   Populus trichocarpa [western balsam poplar]
ref|XP_004234481.1|  PREDICTED: polyadenylate-binding protein RBP...    155   6e-42   Solanum lycopersicum
ref|XP_008796097.1|  PREDICTED: polyadenylate-binding protein RBP45     160   7e-42   Phoenix dactylifera
ref|XP_009352469.1|  PREDICTED: polyadenylate-binding protein RBP...    160   7e-42   Pyrus x bretschneideri [bai li]
gb|KFK29206.1|  hypothetical protein AALP_AA7G103000                    152   8e-42   Arabis alpina [alpine rockcress]
ref|XP_006401513.1|  hypothetical protein EUTSA_v10013710mg             150   9e-42   Eutrema salsugineum [saltwater cress]
dbj|BAJ87828.1|  predicted protein                                      152   1e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85753.1|  predicted protein                                      152   1e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010458570.1|  PREDICTED: polyadenylate-binding protein RBP45B    149   1e-41   Camelina sativa [gold-of-pleasure]
ref|XP_011037670.1|  PREDICTED: polyadenylate-binding protein RBP...    148   1e-41   Populus euphratica
ref|XP_010327242.1|  PREDICTED: polyadenylate-binding protein RBP...    148   2e-41   
ref|XP_009372712.1|  PREDICTED: polyadenylate-binding protein RBP...    159   2e-41   Pyrus x bretschneideri [bai li]
ref|XP_008385660.1|  PREDICTED: polyadenylate-binding protein RBP...    159   2e-41   
ref|NP_001168401.1|  hypothetical protein                               159   2e-41   Zea mays [maize]
ref|XP_006307499.1|  hypothetical protein CARUB_v10009124mg             149   2e-41   
gb|KCW44364.1|  hypothetical protein EUGRSUZ_L02167                     155   2e-41   Eucalyptus grandis [rose gum]
ref|XP_010054589.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    152   3e-41   
ref|XP_006417333.1|  hypothetical protein EUTSA_v10007819mg             148   3e-41   Eutrema salsugineum [saltwater cress]
ref|XP_006401514.1|  hypothetical protein EUTSA_v10013710mg             148   3e-41   Eutrema salsugineum [saltwater cress]
ref|XP_008365193.1|  PREDICTED: polyadenylate-binding protein RBP...    158   4e-41   Malus domestica [apple tree]
ref|XP_010493089.1|  PREDICTED: polyadenylate-binding protein RBP...    147   4e-41   Camelina sativa [gold-of-pleasure]
ref|XP_002864364.1|  hypothetical protein ARALYDRAFT_495572             157   4e-41   
ref|XP_006343293.1|  PREDICTED: polyadenylate-binding protein RBP...    152   5e-41   Solanum tuberosum [potatoes]
gb|KFK43438.1|  hypothetical protein AALP_AA1G125300                    147   5e-41   Arabis alpina [alpine rockcress]
gb|ABR18422.1|  unknown                                                 149   5e-41   Picea sitchensis
dbj|BAB08769.1|  unnamed protein product                                156   8e-41   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568815.1|  RNA-binding protein 45A                               156   9e-41   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889883.1|  ATRBP45B                                           146   2e-40   Arabidopsis lyrata subsp. lyrata
ref|XP_007026047.1|  RNA-binding family protein                         149   2e-40   Theobroma cacao [chocolate]
gb|ABK25253.1|  unknown                                                 147   3e-40   Picea sitchensis
ref|XP_004957865.1|  PREDICTED: polyadenylate-binding protein RBP...    152   6e-40   Setaria italica
emb|CBI19566.3|  unnamed protein product                                149   7e-40   Vitis vinifera
ref|XP_004957864.1|  PREDICTED: polyadenylate-binding protein RBP...    152   9e-40   
ref|XP_003634360.1|  PREDICTED: polyadenylate-binding protein RBP...    148   1e-39   Vitis vinifera
emb|CAN81343.1|  hypothetical protein VITISV_008697                     147   1e-39   Vitis vinifera
ref|XP_011013053.1|  PREDICTED: polyadenylate-binding protein RBP...    148   2e-39   Populus euphratica
gb|KJB69303.1|  hypothetical protein B456_011G015300                    147   2e-39   Gossypium raimondii
ref|XP_006658612.1|  PREDICTED: polyadenylate-binding protein RBP...    148   2e-39   
gb|KJB59840.1|  hypothetical protein B456_009G275200                    148   3e-39   Gossypium raimondii
gb|KJB69301.1|  hypothetical protein B456_011G015300                    147   3e-39   Gossypium raimondii
ref|XP_011017227.1|  PREDICTED: polyadenylate-binding protein RBP...    147   3e-39   Populus euphratica
gb|KFK27101.1|  hypothetical protein AALP_AA8G334500                    145   3e-39   Arabis alpina [alpine rockcress]
ref|XP_002302445.2|  RNA-binding protein 47                             147   3e-39   
gb|KFK27100.1|  hypothetical protein AALP_AA8G334500                    145   3e-39   Arabis alpina [alpine rockcress]
ref|XP_002510266.1|  nuclear acid binding protein, putative             146   6e-39   Ricinus communis
gb|EMS56663.1|  Uncharacterized RNA-binding protein C23E6.01c           147   7e-39   Triticum urartu
ref|XP_009120017.1|  PREDICTED: polyadenylate-binding protein RBP45A    142   1e-38   Brassica rapa
emb|CDY17286.1|  BnaA10g09200D                                          142   2e-38   Brassica napus [oilseed rape]
emb|CDY34639.1|  BnaC08g41980D                                          140   2e-38   Brassica napus [oilseed rape]
emb|CDY19874.1|  BnaC09g31400D                                          141   3e-38   Brassica napus [oilseed rape]
gb|ABK24911.1|  unknown                                                 141   3e-38   Picea sitchensis
emb|CDY34835.1|  BnaA09g47610D                                          139   3e-38   Brassica napus [oilseed rape]
dbj|BAD33940.1|  putative nucleic acid binding protein                  143   5e-38   Oryza sativa Japonica Group [Japonica rice]
gb|EEE69858.1|  hypothetical protein OsJ_29658                          143   5e-38   Oryza sativa Japonica Group [Japonica rice]
gb|KJB58432.1|  hypothetical protein B456_009G209600                    144   6e-38   Gossypium raimondii
dbj|BAG87507.1|  unnamed protein product                                143   6e-38   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063403.1|  Os09g0462700                                       142   8e-38   
ref|XP_006374988.1|  RNA-binding protein 47                             141   8e-38   
ref|XP_009118181.1|  PREDICTED: polyadenylate-binding protein RBP...    140   1e-37   Brassica rapa
gb|EEC84714.1|  hypothetical protein OsI_31675                          142   1e-37   Oryza sativa Indica Group [Indian rice]
gb|KHN12758.1|  Polyadenylate-binding protein RBP47C                    143   1e-37   Glycine soja [wild soybean]
ref|XP_003560152.2|  PREDICTED: polyadenylate-binding protein RBP...    142   2e-37   Brachypodium distachyon [annual false brome]
ref|XP_006354957.1|  PREDICTED: polyadenylate-binding protein RBP...    144   2e-37   Solanum tuberosum [potatoes]
ref|XP_003549410.2|  PREDICTED: polyadenylate-binding protein RBP...    142   2e-37   Glycine max [soybeans]
gb|EYU25396.1|  hypothetical protein MIMGU_mgv1a006186mg                143   3e-37   Erythranthe guttata [common monkey flower]
tpg|DAA62918.1|  TPA: hypothetical protein ZEAMMB73_604225              144   5e-37   
ref|NP_001142233.1|  hypothetical protein                               144   5e-37   Zea mays [maize]
ref|XP_008651136.1|  PREDICTED: hypothetical protein isoform X1         144   5e-37   
ref|XP_007017333.1|  RNA-binding protein 47C isoform 5                  140   5e-37   
ref|XP_010098709.1|  Polyadenylate-binding protein RBP47C               141   6e-37   Morus notabilis
ref|XP_009118182.1|  PREDICTED: polyadenylate-binding protein RBP...    137   7e-37   Brassica rapa
ref|XP_010476097.1|  PREDICTED: polyadenylate-binding protein RBP...    133   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_004499084.1|  PREDICTED: polyadenylate-binding protein RBP...    138   1e-36   Cicer arietinum [garbanzo]
gb|ACF83065.1|  unknown                                                 137   1e-36   Zea mays [maize]
ref|XP_007017330.1|  RNA-binding protein 47C isoform 2                  138   2e-36   
ref|XP_004291135.1|  PREDICTED: polyadenylate-binding protein RBP...    137   2e-36   Fragaria vesca subsp. vesca
gb|AGV54251.1|  RNA binding post-transcriptional regulator csx1 l...    139   2e-36   Phaseolus vulgaris [French bean]
ref|XP_007160823.1|  hypothetical protein PHAVU_001G019600g             139   2e-36   Phaseolus vulgaris [French bean]
ref|XP_012071696.1|  PREDICTED: polyadenylate-binding protein RBP...    139   2e-36   Jatropha curcas
gb|KHN46301.1|  Polyadenylate-binding protein RBP47C                    140   2e-36   Glycine soja [wild soybean]
ref|XP_010275610.1|  PREDICTED: polyadenylate-binding protein RBP...    136   2e-36   Nelumbo nucifera [Indian lotus]
gb|ACF87959.1|  unknown                                                 135   2e-36   Zea mays [maize]
ref|NP_001144988.1|  uncharacterized protein LOC100278143               135   3e-36   Zea mays [maize]
ref|XP_007017329.1|  RNA-binding protein 47C isoform 1                  137   3e-36   
ref|XP_003544447.1|  PREDICTED: polyadenylate-binding protein RBP...    138   3e-36   Glycine max [soybeans]
ref|XP_009765294.1|  PREDICTED: polyadenylate-binding protein RBP...    137   4e-36   Nicotiana sylvestris
ref|XP_009629702.1|  PREDICTED: polyadenylate-binding protein RBP...    137   4e-36   Nicotiana tomentosiformis
ref|XP_004141245.1|  PREDICTED: polyadenylate-binding protein RBP...    137   4e-36   Cucumis sativus [cucumbers]
ref|XP_008220170.1|  PREDICTED: polyadenylate-binding protein RBP...    135   4e-36   Prunus mume [ume]
ref|XP_008220171.1|  PREDICTED: polyadenylate-binding protein RBP...    135   5e-36   Prunus mume [ume]
ref|XP_010268853.1|  PREDICTED: polyadenylate-binding protein RBP...    133   5e-36   Nelumbo nucifera [Indian lotus]
ref|XP_004501589.1|  PREDICTED: polyadenylate-binding protein RBP...    138   5e-36   Cicer arietinum [garbanzo]
ref|XP_010668311.1|  PREDICTED: polyadenylate-binding protein RBP...    136   6e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007017331.1|  RNA-binding protein 47C isoform 3                  136   6e-36   
ref|XP_008452518.1|  PREDICTED: polyadenylate-binding protein RBP...    137   6e-36   Cucumis melo [Oriental melon]
ref|XP_006307520.1|  hypothetical protein CARUB_v10009143mg             134   8e-36   Capsella rubella
ref|XP_010275609.1|  PREDICTED: polyadenylate-binding protein RBP...    134   8e-36   Nelumbo nucifera [Indian lotus]
gb|KJB58433.1|  hypothetical protein B456_009G209600                    137   9e-36   Gossypium raimondii
ref|XP_007222286.1|  hypothetical protein PRUPE_ppa005903mg             134   1e-35   Prunus persica
ref|XP_011030472.1|  PREDICTED: polyadenylate-binding protein RBP...    134   1e-35   Populus euphratica
ref|XP_011030463.1|  PREDICTED: polyadenylate-binding protein RBP...    134   1e-35   Populus euphratica
ref|XP_011030480.1|  PREDICTED: polyadenylate-binding protein RBP...    134   1e-35   Populus euphratica
ref|XP_008782204.1|  PREDICTED: polyadenylate-binding protein RBP...    133   1e-35   Phoenix dactylifera
ref|XP_007136663.1|  hypothetical protein PHAVU_009G063200g             137   1e-35   
ref|XP_004957051.1|  PREDICTED: polyadenylate-binding protein RBP...    133   1e-35   
ref|XP_010525621.1|  PREDICTED: polyadenylate-binding protein RBP...    136   1e-35   
ref|XP_008667046.1|  PREDICTED: uncharacterized protein LOC100191...    139   1e-35   
ref|NP_001130512.1|  uncharacterized protein LOC100191611               139   1e-35   
ref|XP_003578248.1|  PREDICTED: polyadenylate-binding protein RBP...    133   1e-35   
ref|XP_009370172.1|  PREDICTED: polyadenylate-binding protein RBP...    134   2e-35   
ref|XP_009370171.1|  PREDICTED: polyadenylate-binding protein RBP...    134   2e-35   
ref|XP_007017332.1|  RNA-binding protein 47C isoform 4                  135   2e-35   
ref|XP_010539063.1|  PREDICTED: polyadenylate-binding protein RBP...    135   2e-35   
ref|XP_010268845.1|  PREDICTED: polyadenylate-binding protein RBP...    131   2e-35   
ref|XP_004238180.1|  PREDICTED: polyadenylate-binding protein RBP...    137   2e-35   
gb|EMS68577.1|  Uncharacterized RNA-binding protein C23E6.01c           132   2e-35   
ref|XP_010500273.1|  PREDICTED: polyadenylate-binding protein RBP...    133   3e-35   
ref|XP_009605325.1|  PREDICTED: polyadenylate-binding protein RBP...    134   3e-35   
gb|EMS62393.1|  Uncharacterized RNA-binding protein C23E6.01c           133   3e-35   
ref|XP_006452315.1|  hypothetical protein CICLE_v10008440mg             125   3e-35   
ref|XP_008812246.1|  PREDICTED: polyadenylate-binding protein RBP...    132   3e-35   
dbj|BAJ85879.1|  predicted protein                                      132   4e-35   
ref|XP_008444645.1|  PREDICTED: polyadenylate-binding protein RBP...    134   4e-35   
gb|KHN22302.1|  Polyadenylate-binding protein RBP47C                    134   5e-35   
gb|EMT16295.1|  Putative RNA-binding protein                            132   5e-35   
ref|XP_004152729.1|  PREDICTED: polyadenylate-binding protein RBP47     133   5e-35   
gb|KDO35913.1|  hypothetical protein CISIN_1g029152mg                   134   6e-35   
ref|XP_012089580.1|  PREDICTED: polyadenylate-binding protein RBP...    130   8e-35   
ref|XP_006434827.1|  hypothetical protein CICLE_v10001214mg             133   8e-35   
ref|XP_002518798.1|  nuclear acid binding protein, putative             132   8e-35   
gb|KJB63805.1|  hypothetical protein B456_010G017300                    134   1e-34   
gb|ERN19652.1|  hypothetical protein AMTR_s00062p00161920               141   1e-34   
ref|XP_008667171.1|  PREDICTED: uncharacterized protein LOC100193...    130   1e-34   
ref|XP_008361011.1|  PREDICTED: polyadenylate-binding protein RBP...    133   1e-34   
ref|XP_011623994.1|  PREDICTED: polyadenylate-binding protein RBP47     128   1e-34   
ref|XP_008393835.1|  PREDICTED: polyadenylate-binding protein RBP...    132   1e-34   
gb|ACL54800.1|  unknown                                                 130   1e-34   
ref|XP_009367486.1|  PREDICTED: polyadenylate-binding protein RBP...    132   1e-34   
ref|XP_011092727.1|  PREDICTED: polyadenylate-binding protein RBP...    127   1e-34   
ref|XP_001784132.1|  predicted protein                                  132   1e-34   
ref|XP_008357395.1|  PREDICTED: polyadenylate-binding protein RBP...    132   2e-34   
ref|XP_001777334.1|  predicted protein                                  131   2e-34   
ref|XP_011092726.1|  PREDICTED: polyadenylate-binding protein RBP...    127   2e-34   
ref|XP_008357394.1|  PREDICTED: polyadenylate-binding protein RBP...    132   2e-34   
ref|XP_010265753.1|  PREDICTED: polyadenylate-binding protein RBP...    131   2e-34   
ref|XP_002973844.1|  hypothetical protein SELMODRAFT_100454             129   2e-34   
ref|XP_008782206.1|  PREDICTED: polyadenylate-binding protein RBP...    128   3e-34   
ref|XP_010479152.1|  PREDICTED: polyadenylate-binding protein RBP...    130   3e-34   
ref|NP_175181.1|  RNA-binding protein 47C'                              128   3e-34   
ref|XP_010938882.1|  PREDICTED: polyadenylate-binding protein RBP...    129   4e-34   
ref|XP_002468416.1|  hypothetical protein SORBIDRAFT_01g045570          130   4e-34   
gb|KCW68769.1|  hypothetical protein EUGRSUZ_F02369                     130   5e-34   
gb|ACR34003.1|  unknown                                                 130   6e-34   
ref|NP_001132004.1|  uncharacterized protein LOC100193409               128   6e-34   
ref|XP_010061775.1|  PREDICTED: polyadenylate-binding protein RBP...    130   6e-34   
gb|KCW68770.1|  hypothetical protein EUGRSUZ_F02369                     130   6e-34   
ref|XP_004230808.1|  PREDICTED: polyadenylate-binding protein RBP47     125   6e-34   
ref|XP_006473363.1|  PREDICTED: polyadenylate-binding protein RBP...    131   6e-34   
ref|NP_001152183.1|  LOC100285821                                       129   7e-34   
ref|XP_003523906.1|  PREDICTED: polyadenylate-binding protein RBP...    129   7e-34   
ref|XP_010461546.1|  PREDICTED: polyadenylate-binding protein RBP...    129   7e-34   
ref|XP_010519119.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    130   7e-34   
ref|XP_010265752.1|  PREDICTED: polyadenylate-binding protein RBP...    129   7e-34   
ref|XP_006393576.1|  hypothetical protein EUTSA_v10011476mg             133   7e-34   
ref|XP_008349307.1|  PREDICTED: polyadenylate-binding protein RBP...    122   7e-34   
gb|KHN04518.1|  Polyadenylate-binding protein RBP47C                    129   8e-34   
gb|KDO35910.1|  hypothetical protein CISIN_1g029152mg                   133   8e-34   
gb|KFK36144.1|  hypothetical protein AALP_AA4G083000                    130   9e-34   
ref|XP_006660711.1|  PREDICTED: polyadenylate-binding protein RBP...    130   1e-33   
ref|NP_001275480.1|  DNA binding protein ACBF-like                      125   1e-33   
ref|XP_008224811.1|  PREDICTED: polyadenylate-binding protein RBP...    120   1e-33   
ref|XP_007156541.1|  hypothetical protein PHAVU_003G294800g             125   2e-33   
gb|KEH40058.1|  polyadenylate-binding protein RBP47C                    126   2e-33   
gb|AFK35123.1|  unknown                                                 126   2e-33   
ref|XP_006346456.1|  PREDICTED: polyadenylate-binding protein RBP47     124   2e-33   
gb|EAY95631.1|  hypothetical protein OsI_17488                          134   2e-33   
ref|XP_003558701.1|  PREDICTED: polyadenylate-binding protein RBP...    128   2e-33   
ref|XP_006361746.1|  PREDICTED: polyadenylate-binding protein RBP...    129   2e-33   
ref|XP_010907889.1|  PREDICTED: polyadenylate-binding protein RBP47     131   2e-33   
ref|XP_004985527.1|  PREDICTED: polyadenylate-binding protein RBP...    127   2e-33   
ref|XP_009590296.1|  PREDICTED: polyadenylate-binding protein RBP47     123   2e-33   
gb|AAB92518.1|  putative RNA binding protein                            123   2e-33   
ref|XP_009357435.1|  PREDICTED: polyadenylate-binding protein RBP...    120   2e-33   
ref|XP_011088289.1|  PREDICTED: polyadenylate-binding protein RBP47     125   3e-33   
ref|XP_011083821.1|  PREDICTED: polyadenylate-binding protein RBP...    132   3e-33   
ref|XP_006480131.1|  PREDICTED: polyadenylate-binding protein RBP...    124   3e-33   
ref|XP_004250947.1|  PREDICTED: polyadenylate-binding protein RBP...    130   3e-33   
ref|XP_002285031.1|  PREDICTED: polyadenylate-binding protein RBP...    127   3e-33   
emb|CBI32444.3|  unnamed protein product                                127   3e-33   
ref|XP_002891364.1|  ATRBP47C                                           125   3e-33   
ref|XP_010647773.1|  PREDICTED: polyadenylate-binding protein RBP...    127   3e-33   
ref|XP_006423054.1|  hypothetical protein CICLE_v10028454mg             124   3e-33   
ref|XP_006361747.1|  PREDICTED: polyadenylate-binding protein RBP...    129   3e-33   
ref|XP_009794615.1|  PREDICTED: polyadenylate-binding protein RBP...    122   4e-33   
ref|XP_007156542.1|  hypothetical protein PHAVU_003G294800g             124   4e-33   
ref|XP_009794616.1|  PREDICTED: polyadenylate-binding protein RBP...    122   4e-33   
ref|XP_002313840.2|  RNA-binding protein 47                             126   4e-33   
ref|XP_010313279.1|  PREDICTED: polyadenylate-binding protein RBP...    129   4e-33   
ref|XP_004952707.1|  PREDICTED: polyadenylate-binding protein RBP...    125   4e-33   
ref|XP_009764865.1|  PREDICTED: polyadenylate-binding protein RBP...    129   4e-33   
ref|NP_001049124.1|  Os03g0174100                                       128   5e-33   
gb|ABF94248.1|  RNA recognition motif family protein, expressed         128   5e-33   
ref|XP_011000065.1|  PREDICTED: polyadenylate-binding protein RBP47     125   5e-33   
gb|EEC74608.1|  hypothetical protein OsI_10216                          128   5e-33   
ref|XP_006384437.1|  hypothetical protein POPTR_0004s15080g             126   6e-33   
ref|XP_002285479.1|  PREDICTED: polyadenylate-binding protein RBP...    128   6e-33   
ref|XP_008437079.1|  PREDICTED: polyadenylate-binding protein RBP...    128   7e-33   
ref|XP_004152401.1|  PREDICTED: polyadenylate-binding protein RBP...    128   7e-33   
emb|CBI16387.3|  unnamed protein product                                128   7e-33   
ref|XP_004145357.2|  PREDICTED: polyadenylate-binding protein RBP47     123   7e-33   
emb|CAN74486.1|  hypothetical protein VITISV_029928                     125   8e-33   
ref|NP_175180.1|  RNA-binding protein 47C                               123   8e-33   
ref|XP_003603009.1|  RNA-binding protein                                129   8e-33   
ref|XP_009417617.1|  PREDICTED: polyadenylate-binding protein RBP...    128   9e-33   
gb|ADE77364.1|  unknown                                                 132   1e-32   
sp|Q9LEB3.1|RBP47_NICPL  RecName: Full=Polyadenylate-binding prot...    121   1e-32   
ref|XP_002446570.1|  hypothetical protein SORBIDRAFT_06g018280          125   1e-32   
gb|EYU42664.1|  hypothetical protein MIMGU_mgv1a008163mg                122   1e-32   
ref|XP_006349628.1|  PREDICTED: polyadenylate-binding protein RBP...    124   1e-32   
ref|XP_008813037.1|  PREDICTED: polyadenylate-binding protein RBP...    128   1e-32   
ref|XP_002452313.1|  hypothetical protein SORBIDRAFT_04g023540          123   1e-32   
ref|NP_001275430.1|  DNA-binding protein-like                           124   1e-32   
ref|XP_008813039.1|  PREDICTED: polyadenylate-binding protein RBP...    128   1e-32   
ref|XP_011654802.1|  PREDICTED: polyadenylate-binding protein RBP...    127   1e-32   
ref|XP_011654806.1|  PREDICTED: polyadenylate-binding protein RBP...    127   1e-32   
emb|CDP18029.1|  unnamed protein product                                126   2e-32   
ref|XP_003579863.1|  PREDICTED: polyadenylate-binding protein RBP...    121   2e-32   
ref|XP_011654805.1|  PREDICTED: polyadenylate-binding protein RBP...    127   2e-32   
gb|KHN31058.1|  Polyadenylate-binding protein RBP47                     121   2e-32   
gb|EPS57677.1|  hypothetical protein M569_17140                         126   2e-32   
gb|EEE57226.1|  hypothetical protein OsJ_07197                          124   2e-32   
ref|XP_009628458.1|  PREDICTED: polyadenylate-binding protein RBP...    124   3e-32   
ref|XP_011004995.1|  PREDICTED: polyadenylate-binding protein RBP...    124   3e-32   
ref|NP_001047180.1|  Os02g0567900                                       124   3e-32   
ref|XP_011625480.1|  PREDICTED: polyadenylate-binding protein RBP...    125   3e-32   
ref|XP_003529385.1|  PREDICTED: polyadenylate-binding protein RBP...    120   3e-32   
ref|XP_010108648.1|  Polyadenylate-binding protein RBP47B'              123   3e-32   
ref|XP_004975779.1|  PREDICTED: polyadenylate-binding protein RBP...    124   3e-32   
ref|XP_008437076.1|  PREDICTED: polyadenylate-binding protein RBP...    126   3e-32   
ref|XP_003575198.1|  PREDICTED: polyadenylate-binding protein RBP...    122   3e-32   
ref|XP_006349627.1|  PREDICTED: polyadenylate-binding protein RBP...    123   3e-32   
gb|EEC73442.1|  hypothetical protein OsI_07730                          123   4e-32   
gb|KHN37491.1|  Polyadenylate-binding protein RBP47                     120   4e-32   
gb|EMT05029.1|  Putative RNA-binding protein                            122   4e-32   
ref|XP_009391347.1|  PREDICTED: polyadenylate-binding protein RBP...    125   4e-32   
ref|XP_008437078.1|  PREDICTED: polyadenylate-binding protein RBP...    125   4e-32   
ref|XP_003518846.1|  PREDICTED: polyadenylate-binding protein RBP...    120   5e-32   
ref|XP_010926371.1|  PREDICTED: leucine-rich repeat extensin-like...    121   5e-32   
ref|XP_010066047.1|  PREDICTED: polyadenylate-binding protein RBP47     121   6e-32   
gb|KCW63816.1|  hypothetical protein EUGRSUZ_G01492                     121   6e-32   
ref|XP_006648763.1|  PREDICTED: polyadenylate-binding protein RBP...    124   6e-32   
ref|XP_010327390.1|  PREDICTED: DNA-binding protein isoform X2          122   7e-32   
gb|KDO49116.1|  hypothetical protein CISIN_1g013061mg                   120   7e-32   
dbj|BAD17764.1|  putative nucleic acid binding protein                  122   7e-32   
ref|XP_006487135.1|  PREDICTED: uncharacterized protein LOC102626638    122   7e-32   
ref|XP_008236618.1|  PREDICTED: polyadenylate-binding protein RBP...    122   8e-32   
ref|XP_010327389.1|  PREDICTED: DNA-binding protein isoform X1          121   9e-32   
ref|XP_009380242.1|  PREDICTED: polyadenylate-binding protein RBP...    122   9e-32   
ref|XP_006452305.1|  hypothetical protein CICLE_v10010830mg             125   9e-32   
gb|EMT27298.1|  Putative RNA-binding protein                            122   9e-32   
emb|CDP01376.1|  unnamed protein product                                123   1e-31   
ref|XP_006475165.1|  PREDICTED: polyadenylate-binding protein RBP...    125   1e-31   
ref|XP_011461514.1|  PREDICTED: polyadenylate-binding protein RBP...    125   1e-31   
ref|XP_006649483.1|  PREDICTED: polyadenylate-binding protein RBP...    123   1e-31   
ref|XP_008813036.1|  PREDICTED: polyadenylate-binding protein RBP...    124   1e-31   
ref|XP_009783557.1|  PREDICTED: polyadenylate-binding protein RBP...    121   1e-31   
emb|CAC69852.1|  nucleic acid binding protein                           122   1e-31   
ref|XP_009783555.1|  PREDICTED: polyadenylate-binding protein RBP...    121   1e-31   
gb|EMS47480.1|  Uncharacterized RNA-binding protein C23E6.01c           122   1e-31   
ref|XP_006452306.1|  hypothetical protein CICLE_v10010830mg             124   2e-31   
gb|KHG16958.1|  Polyadenylate-binding RBP45B -like protein              132   2e-31   
gb|AFA36523.1|  nucleic acid binding protein                            123   2e-31   
ref|XP_006594429.1|  PREDICTED: polyadenylate-binding protein RBP...    117   2e-31   
ref|XP_008459212.1|  PREDICTED: polyadenylate-binding protein RBP47     120   2e-31   
ref|XP_008236617.1|  PREDICTED: polyadenylate-binding protein RBP...    121   2e-31   
ref|XP_007199852.1|  hypothetical protein PRUPE_ppa005661mg             121   2e-31   
ref|XP_006452304.1|  hypothetical protein CICLE_v10010830mg             124   2e-31   
ref|NP_001234487.1|  DNA-binding protein                                120   2e-31   
ref|XP_006475164.1|  PREDICTED: polyadenylate-binding protein RBP...    125   2e-31   
ref|XP_008678713.1|  PREDICTED: polyadenylate-binding protein RBP...    118   2e-31   
gb|ACN40970.1|  unknown                                                 118   2e-31   
emb|CDP04387.1|  unnamed protein product                                126   3e-31   
ref|XP_006475163.1|  PREDICTED: polyadenylate-binding protein RBP...    124   3e-31   
ref|XP_006653468.1|  PREDICTED: polyadenylate-binding protein RBP...    120   3e-31   
ref|XP_007015033.1|  RNA-binding family protein isoform 1               122   3e-31   
ref|XP_008782322.1|  PREDICTED: polyadenylate-binding protein RBP...    125   4e-31   
ref|XP_003608019.1|  RNA Binding Protein                                115   4e-31   
ref|XP_007015035.1|  RNA-binding family protein isoform 3               122   4e-31   
ref|XP_007015034.1|  RNA-binding family protein isoform 2               122   4e-31   
gb|AAC49850.1|  DNA binding protein ACBF                                116   4e-31   
gb|AFK40720.1|  unknown                                                 115   4e-31   
ref|XP_004294842.1|  PREDICTED: polyadenylate-binding protein RBP...    123   5e-31   
gb|EEE61093.1|  hypothetical protein OsJ_14988                          120   5e-31   
gb|EYU37704.1|  hypothetical protein MIMGU_mgv1a006826mg                116   6e-31   
gb|EAY94326.1|  hypothetical protein OsI_16094                          119   7e-31   
emb|CAH67097.1|  H0818E04.14                                            119   7e-31   
ref|XP_006850190.1|  PREDICTED: polyadenylate-binding protein RBP...    120   7e-31   
gb|EPS64859.1|  nucleic acid binding protein                            120   8e-31   
ref|NP_001052934.2|  Os04g0449900                                       119   9e-31   
ref|XP_002963882.1|  hypothetical protein SELMODRAFT_80061              120   9e-31   
ref|XP_002988285.1|  hypothetical protein SELMODRAFT_447249             120   9e-31   
ref|XP_004987274.1|  PREDICTED: polyadenylate-binding protein RBP...    120   9e-31   
ref|XP_008797245.1|  PREDICTED: polyadenylate-binding protein RBP...    126   9e-31   
dbj|BAJ93453.1|  predicted protein                                      119   1e-30   
gb|ACN39849.1|  unknown                                                 116   1e-30   
emb|CDX95462.1|  BnaC01g33540D                                          114   1e-30   
gb|EMS68789.1|  Uncharacterized RNA-binding protein C23E6.01c           119   1e-30   
ref|XP_009615947.1|  PREDICTED: polyadenylate-binding protein RBP...    120   1e-30   
emb|CDX92304.1|  BnaA05g21030D                                          115   1e-30   
ref|NP_001130489.1|  uncharacterized protein LOC100191587               118   1e-30   
ref|XP_009145825.1|  PREDICTED: polyadenylate-binding protein RBP...    116   1e-30   
gb|KHG09232.1|  Polyadenylate-binding RBP47B' -like protein             120   1e-30   
ref|XP_003528246.1|  PREDICTED: polyadenylate-binding protein RBP...    119   2e-30   
ref|XP_009358068.1|  PREDICTED: polyadenylate-binding protein RBP...    120   2e-30   
ref|XP_009768585.1|  PREDICTED: polyadenylate-binding protein RBP...    120   2e-30   
ref|XP_004505196.1|  PREDICTED: polyadenylate-binding protein RBP...    115   2e-30   
ref|XP_004288602.1|  PREDICTED: polyadenylate-binding protein RBP...    119   2e-30   
ref|XP_009356988.1|  PREDICTED: polyadenylate-binding protein RBP...    120   2e-30   
ref|XP_006279885.1|  hypothetical protein CARUB_v100264670mg            127   2e-30   
ref|XP_011080284.1|  PREDICTED: polyadenylate-binding protein RBP...    121   2e-30   
gb|KFK31829.1|  hypothetical protein AALP_AA6G163800                    117   2e-30   
gb|EYU46265.1|  hypothetical protein MIMGU_mgv1a007107mg                122   3e-30   
ref|XP_002513488.1|  nuclear acid binding protein, putative             115   4e-30   
emb|CDY18570.1|  BnaA01g26250D                                          114   4e-30   



>ref|XP_006346222.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
tuberosum]
Length=414

 Score =   233 bits (595),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 130/174 (75%), Positives = 141/174 (81%), Gaps = 3/174 (2%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            V C SSRPMRIGPAANK  + T QKATYQ+ QA QG+SDPNNTTIFVGGLDP+V+EE +R
Sbjct  242  VLC-SSRPMRIGPAANKKPMGTPQKATYQNPQATQGESDPNNTTIFVGGLDPSVAEEHLR  300

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            QVFSPYGELVHVKIVA KRCGFVQF +R SAE ALSSL GAQLG Q++RLSWGR+PSNKQ
Sbjct  301  QVFSPYGELVHVKIVAGKRCGFVQFGSRASAEQALSSLNGAQLGGQSIRLSWGRSPSNKQ  360

Query  461  SDQTqwgggvggsyygyaqqgydayg--yAPPPQDPNMYYGSYPGYTNYQQPQQ  306
            SDQTQWGG  GG    Y           YAPPPQDPNMYYG+YPGY NYQQPQQ
Sbjct  361  SDQTQWGGSAGGGAGAYYGYAQGYDAYGYAPPPQDPNMYYGNYPGYGNYQQPQQ  414



>ref|XP_009600135.1| PREDICTED: polyadenylate-binding protein RBP45 [Nicotiana tomentosiformis]
Length=410

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 140/172 (81%), Gaps = 3/172 (2%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            V C S+RPMRIGPAANK  V T QKATYQ+ QA QG+SDPNNTTIFVGGLDP V+EE +R
Sbjct  242  VLC-STRPMRIGPAANKKPVGTLQKATYQNPQATQGESDPNNTTIFVGGLDPTVAEEHLR  300

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            QVFSPYGELVHVKIVA KRCGFVQF  R SAE ALSSL G QLG Q++RLSWGR+PS+KQ
Sbjct  301  QVFSPYGELVHVKIVAGKRCGFVQFGTRGSAEQALSSLNGTQLGGQSIRLSWGRSPSSKQ  360

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQPQQ  306
            +DQT       G  Y    QGY+AYGYAPP QDPNMYYG+YPGYTNYQQPQQ
Sbjct  361  TDQT--QWSGSGGAYYGYGQGYEAYGYAPPAQDPNMYYGNYPGYTNYQQPQQ  410



>sp|Q9LEB4.1|RBP45_NICPL RecName: Full=Polyadenylate-binding protein RBP45; Short=Poly(A)-binding 
protein RBP45; AltName: Full=RNA-binding protein 
45; Short=NplRBP45 [Nicotiana plumbaginifolia]
 emb|CAC01237.1| RNA Binding Protein 45 [Nicotiana plumbaginifolia]
Length=409

 Score =   228 bits (581),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 140/172 (81%), Gaps = 3/172 (2%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            V C S+RPMRIGPAANK  V T QKATYQ+ QA QG+SDPNNTTIFVGGLDP V+EE +R
Sbjct  241  VLC-STRPMRIGPAANKKPVGTPQKATYQNPQATQGESDPNNTTIFVGGLDPTVAEEHLR  299

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            QVFSPYGELVHVKIVA KRCGFVQF  R SAE ALSSL G QLG Q++RLSWGR+PS+KQ
Sbjct  300  QVFSPYGELVHVKIVAGKRCGFVQFGTRASAEQALSSLNGTQLGGQSIRLSWGRSPSSKQ  359

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQPQQ  306
            +DQT    G  G  Y    QGY+AYGYAPP QDPNMYYG+YPGY NYQQPQQ
Sbjct  360  TDQT--QWGGSGGAYYGYGQGYEAYGYAPPAQDPNMYYGNYPGYANYQQPQQ  409



>ref|XP_009795696.1| PREDICTED: polyadenylate-binding protein RBP45 [Nicotiana sylvestris]
Length=409

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 140/172 (81%), Gaps = 3/172 (2%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            V C S+RPMRIGPAANK  V T QKA YQ+ QA QG+SDPNNTTIFVGGLDP V+EE +R
Sbjct  241  VLC-STRPMRIGPAANKKPVGTPQKAIYQNPQATQGESDPNNTTIFVGGLDPTVAEEHLR  299

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            QVFSPYGELVHVKIVA KRCGFVQF  R SAE ALSSL G QLG Q++RLSWGR+PS+KQ
Sbjct  300  QVFSPYGELVHVKIVAGKRCGFVQFGTRASAEQALSSLNGTQLGGQSIRLSWGRSPSSKQ  359

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQPQQ  306
            +DQT    G  G  Y    QGY+AYGYAPP QDPNMYYG+YPGYTNYQQPQQ
Sbjct  360  TDQT--QWGGSGGAYYGYGQGYEAYGYAPPAQDPNMYYGNYPGYTNYQQPQQ  409



>ref|XP_004244127.1| PREDICTED: polyadenylate-binding protein RBP45 [Solanum lycopersicum]
Length=410

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 126/174 (72%), Positives = 137/174 (79%), Gaps = 3/174 (2%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            V C SSRPMRIGPAANK  + T QKATYQ+ QA QG+SDPNNTTIFVGGLDP+V+EE +R
Sbjct  238  VLC-SSRPMRIGPAANKKPMGTPQKATYQNPQATQGESDPNNTTIFVGGLDPSVAEEHLR  296

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            QVFSPYGELVHVKIVA KRCGFVQF +R SAE ALSSL G QLG Q++RLSWGR+PSNKQ
Sbjct  297  QVFSPYGELVHVKIVAGKRCGFVQFGSRASAEQALSSLNGTQLGGQSIRLSWGRSPSNKQ  356

Query  461  SDQTqwgggvggsyygyaqqgydayg--yAPPPQDPNMYYGSYPGYTNYQQPQQ  306
            SDQ QWGG  G     Y           YAPP QDPNMYYG+YPGY NYQQPQQ
Sbjct  357  SDQAQWGGSAGAGAGAYYGYAQGYEAYGYAPPAQDPNMYYGNYPGYGNYQQPQQ  410



>ref|XP_011097972.1| PREDICTED: polyadenylate-binding protein RBP45-like [Sesamum 
indicum]
Length=376

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 133/173 (77%), Gaps = 7/173 (4%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKN-LVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELM  645
            V C S+RPMRIGPAANK  +  + QKA+YQ+ Q  QG+SDPNNTT+FVGGLDPNV+++ +
Sbjct  210  VLC-STRPMRIGPAANKKPMTASTQKASYQNPQGTQGESDPNNTTVFVGGLDPNVTDDHL  268

Query  644  RQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNK  465
            +QVFS YGE+VHVKI   KRCGFVQF++R  AE ALS+L G  LG QN+RLSWGRNPSNK
Sbjct  269  KQVFSQYGEVVHVKIPVGKRCGFVQFADRSCAEQALSNLNGTLLGGQNIRLSWGRNPSNK  328

Query  464  QSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQPQQ  306
            QSDQ        GS Y    QGY++YG   PPQDPNMYYG YPGY NYQQPQQ
Sbjct  329  QSDQN-----QWGSAYYGYTQGYESYGGYAPPQDPNMYYGGYPGYANYQQPQQ  376



>emb|CDP05748.1| unnamed protein product [Coffea canephora]
Length=328

 Score =   202 bits (513),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 130/174 (75%), Gaps = 8/174 (5%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            V C + RPMRIGPAANK     QQ  KA  Q++Q  +G+SDPNNTTIFVGGLDP+V++E 
Sbjct  148  VICLT-RPMRIGPAANKKPAGVQQYQKAPNQNTQGNEGESDPNNTTIFVGGLDPSVTDEN  206

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            +RQVF  YGE+VHVKI A KRCGFVQF+NR  AE AL SL G QLG Q++RLSWGR+PSN
Sbjct  207  LRQVFGRYGEVVHVKIPAGKRCGFVQFTNRACAEQALESLNGTQLGLQSIRLSWGRSPSN  266

Query  467  KQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQPQQ  306
            KQSDQ                QGYDAY YAPPPQDPN+YYG YPGYTNYQQPQQ
Sbjct  267  KQSDQ-----PPWNGGCYGYTQGYDAYAYAPPPQDPNVYYGGYPGYTNYQQPQQ  315


 Score = 53.1 bits (126),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVCLI  805
            YGFV+FGDES+QLRAMTEMNGV+CL 
Sbjct  127  YGFVKFGDESEQLRAMTEMNGVICLT  152



>ref|XP_002280601.1| PREDICTED: polyadenylate-binding protein RBP45-like [Vitis vinifera]
Length=417

 Score =   203 bits (516),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 132/173 (76%), Gaps = 9/173 (5%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             S+RPMRIGPAA K  V  QQ  KA++Q++Q  QG+SDPNNTTIFVGGLD NV+++ +RQ
Sbjct  250  CSTRPMRIGPAATKKPVGGQQFQKASFQNTQGNQGESDPNNTTIFVGGLDSNVTDDYLRQ  309

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            VFS YGELVHVKI   KRCGFVQF+NR  AE AL+ L G QLG Q++RLSWGR+PSNKQ+
Sbjct  310  VFSQYGELVHVKIPVGKRCGFVQFANRACAEQALAGLNGTQLGAQSIRLSWGRSPSNKQA  369

Query  458  --DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQPQQ  306
              DQ           Y    QGY+AYGYAPPPQDPNMYYG+YPGY NYQQPQQ
Sbjct  370  QPDQA-----QWNGGYYGYAQGYEAYGYAPPPQDPNMYYGAYPGYGNYQQPQQ  417



>ref|XP_006452314.1| hypothetical protein CICLE_v10008440mg [Citrus clementina]
 gb|ESR65554.1| hypothetical protein CICLE_v10008440mg [Citrus clementina]
Length=417

 Score =   199 bits (506),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 130/172 (76%), Gaps = 7/172 (4%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            V C S+RPMRIGPAA K     QQ  KATYQ++Q  QG++DPNNTTIFVGGLDP+V++++
Sbjct  232  VLC-STRPMRIGPAATKKAATGQQYQKATYQNTQGSQGENDPNNTTIFVGGLDPSVTDDI  290

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            ++ VF  YGELVHVKI A KRCGFVQF+NR  AE ALS L G QLG Q++RLSWGR+PSN
Sbjct  291  LKTVFGQYGELVHVKIPAGKRCGFVQFANRTCAEQALSVLNGTQLGGQSIRLSWGRSPSN  350

Query  467  KQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQP  312
            KQSDQ        G  Y    QGY+AYGYAPP QDPNMYYG +PGY  YQQP
Sbjct  351  KQSDQA----QWNGGGYYGFAQGYEAYGYAPPTQDPNMYYGGFPGYGTYQQP  398


 Score = 50.8 bits (120),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+QLR+MTEMNGV+C
Sbjct  211  YGFVRFGDESEQLRSMTEMNGVLC  234



>ref|XP_006452313.1| hypothetical protein CICLE_v10008440mg [Citrus clementina]
 ref|XP_006475160.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Citrus 
sinensis]
 gb|ESR65553.1| hypothetical protein CICLE_v10008440mg [Citrus clementina]
 gb|KDO62643.1| hypothetical protein CISIN_1g015468mg [Citrus sinensis]
Length=406

 Score =   199 bits (505),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 130/172 (76%), Gaps = 7/172 (4%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            V C S+RPMRIGPAA K     QQ  KATYQ++Q  QG++DPNNTTIFVGGLDP+V++++
Sbjct  232  VLC-STRPMRIGPAATKKAATGQQYQKATYQNTQGSQGENDPNNTTIFVGGLDPSVTDDI  290

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            ++ VF  YGELVHVKI A KRCGFVQF+NR  AE ALS L G QLG Q++RLSWGR+PSN
Sbjct  291  LKTVFGQYGELVHVKIPAGKRCGFVQFANRTCAEQALSVLNGTQLGGQSIRLSWGRSPSN  350

Query  467  KQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQP  312
            KQSDQ        G  Y    QGY+AYGYAPP QDPNMYYG +PGY  YQQP
Sbjct  351  KQSDQA----QWNGGGYYGFAQGYEAYGYAPPTQDPNMYYGGFPGYGTYQQP  398


 Score = 50.8 bits (120),  Expect(2) = 4e-57, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+QLR+MTEMNGV+C
Sbjct  211  YGFVRFGDESEQLRSMTEMNGVLC  234



>emb|CAN83958.1| hypothetical protein VITISV_039907 [Vitis vinifera]
Length=410

 Score =   197 bits (501),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 111/171 (65%), Positives = 129/171 (75%), Gaps = 11/171 (6%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAA K  V     A++Q++Q  QG+SDPNNTTIFVGGLD NV+++ +RQVF
Sbjct  235  CSTRPMRIGPAATKKPVG----ASFQNTQGXQGESDPNNTTIFVGGLDSNVTDDYLRQVF  290

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS--  459
            S YGELVHVKI   KRCGFVQF+NR  AE AL+ L G QLG Q++RLSWGR+PSNKQ+  
Sbjct  291  SQYGELVHVKIPVGKRCGFVQFANRACAEQALAGLNGTQLGAQSIRLSWGRSPSNKQAQP  350

Query  458  DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQPQQ  306
            DQ           Y    QGY+AYGYAPPPQDPNMYYG+YPGY NYQQPQQ
Sbjct  351  DQA-----QWNGGYYGYAQGYEAYGYAPPPQDPNMYYGAYPGYGNYQQPQQ  396



>ref|XP_010911059.1| PREDICTED: polyadenylate-binding protein RBP45-like [Elaeis guineensis]
Length=258

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 102/172 (59%), Positives = 121/172 (70%), Gaps = 5/172 (3%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            ++C S+RPMRIGPA +K  V   QKA++Q++   Q ++DPNNTTIFVGGLD NV+EE++R
Sbjct  91   MFC-STRPMRIGPATSKKTVGAPQKASFQTATGTQSENDPNNTTIFVGGLDSNVTEEVLR  149

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            QVFSPYGELVHVKI   K CGFVQF+NR  AE AL  LQG QLG QN+RLSWGR+P+NKQ
Sbjct  150  QVFSPYGELVHVKIPVGKHCGFVQFANRACAEEALLMLQGTQLGGQNIRLSWGRSPTNKQ  209

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNYQQPQ  309
                          YG   + Y       PPQDPNMY YG+YPGY NYQQ Q
Sbjct  210  PQPDPNQWNGSYYGYGQGYEAYSYAQ---PPQDPNMYAYGTYPGYGNYQQQQ  258



>ref|XP_008806741.1| PREDICTED: polyadenylate-binding protein RBP45 [Phoenix dactylifera]
Length=420

 Score =   193 bits (490),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 120/169 (71%), Gaps = 4/169 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPA +K  +  Q KA++QS+   Q ++DPNNTTIFVGGLD NV+EE++RQVF
Sbjct  255  CSTRPMRIGPATSKKTMGVQPKASFQSATGTQSENDPNNTTIFVGGLDSNVTEEVLRQVF  314

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
            SPYGELVHVKI   K CGFVQF+NRP AE AL  LQG QLG QN+RLSWGR+P+NKQ   
Sbjct  315  SPYGELVHVKIPVGKHCGFVQFANRPCAEEALLMLQGTQLGGQNIRLSWGRSPTNKQPQP  374

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNYQQPQ  309
                       YG   + Y+      PPQDPNMY YG+YPGY NYQQ Q
Sbjct  375  DPNQWNGSYYGYGQGYEAYNYAQ---PPQDPNMYAYGAYPGYGNYQQQQ  420



>ref|XP_010062999.1| PREDICTED: polyadenylate-binding protein RBP45C [Eucalyptus grandis]
 gb|KCW70173.1| hypothetical protein EUGRSUZ_F03462 [Eucalyptus grandis]
Length=397

 Score =   187 bits (474),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 130/172 (76%), Gaps = 6/172 (3%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            ++C SSRPMRIGPAANK  + TQQ   A+YQ+SQ  QG++DPNNTTIFVGGLDP+VS++L
Sbjct  222  MYC-SSRPMRIGPAANKKPIATQQYQSASYQNSQGNQGENDPNNTTIFVGGLDPSVSDDL  280

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            +RQVFS YGEL HVKI   KRCGFVQF++R  AE AL  L G QLG Q++RLSWGR+PSN
Sbjct  281  LRQVFSQYGELHHVKIPPGKRCGFVQFTSRACAEQALLMLNGTQLGGQSIRLSWGRSPSN  340

Query  467  KQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQP  312
            KQ+          G  Y    QGY+AYGYAPP QDPNM+YG Y GY NYQQP
Sbjct  341  KQAQ--PEQAQWNGGGYYGYPQGYEAYGYAPPTQDPNMFYGGYAGY-NYQQP  389


 Score = 49.3 bits (116),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE++QLRAMTEMNG+ C
Sbjct  201  YGFVRFGDETEQLRAMTEMNGMYC  224



>ref|XP_010276065.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X2 [Nelumbo 
nucifera]
Length=417

 Score =   186 bits (472),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 126/171 (74%), Gaps = 6/171 (4%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             S+RPMRIGPA  K  V+ QQ  KA+YQ++Q  Q ++DPNNTTIFVGGLD NV++E +RQ
Sbjct  250  CSTRPMRIGPATTKKNVSGQQYPKASYQNTQGTQNENDPNNTTIFVGGLDSNVTDEHLRQ  309

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            VFS +GELVHVKI   KRCGFVQF+NR  AE AL  L G QLG QN+RLSWGR+PSNKQ 
Sbjct  310  VFSQFGELVHVKIPVGKRCGFVQFANRACAEEALLMLNGTQLGGQNIRLSWGRSPSNKQP  369

Query  458  DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNYQQPQ  309
               Q         Y    QGY+AYGYAPPPQDPNMY YG+YPGY NYQQ Q
Sbjct  370  ---QPDPNQWNGGYYGYGQGYEAYGYAPPPQDPNMYAYGAYPGYGNYQQQQ  417


 Score = 48.9 bits (115),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEMNG+ C
Sbjct  227  YGFVRFGDESEQIRAMTEMNGMFC  250



>ref|XP_010276064.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X1 [Nelumbo 
nucifera]
Length=425

 Score =   186 bits (472),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 126/176 (72%), Gaps = 8/176 (5%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             S+RPMRIGPA  K  V+ QQ  KA+YQ++Q  Q ++DPNNTTIFVGGLD NV++E +RQ
Sbjct  250  CSTRPMRIGPATTKKNVSGQQYPKASYQNTQGTQNENDPNNTTIFVGGLDSNVTDEHLRQ  309

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            VFS +GELVHVKI   KRCGFVQF+NR  AE AL  L G QLG QN+RLSWGR+PSNKQ 
Sbjct  310  VFSQFGELVHVKIPVGKRCGFVQFANRACAEEALLMLNGTQLGGQNIRLSWGRSPSNKQD  369

Query  458  DQTqwgg-----gvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNYQQPQ  309
                W             Y    QGY+AYGYAPPPQDPNMY YG+YPGY NYQQ Q
Sbjct  370  PSVGWVQPQPDPNQWNGGYYGYGQGYEAYGYAPPPQDPNMYAYGAYPGYGNYQQQQ  425


 Score = 48.9 bits (115),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEMNG+ C
Sbjct  227  YGFVRFGDESEQIRAMTEMNGMFC  250



>ref|XP_002522953.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF39383.1| nuclear acid binding protein, putative [Ricinus communis]
Length=404

 Score =   186 bits (472),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 122/170 (72%), Gaps = 9/170 (5%)
 Frame = -3

Query  812  ASSRPMRIGPAANKN-LVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
             S+R MRIGPAA K   V   QKA YQS+Q  QG++DPNNTTIFVG LDP+VS+E +RQV
Sbjct  226  CSTRAMRIGPAATKKPAVQQYQKAPYQSTQGTQGENDPNNTTIFVGALDPSVSDEHLRQV  285

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS-  459
            F  YGELVHVKI A KRCGFVQF+NR  AE AL  L G QL  Q++RLSWGR+PSNKQ+ 
Sbjct  286  FGKYGELVHVKIPAGKRCGFVQFANRACAEQALLGLNGTQLAGQSIRLSWGRSPSNKQAQ  345

Query  458  -DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQP  312
             DQ+QW GG  G   GY   GY       PPQDPNMYY  YPGY NYQQP
Sbjct  346  PDQSQWNGGYYGYAQGYDAYGYA------PPQDPNMYYSGYPGYGNYQQP  389



>gb|EYU33637.1| hypothetical protein MIMGU_mgv1a007175mg [Erythranthe guttata]
Length=416

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/181 (60%), Positives = 124/181 (69%), Gaps = 10/181 (6%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKN-LVNTQQKATYQSSQAGQGDS---DPNNTTIFVGGLDPNVSE  654
            V C S+RPMRIGPAANK  +  T Q+++YQS Q G G     DPNNTTIFVGGLDPNV++
Sbjct  237  VLC-STRPMRIGPAANKKPMTTTTQQSSYQSPQGGGGSQGESDPNNTTIFVGGLDPNVTD  295

Query  653  ELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNP  474
            + ++QVFS YGELVHVKI   KRCGFVQF+ R  AE AL +L G QLG QN+RLSWGR+P
Sbjct  296  DHLKQVFSQYGELVHVKIPVGKRCGFVQFAERSCAEQALGNLNGTQLGGQNIRLSWGRSP  355

Query  473  SNKQSDQ-----TqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQPQ  309
            SNKQ++Q        GGG     Y          G   PPQDPNMYYG YPGY NY QPQ
Sbjct  356  SNKQTEQNQWGSGGGGGGSYQGGYSQGGYEGHGGGGYAPPQDPNMYYGGYPGYANYHQPQ  415

Query  308  Q  306
            Q
Sbjct  416  Q  416



>ref|XP_010278708.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010278709.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nelumbo nucifera]
Length=430

 Score =   181 bits (460),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 127/176 (72%), Gaps = 8/176 (5%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            ++C S+RPMRIGPA  K  V  QQ  KA YQ++Q  Q ++DPNNTTIFVGGLD NV+++ 
Sbjct  255  IFC-STRPMRIGPATTKKNVGGQQYSKAPYQNTQGTQNENDPNNTTIFVGGLDSNVTDDH  313

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            +RQVFS +GELVHVKI   KRCGFVQF NR  AE AL  L G QLG QN+RLSWGR+PS+
Sbjct  314  LRQVFSQFGELVHVKIPVGKRCGFVQFVNRACAEEALLMLNGTQLGGQNIRLSWGRSPSS  373

Query  467  KQS----DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNYQQ  315
            KQ     +Q Q         Y    QGY+AYGYAPPPQDPNMY YG+YPGY NYQQ
Sbjct  374  KQDSVGWEQPQPDPNQWNGGYYGYGQGYEAYGYAPPPQDPNMYAYGAYPGYGNYQQ  429


 Score = 49.7 bits (117),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEMNG+ C
Sbjct  234  YGFVRFGDESEQIRAMTEMNGIFC  257



>emb|CBI26626.3| unnamed protein product [Vitis vinifera]
Length=224

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 123/174 (71%), Gaps = 7/174 (4%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            V+  +S P            N Q  +++Q++Q  QG+SDPNNTTIFVGGLD NV+++ +R
Sbjct  10   VYLNTSFPFLFWVPVGNFASNFQLFSSFQNTQGNQGESDPNNTTIFVGGLDSNVTDDYLR  69

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            QVFS YGELVHVKI   KRCGFVQF+NR  AE AL+ L G QLG Q++RLSWGR+PSNKQ
Sbjct  70   QVFSQYGELVHVKIPVGKRCGFVQFANRACAEQALAGLNGTQLGAQSIRLSWGRSPSNKQ  129

Query  461  S--DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQPQQ  306
            +  DQ           Y    QGY+AYGYAPPPQDPNMYYG+YPGY NYQQPQQ
Sbjct  130  AQPDQA-----QWNGGYYGYAQGYEAYGYAPPPQDPNMYYGAYPGYGNYQQPQQ  178



>ref|XP_010278711.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X3 
[Nelumbo nucifera]
 ref|XP_010278712.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X4 
[Nelumbo nucifera]
Length=423

 Score =   180 bits (456),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 108/172 (63%), Positives = 125/172 (73%), Gaps = 7/172 (4%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            ++C S+RPMRIGPA  K  V  QQ  KA YQ++Q  Q ++DPNNTTIFVGGLD NV+++ 
Sbjct  255  IFC-STRPMRIGPATTKKNVGGQQYSKAPYQNTQGTQNENDPNNTTIFVGGLDSNVTDDH  313

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            +RQVFS +GELVHVKI   KRCGFVQF NR  AE AL  L G QLG QN+RLSWGR+PS+
Sbjct  314  LRQVFSQFGELVHVKIPVGKRCGFVQFVNRACAEEALLMLNGTQLGGQNIRLSWGRSPSS  373

Query  467  KQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNYQQ  315
            KQ    Q         Y    QGY+AYGYAPPPQDPNMY YG+YPGY NYQQ
Sbjct  374  KQP---QPDPNQWNGGYYGYGQGYEAYGYAPPPQDPNMYAYGAYPGYGNYQQ  422


 Score = 49.7 bits (117),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEMNG+ C
Sbjct  234  YGFVRFGDESEQIRAMTEMNGIFC  257



>ref|XP_010240455.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Brachypodium distachyon]
Length=423

 Score =   182 bits (463),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 115/166 (69%), Gaps = 2/166 (1%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             SSRPMRIGPAAN+     Q++    ++Q  Q D+DPNNTTIFVGGLDPNV+E+ ++QVF
Sbjct  245  CSSRPMRIGPAANRKTTGVQERVPNTNTQGAQSDNDPNNTTIFVGGLDPNVTEDALKQVF  304

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
            +PYGE++HVKI   KRCGFVQF NRPSAE AL  LQG  +G QNVRLSWGR+PSNKQ+ +
Sbjct  305  APYGEVIHVKIPVGKRCGFVQFVNRPSAEQALQMLQGTPIGGQNVRLSWGRSPSNKQAQE  364

Query  452  TqwgggvggsyygyaqqgydaygyAPP-PQDPNMY-YGSYPGYTNY  321
            +   G   G+ Y                PQDPNMY YG+Y GY NY
Sbjct  365  SSQWGANAGAGYYGGYGQGYDAYGGYAQPQDPNMYGYGAYAGYPNY  410



>ref|XP_008349306.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X1 [Malus domestica]
Length=377

 Score =   177 bits (448),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 106/171 (62%), Positives = 122/171 (71%), Gaps = 6/171 (4%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            V C S+RPMRIGPAANKN   +QQ   A+YQ+SQ  + DSDPNNTTIFVG LD NV+++ 
Sbjct  192  VLC-STRPMRIGPAANKNAGGSQQYSNASYQNSQGAKNDSDPNNTTIFVGNLDGNVTDDH  250

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            +RQVFS YGELVHVKI   KRCGFVQF++R  AE AL  L G+QLG QN+RLSWGR+PSN
Sbjct  251  LRQVFSKYGELVHVKIPMGKRCGFVQFADRSCAEEALRVLNGSQLGAQNIRLSWGRSPSN  310

Query  467  KQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYP--GYTNY  321
            KQ  Q       GG  Y       D+YGYA   QDPN+YYGSYP  GY NY
Sbjct  311  KQP-QADPSQWNGGGGYYGYAPTPDSYGYAQVSQDPNLYYGSYPAAGYGNY  360


 Score = 50.1 bits (118),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+Q+RAMTEMNGV+C
Sbjct  171  YGFVKFGDESEQMRAMTEMNGVLC  194


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/89 (34%), Positives = 50/89 (56%), Gaps = 9/89 (10%)
 Frame = -3

Query  692  TIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKR-C-----GFVQFSNRPSAEHALSS  531
            T+++G L   + E  +  +F   GE+V VK++  K+ C     GF++F++R +AE  L +
Sbjct  37   TLWIGDLQYWMEENYLYNIFLHTGEVVSVKVIRNKQTCQSEGYGFIEFNSRAAAERVLQA  96

Query  530  LQGAQL--GEQNVRLSWGRNPSNKQSDQT  450
              G  +  G QN RL+W  +   K+SD T
Sbjct  97   FNGTPMPNGAQNFRLNWA-STGEKRSDDT  124



>ref|XP_009406503.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=430

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 120/172 (70%), Gaps = 10/172 (6%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQK----ATYQSSQAGQGDSDPNNTTIFVGGLDPNVSE  654
            V+C S+RPMRIGPAA+K  + TQQ+    A+YQ++Q  + ++DPNNTTIFVGGLDPNV++
Sbjct  253  VYC-STRPMRIGPAADKKSLGTQQQYPSNASYQTTQGAESENDPNNTTIFVGGLDPNVTD  311

Query  653  ELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNP  474
            E +RQVFSPYGE+V++KI   KRCGFVQF NR +AE AL  L G  LG QNVRLSWGR+P
Sbjct  312  EHLRQVFSPYGEIVYIKIPVGKRCGFVQFGNRANAEEALQMLNGTLLGGQNVRLSWGRSP  371

Query  473  SNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
            +NKQ  Q           Y  +   Y       PPQDPNMY Y +YPGY NY
Sbjct  372  TNKQPQQDPNQWNGNYYGYTQSYDAYGYA----PPQDPNMYAYATYPGYGNY  419



>ref|XP_009406502.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=437

 Score =   182 bits (461),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 120/172 (70%), Gaps = 10/172 (6%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQK----ATYQSSQAGQGDSDPNNTTIFVGGLDPNVSE  654
            V+C S+RPMRIGPAA+K  + TQQ+    A+YQ++Q  + ++DPNNTTIFVGGLDPNV++
Sbjct  260  VYC-STRPMRIGPAADKKSLGTQQQYPSNASYQTTQGAESENDPNNTTIFVGGLDPNVTD  318

Query  653  ELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNP  474
            E +RQVFSPYGE+V++KI   KRCGFVQF NR +AE AL  L G  LG QNVRLSWGR+P
Sbjct  319  EHLRQVFSPYGEIVYIKIPVGKRCGFVQFGNRANAEEALQMLNGTLLGGQNVRLSWGRSP  378

Query  473  SNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
            +NKQ  Q           Y  +   Y       PPQDPNMY Y +YPGY NY
Sbjct  379  TNKQPQQDPNQWNGNYYGYTQSYDAYGYA----PPQDPNMYAYATYPGYGNY  426



>ref|XP_007153936.1| hypothetical protein PHAVU_003G077700g [Phaseolus vulgaris]
 gb|ESW25930.1| hypothetical protein PHAVU_003G077700g [Phaseolus vulgaris]
Length=398

 Score =   177 bits (449),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 124/168 (74%), Gaps = 3/168 (2%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKN-LVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELM  645
            V C S+RPMRIGPA+NKN    +Q KA+YQ+ Q  Q + DPNNTTIFVG LDPNV+++ +
Sbjct  221  VLC-STRPMRIGPASNKNPSTQSQPKASYQNPQGAQNEHDPNNTTIFVGNLDPNVTDDHL  279

Query  644  RQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNK  465
            RQVF  YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLSWGR+PSNK
Sbjct  280  RQVFGQYGELVHVKIPAGKRCGFVQFADRSCAEEALRVLNGTLLGGQNVRLSWGRSPSNK  339

Query  464  QSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
            Q+          G YYGYA QGY+ YGYAP  QDPNM YGSYPGY NY
Sbjct  340  QAQPDANQWNGSGGYYGYAAQGYENYGYAPAGQDPNM-YGSYPGYANY  386


 Score = 48.5 bits (114),  Expect(2) = 9e-50, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEM GV+C
Sbjct  200  YGFVRFGDESEQVRAMTEMQGVLC  223



>ref|XP_003580589.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Brachypodium distachyon]
Length=426

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 106/169 (63%), Positives = 125/169 (74%), Gaps = 5/169 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             SSRPMRIGPAAN+     Q++    ++Q  Q D+DPNNTTIFVGGLDPNV+E+ ++QVF
Sbjct  245  CSSRPMRIGPAANRKTTGVQERVPNTNTQGAQSDNDPNNTTIFVGGLDPNVTEDALKQVF  304

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS--  459
            +PYGE++HVKI   KRCGFVQF NRPSAE AL  LQG  +G QNVRLSWGR+PSNKQ+  
Sbjct  305  APYGEVIHVKIPVGKRCGFVQFVNRPSAEQALQMLQGTPIGGQNVRLSWGRSPSNKQAQP  364

Query  458  --DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
              + +QWG   G  YYG   QGYDAYG    PQDPNMY YG+Y GY NY
Sbjct  365  QQESSQWGANAGAGYYGGYGQGYDAYGGYAQPQDPNMYGYGAYAGYPNY  413



>dbj|BAE71244.1| putative DNA binding protein [Trifolium pratense]
Length=402

 Score =   178 bits (452),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 120/178 (67%), Gaps = 10/178 (6%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKN-LVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELM  645
            V C S+RPMRIGPA NKN    TQ KA+Y ++  GQ ++DPNNTTIFVG LDPNV+++ +
Sbjct  217  VLC-STRPMRIGPATNKNPAATTQAKASYSNTPGGQSENDPNNTTIFVGNLDPNVTDDHL  275

Query  644  RQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNK  465
            RQVFS YGELVHVKI + KRCGFVQFS+R SAE A+  L G  LG QNVRLSWGR PSNK
Sbjct  276  RQVFSQYGELVHVKIPSGKRCGFVQFSDRSSAEEAIRVLNGTLLGGQNVRLSWGRTPSNK  335

Query  464  QSDQ-------TqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQP  312
            Q+ Q          GGG G   Y         Y  AP  QDPN+ YGSYPGY  YQ P
Sbjct  336  QTQQDPNQWNAAAAGGGGGYYGYPQGGYENYGYAAAPAGQDPNV-YGSYPGYAGYQHP  392


 Score = 45.1 bits (105),  Expect(2) = 3e-49, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DE +Q+RAMTEM GV+C
Sbjct  196  YGFVRFADEGEQMRAMTEMQGVLC  219



>ref|XP_004486120.1| PREDICTED: polyadenylate-binding protein RBP45-like [Cicer arietinum]
Length=399

 Score =   176 bits (447),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 123/176 (70%), Gaps = 8/176 (5%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            V C S+RPMRIGPA NKN   T Q  KA+YQ+SQ  Q ++DPNNTTIFVG LDPNV+++ 
Sbjct  216  VLC-STRPMRIGPATNKNPAATTQQPKASYQNSQGAQSENDPNNTTIFVGNLDPNVTDDH  274

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            +RQVFS YGELVHVKI + KRCGFVQFS+R  AE A+  L G  LG QNVRLSWGR PSN
Sbjct  275  LRQVFSQYGELVHVKIPSGKRCGFVQFSDRSCAEEAIRVLNGTLLGGQNVRLSWGRTPSN  334

Query  467  KQS----DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQP  312
            KQ+    +Q   GGG  G    +   GY A   AP  QDPN+ YGSYPGY  YQ P
Sbjct  335  KQTQQDPNQWGPGGGYYGYPQSFENYGYAAAAPAPAGQDPNV-YGSYPGYAGYQAP  389


 Score = 46.6 bits (109),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEM GV+C
Sbjct  195  YGFVRFADESEQIRAMTEMQGVLC  218



>ref|XP_003549897.1| PREDICTED: polyadenylate-binding protein RBP45-like [Glycine 
max]
 gb|KHN03463.1| Polyadenylate-binding protein RBP45 [Glycine soja]
Length=402

 Score =   176 bits (446),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 129/170 (76%), Gaps = 5/170 (3%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKN-LVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELM  645
            V C S+RPMRIGPA+NKN    +Q KA+YQ+ Q  Q + DPNNTTIFVG LDPNV+++ +
Sbjct  223  VLC-STRPMRIGPASNKNPSTQSQPKASYQNPQGAQNEHDPNNTTIFVGNLDPNVTDDHL  281

Query  644  RQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNK  465
            RQVF  YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLSWGR+PSNK
Sbjct  282  RQVFGQYGELVHVKIPAGKRCGFVQFADRSCAEEALRVLNGTLLGGQNVRLSWGRSPSNK  341

Query  464  QS--DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
            Q+  D  QW G  GG YYGYAQ GY+ YGYAP  QDPNM YGSYPGY NY
Sbjct  342  QAQPDANQWNGSGGGGYYGYAQGGYENYGYAPAGQDPNM-YGSYPGYANY  390


 Score = 47.0 bits (110),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAM+EM GV+C
Sbjct  202  YGFVRFGDESEQVRAMSEMQGVLC  225



>ref|XP_011096085.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X2 [Sesamum 
indicum]
Length=420

 Score =   175 bits (444),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 113/164 (69%), Gaps = 5/164 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAANK  V  Q KA+YQ+SQ    + DP NTTIFVG LD NV++E +RQVF
Sbjct  246  CSTRPMRIGPAANKQKVGGQTKASYQTSQGTPSEDDPTNTTIFVGNLDSNVTDEHLRQVF  305

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              YG+L+HVKI   KRCGFVQF++R  AE AL  L G QLG Q++RLSWGR+PSNKQ D 
Sbjct  306  GQYGQLLHVKIPVGKRCGFVQFTDRSCAEEALRILNGTQLGGQSIRLSWGRSPSNKQVD-  364

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
                    G  Y     GY+ YGYAP  QDPN+YY  YPGY NY
Sbjct  365  ----PNQWGGGYYGYAPGYETYGYAPAAQDPNLYYAGYPGYGNY  404


 Score = 47.8 bits (112),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEMNG  C
Sbjct  223  YGFVRFGDESEQIRAMTEMNGRFC  246



>ref|XP_007211969.1| hypothetical protein PRUPE_ppa006617mg [Prunus persica]
 gb|EMJ13168.1| hypothetical protein PRUPE_ppa006617mg [Prunus persica]
Length=403

 Score =   172 bits (435),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 98/170 (58%), Positives = 116/170 (68%), Gaps = 6/170 (4%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            V C S+RPMRIGPAANKN   +QQ  K +YQ+SQ  + +SDPNNTTIFVG LD NV+++ 
Sbjct  223  VLC-STRPMRIGPAANKNAGGSQQYSKGSYQNSQGSKNESDPNNTTIFVGNLDGNVTDDH  281

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            +RQVFS YG+L+HVKI A KRCGFVQF +R  AE AL  L G+QLG QN+RLSWGR+PSN
Sbjct  282  LRQVFSQYGDLLHVKIPAGKRCGFVQFQDRSCAEEALRVLNGSQLGAQNIRLSWGRSPSN  341

Query  467  KQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYP-GYTNY  321
            KQ          GG Y          Y      QDP+MYYG YP GY+NY
Sbjct  342  KQPQADPNQWNGGGYYGYAPTPDGYGYAQV--SQDPSMYYGGYPAGYSNY  389


 Score = 50.8 bits (120),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+QLRAMTEMNGV+C
Sbjct  202  YGFVKFGDESEQLRAMTEMNGVLC  225


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 48/89 (54%), Gaps = 9/89 (10%)
 Frame = -3

Query  692  TIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRC------GFVQFSNRPSAEHALSS  531
            T+++G L   + E  +  +    GELV VK++  K+       GF++FS+R +AE  L S
Sbjct  68   TLWIGDLQYWMEETYLYNILVHTGELVSVKVIRNKQTTQSEGYGFIEFSSRAAAERVLQS  127

Query  530  LQGAQL--GEQNVRLSWGRNPSNKQSDQT  450
              G  +  G QN RL+W  +   K+SD T
Sbjct  128  YNGTPMPNGAQNFRLNWA-SAGEKRSDDT  155



>ref|XP_003529629.1| PREDICTED: polyadenylate-binding protein RBP45 [Glycine max]
Length=397

 Score =   174 bits (441),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 126/169 (75%), Gaps = 4/169 (2%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKN-LVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELM  645
            V C S+RPMRIGPA+NKN    +Q KA+YQ+ Q  Q + DPNNTTIFVG LDPNV+++ +
Sbjct  219  VLC-STRPMRIGPASNKNPSTQSQPKASYQNPQGAQNEHDPNNTTIFVGNLDPNVTDDHL  277

Query  644  RQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNK  465
            RQVF  YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLSWGR+PSNK
Sbjct  278  RQVFGHYGELVHVKIPAGKRCGFVQFADRSCAEEALRVLNGTLLGGQNVRLSWGRSPSNK  337

Query  464  QSD-QTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
            Q+        G GG YYGYAQ GY+ YGYAP  QDPNM YGSYPGY NY
Sbjct  338  QAQPDANQWNGSGGGYYGYAQGGYENYGYAPAGQDPNM-YGSYPGYANY  385


 Score = 48.5 bits (114),  Expect(2) = 6e-49, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEM GV+C
Sbjct  198  YGFVRFGDESEQVRAMTEMQGVLC  221



>dbj|BAD05744.1| putative RNA Binding Protein 45 [Oryza sativa Japonica Group]
 dbj|BAD05783.1| putative RNA Binding Protein 45 [Oryza sativa Japonica Group]
Length=427

 Score =   174 bits (442),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 114/167 (68%), Gaps = 4/167 (2%)
 Frame = -3

Query  815  CASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
              SSRPMRIGPAANK     Q+K    S+Q  Q DSDP+NTTIFVGGLDP+V++++++QV
Sbjct  251  VCSSRPMRIGPAANKKATGVQEKVP--SAQGVQSDSDPSNTTIFVGGLDPSVTDDMLKQV  308

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD  456
            F+PYG++VHVKI   KRCGFVQF+NR SA+ AL  LQG  +G QNVRLSWGR+PSN+Q+ 
Sbjct  309  FTPYGDVVHVKIPVGKRCGFVQFANRASADEALVLLQGTLIGGQNVRLSWGRSPSNRQAQ  368

Query  455  -QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
             Q       G +   Y             PQDPNMY YG+Y GY NY
Sbjct  369  PQQDSNQWGGANAGYYGYGQGYEGYGYAQPQDPNMYGYGAYAGYPNY  415


 Score = 47.0 bits (110),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD S+Q RAMTEMNG+VC
Sbjct  229  YGFVKFGDPSEQARAMTEMNGMVC  252



>gb|KHN35750.1| Polyadenylate-binding protein RBP45 [Glycine soja]
Length=397

 Score =   174 bits (441),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 126/169 (75%), Gaps = 4/169 (2%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKN-LVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELM  645
            V C S+RPMRIGPA+NKN    +Q KA+YQ+ Q  Q + DPNNTTIFVG LDPNV+++ +
Sbjct  219  VLC-STRPMRIGPASNKNPSTQSQPKASYQNPQGAQNEHDPNNTTIFVGNLDPNVTDDHL  277

Query  644  RQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNK  465
            RQVF  YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLSWGR+PSNK
Sbjct  278  RQVFGHYGELVHVKIPAGKRCGFVQFADRSCAEEALRVLNGTLLGGQNVRLSWGRSPSNK  337

Query  464  QSD-QTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
            Q+        G GG YYGYAQ GY+ YGYAP  QDPNM YGSYPGY NY
Sbjct  338  QAQPDANQWNGSGGGYYGYAQGGYENYGYAPAGQDPNM-YGSYPGYANY  385


 Score = 47.0 bits (110),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAM+EM GV+C
Sbjct  198  YGFVRFGDESEQVRAMSEMQGVLC  221



>ref|XP_009776429.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nicotiana sylvestris]
Length=415

 Score =   172 bits (436),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 113/164 (69%), Gaps = 3/164 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAANK     Q +A+YQS+   Q + DP NTTIFVG LD NV+++ +RQVF
Sbjct  240  CSTRPMRIGPAANKKSAGGQMQASYQSTLGTQNEDDPTNTTIFVGNLDSNVTDDHLRQVF  299

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              YG+L+HVKI   KRCGFVQF++R  AE AL +L G QLG Q++RLSWGR+PSNKQ  Q
Sbjct  300  GHYGQLLHVKIPVGKRCGFVQFADRSCAEEALRALSGTQLGGQSIRLSWGRSPSNKQQPQ  359

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
                       Y     GY+AYGYAPP QDPNMYY  Y GY NY
Sbjct  360  V---DPNQYGGYYGYTPGYEAYGYAPPVQDPNMYYAGYAGYGNY  400


 Score = 49.3 bits (116),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+QLRAMTEMNG  C
Sbjct  217  YGFVRFGDESEQLRAMTEMNGKFC  240



>gb|EEE68172.1| hypothetical protein OsJ_26296 [Oryza sativa Japonica Group]
Length=329

 Score =   176 bits (445),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/167 (56%), Positives = 114/167 (68%), Gaps = 4/167 (2%)
 Frame = -3

Query  815  CASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
              SSRPMRIGPAANK     Q+K    S+Q  Q DSDP+NTTIFVGGLDP+V++++++QV
Sbjct  146  VCSSRPMRIGPAANKKATGVQEKVP--SAQGVQSDSDPSNTTIFVGGLDPSVTDDMLKQV  203

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD  456
            F+PYG++VHVKI   KRCGFVQF+NR SA+ AL  LQG  +G QNVRLSWGR+PSN+Q+ 
Sbjct  204  FTPYGDVVHVKIPVGKRCGFVQFANRASADEALVLLQGTLIGGQNVRLSWGRSPSNRQAQ  263

Query  455  -QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
             Q       G +   Y             PQDPNMY YG+Y GY NY
Sbjct  264  PQQDSNQWGGANAGYYGYGQGYEGYGYAQPQDPNMYGYGAYAGYPNY  310



>ref|XP_003610417.1| RNA-binding protein [Medicago truncatula]
 gb|AES92614.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=411

 Score =   174 bits (442),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 126/170 (74%), Gaps = 5/170 (3%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAG-QGDSDPNNTTIFVGGLDPNVSEELM  645
            V C S+RPMRIGPA+NKNL     KA+YQ+ Q G Q ++DPNNTTIFVG LDPNV++E +
Sbjct  232  VLC-STRPMRIGPASNKNLGTQTSKASYQNPQGGAQNENDPNNTTIFVGNLDPNVTDEHL  290

Query  644  RQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNK  465
            +QVF+ YGELVHVKI + KRCGFVQF++R SAE AL  L G  LG QNVRLSWGR+P+NK
Sbjct  291  KQVFTQYGELVHVKIPSGKRCGFVQFADRSSAEEALRVLNGTLLGGQNVRLSWGRSPANK  350

Query  464  QSDQTqwgggvggsyygyaqqgydaygyAPPP-QDPNMYYGSYP-GYTNY  321
            Q+ Q         SY+G   QGY+ Y YAPP  QDPNM YGSYP GY +Y
Sbjct  351  QTQQDPNQWNGSSSYFGGYAQGYENYAYAPPAGQDPNM-YGSYPAGYASY  399


 Score = 46.6 bits (109),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEM GV+C
Sbjct  211  YGFVRFADESEQMRAMTEMQGVLC  234



>gb|AFK41944.1| unknown [Medicago truncatula]
Length=411

 Score =   174 bits (442),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 126/170 (74%), Gaps = 5/170 (3%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAG-QGDSDPNNTTIFVGGLDPNVSEELM  645
            V C S+RPMRIGPA+NKNL     KA+YQ+ Q G Q ++DPNNTTIFVG LDPNV++E +
Sbjct  232  VLC-STRPMRIGPASNKNLGTQTSKASYQNPQGGAQNENDPNNTTIFVGNLDPNVTDEHL  290

Query  644  RQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNK  465
            +QVF+ YGELVHVKI + KRCGFVQF++R SAE AL  L G  LG QNVRLSWGR+P+NK
Sbjct  291  KQVFTQYGELVHVKIPSGKRCGFVQFADRSSAEEALRVLNGTLLGGQNVRLSWGRSPANK  350

Query  464  QSDQTqwgggvggsyygyaqqgydaygyAPPP-QDPNMYYGSYP-GYTNY  321
            Q+ Q         SY+G   QGY+ Y YAPP  QDPNM YGSYP GY +Y
Sbjct  351  QTQQDPNQWNGSSSYFGGYAQGYENYAYAPPAGQDPNM-YGSYPAGYASY  399


 Score = 46.6 bits (109),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEM GV+C
Sbjct  211  YGFVRFADESEQMRAMTEMQGVLC  234



>ref|XP_010930147.1| PREDICTED: polyadenylate-binding protein RBP45 [Elaeis guineensis]
Length=418

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 100/170 (59%), Positives = 114/170 (67%), Gaps = 7/170 (4%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQ--QKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            V+C SSRPMR+GPAANK     Q    A+YQ++   + ++DPNNTTIFVGGLDP V+EEL
Sbjct  240  VYC-SSRPMRVGPAANKKGGAQQYSSNASYQTTPGAESENDPNNTTIFVGGLDPIVTEEL  298

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            +RQVFSPYGELV+VKI   KRCGFVQF+ R  AE AL  L G QLG QNVRLSWGR+P+N
Sbjct  299  LRQVFSPYGELVYVKIPVGKRCGFVQFAARSCAEEALQMLNGTQLGGQNVRLSWGRSPAN  358

Query  467  KQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
            KQ  Q           Y      Y       PPQDPNMY Y SYPGY NY
Sbjct  359  KQPQQDPNQWNGSYYGYAQGYDTYGYAA---PPQDPNMYAYASYPGYGNY  405



>gb|AEW68341.1| putative nuclear acid binding protein [Medicago sativa]
Length=409

 Score =   174 bits (441),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 125/170 (74%), Gaps = 5/170 (3%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAG-QGDSDPNNTTIFVGGLDPNVSEELM  645
            V C S+RPMRIGPA+NKNL     KA+YQ+ Q G Q ++DPNNTTIFVG LDPNV++E +
Sbjct  230  VLC-STRPMRIGPASNKNLGTQTSKASYQNPQGGAQNENDPNNTTIFVGNLDPNVTDEHL  288

Query  644  RQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNK  465
            +QVF+ YGELVHVKI + KRCGFVQF++R SAE AL  L G  LG QNVRLSWGR+P+NK
Sbjct  289  KQVFTQYGELVHVKIPSGKRCGFVQFADRSSAEEALRVLNGTLLGGQNVRLSWGRSPANK  348

Query  464  QSDQTqwgggvggsyygyaqqgydaygyAPPP-QDPNMYYGSYP-GYTNY  321
            Q+ Q          Y+G   QGY+ Y YAPP  QDPNM YGSYP GY +Y
Sbjct  349  QTQQDPNQWNGSSGYFGGYAQGYENYAYAPPAGQDPNM-YGSYPAGYASY  397


 Score = 46.6 bits (109),  Expect(2) = 2e-48, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEM GV+C
Sbjct  209  YGFVRFADESEQMRAMTEMQGVLC  232



>ref|XP_009418782.1| PREDICTED: polyadenylate-binding protein RBP45-like [Musa acuminata 
subsp. malaccensis]
Length=443

 Score =   178 bits (451),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 120/172 (70%), Gaps = 10/172 (6%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQK----ATYQSSQAGQGDSDPNNTTIFVGGLDPNVSE  654
            ++C S+RPMRIG AANK  +  QQ+    A+YQ++Q  + ++DPNNTTIFVGGLDPNV++
Sbjct  267  LYC-STRPMRIGAAANKKTLGAQQQYPANASYQTTQGAESENDPNNTTIFVGGLDPNVTD  325

Query  653  ELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNP  474
            + +RQVF PYGE+V+VKI   KRCGFVQF+NR +AE AL +L G  LG QN+RLSWGR+P
Sbjct  326  DHLRQVFGPYGEIVYVKIPVGKRCGFVQFANRANAEEALRALNGTSLGGQNIRLSWGRSP  385

Query  473  SNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
            +NKQ  Q       G   Y  +   Y       PPQDPNMY Y +YPGY NY
Sbjct  386  TNKQPQQDPNQWNGGYYGYTQSYDAYGYA----PPQDPNMYAYAAYPGYGNY  433



>ref|XP_009614215.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nicotiana 
tomentosiformis]
Length=415

 Score =   171 bits (433),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 112/164 (68%), Gaps = 3/164 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAANK     Q +A+YQS    Q + DP NTTIFVG LD NV+++ +RQVF
Sbjct  240  CSTRPMRIGPAANKKSAGGQMQASYQSPLGTQNEDDPTNTTIFVGNLDSNVTDDHLRQVF  299

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              YG+L+HVKI   KRCGFVQF++R  AE AL +L G QLG Q++RLSWGR+PSNKQ  Q
Sbjct  300  GHYGQLLHVKIPVGKRCGFVQFADRSCAEEALRALSGTQLGGQSIRLSWGRSPSNKQQPQ  359

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
                       Y     GY+AYGYAPP QDPNMYY  Y GY NY
Sbjct  360  V---DPNQYGGYYGYTPGYEAYGYAPPAQDPNMYYAGYAGYGNY  400


 Score = 49.3 bits (116),  Expect(2) = 3e-48, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+QLRAMTEMNG  C
Sbjct  217  YGFVRFGDESEQLRAMTEMNGKFC  240



>ref|XP_011096084.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X1 [Sesamum 
indicum]
Length=422

 Score =   172 bits (436),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 113/164 (69%), Gaps = 3/164 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAANK  V  Q KA+YQ+SQ    + DP NTTIFVG LD NV++E +RQVF
Sbjct  246  CSTRPMRIGPAANKQKVGGQTKASYQTSQGTPSEDDPTNTTIFVGNLDSNVTDEHLRQVF  305

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              YG+L+HVKI   KRCGFVQF++R  AE AL  L G QLG Q++RLSWGR+PSNKQ   
Sbjct  306  GQYGQLLHVKIPVGKRCGFVQFTDRSCAEEALRILNGTQLGGQSIRLSWGRSPSNKQP--  363

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
             Q      G  Y     GY+ YGYAP  QDPN+YY  YPGY NY
Sbjct  364  -QVDPNQWGGGYYGYAPGYETYGYAPAAQDPNLYYAGYPGYGNY  406


 Score = 47.8 bits (112),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEMNG  C
Sbjct  223  YGFVRFGDESEQIRAMTEMNGRFC  246



>gb|AAG59664.1|AC084319_22 putative RNA binding protein [Oryza sativa Japonica Group]
 gb|ABF97192.1| RNA recognition motif family protein, expressed [Oryza sativa 
Japonica Group]
 dbj|BAG95141.1| unnamed protein product [Oryza sativa Japonica Group]
Length=402

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 117/167 (70%), Gaps = 5/167 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQK--ATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             SSRPMRIGPA+NK  +  QQ+  ATYQ++Q    DSDPNNTT+FVGGLDP+V++E+++Q
Sbjct  227  CSSRPMRIGPASNKKNIGGQQQPSATYQNTQGTDSDSDPNNTTVFVGGLDPSVTDEVLKQ  286

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
             FSPYGELV+VKI   KRCGFVQ+SNR SAE A+  L G+QLG Q++RLSWGR+P NKQ 
Sbjct  287  AFSPYGELVYVKIPVGKRCGFVQYSNRASAEEAIRMLNGSQLGGQSIRLSWGRSPGNKQP  346

Query  458  DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
             Q Q     G   Y         Y    PPQDP MY Y +YPGY NY
Sbjct  347  QQDQNQWNAGYYGYPPQGYDPYGYVR--PPQDPAMYAYAAYPGYGNY  391



>gb|EEC75600.1| hypothetical protein OsI_12307 [Oryza sativa Indica Group]
Length=406

 Score =   176 bits (446),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 117/167 (70%), Gaps = 5/167 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQK--ATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             SSRPMRIGPA+NK  +  QQ+  ATYQ++Q    DSDPNNTT+FVGGLDP+V++E+++Q
Sbjct  227  CSSRPMRIGPASNKKNIGGQQQPSATYQNTQGTDSDSDPNNTTVFVGGLDPSVTDEVLKQ  286

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
             FSPYGELV+VKI   KRCGFVQ+SNR SAE A+  L G+QLG Q++RLSWGR+P NKQ 
Sbjct  287  AFSPYGELVYVKIPVGKRCGFVQYSNRASAEEAIRMLNGSQLGGQSIRLSWGRSPGNKQP  346

Query  458  DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
             Q Q     G   Y         Y    PPQDP MY Y +YPGY NY
Sbjct  347  QQDQNQWNAGYYGYPPQGYDPYGYAR--PPQDPAMYAYAAYPGYGNY  391



>ref|XP_008792645.1| PREDICTED: polyadenylate-binding protein RBP45-like [Phoenix 
dactylifera]
Length=425

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 104/170 (61%), Positives = 122/170 (72%), Gaps = 7/170 (4%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQ--QKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            V+C SSRPMRIGPAANK     Q    A+YQ++   + ++DPNNTTIFVGGLDPNV+++L
Sbjct  248  VYC-SSRPMRIGPAANKKAGAQQYSTNASYQTTPGTESENDPNNTTIFVGGLDPNVTDDL  306

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            +RQVFSPYGELV+VKI   KRCGFVQF  R  AE AL  L G Q+G Q++RLSWGR+P+N
Sbjct  307  LRQVFSPYGELVYVKIPVGKRCGFVQFKIRSCAEEALRMLNGTQIGGQSIRLSWGRSPAN  366

Query  467  KQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
            KQ  Q           Y    QGYD YGYAPPPQDPNMY Y +YPGY NY
Sbjct  367  KQPQQ---DPTQWNGSYYGYAQGYDTYGYAPPPQDPNMYAYAAYPGYGNY  413



>ref|XP_010923889.1| PREDICTED: polyadenylate-binding protein RBP45-like [Elaeis guineensis]
Length=432

 Score =   177 bits (448),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 105/170 (62%), Positives = 121/170 (71%), Gaps = 7/170 (4%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQ--QKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            V+C SSRPMRIGPAANK     Q    A+Y ++   + ++DPNNTTIFVGGLDPNV+++L
Sbjct  255  VYC-SSRPMRIGPAANKKAGAQQYSTNASYPTTPGTESENDPNNTTIFVGGLDPNVTDDL  313

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            +RQVFSPYGELV+VKI   KRCGFVQF  R  AE AL  L G QLG QN+RLSWGR+P+N
Sbjct  314  LRQVFSPYGELVYVKIPVGKRCGFVQFKIRSCAEEALRMLNGTQLGGQNIRLSWGRSPAN  373

Query  467  KQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
            KQ  Q           Y    QGYD YGYAPPPQDPNMY Y +YPGY NY
Sbjct  374  KQPQQ---DPNQWNGSYYGYAQGYDTYGYAPPPQDPNMYAYAAYPGYGNY  420



>gb|ABF97193.1| RNA recognition motif family protein, expressed [Oryza sativa 
Japonica Group]
Length=406

 Score =   176 bits (446),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 117/167 (70%), Gaps = 5/167 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQK--ATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             SSRPMRIGPA+NK  +  QQ+  ATYQ++Q    DSDPNNTT+FVGGLDP+V++E+++Q
Sbjct  227  CSSRPMRIGPASNKKNIGGQQQPSATYQNTQGTDSDSDPNNTTVFVGGLDPSVTDEVLKQ  286

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
             FSPYGELV+VKI   KRCGFVQ+SNR SAE A+  L G+QLG Q++RLSWGR+P NKQ 
Sbjct  287  AFSPYGELVYVKIPVGKRCGFVQYSNRASAEEAIRMLNGSQLGGQSIRLSWGRSPGNKQP  346

Query  458  DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
             Q Q     G   Y         Y    PPQDP MY Y +YPGY NY
Sbjct  347  QQDQNQWNAGYYGYPPQGYDPYGYVR--PPQDPAMYAYAAYPGYGNY  391



>gb|EEE61728.1| hypothetical protein OsJ_16246 [Oryza sativa Japonica Group]
Length=607

 Score =   174 bits (441),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 102/168 (61%), Positives = 121/168 (72%), Gaps = 6/168 (4%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             SSRPMRIGPAANK     Q++    ++Q  Q ++DPNNTTIFVGGLDPNV+E++++QVF
Sbjct  196  CSSRPMRIGPAANKKTTGVQERVP--NAQGAQSENDPNNTTIFVGGLDPNVTEDVLKQVF  253

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
            +PYGE+VHVKI   KRCGFVQ+ NRPSAE AL+ LQG  +G QNVRLSWGR+ SNKQ   
Sbjct  254  APYGEVVHVKIPVGKRCGFVQYVNRPSAEQALAVLQGTLIGGQNVRLSWGRSLSNKQPQH  313

Query  452  Tq---wgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
                   G   G YYG   QGY+AYG    PQDPNMY YG+Y GY NY
Sbjct  314  DSNQWGAGAGAGGYYGGYGQGYEAYGGYAQPQDPNMYGYGAYAGYPNY  361


 Score = 44.7 bits (104),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD ++Q RAMTEMNG++C
Sbjct  173  YGFVKFGDPTEQARAMTEMNGMLC  196



>ref|XP_009776437.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nicotiana sylvestris]
Length=414

 Score =   169 bits (429),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 112/164 (68%), Gaps = 4/164 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAANK     Q +A+YQS+   Q + DP NTTIFVG LD NV+++ +RQVF
Sbjct  240  CSTRPMRIGPAANKKSAGGQMQASYQSTLGTQNEDDPTNTTIFVGNLDSNVTDDHLRQVF  299

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              YG+L+HVKI   KRCGFVQF++R  AE AL +L G QLG Q++RLSWGR+PSNKQ   
Sbjct  300  GHYGQLLHVKIPVGKRCGFVQFADRSCAEEALRALSGTQLGGQSIRLSWGRSPSNKQP--  357

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
                       Y     GY+AYGYAPP QDPNMYY  Y GY NY
Sbjct  358  --QVDPNQYGGYYGYTPGYEAYGYAPPVQDPNMYYAGYAGYGNY  399


 Score = 49.3 bits (116),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+QLRAMTEMNG  C
Sbjct  217  YGFVRFGDESEQLRAMTEMNGKFC  240



>dbj|BAK03410.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88936.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=436

 Score =   174 bits (442),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 99/175 (57%), Positives = 117/175 (67%), Gaps = 11/175 (6%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATY--QSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             SSRPMRIGPAAN+     Q++      ++Q  Q D+DPNNTTIFVGGLDPNV+E+ ++Q
Sbjct  248  CSSRPMRIGPAANRKTTGVQERVPIPNTNTQGAQSDNDPNNTTIFVGGLDPNVTEDALKQ  307

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            VF+PYGE+VHVKI   KRCGFVQ++NRPSAE AL  LQG  +G QNVRLSWGR+PSNKQ+
Sbjct  308  VFAPYGEVVHVKIPVGKRCGFVQYANRPSAEQALQLLQGTLVGGQNVRLSWGRSPSNKQT  367

Query  458  D--------QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
                          G  GG Y GY Q           PQDPNMY YG+Y GY NY
Sbjct  368  QPQEATQWGAGAAAGAAGGYYAGYGQGYEAYGQGYAQPQDPNMYGYGAYAGYPNY  422


 Score = 44.3 bits (103),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD ++Q RAMTEMNG+ C
Sbjct  225  YGFVKFGDPTEQARAMTEMNGMPC  248



>ref|XP_006652855.1| PREDICTED: polyadenylate-binding protein RBP45-like [Oryza brachyantha]
Length=372

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 122/167 (73%), Gaps = 4/167 (2%)
 Frame = -3

Query  815  CASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
              SSRPMRIGPAANK     Q++    ++Q  Q ++DPNNTTIFVGGLDPNV+E++++QV
Sbjct  195  ICSSRPMRIGPAANKKTTGVQERVP--NAQGAQSENDPNNTTIFVGGLDPNVTEDVLKQV  252

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ-S  459
            F+PYGE+VHVKI   KRCGFVQ+ NRPSAE AL+ LQG  +G QNVRLSWGR+ SNKQ  
Sbjct  253  FAPYGEVVHVKIPVGKRCGFVQYVNRPSAEQALAMLQGTLIGGQNVRLSWGRSLSNKQPQ  312

Query  458  DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
              +   G   G YYG   QGY+AYG    PQDPNMY YG+Y GY NY
Sbjct  313  HDSNQWGAGAGGYYGGYGQGYEAYGGYAQPQDPNMYGYGAYAGYPNY  359



>ref|XP_009420609.1| PREDICTED: polyadenylate-binding protein RBP45 [Musa acuminata 
subsp. malaccensis]
Length=430

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 118/172 (69%), Gaps = 10/172 (6%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQK----ATYQSSQAGQGDSDPNNTTIFVGGLDPNVSE  654
            V+C S+RPMRIG AANK  + TQQ+    A++Q+ Q  + +SDPNNTTIFVGGLDPN+++
Sbjct  252  VYC-STRPMRIGAAANKKSLGTQQQYSANASFQTGQGDESESDPNNTTIFVGGLDPNITD  310

Query  653  ELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNP  474
            + +RQVFS YGE+V+VKI   KRCGFVQF+NR SAE AL  L G  LG Q++RLSWGR+P
Sbjct  311  DHLRQVFSAYGEIVYVKIPVGKRCGFVQFANRASAEEALRMLNGTLLGGQSIRLSWGRSP  370

Query  473  SNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
            +NKQ  Q           Y  +   Y       PPQDPNMY Y +YPGY NY
Sbjct  371  ANKQPQQDPNQWNGSYYGYTQSYDTYGYA----PPQDPNMYAYATYPGYGNY  418



>ref|XP_009412453.1| PREDICTED: polyadenylate-binding protein RBP45 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412454.1| PREDICTED: polyadenylate-binding protein RBP45 [Musa acuminata 
subsp. malaccensis]
Length=453

 Score =   173 bits (439),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 118/172 (69%), Gaps = 10/172 (6%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQK----ATYQSSQAGQGDSDPNNTTIFVGGLDPNVSE  654
            ++C S+RPMRIGPAANKN + TQQ+    A+YQ++Q  + ++DPNNTTIFVGGLD NV++
Sbjct  262  IYC-STRPMRIGPAANKNTLGTQQQYPTNASYQNAQGAESENDPNNTTIFVGGLDTNVTD  320

Query  653  ELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNP  474
            + +RQVFS YGE+V+VKI   KRCGFVQF++R +AE AL  L G  LG QN+RLSWGR+P
Sbjct  321  DHLRQVFSTYGEIVYVKIPVGKRCGFVQFASRANAEEALRMLNGTPLGGQNIRLSWGRSP  380

Query  473  SNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
            +NKQ  Q           Y      Y       PPQDPNMY Y +Y GY NY
Sbjct  381  ANKQPQQDPNQWNGSYYGYAQNYNTYGYT----PPQDPNMYAYAAYTGYGNY  428


 Score = 44.7 bits (104),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD S+Q RAMTEMNG+ C
Sbjct  241  YGFVKFGDLSEQTRAMTEMNGIYC  264



>ref|NP_001050516.1| Os03g0569900 [Oryza sativa Japonica Group]
 dbj|BAF12430.1| Os03g0569900, partial [Oryza sativa Japonica Group]
Length=446

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 97/167 (58%), Positives = 117/167 (70%), Gaps = 5/167 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQK--ATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             SSRPMRIGPA+NK  +  QQ+  ATYQ++Q    DSDPNNTT+FVGGLDP+V++E+++Q
Sbjct  271  CSSRPMRIGPASNKKNIGGQQQPSATYQNTQGTDSDSDPNNTTVFVGGLDPSVTDEVLKQ  330

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
             FSPYGELV+VKI   KRCGFVQ+SNR SAE A+  L G+QLG Q++RLSWGR+P NKQ 
Sbjct  331  AFSPYGELVYVKIPVGKRCGFVQYSNRASAEEAIRMLNGSQLGGQSIRLSWGRSPGNKQP  390

Query  458  DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
             Q Q     G   Y         Y    PPQDP MY Y +YPGY NY
Sbjct  391  QQDQNQWNAGYYGYPPQGYDPYGYVR--PPQDPAMYAYAAYPGYGNY  435



>ref|XP_006659900.1| PREDICTED: polyadenylate-binding protein RBP45-like [Oryza brachyantha]
Length=420

 Score =   171 bits (434),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 113/167 (68%), Gaps = 4/167 (2%)
 Frame = -3

Query  815  CASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
              SSRPMRIGPAANK     Q+K    S+Q  Q D+DP+NTTIFVGGLDP+V+++ ++QV
Sbjct  244  VCSSRPMRIGPAANKKATGVQEKVP--SAQGVQSDNDPSNTTIFVGGLDPSVTDDALKQV  301

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD  456
            F+PYG++VHVKI   KRCGFVQF++R +AE AL  LQG  +G QNVRLSWGR+PSN+Q+ 
Sbjct  302  FTPYGDVVHVKIPVGKRCGFVQFASRAAAEEALVLLQGTLIGGQNVRLSWGRSPSNRQAQ  361

Query  455  -QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
             Q       G +   Y             PQDPNMY YG+Y GY NY
Sbjct  362  PQQDSNQWGGATTGYYGYGQGYEAYGYAQPQDPNMYGYGAYAGYPNY  408


 Score = 46.2 bits (108),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD S+Q RAMTEMNG+VC
Sbjct  222  YGFVKFGDPSEQARAMTEMNGMVC  245



>gb|EAY95645.1| hypothetical protein OsI_17510 [Oryza sativa Indica Group]
Length=426

 Score =   173 bits (438),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 121/169 (72%), Gaps = 6/169 (4%)
 Frame = -3

Query  815  CASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
              SSRPMRIGPAANK     Q++    ++Q  Q ++DPNNTTIFVGGLDPNV+E++++QV
Sbjct  247  LCSSRPMRIGPAANKKTTGVQERVP--NAQGAQSENDPNNTTIFVGGLDPNVTEDVLKQV  304

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD  456
            F+PYGE+VHVKI   KRCGFVQ+ NRPSAE AL+ LQG  +G QNVRLSWGR+ SNKQ  
Sbjct  305  FAPYGEVVHVKIPVGKRCGFVQYVNRPSAEQALAVLQGTLIGGQNVRLSWGRSLSNKQPQ  364

Query  455  QTq---wgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
                    G   G YYG   QGY+AYG    PQDPNMY YG+Y GY NY
Sbjct  365  HDSNQWGAGAGAGGYYGGYGQGYEAYGGYAQPQDPNMYGYGAYAGYPNY  413


 Score = 44.7 bits (104),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD ++Q RAMTEMNG++C
Sbjct  225  YGFVKFGDPTEQARAMTEMNGMLC  248



>ref|NP_001053941.1| Os04g0625800 [Oryza sativa Japonica Group]
 dbj|BAF15855.1| Os04g0625800 [Oryza sativa Japonica Group]
 dbj|BAH00195.1| unnamed protein product [Oryza sativa Japonica Group]
Length=425

 Score =   173 bits (438),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 121/169 (72%), Gaps = 6/169 (4%)
 Frame = -3

Query  815  CASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
              SSRPMRIGPAANK     Q++    ++Q  Q ++DPNNTTIFVGGLDPNV+E++++QV
Sbjct  246  LCSSRPMRIGPAANKKTTGVQERVP--NAQGAQSENDPNNTTIFVGGLDPNVTEDVLKQV  303

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD  456
            F+PYGE+VHVKI   KRCGFVQ+ NRPSAE AL+ LQG  +G QNVRLSWGR+ SNKQ  
Sbjct  304  FAPYGEVVHVKIPVGKRCGFVQYVNRPSAEQALAVLQGTLIGGQNVRLSWGRSLSNKQPQ  363

Query  455  QTq---wgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
                    G   G YYG   QGY+AYG    PQDPNMY YG+Y GY NY
Sbjct  364  HDSNQWGAGAGAGGYYGGYGQGYEAYGGYAQPQDPNMYGYGAYAGYPNY  412


 Score = 44.7 bits (104),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD ++Q RAMTEMNG++C
Sbjct  224  YGFVKFGDPTEQARAMTEMNGMLC  247



>gb|KEH36836.1| polyadenylate-binding protein RBP47B [Medicago truncatula]
Length=401

 Score =   172 bits (437),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 129/175 (74%), Gaps = 8/175 (5%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKN-LVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELM  645
            V C S+RPMRIGPA NKN    TQ KA+Y  S  GQ ++DPNNTTIFVG LDPNV+++ +
Sbjct  220  VLC-STRPMRIGPATNKNPAATTQPKASYNPS-GGQSENDPNNTTIFVGNLDPNVTDDHL  277

Query  644  RQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNK  465
            RQVF+ YGELVHVKI + KRCGFVQFS+R  AE A+  L G  LG QNVRLSWGR PSNK
Sbjct  278  RQVFTQYGELVHVKIPSGKRCGFVQFSDRSCAEEAIRVLNGTLLGGQNVRLSWGRTPSNK  337

Query  464  QS--DQTqwgggvggsyygyaqqgydaygyAPPP--QDPNMYYGSYPGYTNYQQP  312
            Q+  D TQ G    G YYGYAQ GY+ YGYA PP  QDPN+ YGSYPGY  YQ P
Sbjct  338  QTQQDPTQGGYPAAGGYYGYAQGGYENYGYAAPPAGQDPNV-YGSYPGYPGYQHP  391


 Score = 44.7 bits (104),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DE +Q+RAMTEM GV+C
Sbjct  199  YGFVRFADEGEQMRAMTEMQGVLC  222



>ref|XP_008676816.1| PREDICTED: uncharacterized protein LOC100273450 isoform X1 [Zea 
mays]
 gb|ACF85557.1| unknown [Zea mays]
 gb|AFW61058.1| hypothetical protein ZEAMMB73_234884 [Zea mays]
Length=456

 Score =   172 bits (435),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 112/169 (66%), Gaps = 6/169 (4%)
 Frame = -3

Query  815  CASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
              SSRPMRIGPAANK     Q+K    S+Q  Q D+DPNNTTIFVGGLDPNV+E++++QV
Sbjct  277  LCSSRPMRIGPAANKKATVVQEKVP--SAQGVQSDNDPNNTTIFVGGLDPNVTEDMLKQV  334

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD  456
            F+PYG++VHVKI   KRCGFVQ++NR SAE AL  LQG  +G QNVRLSWGR+PSNKQ  
Sbjct  335  FTPYGDVVHVKIPVGKRCGFVQYANRSSAEEALVILQGTLVGGQNVRLSWGRSPSNKQVQ  394

Query  455  -QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNY  321
             Q       G +   Y           P  QDPNMY    G+Y GY NY
Sbjct  395  PQQDSNQWAGANAGYYGYGQGYEAYGYPQSQDPNMYNYGAGAYAGYPNY  443


 Score = 44.7 bits (104),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD ++Q RAMTEMNG++C
Sbjct  255  YGFVKFGDPNEQARAMTEMNGMLC  278



>ref|XP_010092144.1| Polyadenylate-binding protein RBP45 [Morus notabilis]
 gb|EXB50295.1| Polyadenylate-binding protein RBP45 [Morus notabilis]
Length=543

 Score =   176 bits (446),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 130/179 (73%), Gaps = 14/179 (8%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             S+RPMR+GPAANK  V  QQ  KATY ++Q  QG++DPNNTTIFVGGLD N++++++RQ
Sbjct  233  CSTRPMRVGPAANKKPVGGQQYQKATYTNTQGNQGENDPNNTTIFVGGLDSNINDDMLRQ  292

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            VFS +GELVHVKI   KRCGFVQF NR +AEHALS+L G QLG Q++RLSWGR+P+NKQ+
Sbjct  293  VFSQFGELVHVKIPVGKRCGFVQFVNRANAEHALSTLNGTQLGGQSIRLSWGRSPTNKQN  352

Query  458  DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSY--------PGYTNYQQPQQ  306
             Q        G  Y    QGYDAY YAPP QDPNMYYG Y        PG   YQQPQQ
Sbjct  353  QQ--EQAQWNGGGYYGYPQGYDAYSYAPPSQDPNMYYGGYPGYGNYQQPG--AYQQPQQ  407



>ref|XP_004232721.1| PREDICTED: polyadenylate-binding protein RBP45 [Solanum lycopersicum]
Length=413

 Score =   168 bits (425),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 113/164 (69%), Gaps = 3/164 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAANK  +  Q +A+YQSS   Q + DP+NTTIFVG LD N+++E +RQ+F
Sbjct  239  CSTRPMRIGPAANKKSMGGQSQASYQSSPGTQNEDDPSNTTIFVGNLDSNITDEHLRQIF  298

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              YG+L+HVKI   KRCGF+QF++R  AE AL  L G QLG Q++RLSWGR+P+NKQ  Q
Sbjct  299  GHYGQLLHVKIPVGKRCGFIQFADRSCAEEALRVLNGTQLGGQSIRLSWGRSPANKQQPQ  358

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
                     + Y     GY+ YGYAPP QDPN YY  Y GY NY
Sbjct  359  L---DPNQYAGYYGYTAGYEGYGYAPPAQDPNQYYAGYAGYGNY  399


 Score = 47.8 bits (112),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+QLRAMTEMNG  C
Sbjct  216  YGFVKFGDESEQLRAMTEMNGQFC  239



>ref|XP_009789022.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nicotiana 
sylvestris]
Length=413

 Score =   168 bits (425),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 96/169 (57%), Positives = 116/169 (69%), Gaps = 5/169 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAANKN V  Q +A+YQS+   Q + DP+NTTIFVG LD +V+++ +RQVF
Sbjct  236  CSTRPMRIGPAANKNSVAGQVQASYQSTNGTQNEDDPSNTTIFVGNLDSDVTDDHLRQVF  295

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNK----  465
              YG+L+HVKI   KRCGFVQF++R  AE AL  L G QLG Q++RLSWGR+PSNK    
Sbjct  296  GHYGQLLHVKIPVGKRCGFVQFADRSCAEEALRVLNGTQLGGQSIRLSWGRSPSNKQVVQ  355

Query  464  -QSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
             Q+D  QW GG    Y         AYGYA P QDPN+YY  Y GY NY
Sbjct  356  PQADPNQWNGGGYYGYTAGYDAAAAAYGYAQPAQDPNLYYAGYAGYGNY  404


 Score = 47.8 bits (112),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+QLRAMTEMNG  C
Sbjct  213  YGFVKFGDESEQLRAMTEMNGKFC  236



>gb|AFW61056.1| hypothetical protein ZEAMMB73_234884 [Zea mays]
Length=453

 Score =   171 bits (433),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 112/169 (66%), Gaps = 6/169 (4%)
 Frame = -3

Query  815  CASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
              SSRPMRIGPAANK     Q+K    S+Q  Q D+DPNNTTIFVGGLDPNV+E++++QV
Sbjct  267  LCSSRPMRIGPAANKKATVVQEKVP--SAQGVQSDNDPNNTTIFVGGLDPNVTEDMLKQV  324

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD  456
            F+PYG++VHVKI   KRCGFVQ++NR SAE AL  LQG  +G QNVRLSWGR+PSNKQ  
Sbjct  325  FTPYGDVVHVKIPVGKRCGFVQYANRSSAEEALVILQGTLVGGQNVRLSWGRSPSNKQVQ  384

Query  455  -QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNY  321
             Q       G +   Y           P  QDPNMY    G+Y GY NY
Sbjct  385  PQQDSNQWAGANAGYYGYGQGYEAYGYPQSQDPNMYNYGAGAYAGYPNY  433


 Score = 44.7 bits (104),  Expect(2) = 6e-47, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD ++Q RAMTEMNG++C
Sbjct  245  YGFVKFGDPNEQARAMTEMNGMLC  268



>ref|NP_001141359.1| uncharacterized protein LOC100273450 [Zea mays]
 gb|ACF86164.1| unknown [Zea mays]
 gb|AFW61059.1| hypothetical protein ZEAMMB73_234884 [Zea mays]
Length=453

 Score =   171 bits (433),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 112/168 (67%), Gaps = 7/168 (4%)
 Frame = -3

Query  815  CASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
              SSRPMRIGPAANK     Q+K    S+Q  Q D+DPNNTTIFVGGLDPNV+E++++QV
Sbjct  277  LCSSRPMRIGPAANKKATVVQEKVP--SAQGVQSDNDPNNTTIFVGGLDPNVTEDMLKQV  334

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD  456
            F+PYG++VHVKI   KRCGFVQ++NR SAE AL  LQG  +G QNVRLSWGR+PSNKQ  
Sbjct  335  FTPYGDVVHVKIPVGKRCGFVQYANRSSAEEALVILQGTLVGGQNVRLSWGRSPSNKQVQ  394

Query  455  QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNY  321
             +      G +   Y           P  QDPNMY    G+Y GY NY
Sbjct  395  DS--NQWAGANAGYYGYGQGYEAYGYPQSQDPNMYNYGAGAYAGYPNY  440


 Score = 44.7 bits (104),  Expect(2) = 7e-47, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD ++Q RAMTEMNG++C
Sbjct  255  YGFVKFGDPNEQARAMTEMNGMLC  278



>ref|XP_006348103.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
tuberosum]
Length=413

 Score =   167 bits (424),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 113/164 (69%), Gaps = 3/164 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAANK  +  Q +A+YQSS   Q + DP+NTTIFVG LD N+++E +RQ+F
Sbjct  239  CSTRPMRIGPAANKKSMGGQSQASYQSSPGTQNEDDPSNTTIFVGNLDSNITDEHLRQIF  298

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              YG+L+HVKI   KRCGF+QF++R  AE A+  L G QLG Q++RLSWGR+P+NKQ  Q
Sbjct  299  GHYGQLLHVKIPVGKRCGFIQFADRSCAEEAIRVLNGTQLGGQSIRLSWGRSPANKQQPQ  358

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
                     + Y     GYD YGYAPP QDPN YY  Y GY NY
Sbjct  359  V---DPNQYAGYYGYTAGYDGYGYAPPAQDPNQYYAGYAGYGNY  399


 Score = 47.8 bits (112),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+QLRAMTEMNG  C
Sbjct  216  YGFVKFGDESEQLRAMTEMNGQFC  239



>ref|XP_008441150.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X4 
[Cucumis melo]
Length=402

 Score =   167 bits (422),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 112/156 (72%), Gaps = 6/156 (4%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             SSRPMRIGPAANKN   +QQ  K +YQ+ Q  Q ++DPNNTTIFVG LD NV+++ +RQ
Sbjct  224  CSSRPMRIGPAANKNTSGSQQFSKTSYQNPQGAQNENDPNNTTIFVGNLDANVTDDHLRQ  283

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            VF  YGELVHVKI   KRCGFVQFS+R  AE AL +L G Q+G QN+RLSWGR+PSNKQ+
Sbjct  284  VFGQYGELVHVKIPVGKRCGFVQFSDRNCAEEALRALNGTQIGGQNIRLSWGRSPSNKQA  343

Query  458  DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY  351
            D         G  Y    QGY+ Y YAP PQDPNM+
Sbjct  344  DPN----QWNGGGYYGYGQGYENYSYAPAPQDPNMF  375


 Score = 48.5 bits (114),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+Q+RAMTEMNGV C
Sbjct  201  YGFVKFGDESEQMRAMTEMNGVHC  224


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (51%), Gaps = 8/87 (9%)
 Frame = -3

Query  692  TIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRCG------FVQFSNRPSAEHALSS  531
            T+++G L   + E  +   F+  GE+  VK++  K+ G      F++F  RP+AE  L +
Sbjct  67   TLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERVLQT  126

Query  530  LQGAQL--GEQNVRLSWGRNPSNKQSD  456
              G  +  G QN RL+W      +Q D
Sbjct  127  YNGTAMPNGAQNFRLNWASAGEKRQDD  153



>ref|XP_008224810.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Prunus 
mume]
Length=403

 Score =   164 bits (415),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 97/122 (80%), Gaps = 3/122 (2%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            V C S+RPMRIGPAANKN   +QQ  K +YQ+SQ  + +SDPNNTTIFVG LD NV+++ 
Sbjct  223  VLC-STRPMRIGPAANKNAGGSQQYSKGSYQNSQGSKNESDPNNTTIFVGNLDGNVTDDH  281

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            +RQVFS YG+LVHVKI A KRCGFVQF +R  AE AL  L G+QLG QN+RLSWGR+PSN
Sbjct  282  LRQVFSQYGDLVHVKIPAGKRCGFVQFQDRSCAEEALRVLNGSQLGAQNIRLSWGRSPSN  341

Query  467  KQ  462
            KQ
Sbjct  342  KQ  343


 Score = 50.8 bits (120),  Expect(2) = 9e-47, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+QLRAMTEMNGV+C
Sbjct  202  YGFVKFGDESEQLRAMTEMNGVLC  225


 Score = 52.8 bits (125),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 48/89 (54%), Gaps = 9/89 (10%)
 Frame = -3

Query  692  TIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRC------GFVQFSNRPSAEHALSS  531
            T+++G L   + E  +  +    GELV VK++  K+       GF++FS+R +AE  L S
Sbjct  68   TLWIGDLQYWMEETYLYNILVHTGELVSVKVIRNKQTTQSEGYGFIEFSSRAAAERVLQS  127

Query  530  LQGAQL--GEQNVRLSWGRNPSNKQSDQT  450
              G  +  G QN RL+W  +   K+SD T
Sbjct  128  YNGTPMPNGAQNFRLNWA-SAGEKRSDDT  155



>emb|CAE04743.3| OSJNBb0060E08.6 [Oryza sativa Japonica Group]
 emb|CAH66831.1| OSIGBa0148A10.8 [Oryza sativa Indica Group]
Length=414

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 121/169 (72%), Gaps = 6/169 (4%)
 Frame = -3

Query  815  CASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
              SSRPMRIGPAANK     Q++    ++Q  Q ++DPNNTTIFVGGLDPNV+E++++QV
Sbjct  235  LCSSRPMRIGPAANKKTTGVQERVP--NAQGAQSENDPNNTTIFVGGLDPNVTEDVLKQV  292

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD  456
            F+PYGE+VHVKI   KRCGFVQ+ NRPSAE AL+ LQG  +G QNVRLSWGR+ SNKQ  
Sbjct  293  FAPYGEVVHVKIPVGKRCGFVQYVNRPSAEQALAVLQGTLIGGQNVRLSWGRSLSNKQPQ  352

Query  455  QTq---wgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
                    G   G YYG   QGY+AYG    PQDPNMY YG+Y GY NY
Sbjct  353  HDSNQWGAGAGAGGYYGGYGQGYEAYGGYAQPQDPNMYGYGAYAGYPNY  401



>gb|KHN33037.1| Polyadenylate-binding protein RBP45 [Glycine soja]
Length=334

 Score =   170 bits (431),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 129/179 (72%), Gaps = 11/179 (6%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKN-LVNTQQKATYQSSQ--AGQGDSDPNNTTIFVGGLDPNVSEE  651
            V C S+RPMRIGPA+NK     +Q KA+Y +SQ    Q ++DPNNTTIFVG LDPNV+++
Sbjct  149  VLC-STRPMRIGPASNKTPATQSQPKASYLNSQPQGSQNENDPNNTTIFVGNLDPNVTDD  207

Query  650  LMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPS  471
             +RQVFS YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLSWGR+PS
Sbjct  208  HLRQVFSQYGELVHVKIPAGKRCGFVQFADRSCAEEALRVLNGTLLGGQNVRLSWGRSPS  267

Query  470  NKQSD------QTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQP  312
            NKQ+           G G GG YYGYA QGY+ YGYAP  QDPNM YGSYPGY  YQ P
Sbjct  268  NKQAQADPNQWNGAAGAGSGGGYYGYAAQGYENYGYAPAGQDPNM-YGSYPGYPGYQAP  325


 Score = 44.7 bits (104),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF +ES+Q+RAMTEM GV+C
Sbjct  128  YGFVRFSEESEQMRAMTEMQGVLC  151



>ref|XP_003573391.1| PREDICTED: polyadenylate-binding protein RBP45-like [Brachypodium 
distachyon]
Length=435

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 106/170 (62%), Positives = 126/170 (74%), Gaps = 6/170 (4%)
 Frame = -3

Query  815  CASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
              SSRPMRIGPAANK  V+  Q+    S+Q  Q DSDP+NTTIFVGGLDPNV+E++++QV
Sbjct  254  VCSSRPMRIGPAANKQKVSGAQEKV-PSAQGVQSDSDPSNTTIFVGGLDPNVTEDMLKQV  312

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ--  462
            F+PYGE+VHVKI   KRCGFVQ+++R S+E AL  LQG  +G QNVRLSWGR+PSNKQ  
Sbjct  313  FAPYGEVVHVKIPVGKRCGFVQYASRSSSEEALLMLQGTVIGGQNVRLSWGRSPSNKQVQ  372

Query  461  --SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
               D  QWGG    + Y    QGY+AYGYA  PQDPNMY YG+Y GY NY
Sbjct  373  TPQDSNQWGGATANAGYYGYGQGYEAYGYAAQPQDPNMYGYGAYAGYPNY  422



>ref|XP_010101438.1| Polyadenylate-binding protein RBP45B [Morus notabilis]
 gb|EXB88421.1| Polyadenylate-binding protein RBP45B [Morus notabilis]
Length=398

 Score =   165 bits (417),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 98/124 (79%), Gaps = 4/124 (3%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            V C S+RPMRIGPAANKN V +QQ  KA+YQSSQ  Q ++DPNNTTIFVG LD NV+++ 
Sbjct  221  VLC-STRPMRIGPAANKNAVGSQQYSKASYQSSQGAQNENDPNNTTIFVGNLDSNVTDDH  279

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            +RQVF  YGELVHVKI   KRCGFVQF++R  AE AL  L G+QLG QN+RLSWGR+P N
Sbjct  280  LRQVFHQYGELVHVKIPTGKRCGFVQFTDRSCAEEALRMLNGSQLGGQNIRLSWGRSP-N  338

Query  467  KQSD  456
            KQ D
Sbjct  339  KQVD  342


 Score = 49.3 bits (116),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAM EMNGV+C
Sbjct  200  YGFVRFGDESEQIRAMNEMNGVLC  223


 Score = 55.1 bits (131),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 50/89 (56%), Gaps = 9/89 (10%)
 Frame = -3

Query  692  TIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRCG------FVQFSNRPSAEHALSS  531
            T+++G L   + E  +   F   GE+V VK++  K+ G      F++F +RP+AE AL +
Sbjct  66   TLWIGDLQYWMEENYLYSCFVHTGEVVSVKVIRNKQTGQSEGYGFIEFVSRPAAERALQT  125

Query  530  LQGAQL--GEQNVRLSWGRNPSNKQSDQT  450
              G+ +  G QN RL+W  +   K+SD T
Sbjct  126  FNGSPMPNGAQNFRLNWA-SAGEKRSDDT  153



>ref|XP_004507695.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X1 [Cicer arietinum]
Length=400

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 99/168 (59%), Positives = 115/168 (68%), Gaps = 4/168 (2%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAG-QGDSDPNNTTIFVGGLDPNVSEELM  645
            V C S+RPMRIGPA+NKNL     KA+YQ+ Q G Q ++DPNNTTIFVG LDPNV+++ +
Sbjct  223  VLC-STRPMRIGPASNKNLNTQSSKASYQNPQGGAQNENDPNNTTIFVGNLDPNVTDDHL  281

Query  644  RQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNK  465
            RQVF  YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLSWG++P NK
Sbjct  282  RQVFGQYGELVHVKIPAGKRCGFVQFADRSCAEEALRVLNGTLLGGQNVRLSWGKSP-NK  340

Query  464  QSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
            Q+ Q           YGY Q   +        QDPNM YGSYPGY NY
Sbjct  341  QAQQDPNQWSGYTQGYGYTQGYENYGYAPAAGQDPNM-YGSYPGYANY  387



>ref|XP_009595795.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nicotiana 
tomentosiformis]
Length=409

 Score =   166 bits (420),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 113/168 (67%), Gaps = 4/168 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAANKN V  Q +A+YQS+   Q + DP NTTIFVG LD +V+++ +RQVF
Sbjct  234  CSTRPMRIGPAANKNSVAGQVQASYQSTNGTQNEDDPTNTTIFVGNLDSDVTDDHLRQVF  293

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              YG+L+HVKI   KRCGFVQF++R  AE AL  L G QLG Q++RLSWGR+PSNKQ  Q
Sbjct  294  GHYGQLLHVKIPVGKRCGFVQFADRSCAEEALRVLNGTQLGGQSIRLSWGRSPSNKQVVQ  353

Query  452  Tqwg----ggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
             Q       G G   Y        AYGYA P QDPN+YY  Y GY NY
Sbjct  354  PQADPNQWNGGGYYGYTAGYDAAAAYGYAQPAQDPNLYYAGYAGYGNY  401


 Score = 48.1 bits (113),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+QLRAMTEMNG  C
Sbjct  211  YGFVKFGDESEQLRAMTEMNGKFC  234



>ref|XP_004982540.1| PREDICTED: polyadenylate-binding protein RBP45-like [Setaria 
italica]
Length=409

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 117/168 (70%), Gaps = 7/168 (4%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQK---ATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
             SSRPMR+GPA+NK  ++ QQ+   ATY ++Q    D+DPNNTT+FVGGLDP+V++E++R
Sbjct  233  CSSRPMRLGPASNKKNISGQQQPSSATYPNTQGTDSDNDPNNTTVFVGGLDPSVTDEVLR  292

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            Q FSPYGEL++VKI   KRCGFVQ+SNR SAE A+  L G QLG Q+VRLSWGR+P+NKQ
Sbjct  293  QTFSPYGELLYVKIPVGKRCGFVQYSNRASAEEAIRVLNGTQLGGQSVRLSWGRSPANKQ  352

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
              Q Q     G   Y      Y       PPQDP MY Y +YPGY NY
Sbjct  353  PQQEQNQWSSGYYGYPQGYDPYGYAR---PPQDPAMYAYTAYPGYGNY  397



>ref|XP_011652720.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X4 [Cucumis 
sativus]
Length=402

 Score =   165 bits (418),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 110/156 (71%), Gaps = 6/156 (4%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             SSRPMRIGPAANKN    QQ  K +YQ+ Q  Q ++DPNNTTIFVG LD NV++E +RQ
Sbjct  224  CSSRPMRIGPAANKNTSGGQQFSKTSYQNPQGAQNENDPNNTTIFVGNLDANVTDEHLRQ  283

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            VF  YGELVHVKI   KRCGFVQF++R  AE AL  L G Q+G QN+RLSWGR+PSNKQ+
Sbjct  284  VFGQYGELVHVKIPVGKRCGFVQFADRNCAEEALRVLNGTQIGGQNIRLSWGRSPSNKQA  343

Query  458  DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY  351
            D         G  Y    QGY+ Y YAP PQDPNM+
Sbjct  344  D----PNQWNGGGYYGYGQGYENYSYAPAPQDPNMF  375


 Score = 48.5 bits (114),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+Q+RAMTEMNGV C
Sbjct  201  YGFVKFGDESEQMRAMTEMNGVHC  224


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (51%), Gaps = 8/87 (9%)
 Frame = -3

Query  692  TIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRC------GFVQFSNRPSAEHALSS  531
            T+++G L   + E  +   F+  GE+  VK++  K+       GF++F  RP+AE  L +
Sbjct  67   TLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERVLQT  126

Query  530  LQGAQL--GEQNVRLSWGRNPSNKQSD  456
              G  +  G QN RL+W      +Q D
Sbjct  127  YNGTAMPNGAQNFRLNWASAGEKRQDD  153



>gb|KHN37596.1| Polyadenylate-binding protein RBP45B, partial [Glycine soja]
Length=357

 Score =   167 bits (424),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 131/176 (74%), Gaps = 10/176 (6%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKN-LVNTQQKATYQSSQ--AGQGDSDPNNTTIFVGGLDPNVSEE  651
            V C S+RPMRIGPA+NK     +Q KA+YQ+SQ    Q ++DPNNTTIFVG LDPNV+++
Sbjct  171  VLC-STRPMRIGPASNKTPTTQSQPKASYQNSQPQGSQNENDPNNTTIFVGNLDPNVTDD  229

Query  650  LMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPS  471
             +RQVFS YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLSWGR+PS
Sbjct  230  HLRQVFSQYGELVHVKIPAGKRCGFVQFADRSCAEEALRVLNGTLLGGQNVRLSWGRSPS  289

Query  470  NKQS----DQTqwgggvggsyygyaqqgydaygyAPPP-QDPNMYYGSYPGYTNYQ  318
            NKQ+    +Q   G G GG YYGYA QGY+ YGYAP   QDPNM YGSYPGY  YQ
Sbjct  290  NKQAQADPNQWNGGAGSGGGYYGYAAQGYENYGYAPAAGQDPNM-YGSYPGYPGYQ  344


 Score = 45.8 bits (107),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEM GV+C
Sbjct  150  YGFVRFSDESEQVRAMTEMQGVLC  173



>ref|XP_011628461.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X2 [Amborella 
trichopoda]
Length=422

 Score =   164 bits (414),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 98/125 (78%), Gaps = 6/125 (5%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ----KATYQSS-QAGQGDSDPNNTTIFVGGLDPNVS  657
            V+C S+RPMRIGPA  K  V  QQ    KA YQS+ QA Q +SDPNNTTIFVGGLDPNV+
Sbjct  249  VFC-STRPMRIGPATTKKTVGVQQQYPAKAPYQSNPQASQSESDPNNTTIFVGGLDPNVN  307

Query  656  EELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRN  477
            +++++QVF  YGEL+HVKI   KRCGFVQF+NR  AE AL  L G QLG+Q++RLSWGR+
Sbjct  308  DDILKQVFGQYGELIHVKIPVGKRCGFVQFANRACAEEALLMLNGTQLGQQSIRLSWGRS  367

Query  476  PSNKQ  462
            PSNKQ
Sbjct  368  PSNKQ  372


 Score = 50.1 bits (118),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE++QLRAMTEMNGV C
Sbjct  228  YGFVRFGDENEQLRAMTEMNGVFC  251



>ref|XP_011628460.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X1 [Amborella 
trichopoda]
Length=430

 Score =   164 bits (414),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/125 (66%), Positives = 98/125 (78%), Gaps = 6/125 (5%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ----KATYQSS-QAGQGDSDPNNTTIFVGGLDPNVS  657
            V+C S+RPMRIGPA  K  V  QQ    KA YQS+ QA Q +SDPNNTTIFVGGLDPNV+
Sbjct  249  VFC-STRPMRIGPATTKKTVGVQQQYPAKAPYQSNPQASQSESDPNNTTIFVGGLDPNVN  307

Query  656  EELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRN  477
            +++++QVF  YGEL+HVKI   KRCGFVQF+NR  AE AL  L G QLG+Q++RLSWGR+
Sbjct  308  DDILKQVFGQYGELIHVKIPVGKRCGFVQFANRACAEEALLMLNGTQLGQQSIRLSWGRS  367

Query  476  PSNKQ  462
            PSNKQ
Sbjct  368  PSNKQ  372


 Score = 50.1 bits (118),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE++QLRAMTEMNGV C
Sbjct  228  YGFVRFGDENEQLRAMTEMNGVFC  251



>ref|XP_006468021.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Citrus sinensis]
 gb|KDO75473.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
Length=413

 Score =   162 bits (410),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 97/124 (78%), Gaps = 4/124 (3%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ---KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEE  651
            V+C S+RPMRIGPA NK  V+ QQ   KA+YQ+SQ  Q D DPNNTT+FVG LD  V++E
Sbjct  239  VFC-STRPMRIGPATNKKTVSGQQQYPKASYQNSQVAQSDDDPNNTTVFVGNLDSIVTDE  297

Query  650  LMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPS  471
             +R++FS YG+LVHVKI A KRCGFVQF++R  AE AL  L G QLG QN+RLSWGR+PS
Sbjct  298  HLRELFSQYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWGRSPS  357

Query  470  NKQS  459
            NKQ+
Sbjct  358  NKQA  361


 Score = 51.2 bits (121),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+QLRAMTEMNGV C
Sbjct  218  YGFVRFGDESEQLRAMTEMNGVFC  241


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 47/89 (53%), Gaps = 8/89 (9%)
 Frame = -3

Query  692  TIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRC------GFVQFSNRPSAEHALSS  531
            T+++G L   + E  +   F+  GE+V VK++  K+       GF++F +R  AE  L +
Sbjct  83   TLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERVLQT  142

Query  530  LQGAQL--GEQNVRLSWGRNPSNKQSDQT  450
              G  +  GEQN RL+W    + ++ D T
Sbjct  143  FNGTPMPNGEQNFRLNWASFGAGEKRDDT  171



>ref|XP_008441138.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Cucumis melo]
Length=405

 Score =   165 bits (417),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 111/156 (71%), Gaps = 3/156 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             SSRPMRIGPAANKN   +QQ  K +YQ+ Q  Q ++DPNNTTIFVG LD NV+++ +RQ
Sbjct  224  CSSRPMRIGPAANKNTSGSQQFSKTSYQNPQGAQNENDPNNTTIFVGNLDANVTDDHLRQ  283

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            VF  YGELVHVKI   KRCGFVQFS+R  AE AL +L G Q+G QN+RLSWGR+PSNKQ 
Sbjct  284  VFGQYGELVHVKIPVGKRCGFVQFSDRNCAEEALRALNGTQIGGQNIRLSWGRSPSNKQV  343

Query  458  DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY  351
             Q        G  Y    QGY+ Y YAP PQDPNM+
Sbjct  344  PQA-DPNQWNGGGYYGYGQGYENYSYAPAPQDPNMF  378


 Score = 48.5 bits (114),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+Q+RAMTEMNGV C
Sbjct  201  YGFVKFGDESEQMRAMTEMNGVHC  224


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (51%), Gaps = 8/87 (9%)
 Frame = -3

Query  692  TIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRCG------FVQFSNRPSAEHALSS  531
            T+++G L   + E  +   F+  GE+  VK++  K+ G      F++F  RP+AE  L +
Sbjct  67   TLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERVLQT  126

Query  530  LQGAQL--GEQNVRLSWGRNPSNKQSD  456
              G  +  G QN RL+W      +Q D
Sbjct  127  YNGTAMPNGAQNFRLNWASAGEKRQDD  153



>ref|XP_006449038.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
 gb|ESR62278.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
Length=413

 Score =   162 bits (410),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 97/124 (78%), Gaps = 4/124 (3%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ---KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEE  651
            V+C S+RPMRIGPA NK  V+ QQ   KA+YQ+SQ  Q D DPNNTT+FVG LD  V++E
Sbjct  239  VFC-STRPMRIGPATNKKTVSGQQQYPKASYQNSQVAQSDDDPNNTTVFVGNLDSIVTDE  297

Query  650  LMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPS  471
             +R++FS YG+LVHVKI A KRCGFVQF++R  AE AL  L G QLG QN+RLSWGR+PS
Sbjct  298  HLRELFSQYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWGRSPS  357

Query  470  NKQS  459
            NKQ+
Sbjct  358  NKQA  361


 Score = 50.8 bits (120),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+QLRAMTEMNGV C
Sbjct  218  YGFVRFGDESEQLRAMTEMNGVFC  241


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 47/89 (53%), Gaps = 8/89 (9%)
 Frame = -3

Query  692  TIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRC------GFVQFSNRPSAEHALSS  531
            T+++G L   + E  +   F+  GE+V VK++  K+       GF++F +R  AE  L +
Sbjct  83   TLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERVLQT  142

Query  530  LQGAQL--GEQNVRLSWGRNPSNKQSDQT  450
              G  +  GEQN RL+W    + ++ D T
Sbjct  143  YNGTPMPNGEQNFRLNWASFGAGEKRDDT  171



>ref|XP_003546146.1| PREDICTED: polyadenylate-binding protein RBP45-like [Glycine 
max]
Length=411

 Score =   168 bits (425),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 129/179 (72%), Gaps = 11/179 (6%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKN-LVNTQQKATYQSSQ--AGQGDSDPNNTTIFVGGLDPNVSEE  651
            V C S+RPMRIGPA+NK     +Q KA+Y +SQ    Q ++DPNNTTIFVG LDPNV+++
Sbjct  226  VLC-STRPMRIGPASNKTPATQSQPKASYLNSQPQGSQNENDPNNTTIFVGNLDPNVTDD  284

Query  650  LMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPS  471
             +RQVFS YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLSWGR+PS
Sbjct  285  HLRQVFSQYGELVHVKIPAGKRCGFVQFADRSCAEEALRVLNGTLLGGQNVRLSWGRSPS  344

Query  470  NKQSD------QTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQP  312
            NKQ+           G G GG YYGYA QGY+ YGYAP  QDPNM YGSYPGY  YQ P
Sbjct  345  NKQAQADPNQWNGAAGAGSGGGYYGYAAQGYENYGYAPAGQDPNM-YGSYPGYPGYQAP  402


 Score = 45.1 bits (105),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF +ES+Q+RAMTEM GV+C
Sbjct  205  YGFVRFSEESEQMRAMTEMQGVLC  228



>ref|XP_002518499.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF43886.1| nuclear acid binding protein, putative [Ricinus communis]
Length=430

 Score =   166 bits (421),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 120/167 (72%), Gaps = 6/167 (4%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ--KATYQSSQA-GQGDSDPNNTTIFVGGLDPNVSEELMR  642
             S+RPMRIG A NKN V  QQ  KA+YQ+SQ  G+ ++DPNNTTIFVG LD NV+++ +R
Sbjct  248  CSTRPMRIGLATNKNAVTGQQYPKASYQNSQTQGENENDPNNTTIFVGNLDSNVTDDNLR  307

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            ++F  YG+L+HVKI A KRCGFVQF++R  AE AL  L G  L  Q++RLSWGR+PSNKQ
Sbjct  308  ELFGRYGQLLHVKIPAGKRCGFVQFADRSCAEEALRLLNGTSLSGQSIRLSWGRSPSNKQ  367

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
                Q       + Y    QGY+ YGYAP PQDPNMYYG+YPGY NY
Sbjct  368  P---QPDANQWNAGYYGYAQGYENYGYAPAPQDPNMYYGNYPGYGNY  411


 Score = 46.6 bits (109),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMT+MNG  C
Sbjct  225  YGFVRFGDESEQVRAMTDMNGAFC  248



>ref|XP_004972673.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Setaria italica]
Length=456

 Score =   168 bits (425),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 94/118 (80%), Gaps = 2/118 (2%)
 Frame = -3

Query  815  CASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
              SSRPMRIGPAANK     Q+K    S+Q  Q DSDPNNTTIFVGGLDPNV+E++++QV
Sbjct  265  LCSSRPMRIGPAANKKATGVQEKVP--SAQGVQSDSDPNNTTIFVGGLDPNVTEDVLKQV  322

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            F+PYGE+VHVKI   KRCGFVQ++NR SAE AL  LQG  +G QNVRLSWGR+PSNKQ
Sbjct  323  FAPYGEVVHVKIPVGKRCGFVQYANRSSAEEALVILQGTLIGGQNVRLSWGRSPSNKQ  380


 Score = 44.7 bits (104),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD ++Q RAMTEMNG++C
Sbjct  243  YGFVKFGDPNEQARAMTEMNGMLC  266



>ref|XP_004972674.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Setaria italica]
Length=446

 Score =   168 bits (425),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 94/118 (80%), Gaps = 2/118 (2%)
 Frame = -3

Query  815  CASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
              SSRPMRIGPAANK     Q+K    S+Q  Q DSDPNNTTIFVGGLDPNV+E++++QV
Sbjct  265  LCSSRPMRIGPAANKKATGVQEKVP--SAQGVQSDSDPNNTTIFVGGLDPNVTEDVLKQV  322

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            F+PYGE+VHVKI   KRCGFVQ++NR SAE AL  LQG  +G QNVRLSWGR+PSNKQ
Sbjct  323  FAPYGEVVHVKIPVGKRCGFVQYANRSSAEEALVILQGTLIGGQNVRLSWGRSPSNKQ  380


 Score = 44.7 bits (104),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD ++Q RAMTEMNG++C
Sbjct  243  YGFVKFGDPNEQARAMTEMNGMLC  266



>ref|XP_008441142.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X3 
[Cucumis melo]
Length=403

 Score =   164 bits (415),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 110/156 (71%), Gaps = 5/156 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             SSRPMRIGPAANKN   +QQ  K +YQ+ Q  Q ++DPNNTTIFVG LD NV+++ +RQ
Sbjct  224  CSSRPMRIGPAANKNTSGSQQFSKTSYQNPQGAQNENDPNNTTIFVGNLDANVTDDHLRQ  283

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            VF  YGELVHVKI   KRCGFVQFS+R  AE AL +L G Q+G QN+RLSWGR+PSNK  
Sbjct  284  VFGQYGELVHVKIPVGKRCGFVQFSDRNCAEEALRALNGTQIGGQNIRLSWGRSPSNK--  341

Query  458  DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY  351
             Q        G  Y    QGY+ Y YAP PQDPNM+
Sbjct  342  -QVADPNQWNGGGYYGYGQGYENYSYAPAPQDPNMF  376


 Score = 48.5 bits (114),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+Q+RAMTEMNGV C
Sbjct  201  YGFVKFGDESEQMRAMTEMNGVHC  224


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (51%), Gaps = 8/87 (9%)
 Frame = -3

Query  692  TIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRCG------FVQFSNRPSAEHALSS  531
            T+++G L   + E  +   F+  GE+  VK++  K+ G      F++F  RP+AE  L +
Sbjct  67   TLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERVLQT  126

Query  530  LQGAQL--GEQNVRLSWGRNPSNKQSD  456
              G  +  G QN RL+W      +Q D
Sbjct  127  YNGTAMPNGAQNFRLNWASAGEKRQDD  153



>ref|XP_010327241.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Solanum lycopersicum]
Length=411

 Score =   163 bits (412),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 114/164 (70%), Gaps = 3/164 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAANK     Q +A+YQS+   Q + DP NTTIFVG LD +V+++ +RQVF
Sbjct  236  CSTRPMRIGPAANKKNSGGQMQASYQST-GTQNEDDPTNTTIFVGNLDASVTDDHLRQVF  294

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              YG+L+HVKI   KRCGFVQF++R  AE AL++L G QLG Q +RLSWGR+PSNKQ  Q
Sbjct  295  GNYGQLLHVKIPLGKRCGFVQFTDRSCAEEALNALSGTQLGGQTIRLSWGRSPSNKQ--Q  352

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
            +Q         Y     GYDAYGYA P QDPNMYY  Y GY NY
Sbjct  353  SQGDPNQWSGGYYGYTPGYDAYGYAQPTQDPNMYYAGYAGYGNY  396


 Score = 49.3 bits (116),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+QLRAMTEMNG  C
Sbjct  213  YGFVRFGDESEQLRAMTEMNGKFC  236



>ref|XP_002447134.1| hypothetical protein SORBIDRAFT_06g029180 [Sorghum bicolor]
 gb|EES11462.1| hypothetical protein SORBIDRAFT_06g029180 [Sorghum bicolor]
Length=440

 Score =   168 bits (426),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 113/173 (65%), Gaps = 9/173 (5%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             SSRPMRIGPAA++       +    +SQ  Q ++DPNNTTIFVGGLDPNV+E+ ++QVF
Sbjct  249  CSSRPMRIGPAASRKNTGGVVQERVPNSQGAQSENDPNNTTIFVGGLDPNVTEDTLKQVF  308

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD-  456
            SPYGE+VHVKI   KRCGFVQF  RPSAE AL  LQGA +G QNVRLSWGR+ SNKQ+  
Sbjct  309  SPYGEVVHVKIPVGKRCGFVQFVTRPSAEQALLMLQGALIGAQNVRLSWGRSLSNKQAQP  368

Query  455  -------QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
                         G GG Y GY Q           PQDPNMY YG+Y GY NY
Sbjct  369  QQESNQWGAAAAAGAGGYYGGYGQGYEAYGSGYAQPQDPNMYGYGAYAGYPNY  421


 Score = 43.9 bits (102),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD ++Q RAMTEMNG+ C
Sbjct  226  YGFVKFGDPTEQARAMTEMNGMPC  249



>gb|EMS60206.1| RNA-binding post-transcriptional regulator csx1 [Triticum urartu]
Length=336

 Score =   168 bits (426),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 103/169 (61%), Positives = 122/169 (72%), Gaps = 6/169 (4%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             SSRPMRIGPAANK      Q+    SSQ  Q D+DP+N+TIFVGGLDPN +E++++Q+F
Sbjct  147  CSSRPMRIGPAANKQKATGVQEKI-PSSQGVQTDNDPSNSTIFVGGLDPNATEDVLKQLF  205

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ---  462
            +PYGE+VHVKI   KRCGFVQ+++R SAE AL  LQG  +G QNVRLSWGR+PSNKQ   
Sbjct  206  TPYGEVVHVKIPVGKRCGFVQYASRSSAEEALLMLQGTMIGGQNVRLSWGRSPSNKQVQS  265

Query  461  -SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
              D  QWGG    + Y    QGY AYGYA  PQDPNMY YG+Y GY NY
Sbjct  266  QQDFNQWGGATANAGYYGYGQGYRAYGYATHPQDPNMYGYGTYAGYPNY  314



>ref|XP_008441163.1| PREDICTED: polyadenylate-binding protein RBP45-like [Cucumis 
melo]
Length=407

 Score =   163 bits (412),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 116/158 (73%), Gaps = 4/158 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             SSRPMRIGPAANKN   +QQ  K +YQ+    Q ++DPNNTTIFVG LD NV++E +RQ
Sbjct  224  CSSRPMRIGPAANKNTSGSQQFSKTSYQNPPGTQNENDPNNTTIFVGNLDSNVTDEHLRQ  283

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNK--  465
            VFS YGELVHVKI A KRCGFVQFS+R  AE AL  L G Q+G QN+RLSWGR+PSNK  
Sbjct  284  VFSQYGELVHVKIPAGKRCGFVQFSDRSCAEEALRMLNGTQIGGQNIRLSWGRSPSNKQP  343

Query  464  QSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY  351
            Q+D  QW GG GG  Y    QGY+ Y YAP  QDPNM+
Sbjct  344  QADPNQWNGGGGGGGYYGYGQGYENYSYAPAAQDPNMF  381


 Score = 48.9 bits (115),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+Q+RAMTEMNGV C
Sbjct  201  YGFVKFGDESEQIRAMTEMNGVHC  224


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (51%), Gaps = 8/87 (9%)
 Frame = -3

Query  692  TIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRCG------FVQFSNRPSAEHALSS  531
            T+++G L   + E  +   F+  GE+  VK++  K+ G      F++F  RP+AE  L +
Sbjct  67   TLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERVLQT  126

Query  530  LQGAQL--GEQNVRLSWGRNPSNKQSD  456
              G  +  G QN RL+W      +Q D
Sbjct  127  YNGTAMPNGAQNFRLNWASAGEKRQDD  153



>ref|XP_004976877.1| PREDICTED: polyadenylate-binding protein RBP45-like [Setaria 
italica]
Length=428

 Score =   168 bits (425),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 114/171 (67%), Gaps = 9/171 (5%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             SSRPMRIGPAA++     Q++    +SQ  Q ++DPNNTTIFVGGLDPNV+E++++QVF
Sbjct  247  CSSRPMRIGPAASRKTTGVQERVP--NSQGAQSENDPNNTTIFVGGLDPNVTEDVLKQVF  304

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNK----  465
            +PYGE+VHVKI   KRCGFVQF  RPSAE AL  LQG  +G QNVRLSWGR+ SNK    
Sbjct  305  APYGEVVHVKIPVGKRCGFVQFVTRPSAEQALLMLQGTLIGGQNVRLSWGRSLSNKPQQD  364

Query  464  --QSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
              Q          GG Y GY Q      G    PQDPNMY YG+Y GY NY
Sbjct  365  SNQWGGAAASAAAGGYYGGYGQGYEAYGGGYAQPQDPNMYGYGAYAGYPNY  415


 Score = 43.5 bits (101),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD ++Q RAMTEMNG+ C
Sbjct  224  YGFVKFGDPTEQARAMTEMNGMPC  247



>ref|XP_011652705.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X1 [Cucumis 
sativus]
Length=405

 Score =   163 bits (412),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 109/156 (70%), Gaps = 3/156 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             SSRPMRIGPAANKN    QQ  K +YQ+ Q  Q ++DPNNTTIFVG LD NV++E +RQ
Sbjct  224  CSSRPMRIGPAANKNTSGGQQFSKTSYQNPQGAQNENDPNNTTIFVGNLDANVTDEHLRQ  283

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            VF  YGELVHVKI   KRCGFVQF++R  AE AL  L G Q+G QN+RLSWGR+PSNKQ 
Sbjct  284  VFGQYGELVHVKIPVGKRCGFVQFADRNCAEEALRVLNGTQIGGQNIRLSWGRSPSNKQV  343

Query  458  DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY  351
             Q        G  Y    QGY+ Y YAP PQDPNM+
Sbjct  344  PQA-DPNQWNGGGYYGYGQGYENYSYAPAPQDPNMF  378


 Score = 48.5 bits (114),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+Q+RAMTEMNGV C
Sbjct  201  YGFVKFGDESEQMRAMTEMNGVHC  224


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (51%), Gaps = 8/87 (9%)
 Frame = -3

Query  692  TIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRC------GFVQFSNRPSAEHALSS  531
            T+++G L   + E  +   F+  GE+  VK++  K+       GF++F  RP+AE  L +
Sbjct  67   TLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERVLQT  126

Query  530  LQGAQL--GEQNVRLSWGRNPSNKQSD  456
              G  +  G QN RL+W      +Q D
Sbjct  127  YNGTAMPNGAQNFRLNWASAGEKRQDD  153



>ref|XP_008441139.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Cucumis melo]
Length=404

 Score =   163 bits (412),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 110/156 (71%), Gaps = 4/156 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             SSRPMRIGPAANKN   +QQ  K +YQ+ Q  Q ++DPNNTTIFVG LD NV+++ +RQ
Sbjct  224  CSSRPMRIGPAANKNTSGSQQFSKTSYQNPQGAQNENDPNNTTIFVGNLDANVTDDHLRQ  283

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            VF  YGELVHVKI   KRCGFVQFS+R  AE AL +L G Q+G QN+RLSWGR+PSNKQ 
Sbjct  284  VFGQYGELVHVKIPVGKRCGFVQFSDRNCAEEALRALNGTQIGGQNIRLSWGRSPSNKQP  343

Query  458  DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY  351
                      G  Y    QGY+ Y YAP PQDPNM+
Sbjct  344  Q--ADPNQWNGGGYYGYGQGYENYSYAPAPQDPNMF  377


 Score = 48.5 bits (114),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+Q+RAMTEMNGV C
Sbjct  201  YGFVKFGDESEQMRAMTEMNGVHC  224


 Score = 51.2 bits (121),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (51%), Gaps = 8/87 (9%)
 Frame = -3

Query  692  TIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRCG------FVQFSNRPSAEHALSS  531
            T+++G L   + E  +   F+  GE+  VK++  K+ G      F++F  RP+AE  L +
Sbjct  67   TLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERVLQT  126

Query  530  LQGAQL--GEQNVRLSWGRNPSNKQSD  456
              G  +  G QN RL+W      +Q D
Sbjct  127  YNGTAMPNGAQNFRLNWASAGEKRQDD  153



>ref|XP_004248403.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Solanum lycopersicum]
Length=410

 Score =   162 bits (410),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 113/164 (69%), Gaps = 4/164 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAANK     Q +A+YQS+   Q + DP NTTIFVG LD +V+++ +RQVF
Sbjct  236  CSTRPMRIGPAANKKNSGGQMQASYQST-GTQNEDDPTNTTIFVGNLDASVTDDHLRQVF  294

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              YG+L+HVKI   KRCGFVQF++R  AE AL++L G QLG Q +RLSWGR+PSNKQS  
Sbjct  295  GNYGQLLHVKIPLGKRCGFVQFTDRSCAEEALNALSGTQLGGQTIRLSWGRSPSNKQS--  352

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
             Q         Y     GYDAYGYA P QDPNMYY  Y GY NY
Sbjct  353  -QGDPNQWSGGYYGYTPGYDAYGYAQPTQDPNMYYAGYAGYGNY  395


 Score = 49.3 bits (116),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+QLRAMTEMNG  C
Sbjct  213  YGFVRFGDESEQLRAMTEMNGKFC  236



>ref|XP_007020874.1| RNA-binding family protein [Theobroma cacao]
 gb|EOY12399.1| RNA-binding family protein [Theobroma cacao]
Length=417

 Score =   160 bits (406),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 108/184 (59%), Positives = 131/184 (71%), Gaps = 20/184 (11%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            ++C S+R MRIGPAANK  V  QQ  KA+YQ++Q   G++DPNNTTIFVGGLDP+VSE+ 
Sbjct  242  IYC-STRAMRIGPAANKKPVTGQQYPKASYQNTQGNPGENDPNNTTIFVGGLDPSVSEDQ  300

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            ++Q+FS  GE+VHVKI A K CGFVQ++NR SAE ALS L G  LG +N+RLSWGR+PS+
Sbjct  301  LKQIFSQLGEVVHVKIPANKHCGFVQYANRTSAEQALSVLNGTMLGGRNIRLSWGRSPSS  360

Query  467  KQS--DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSY--------PGYTNYQ  318
            KQ+  DQ           Y    QG++AYGYAPPPQDPNMYYG Y        PG   YQ
Sbjct  361  KQAQPDQA-----QWNGGYYGYAQGFEAYGYAPPPQDPNMYYGGYPGYGNYQQPG--AYQ  413

Query  317  QPQQ  306
            QPQQ
Sbjct  414  QPQQ  417


 Score = 50.4 bits (119),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE++QLRAMTEMNG+ C
Sbjct  221  YGFVRFGDETEQLRAMTEMNGIYC  244



>gb|EMS52025.1| RNA-binding post-transcriptional regulator csx1 [Triticum urartu]
Length=514

 Score =   166 bits (421),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 102/167 (61%), Positives = 121/167 (72%), Gaps = 5/167 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANK-NLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
             SSRPMRIGPAANK      Q+K    SSQ  Q D+DP+N+TIFVGGLDP  +E++++QV
Sbjct  328  CSSRPMRIGPAANKQKAAGVQEKV--PSSQGVQTDNDPSNSTIFVGGLDPKATEDVLKQV  385

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS-  459
            F+PYG++VHVKI   KRCGFVQ+++R SAE AL  LQG  +G QNVRLSWGR+PSNKQ  
Sbjct  386  FTPYGDVVHVKIPVGKRCGFVQYASRSSAEEALLMLQGTMIGGQNVRLSWGRSPSNKQVQ  445

Query  458  DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
            D   WGG    + Y    QGY AYGYA  PQDPNMY YG+Y GY NY
Sbjct  446  DFNHWGGATANAGYYRYGQGYGAYGYATQPQDPNMYGYGTYAGYPNY  492


 Score = 44.3 bits (103),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD ++Q RAMTEMNG++C
Sbjct  305  YGFVKFGDPTEQTRAMTEMNGMLC  328



>ref|XP_010675694.1| PREDICTED: polyadenylate-binding protein RBP45 [Beta vulgaris 
subsp. vulgaris]
Length=417

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 124/169 (73%), Gaps = 4/169 (2%)
 Frame = -3

Query  809  SSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVFS  630
            S+RPMR GPAANK     Q KA+YQ++Q   G++DPNNTTIFVGGLDPNVS+E +RQVFS
Sbjct  252  STRPMRTGPAANKKPATGQPKASYQNTQGNPGENDPNNTTIFVGGLDPNVSDEQLRQVFS  311

Query  629  PYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQT  450
            PYGELVHVKI   K CGFVQF +R +AE AL++L G Q+G QNVRLSWGR+PS KQ    
Sbjct  312  PYGELVHVKIPMGKGCGFVQFGSRAAAEQALAALNGVQIGSQNVRLSWGRSPSAKQG---  368

Query  449  qwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSY-PGYTNYQQPQQ  306
            Q G       Y    QGYDAYGYA  PQDPNMYY +Y  GY NYQQ QQ
Sbjct  369  QPGQAQWNGGYYGYPQGYDAYGYAAAPQDPNMYYANYAAGYGNYQQTQQ  417



>ref|XP_011652716.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X3 [Cucumis 
sativus]
Length=403

 Score =   162 bits (411),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 108/156 (69%), Gaps = 5/156 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             SSRPMRIGPAANKN    QQ  K +YQ+ Q  Q ++DPNNTTIFVG LD NV++E +RQ
Sbjct  224  CSSRPMRIGPAANKNTSGGQQFSKTSYQNPQGAQNENDPNNTTIFVGNLDANVTDEHLRQ  283

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            VF  YGELVHVKI   KRCGFVQF++R  AE AL  L G Q+G QN+RLSWGR+PSNK  
Sbjct  284  VFGQYGELVHVKIPVGKRCGFVQFADRNCAEEALRVLNGTQIGGQNIRLSWGRSPSNK--  341

Query  458  DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY  351
             Q        G  Y    QGY+ Y YAP PQDPNM+
Sbjct  342  -QVADPNQWNGGGYYGYGQGYENYSYAPAPQDPNMF  376


 Score = 48.5 bits (114),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+Q+RAMTEMNGV C
Sbjct  201  YGFVKFGDESEQMRAMTEMNGVHC  224


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (51%), Gaps = 8/87 (9%)
 Frame = -3

Query  692  TIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRC------GFVQFSNRPSAEHALSS  531
            T+++G L   + E  +   F+  GE+  VK++  K+       GF++F  RP+AE  L +
Sbjct  67   TLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERVLQT  126

Query  530  LQGAQL--GEQNVRLSWGRNPSNKQSD  456
              G  +  G QN RL+W      +Q D
Sbjct  127  YNGTAMPNGAQNFRLNWASAGEKRQDD  153



>ref|XP_006352617.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Solanum tuberosum]
Length=412

 Score =   163 bits (413),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 113/164 (69%), Gaps = 3/164 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAANK     Q +A+YQS+   Q + DP NTTIFVG LD +V+++ +RQVF
Sbjct  237  CSTRPMRIGPAANKKNAGGQMQASYQST-GTQNEDDPTNTTIFVGNLDASVTDDHLRQVF  295

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              YG+L+HVKI   KRCGFVQF++R  AE AL +L G QLG Q +RLSWGR+PSNKQ  Q
Sbjct  296  GNYGQLLHVKIPLGKRCGFVQFTDRSCAEEALRALSGTQLGGQTIRLSWGRSPSNKQ--Q  353

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
            +Q         Y     GYDAYGYA P QDPNMYY  Y GY NY
Sbjct  354  SQGDPNQWSGGYYGYTPGYDAYGYAQPTQDPNMYYAGYAGYGNY  397


 Score = 47.0 bits (110),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+QL AMTEMNG  C
Sbjct  214  YGFVRFGDESEQLHAMTEMNGKFC  237



>ref|NP_001168324.1| hypothetical protein [Zea mays]
 gb|ACN27804.1| unknown [Zea mays]
 gb|ACN27818.1| unknown [Zea mays]
 gb|AFW68317.1| hypothetical protein ZEAMMB73_975236, partial [Zea mays]
Length=406

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 114/167 (68%), Gaps = 5/167 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             SSR MR+GPA+NK      Q   A YQ++Q    DSDPNNTT+FVGGLDP+V++EL++Q
Sbjct  230  CSSRAMRLGPASNKKNTGGPQPSSAIYQNTQGTDSDSDPNNTTVFVGGLDPSVTDELLKQ  289

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
             FSPYGEL++VKI   KRCGFVQ+SNR SAE A+  L G+QLG Q++RLSWGR+P+NKQ 
Sbjct  290  TFSPYGELLYVKIPVGKRCGFVQYSNRASAEEAIRVLNGSQLGGQSIRLSWGRSPANKQP  349

Query  458  DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
             Q Q     GG Y          Y    PPQDP MY Y +YPGY NY
Sbjct  350  QQEQSQWSGGGYYGYPQGYDPYGYAR--PPQDPAMYAYAAYPGYGNY  394



>ref|XP_006283830.1| hypothetical protein CARUB_v10004931mg [Capsella rubella]
 gb|EOA16728.1| hypothetical protein CARUB_v10004931mg [Capsella rubella]
Length=413

 Score =   162 bits (410),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 100/151 (66%), Positives = 117/151 (77%), Gaps = 1/151 (1%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             SSRPMR GPAANK  + T Q A+YQ++Q  QG+SDP NTTIFVG LD +V+E+L++ VF
Sbjct  238  CSSRPMRTGPAANKKPL-TMQPASYQNTQGNQGESDPTNTTIFVGALDQSVTEDLLKSVF  296

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              +GELVHVKI A KRCGFVQ++NR  AE ALS L G QLG Q+VRLSWGR+PSNKQ+  
Sbjct  297  GQFGELVHVKIPAGKRCGFVQYANRACAEQALSMLNGTQLGGQSVRLSWGRSPSNKQNQP  356

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDP  360
             Q   G GG YYGY  QGY+AYGYAPPPQDP
Sbjct  357  DQAQYGGGGGYYGYPPQGYEAYGYAPPPQDP  387


 Score = 48.5 bits (114),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEMNG  C
Sbjct  215  YGFVRFGDESEQIRAMTEMNGQFC  238



>ref|XP_004145109.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X2 [Cucumis 
sativus]
Length=404

 Score =   161 bits (408),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 94/156 (60%), Positives = 108/156 (69%), Gaps = 4/156 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             SSRPMRIGPAANKN    QQ  K +YQ+ Q  Q ++DPNNTTIFVG LD NV++E +RQ
Sbjct  224  CSSRPMRIGPAANKNTSGGQQFSKTSYQNPQGAQNENDPNNTTIFVGNLDANVTDEHLRQ  283

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            VF  YGELVHVKI   KRCGFVQF++R  AE AL  L G Q+G QN+RLSWGR+PSNKQ 
Sbjct  284  VFGQYGELVHVKIPVGKRCGFVQFADRNCAEEALRVLNGTQIGGQNIRLSWGRSPSNKQP  343

Query  458  DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY  351
                      G  Y    QGY+ Y YAP PQDPNM+
Sbjct  344  Q--ADPNQWNGGGYYGYGQGYENYSYAPAPQDPNMF  377


 Score = 48.5 bits (114),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+Q+RAMTEMNGV C
Sbjct  201  YGFVKFGDESEQMRAMTEMNGVHC  224


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (51%), Gaps = 8/87 (9%)
 Frame = -3

Query  692  TIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRC------GFVQFSNRPSAEHALSS  531
            T+++G L   + E  +   F+  GE+  VK++  K+       GF++F  RP+AE  L +
Sbjct  67   TLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERVLQT  126

Query  530  LQGAQL--GEQNVRLSWGRNPSNKQSD  456
              G  +  G QN RL+W      +Q D
Sbjct  127  YNGTAMPNGAQNFRLNWASAGEKRQDD  153



>ref|XP_008661406.1| PREDICTED: uncharacterized protein LOC100193230 isoform X1 [Zea 
mays]
Length=503

 Score =   166 bits (419),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 113/173 (65%), Gaps = 9/173 (5%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             SSRPMRIGPAA++       +    +SQ  Q ++DPNNTTIFVGGLDPNV+E++++Q F
Sbjct  318  CSSRPMRIGPAASRKNAGGVVQERVPNSQGAQSENDPNNTTIFVGGLDPNVTEDVLKQAF  377

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD-  456
            SPYGE++HVKI   KRCGFVQF  RPSAE AL  LQGA +G QNVRLSWGR+ SNKQ+  
Sbjct  378  SPYGEVIHVKIPVGKRCGFVQFVTRPSAEQALLMLQGALIGAQNVRLSWGRSLSNKQTQP  437

Query  455  -------QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
                         GVG  Y GY Q           PQDPNMY YG+Y GY NY
Sbjct  438  QQESMQWGAGAPAGVGDYYGGYGQGYEAYGSGYAQPQDPNMYGYGAYVGYPNY  490


 Score = 44.3 bits (103),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD ++Q RAMTEMNG+ C
Sbjct  295  YGFVKFGDPTEQARAMTEMNGMPC  318



>ref|XP_006352618.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Solanum tuberosum]
Length=411

 Score =   162 bits (411),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 95/164 (58%), Positives = 112/164 (68%), Gaps = 4/164 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAANK     Q +A+YQS+   Q + DP NTTIFVG LD +V+++ +RQVF
Sbjct  237  CSTRPMRIGPAANKKNAGGQMQASYQST-GTQNEDDPTNTTIFVGNLDASVTDDHLRQVF  295

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              YG+L+HVKI   KRCGFVQF++R  AE AL +L G QLG Q +RLSWGR+PSNKQS  
Sbjct  296  GNYGQLLHVKIPLGKRCGFVQFTDRSCAEEALRALSGTQLGGQTIRLSWGRSPSNKQS--  353

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
             Q         Y     GYDAYGYA P QDPNMYY  Y GY NY
Sbjct  354  -QGDPNQWSGGYYGYTPGYDAYGYAQPTQDPNMYYAGYAGYGNY  396


 Score = 47.0 bits (110),  Expect(2) = 4e-45, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+QL AMTEMNG  C
Sbjct  214  YGFVRFGDESEQLHAMTEMNGKFC  237



>ref|XP_002464324.1| hypothetical protein SORBIDRAFT_01g016170 [Sorghum bicolor]
 gb|EER91322.1| hypothetical protein SORBIDRAFT_01g016170 [Sorghum bicolor]
Length=409

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 113/168 (67%), Gaps = 6/168 (4%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQ---QKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
             SSRPMR+GPA+NK     Q       YQ++Q    DSDPNNTT+FVGGLDP+V++EL++
Sbjct  232  CSSRPMRLGPASNKKNTGGQPQPSSTIYQNTQGTDSDSDPNNTTVFVGGLDPSVTDELLK  291

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            Q FSPYGEL++VKI   KRCGFVQ+SNR SAE A+  L G+QLG Q++RLSWGR+P+NKQ
Sbjct  292  QTFSPYGELLYVKIPVGKRCGFVQYSNRASAEEAIRMLNGSQLGGQSIRLSWGRSPANKQ  351

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
              Q Q     GG Y          Y    PPQDP MY Y  YPGY NY
Sbjct  352  PQQEQNQWSGGGYYGYPQGYDPYGYAR--PPQDPAMYAYTPYPGYGNY  397



>gb|EMT04468.1| RNA-binding post-transcriptional regulator csx1 [Aegilops tauschii]
Length=350

 Score =   165 bits (417),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 104/183 (57%), Positives = 123/183 (67%), Gaps = 18/183 (10%)
 Frame = -3

Query  815  CASSRPMRIGPAANK-NLVNTQQKATYQSS---------------QAGQGDSDPNNTTIF  684
              SSRPMRIGPAANK      Q+K  Y SS               Q  Q D+DP+N+TIF
Sbjct  146  LCSSRPMRIGPAANKQKATGVQEKVQYPSSLTVYLYLSLFTVPSSQGVQTDNDPSNSTIF  205

Query  683  VGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQ  504
            VGGLDPN +E++++QVF+PYG++VHVKI   KRCGFVQ+++R SAE AL  LQG  +G Q
Sbjct  206  VGGLDPNATEDVLKQVFTPYGDVVHVKIPVGKRCGFVQYASRFSAEEALLMLQGTMIGGQ  265

Query  503  NVRLSWGRNPSNKQ-SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGY  330
            NVRLSWGR+PSNKQ  D   WGG    + Y    QGY AYGYA  PQDPNMY YG+Y GY
Sbjct  266  NVRLSWGRSPSNKQVQDFNHWGGATANAGYYGYGQGYGAYGYATQPQDPNMYGYGTYAGY  325

Query  329  TNY  321
             NY
Sbjct  326  PNY  328


 Score = 44.3 bits (103),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD ++Q RAMTEMNG++C
Sbjct  124  YGFVKFGDPTEQTRAMTEMNGMLC  147



>ref|NP_001131852.1| uncharacterized protein LOC100193230 [Zea mays]
 gb|ACF80447.1| unknown [Zea mays]
 gb|AFW59517.1| hypothetical protein ZEAMMB73_768040 [Zea mays]
Length=434

 Score =   165 bits (417),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 113/173 (65%), Gaps = 9/173 (5%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             SSRPMRIGPAA++       +    +SQ  Q ++DPNNTTIFVGGLDPNV+E++++Q F
Sbjct  243  CSSRPMRIGPAASRKNAGGVVQERVPNSQGAQSENDPNNTTIFVGGLDPNVTEDVLKQAF  302

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD-  456
            SPYGE++HVKI   KRCGFVQF  RPSAE AL  LQGA +G QNVRLSWGR+ SNKQ+  
Sbjct  303  SPYGEVIHVKIPVGKRCGFVQFVTRPSAEQALLMLQGALIGAQNVRLSWGRSLSNKQTQP  362

Query  455  -------QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
                         GVG  Y GY Q           PQDPNMY YG+Y GY NY
Sbjct  363  QQESMQWGAGAPAGVGDYYGGYGQGYEAYGSGYAQPQDPNMYGYGAYVGYPNY  415


 Score = 43.9 bits (102),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD ++Q RAMTEMNG+ C
Sbjct  220  YGFVKFGDPTEQARAMTEMNGMPC  243



>gb|AFW59516.1| hypothetical protein ZEAMMB73_768040, partial [Zea mays]
Length=428

 Score =   165 bits (417),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 96/173 (55%), Positives = 113/173 (65%), Gaps = 9/173 (5%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             SSRPMRIGPAA++       +    +SQ  Q ++DPNNTTIFVGGLDPNV+E++++Q F
Sbjct  243  CSSRPMRIGPAASRKNAGGVVQERVPNSQGAQSENDPNNTTIFVGGLDPNVTEDVLKQAF  302

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD-  456
            SPYGE++HVKI   KRCGFVQF  RPSAE AL  LQGA +G QNVRLSWGR+ SNKQ+  
Sbjct  303  SPYGEVIHVKIPVGKRCGFVQFVTRPSAEQALLMLQGALIGAQNVRLSWGRSLSNKQTQP  362

Query  455  -------QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
                         GVG  Y GY Q           PQDPNMY YG+Y GY NY
Sbjct  363  QQESMQWGAGAPAGVGDYYGGYGQGYEAYGSGYAQPQDPNMYGYGAYVGYPNY  415


 Score = 43.9 bits (102),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD ++Q RAMTEMNG+ C
Sbjct  220  YGFVKFGDPTEQARAMTEMNGMPC  243



>gb|KJB13666.1| hypothetical protein B456_002G088100 [Gossypium raimondii]
Length=418

 Score =   160 bits (405),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 117/158 (74%), Gaps = 6/158 (4%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            ++C S+R MRIGPAANK  V  QQ  KA YQ++Q   G++DPNNTTIFVGGLDP+VSE+ 
Sbjct  239  IYC-STRAMRIGPAANKKPVTDQQYQKAAYQNTQGNSGENDPNNTTIFVGGLDPSVSEDQ  297

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            ++Q+FS  GE+VHVKI A K CGFVQ++NR SAE ALS L G  LG +NVRLSWGR+PS+
Sbjct  298  LKQIFSQLGEVVHVKIPANKHCGFVQYANRASAEQALSVLNGTVLGGRNVRLSWGRSPSS  357

Query  467  KQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNM  354
            K   Q Q       + Y    QGY+AYGYAPPPQDPNM
Sbjct  358  K---QVQPDQAQWNTGYYGYAQGYEAYGYAPPPQDPNM  392


 Score = 48.5 bits (114),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDE++Q+RAMTEMNG+ C
Sbjct  218  YGFVKFGDETEQIRAMTEMNGIYC  241



>gb|KJB13665.1| hypothetical protein B456_002G088100 [Gossypium raimondii]
Length=415

 Score =   160 bits (405),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 117/158 (74%), Gaps = 6/158 (4%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            ++C S+R MRIGPAANK  V  QQ  KA YQ++Q   G++DPNNTTIFVGGLDP+VSE+ 
Sbjct  239  IYC-STRAMRIGPAANKKPVTDQQYQKAAYQNTQGNSGENDPNNTTIFVGGLDPSVSEDQ  297

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            ++Q+FS  GE+VHVKI A K CGFVQ++NR SAE ALS L G  LG +NVRLSWGR+PS+
Sbjct  298  LKQIFSQLGEVVHVKIPANKHCGFVQYANRASAEQALSVLNGTVLGGRNVRLSWGRSPSS  357

Query  467  KQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNM  354
            K   Q Q       + Y    QGY+AYGYAPPPQDPNM
Sbjct  358  K---QVQPDQAQWNTGYYGYAQGYEAYGYAPPPQDPNM  392


 Score = 48.1 bits (113),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDE++Q+RAMTEMNG+ C
Sbjct  218  YGFVKFGDETEQIRAMTEMNGIYC  241



>gb|KJB13664.1| hypothetical protein B456_002G088100 [Gossypium raimondii]
Length=413

 Score =   160 bits (405),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 97/158 (61%), Positives = 117/158 (74%), Gaps = 6/158 (4%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            ++C S+R MRIGPAANK  V  QQ  KA YQ++Q   G++DPNNTTIFVGGLDP+VSE+ 
Sbjct  239  IYC-STRAMRIGPAANKKPVTDQQYQKAAYQNTQGNSGENDPNNTTIFVGGLDPSVSEDQ  297

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            ++Q+FS  GE+VHVKI A K CGFVQ++NR SAE ALS L G  LG +NVRLSWGR+PS+
Sbjct  298  LKQIFSQLGEVVHVKIPANKHCGFVQYANRASAEQALSVLNGTVLGGRNVRLSWGRSPSS  357

Query  467  KQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNM  354
            K   Q Q       + Y    QGY+AYGYAPPPQDPNM
Sbjct  358  K---QVQPDQAQWNTGYYGYAQGYEAYGYAPPPQDPNM  392


 Score = 48.1 bits (113),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDE++Q+RAMTEMNG+ C
Sbjct  218  YGFVKFGDETEQIRAMTEMNGIYC  241



>ref|XP_006449039.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
 gb|ESR62279.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
Length=406

 Score =   157 bits (397),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 94/121 (78%), Gaps = 5/121 (4%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            V+C S+RPMRIGPA NK  V+    A+YQ+SQ  Q D DPNNTT+FVG LD  V++E +R
Sbjct  239  VFC-STRPMRIGPATNKKTVS----ASYQNSQVAQSDDDPNNTTVFVGNLDSIVTDEHLR  293

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            ++FS YG+LVHVKI A KRCGFVQF++R  AE AL  L G QLG QN+RLSWGR+PSNKQ
Sbjct  294  ELFSQYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWGRSPSNKQ  353

Query  461  S  459
            +
Sbjct  354  A  354


 Score = 50.8 bits (120),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+QLRAMTEMNGV C
Sbjct  218  YGFVRFGDESEQLRAMTEMNGVFC  241


 Score = 51.6 bits (122),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 47/89 (53%), Gaps = 8/89 (9%)
 Frame = -3

Query  692  TIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRC------GFVQFSNRPSAEHALSS  531
            T+++G L   + E  +   F+  GE+V VK++  K+       GF++F +R  AE  L +
Sbjct  83   TLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERVLQT  142

Query  530  LQGAQL--GEQNVRLSWGRNPSNKQSDQT  450
              G  +  GEQN RL+W    + ++ D T
Sbjct  143  YNGTPMPNGEQNFRLNWASFGAGEKRDDT  171



>ref|XP_011030800.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Populus 
euphratica]
Length=402

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = -3

Query  818  WCASSRPMRIGPAANKN-LVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            +C S+RPMRIGPAA K  L    QKATYQ+ Q  QG++DPNNTTIFVG LDP+V+++ +R
Sbjct  228  YC-STRPMRIGPAATKKPLTQQYQKATYQNPQGNQGENDPNNTTIFVGALDPSVTDDTLR  286

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
             VFS YGELVHVKI A KRCGFVQF+NR SAE ALS L G Q+  QN+RLSWGR+PSNKQ
Sbjct  287  AVFSKYGELVHVKIPAGKRCGFVQFANRTSAEQALSMLNGTQIAGQNIRLSWGRSPSNKQ  346



>ref|XP_006468022.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Citrus sinensis]
 gb|KDO75472.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
Length=406

 Score =   157 bits (397),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 94/121 (78%), Gaps = 5/121 (4%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            V+C S+RPMRIGPA NK  V+    A+YQ+SQ  Q D DPNNTT+FVG LD  V++E +R
Sbjct  239  VFC-STRPMRIGPATNKKTVS----ASYQNSQVAQSDDDPNNTTVFVGNLDSIVTDEHLR  293

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            ++FS YG+LVHVKI A KRCGFVQF++R  AE AL  L G QLG QN+RLSWGR+PSNKQ
Sbjct  294  ELFSQYGQLVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWGRSPSNKQ  353

Query  461  S  459
            +
Sbjct  354  A  354


 Score = 50.8 bits (120),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+QLRAMTEMNGV C
Sbjct  218  YGFVRFGDESEQLRAMTEMNGVFC  241


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 47/89 (53%), Gaps = 8/89 (9%)
 Frame = -3

Query  692  TIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRC------GFVQFSNRPSAEHALSS  531
            T+++G L   + E  +   F+  GE+V VK++  K+       GF++F +R  AE  L +
Sbjct  83   TLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERVLQT  142

Query  530  LQGAQL--GEQNVRLSWGRNPSNKQSDQT  450
              G  +  GEQN RL+W    + ++ D T
Sbjct  143  FNGTPMPNGEQNFRLNWASFGAGEKRDDT  171



>ref|XP_002316998.2| RNA-binding protein 45 [Populus trichocarpa]
 gb|EEE97610.2| RNA-binding protein 45 [Populus trichocarpa]
Length=404

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/120 (68%), Positives = 96/120 (80%), Gaps = 2/120 (2%)
 Frame = -3

Query  818  WCASSRPMRIGPAANKN-LVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            +C S+RPMRIGPAA K  L    QKATYQ+ Q  QG++DPNNTTIFVG LDP+V+++ +R
Sbjct  229  YC-STRPMRIGPAATKKPLTQQYQKATYQNPQGNQGENDPNNTTIFVGALDPSVTDDTLR  287

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
             VFS YGELVHVKI A KRCGFVQF+NR SAE ALS L G Q+  QN+RLSWGR+PSNKQ
Sbjct  288  AVFSKYGELVHVKIPAGKRCGFVQFANRTSAEQALSMLNGTQIAGQNIRLSWGRSPSNKQ  347



>ref|XP_007147735.1| hypothetical protein PHAVU_006G150400g [Phaseolus vulgaris]
 gb|ESW19729.1| hypothetical protein PHAVU_006G150400g [Phaseolus vulgaris]
Length=399

 Score =   161 bits (408),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 96/122 (79%), Gaps = 4/122 (3%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQA--GQGDSDPNNTTIFVGGLDPNVSEEL  648
            V C S+RPMRIGPA+NK    TQ KATYQ+SQA   Q +SDPNNTTIFVG LD NVS++ 
Sbjct  223  VLC-STRPMRIGPASNKTPA-TQPKATYQNSQAQGTQNESDPNNTTIFVGNLDANVSDDH  280

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            +RQVFS YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLSWGR+PSN
Sbjct  281  LRQVFSQYGELVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTLLGGQNVRLSWGRSPSN  340

Query  467  KQ  462
            KQ
Sbjct  341  KQ  342


 Score = 46.6 bits (109),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEM GV+C
Sbjct  202  YGFVRFADESEQVRAMTEMQGVLC  225



>ref|XP_011010322.1| PREDICTED: polyadenylate-binding protein RBP45C-like isoform 
X3 [Populus euphratica]
Length=427

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 95/121 (79%), Gaps = 2/121 (2%)
 Frame = -3

Query  818  WCASSRPMRIGPAANKN-LVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            +C S+RPMRIGPAA K  L    QKA YQS Q  QG+SDPNNTTIFVG LDP+V+++ +R
Sbjct  226  YC-STRPMRIGPAATKKPLTQQYQKAAYQSPQGNQGESDPNNTTIFVGALDPSVTDDTLR  284

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
             VFS YGELVHVKI A KRCGFVQF+NR  AE ALS L G Q+  QN+RLSWGR+PSNKQ
Sbjct  285  AVFSKYGELVHVKIPAGKRCGFVQFANRTCAEQALSMLNGTQIAGQNIRLSWGRSPSNKQ  344

Query  461  S  459
            +
Sbjct  345  A  345



>ref|XP_004145107.1| PREDICTED: polyadenylate-binding protein RBP45-like [Cucumis 
sativus]
Length=408

 Score =   159 bits (401),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/119 (67%), Positives = 92/119 (77%), Gaps = 2/119 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             SSRPMRIGPAANKN   +QQ  K +YQ+    Q ++DPNNTTIFVG LD NV++E +RQ
Sbjct  224  CSSRPMRIGPAANKNTSGSQQFSKTSYQNPPGTQNENDPNNTTIFVGNLDSNVTDEHLRQ  283

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            VFS YGELVHVKI A KRCGFVQFS+R  AE AL  L G  +G QN+RLSWGR+PSNKQ
Sbjct  284  VFSQYGELVHVKIPAGKRCGFVQFSDRSCAEEALRILNGTPIGGQNIRLSWGRSPSNKQ  342


 Score = 48.9 bits (115),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+Q+RAMTEMNGV C
Sbjct  201  YGFVKFGDESEQIRAMTEMNGVHC  224


 Score = 51.2 bits (121),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 44/87 (51%), Gaps = 8/87 (9%)
 Frame = -3

Query  692  TIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRCG------FVQFSNRPSAEHALSS  531
            T+++G L   + E  +   F+  GE+  VK++  K+ G      F++F  RP+AE  L +
Sbjct  67   TLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAERVLQT  126

Query  530  LQGAQL--GEQNVRLSWGRNPSNKQSD  456
              G  +  G QN RL+W      +Q D
Sbjct  127  YNGTAMPNGAQNFRLNWASAGEKRQDD  153



>ref|XP_011010320.1| PREDICTED: polyadenylate-binding protein RBP45C-like isoform 
X1 [Populus euphratica]
 ref|XP_011010321.1| PREDICTED: polyadenylate-binding protein RBP45C-like isoform 
X2 [Populus euphratica]
Length=428

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 95/121 (79%), Gaps = 2/121 (2%)
 Frame = -3

Query  818  WCASSRPMRIGPAANKN-LVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            +C S+RPMRIGPAA K  L    QKA YQS Q  QG+SDPNNTTIFVG LDP+V+++ +R
Sbjct  226  YC-STRPMRIGPAATKKPLTQQYQKAAYQSPQGNQGESDPNNTTIFVGALDPSVTDDTLR  284

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
             VFS YGELVHVKI A KRCGFVQF+NR  AE ALS L G Q+  QN+RLSWGR+PSNKQ
Sbjct  285  AVFSKYGELVHVKIPAGKRCGFVQFANRTCAEQALSMLNGTQIAGQNIRLSWGRSPSNKQ  344

Query  461  S  459
            +
Sbjct  345  A  345



>ref|XP_006370698.1| hypothetical protein POPTR_0001s45000g [Populus trichocarpa]
 gb|ERP67267.1| hypothetical protein POPTR_0001s45000g [Populus trichocarpa]
Length=430

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 82/121 (68%), Positives = 95/121 (79%), Gaps = 2/121 (2%)
 Frame = -3

Query  818  WCASSRPMRIGPAANKN-LVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            +C S+RPMRIGPAA K  L    QKA YQS Q  QG+SDPNNTTIFVG LDP+V+++ +R
Sbjct  226  YC-STRPMRIGPAATKKPLTQQYQKAAYQSPQGNQGESDPNNTTIFVGALDPSVTDDTLR  284

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
             VFS YGELVHVKI A KRCGFVQF+NR  AE ALS L G Q+  QN+RLSWGR+PSNKQ
Sbjct  285  AVFSKYGELVHVKIPAGKRCGFVQFANRTCAEQALSMLNGTQIAGQNIRLSWGRSPSNKQ  344

Query  461  S  459
            +
Sbjct  345  A  345



>ref|XP_002867529.1| hypothetical protein ARALYDRAFT_913848 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43788.1| hypothetical protein ARALYDRAFT_913848 [Arabidopsis lyrata subsp. 
lyrata]
Length=418

 Score =   158 bits (400),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 103/155 (66%), Positives = 122/155 (79%), Gaps = 4/155 (3%)
 Frame = -3

Query  818  WCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
            +C SSRPMR GPAANK  + T Q A+YQ++Q  QG+SDP NTTIFVG LD +V E+ ++ 
Sbjct  240  YC-SSRPMRTGPAANKKPL-TMQPASYQNTQGNQGESDPTNTTIFVGALDQSVIEDDLKS  297

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            VF  +GELVHVKI A KRCGFVQ++NR  AE ALS L G QLG Q++RLSWGR+PSNKQ+
Sbjct  298  VFGQFGELVHVKIPAGKRCGFVQYANRACAEQALSLLNGTQLGGQSIRLSWGRSPSNKQT  357

Query  458  --DQTqwgggvggsyygyaqqgydaygyAPPPQDP  360
              DQ Q+GGG GG YYGY  QGY+AYGYAPPPQDP
Sbjct  358  QPDQAQYGGGGGGGYYGYPPQGYEAYGYAPPPQDP  392


 Score = 48.5 bits (114),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEMNG  C
Sbjct  218  YGFVRFGDESEQIRAMTEMNGQYC  241



>ref|XP_010545222.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Tarenaya 
hassleriana]
Length=411

 Score =   159 bits (401),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 95/118 (81%), Gaps = 1/118 (1%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAA+K  +  QQ ATYQ++Q   G+SDPNNTTIFVG LDP+V++++++ VF
Sbjct  237  CSTRPMRIGPAASKKPLTAQQ-ATYQTTQGSPGESDPNNTTIFVGALDPSVTDDVLKSVF  295

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
              +GELVHVKI A KRCGFVQF+NR  AE ALS L G  LG Q++RLSWGR+PS+KQ+
Sbjct  296  GQFGELVHVKIPAGKRCGFVQFANRACAEQALSMLNGTTLGGQSIRLSWGRSPSSKQA  353


 Score = 48.1 bits (113),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE++QLRAMTEMNG  C
Sbjct  214  YGFVRFGDENEQLRAMTEMNGQYC  237



>ref|XP_008226922.1| PREDICTED: polyadenylate-binding protein RBP45C [Prunus mume]
Length=406

 Score =   159 bits (403),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 114/156 (73%), Gaps = 3/156 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVN---TQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
             S+RPMRIGPAA K   +     QKA+Y S+Q   G++DPNNTTIFVGGLDP+V+++++R
Sbjct  229  CSTRPMRIGPAATKKPASGGQQYQKASYPSTQGNPGEADPNNTTIFVGGLDPSVNDDMLR  288

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            QVFS +GELVHVKI   KRCGFVQF NR  AE AL +L G QLG Q++RLSWGR+P++KQ
Sbjct  289  QVFSQFGELVHVKIPVGKRCGFVQFGNRSCAEQALGTLNGTQLGGQSIRLSWGRSPTSKQ  348

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNM  354
            +   Q     GG  +    QGYDAY YAPP QDPN+
Sbjct  349  NQPDQAQWNGGGGGFYGYPQGYDAYTYAPPAQDPNL  384


 Score = 47.4 bits (111),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE +QLRAMTEMNG  C
Sbjct  206  YGFVRFGDEGEQLRAMTEMNGQYC  229



>gb|KCW76953.1| hypothetical protein EUGRSUZ_D01313 [Eucalyptus grandis]
Length=270

 Score =   162 bits (411),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 112/167 (67%), Gaps = 10/167 (6%)
 Frame = -3

Query  809  SSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
            S+RPMRIG A NK +   QQ  KA+YQ++Q    ++DPNN T+FVGGLDPNV+++ +RQV
Sbjct  94   STRPMRIGLATNKKIATGQQYQKASYQNTQVTPNETDPNNKTVFVGGLDPNVTDDHLRQV  153

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ--  462
            F  YGE+V VKI   KRCGFVQF++R  AE AL  L G QLG QN+RLSWGR+P+NKQ  
Sbjct  154  FGQYGEIVQVKIPPGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWGRSPANKQPQ  213

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
            SD +Q+GG  G +          A       QD NMYYG Y GY NY
Sbjct  214  SDPSQYGGYYGYAAGYENYGYGAAS------QDANMYYGGYAGYANY  254



>ref|XP_006413118.1| hypothetical protein EUTSA_v10025342mg [Eutrema salsugineum]
 gb|ESQ54571.1| hypothetical protein EUTSA_v10025342mg [Eutrema salsugineum]
Length=408

 Score =   158 bits (399),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 114/157 (73%), Gaps = 5/157 (3%)
 Frame = -3

Query  818  WCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
            +C SSRPMR GPAANK  + T Q   YQ+SQ   G+SDP NTTIFVG LD +V+E++++ 
Sbjct  229  YC-SSRPMRTGPAANKKPL-TMQPGAYQNSQGNPGESDPTNTTIFVGALDQSVTEDVLKS  286

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNK--  465
            VF  +GELVHVKI A KRCGFVQ++NR SAE ALS L G QLG Q++RLSWGR+PSNK  
Sbjct  287  VFGQFGELVHVKIPAGKRCGFVQYANRGSAEQALSMLNGTQLGGQSIRLSWGRSPSNKQT  346

Query  464  QSDQTqwgggvggsyygyaqqgyday-gyAPPPQDPN  357
            QSDQ Q+GGG GG  Y           GYAPPPQDPN
Sbjct  347  QSDQAQYGGGGGGGGYYGYPPQGYEAYGYAPPPQDPN  383


 Score = 48.9 bits (115),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEMNG  C
Sbjct  207  YGFVRFGDESEQIRAMTEMNGQYC  230



>ref|XP_009137630.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Brassica 
rapa]
Length=412

 Score =   159 bits (402),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 119/155 (77%), Gaps = 3/155 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKN-LVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
             SSRPMRIGPAANK  L   QQ   YQ++Q   G+ DP NTTIFVG LD +V+E++++ V
Sbjct  233  CSSRPMRIGPAANKKPLTMQQQPGAYQNTQGNPGEGDPTNTTIFVGALDESVTEDVLKSV  292

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS-  459
            F  +GELVHVKI A KRCGFVQ++NR  AE AL+SL G QLG Q++RLSWGR PSNKQ+ 
Sbjct  293  FGQFGELVHVKIPAGKRCGFVQYANRGCAEQALNSLNGTQLGGQSIRLSWGRTPSNKQTQ  352

Query  458  -DQTqwgggvggsyygyaqqgydaygyAPPPQDPN  357
             +Q Q+GGG GG YYGY  QGY+ YGYAPPPQDPN
Sbjct  353  PEQAQYGGGGGGGYYGYPPQGYEGYGYAPPPQDPN  387


 Score = 47.4 bits (111),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+Q+RAMTEMNG  C
Sbjct  210  YGFVKFGDESEQIRAMTEMNGQYC  233



>gb|AGV54881.1| RNA-binding post-transcriptional regulator csx1-like protein 
[Phaseolus vulgaris]
Length=399

 Score =   160 bits (405),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 96/122 (79%), Gaps = 4/122 (3%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQA--GQGDSDPNNTTIFVGGLDPNVSEEL  648
            V C S+RPMRIGPA+NK    TQ KATYQ+SQA   Q ++DPNNTTIFVG LD NVS++ 
Sbjct  223  VLC-STRPMRIGPASNKTPA-TQPKATYQNSQAQGTQNENDPNNTTIFVGNLDANVSDDH  280

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            +RQVFS YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLSWGR+PSN
Sbjct  281  LRQVFSQYGELVHVKIPAGKRCGFVQFADRSCAEEALRMLNGTLLGGQNVRLSWGRSPSN  340

Query  467  KQ  462
            KQ
Sbjct  341  KQ  342


 Score = 46.2 bits (108),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEM GV+C
Sbjct  202  YGFVRFADESEQVRAMTEMQGVLC  225



>emb|CDY46671.1| BnaA03g48370D [Brassica napus]
Length=429

 Score =   159 bits (402),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 119/155 (77%), Gaps = 3/155 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKN-LVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
             SSRPMRIGPAANK  L   QQ   YQ++Q   G+ DP NTTIFVG LD +V+E++++ V
Sbjct  232  CSSRPMRIGPAANKKPLTMQQQPGAYQNTQGNPGEGDPTNTTIFVGALDESVTEDVLKSV  291

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS-  459
            F  +GELVHVKI A KRCGFVQ++NR  AE AL+SL G QLG Q++RLSWGR PSNKQ+ 
Sbjct  292  FGQFGELVHVKIPAGKRCGFVQYANRGCAEQALNSLNGTQLGGQSIRLSWGRTPSNKQTQ  351

Query  458  -DQTqwgggvggsyygyaqqgydaygyAPPPQDPN  357
             +Q Q+GGG GG YYGY  QGY+ YGYAPPPQDPN
Sbjct  352  PEQAQYGGGGGGGYYGYPPQGYEGYGYAPPPQDPN  386


 Score = 47.4 bits (111),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+Q+RAMTEMNG  C
Sbjct  209  YGFVKFGDESEQIRAMTEMNGQYC  232



>ref|XP_010448802.1| PREDICTED: polyadenylate-binding protein RBP45A-like [Camelina 
sativa]
Length=388

 Score =   158 bits (399),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 97/123 (79%), Gaps = 4/123 (3%)
 Frame = -3

Query  818  WCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQ-GDSDPNNTTIFVGGLDPNVSEELMR  642
            +C S+RPMRIGPAANKN +   Q A YQ++Q G  GDSDPNNTT+FVGGLD NV+++ ++
Sbjct  217  YC-STRPMRIGPAANKNPLPV-QPAVYQNTQGGNPGDSDPNNTTLFVGGLDTNVTDDELK  274

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
             +F  +GEL+HVKI   KRCGFVQF+NR SAEHALS L G QLG Q++RLSWGR P NKQ
Sbjct  275  SIFGQFGELIHVKIPPGKRCGFVQFANRASAEHALSVLNGTQLGGQSIRLSWGRTP-NKQ  333

Query  461  SDQ  453
             DQ
Sbjct  334  PDQ  336


 Score = 48.1 bits (113),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEMNG  C
Sbjct  195  YGFVRFGDESEQMRAMTEMNGQYC  218


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 51/106 (48%), Gaps = 13/106 (12%)
 Frame = -3

Query  728  QAGQGDSDPNNTTIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRCG------FVQF  567
            Q G G  +P   ++++G L   + E  +  +F+  GE V  K++  K  G      F++F
Sbjct  47   QYGAGSQNPEVKSLWIGDLQQWMDENYIMSIFNQSGEAVTAKVIRNKLTGQSEGYGFIEF  106

Query  566  SNRPSAEHALSSLQGAQL--GEQNVRLSW-----GRNPSNKQSDQT  450
             NR  AE  L +  GAQ+  GE   RL+W     G    N+ +D T
Sbjct  107  VNRSVAEKYLQTYNGAQMPSGELTFRLNWAQAGAGERRQNEGADHT  152



>ref|XP_010052832.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X1 [Eucalyptus 
grandis]
 gb|KCW76949.1| hypothetical protein EUGRSUZ_D01310 [Eucalyptus grandis]
Length=427

 Score =   162 bits (409),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 112/167 (67%), Gaps = 10/167 (6%)
 Frame = -3

Query  809  SSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
            S+RPMRIG A NK +   QQ  KA+YQ++Q    ++DPNN T+FVGGLDPNV+++ +RQV
Sbjct  251  STRPMRIGLATNKKIATGQQYQKASYQNTQVTPNETDPNNKTVFVGGLDPNVTDDHLRQV  310

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ--  462
            F  YGE+V VKI   KRCGFVQF++R  AE AL  L G QLG QN+RLSWGR+P+NKQ  
Sbjct  311  FGQYGEIVQVKIPPGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWGRSPANKQPQ  370

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
            SD +Q+GG  G +          A       QD NMYYG Y GY NY
Sbjct  371  SDPSQYGGYYGYAAGYENYGYGAAS------QDANMYYGGYAGYANY  411


 Score = 44.3 bits (103),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGV  817
            YGFV+FGDES+Q+RAM+EMNGV
Sbjct  227  YGFVKFGDESEQIRAMSEMNGV  248



>ref|XP_010443072.1| PREDICTED: polyadenylate-binding protein RBP45A-like [Camelina 
sativa]
Length=387

 Score =   159 bits (402),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 95/122 (78%), Gaps = 3/122 (2%)
 Frame = -3

Query  815  CASSRPMRIGPAANKNLVNTQQKATYQSSQAGQ-GDSDPNNTTIFVGGLDPNVSEELMRQ  639
            C S+RPMRIGPAANKN +   Q A YQ++  G  GDSDPNNTT+FVGGLD NV+++ ++ 
Sbjct  216  CCSTRPMRIGPAANKNPL-PMQPAMYQNTPGGNPGDSDPNNTTVFVGGLDTNVTDDELKS  274

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            +F  +GEL+HVKI   KRCGFVQF+NR SAEHALS L G QLG Q++RLSWGR P NKQ 
Sbjct  275  IFGQFGELIHVKIPPGKRCGFVQFANRASAEHALSVLNGTQLGGQSIRLSWGRTP-NKQP  333

Query  458  DQ  453
            DQ
Sbjct  334  DQ  335


 Score = 47.0 bits (110),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE++Q+RAMTEMNG  C
Sbjct  194  YGFVRFGDETEQMRAMTEMNGQCC  217


 Score = 55.5 bits (132),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/95 (34%), Positives = 47/95 (49%), Gaps = 8/95 (8%)
 Frame = -3

Query  746  ATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRC-----  582
            A  Q  Q G G  +P   ++++G L   + E  +  +F   GE V  K++  K       
Sbjct  40   ALGQQQQYGAGSQNPEVKSLWIGDLQQWMDESYIMSIFGQSGEAVSAKVIRNKLTRQSEG  99

Query  581  -GFVQFSNRPSAEHALSSLQGAQL--GEQNVRLSW  486
             GF++F NR  AE  L +  GAQ+  GEQ  RL+W
Sbjct  100  YGFIEFVNRSVAERFLQTYNGAQMPSGEQTFRLNW  134



>gb|KHG22988.1| Polyadenylate-binding RBP45C -like protein [Gossypium arboreum]
Length=415

 Score =   156 bits (394),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 127/183 (69%), Gaps = 17/183 (9%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQ--QKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            ++C S+R MRIGPA+NK  V  Q  QKATYQ++Q   G++DP+NTTIFVGGLDP+VSE+ 
Sbjct  239  MYC-STRAMRIGPASNKKPVTGQPYQKATYQNAQGNPGENDPSNTTIFVGGLDPSVSEDQ  297

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            ++Q+FS  GE+VHVKI A K CGFVQ++NR SAE ALS L G   G +NVRLSWGR+PS 
Sbjct  298  LKQIFSQLGEVVHVKIPANKNCGFVQYANRASAEQALSVLNGTIFGGRNVRLSWGRSPST  357

Query  467  KQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSY---------PGYTNYQQ  315
            KQ+             Y    QGY+AYGYAPPPQDPNMYYG Y         PG   YQQ
Sbjct  358  KQAQ---PDPAQWNGGYYGYAQGYEAYGYAPPPQDPNMYYGGYPAGYGNYQQPG--AYQQ  412

Query  314  PQQ  306
            PQQ
Sbjct  413  PQQ  415


 Score = 49.7 bits (117),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEMNG+ C
Sbjct  218  YGFVRFGDESEQMRAMTEMNGMYC  241



>ref|XP_009142977.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Brassica 
rapa]
Length=409

 Score =   158 bits (400),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             SSRPMR GPAANK  +  QQ   YQS+Q   G++DP NTTIFVG LD +V+E+ ++ VF
Sbjct  234  CSSRPMRTGPAANKKPLTMQQPGAYQSAQGNPGETDPTNTTIFVGALDESVTEDGLKSVF  293

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              +GELVHVKI A KRCGFVQ++NR  AE AL+ L G QLG Q++RLSWGR+P+NKQ+  
Sbjct  294  GQFGELVHVKIPAGKRCGFVQYANRACAEQALNQLNGTQLGGQSIRLSWGRSPNNKQTQP  353

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPN  357
             Q   G GG YYGY  QGY+ YGYAPPPQDPN
Sbjct  354  DQAQYGGGGGYYGYPPQGYEGYGYAPPPQDPN  385


 Score = 47.0 bits (110),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+Q+RAMTEMNG  C
Sbjct  211  YGFVKFGDESEQIRAMTEMNGQYC  234



>ref|XP_004295261.2| PREDICTED: polyadenylate-binding protein RBP45B [Fragaria vesca 
subsp. vesca]
Length=410

 Score =   154 bits (388),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 91/123 (74%), Gaps = 2/123 (2%)
 Frame = -3

Query  815  CASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
              SSR MRIGPAANKN    QQ  KA+YQ S   + ++DPNNTTIFVG LD NV+++ +R
Sbjct  228  VCSSRAMRIGPAANKNAGGNQQYSKASYQGSPGAKNETDPNNTTIFVGNLDANVTDDHLR  287

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
             VFS YGELVHVKI A KRCGFVQF++R  AE AL  L  + +G QN+RLSWGR+PSNKQ
Sbjct  288  TVFSQYGELVHVKIPAGKRCGFVQFADRSRAEEALQGLNNSPIGGQNIRLSWGRSPSNKQ  347

Query  461  SDQ  453
              Q
Sbjct  348  QAQ  350


 Score = 52.0 bits (123),  Expect(2) = 7e-44, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+QLRAMTEMNGVVC
Sbjct  206  YGFVKFGDESEQLRAMTEMNGVVC  229



>ref|XP_007213954.1| hypothetical protein PRUPE_ppa006577mg [Prunus persica]
 gb|EMJ15153.1| hypothetical protein PRUPE_ppa006577mg [Prunus persica]
Length=405

 Score =   158 bits (399),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 113/156 (72%), Gaps = 3/156 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVN---TQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
             S+RPMRIGPAA K   +     QKA+Y S+Q   G++DPNNTTIFVGGLDP+V+++++R
Sbjct  228  CSTRPMRIGPAATKKPASGGQQYQKASYPSTQGNPGEADPNNTTIFVGGLDPSVNDDMLR  287

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            QVF  +GELVHVKI   KRCGFVQF NR  AE AL +L G QLG Q++RLSWGR+P++KQ
Sbjct  288  QVFGQFGELVHVKIPVGKRCGFVQFGNRSCAEQALGTLNGTQLGGQSIRLSWGRSPTSKQ  347

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNM  354
            +   Q     GG  +    QGYDAY YAPP QDPN+
Sbjct  348  NQPDQAQWNGGGGGFYGYPQGYDAYTYAPPAQDPNL  383


 Score = 47.4 bits (111),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE +QLRAMTEMNG  C
Sbjct  205  YGFVRFGDEGEQLRAMTEMNGQYC  228



>ref|XP_003542872.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Glycine 
max]
Length=409

 Score =   159 bits (401),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 4/124 (3%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKN-LVNTQQKATYQSSQ--AGQGDSDPNNTTIFVGGLDPNVSEE  651
            V C S+RPMRIGPA+NK     +Q KA+YQ+SQ    Q ++DPNNTTIFVG LDPNV+++
Sbjct  225  VLC-STRPMRIGPASNKTPTTQSQPKASYQNSQPQGSQNENDPNNTTIFVGNLDPNVTDD  283

Query  650  LMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPS  471
             +RQVFS YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLSWGR+PS
Sbjct  284  HLRQVFSQYGELVHVKIPAGKRCGFVQFADRSCAEEALRVLNGTLLGGQNVRLSWGRSPS  343

Query  470  NKQS  459
            NKQ+
Sbjct  344  NKQA  347


 Score = 46.2 bits (108),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEM GV+C
Sbjct  204  YGFVRFSDESEQVRAMTEMQGVLC  227



>gb|KHG01774.1| Polyadenylate-binding RBP45C -like protein [Gossypium arboreum]
Length=413

 Score =   156 bits (394),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 116/158 (73%), Gaps = 6/158 (4%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            ++C S+R MRIGPAANK  V  QQ  KA Y ++Q   G++DPNNTTIFVGGLDP+VSE+ 
Sbjct  239  IYC-SARAMRIGPAANKKPVTDQQYQKAAYPNTQGNSGENDPNNTTIFVGGLDPSVSEDQ  297

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            ++Q+FS  GE+VHVKI A K CGFVQ++NR SAE +LS L G  LG +NVRLSWGR+PS+
Sbjct  298  LKQIFSQLGEVVHVKIPANKHCGFVQYANRASAEQSLSVLNGTVLGGRNVRLSWGRSPSS  357

Query  467  KQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNM  354
            K   Q Q       + Y    QGY+AYGYAPPPQDPNM
Sbjct  358  K---QVQPEQAQWNTGYYGYAQGYEAYGYAPPPQDPNM  392


 Score = 48.5 bits (114),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDE++Q+RAMTEMNG+ C
Sbjct  218  YGFVKFGDETEQIRAMTEMNGIYC  241



>ref|XP_012070803.1| PREDICTED: polyadenylate-binding protein RBP45C [Jatropha curcas]
Length=394

 Score =   164 bits (414),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 123/170 (72%), Gaps = 10/170 (6%)
 Frame = -3

Query  812  ASSRPMRIGPAANKN-LVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
             S+R MRIGPAA K  +V   QKA +Q++Q  QG++DPNNTTIFVG LDP+VS+E +RQV
Sbjct  217  CSTRQMRIGPAATKKPVVQQFQKAPFQNTQGSQGENDPNNTTIFVGALDPSVSDEHLRQV  276

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ--  462
            FS YGELVHVKI A KRCGFVQF+NR  AE AL  L G QL  Q++RLSWGR+PSNKQ  
Sbjct  277  FSKYGELVHVKIPAGKRCGFVQFANRACAEQALLMLNGTQLAGQSIRLSWGRSPSNKQAS  336

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQP  312
            +DQ+QW GG  G   GY            PPQDPNMYYG YPGY NYQQP
Sbjct  337  ADQSQWNGGYYGYAPGYEYGYA-------PPQDPNMYYGGYPGYGNYQQP  379



>ref|XP_009772574.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nicotiana sylvestris]
Length=411

 Score =   157 bits (396),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 102/167 (61%), Gaps = 31/167 (19%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAANK  +  Q +A+YQSS   Q + DP+NTTIFVG +D NV++E +RQ+F
Sbjct  236  CSTRPMRIGPAANKKGMGGQSQASYQSSPGTQNEDDPSNTTIFVGNVDTNVTDEHLRQIF  295

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              YG+L+HVKI   KRCGFVQF++R  AE AL SL G QLG Q++RLSWGR+P+NKQ   
Sbjct  296  GHYGQLLHVKIPVGKRCGFVQFADRSCAEEALRSLNGTQLGGQSIRLSWGRSPANKQQ--  353

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPNM---YYGSYPGYTNY  321
                                      P  DPN    YYG  PGY  Y
Sbjct  354  --------------------------PQVDPNQYGGYYGCTPGYEAY  374


 Score = 47.4 bits (111),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+QLRAMTEMNG  C
Sbjct  213  YGFVKFGDESEQLRAMTEMNGQFC  236



>ref|XP_009772575.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nicotiana sylvestris]
Length=410

 Score =   157 bits (396),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 102/167 (61%), Gaps = 32/167 (19%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAANK  +  Q +A+YQSS   Q + DP+NTTIFVG +D NV++E +RQ+F
Sbjct  236  CSTRPMRIGPAANKKGMGGQSQASYQSSPGTQNEDDPSNTTIFVGNVDTNVTDEHLRQIF  295

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              YG+L+HVKI   KRCGFVQF++R  AE AL SL G QLG Q++RLSWGR+P+NKQ   
Sbjct  296  GHYGQLLHVKIPVGKRCGFVQFADRSCAEEALRSLNGTQLGGQSIRLSWGRSPANKQ---  352

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPNM---YYGSYPGYTNY  321
                                      P  DPN    YYG  PGY  Y
Sbjct  353  --------------------------PQVDPNQYGGYYGCTPGYEAY  373


 Score = 47.4 bits (111),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+QLRAMTEMNG  C
Sbjct  213  YGFVKFGDESEQLRAMTEMNGQFC  236



>gb|KDP39118.1| hypothetical protein JCGZ_00875 [Jatropha curcas]
Length=407

 Score =   164 bits (414),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 108/170 (64%), Positives = 123/170 (72%), Gaps = 10/170 (6%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQ-QKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
             S+R MRIGPAA K  V  Q QKA +Q++Q  QG++DPNNTTIFVG LDP+VS+E +RQV
Sbjct  230  CSTRQMRIGPAATKKPVVQQFQKAPFQNTQGSQGENDPNNTTIFVGALDPSVSDEHLRQV  289

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ--  462
            FS YGELVHVKI A KRCGFVQF+NR  AE AL  L G QL  Q++RLSWGR+PSNKQ  
Sbjct  290  FSKYGELVHVKIPAGKRCGFVQFANRACAEQALLMLNGTQLAGQSIRLSWGRSPSNKQAS  349

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQP  312
            +DQ+QW GG  G   GY            PPQDPNMYYG YPGY NYQQP
Sbjct  350  ADQSQWNGGYYGYAPGYEYGYA-------PPQDPNMYYGGYPGYGNYQQP  392



>ref|XP_010546929.1| PREDICTED: polyadenylate-binding protein RBP45B [Tarenaya hassleriana]
Length=416

 Score =   151 bits (382),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 94/124 (76%), Gaps = 2/124 (2%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            V C S+RPMRIGPAA+K  V+ Q K +YQS Q    D+DP NTT+FVGGLDP+V+++ +R
Sbjct  233  VLC-STRPMRIGPAASKKGVSGQ-KDSYQSGQGIPTDNDPTNTTVFVGGLDPSVTDDHLR  290

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            +VF  YGE+VHVKI A KRCGFVQFS +  AE AL  L G QLG Q+VRLSWGR+P++KQ
Sbjct  291  KVFGQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRMLNGLQLGGQSVRLSWGRSPTSKQ  350

Query  461  SDQT  450
               T
Sbjct  351  GQAT  354


 Score = 52.0 bits (123),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 22/24 (92%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+QLRAMTEMNGV+C
Sbjct  212  YGFVRFGDESEQLRAMTEMNGVLC  235



>gb|KJB22074.1| hypothetical protein B456_004G028000 [Gossypium raimondii]
Length=414

 Score =   155 bits (393),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 128/183 (70%), Gaps = 17/183 (9%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQ--QKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            ++C S+R MRIGPA+NK  V  Q  QKATYQ++Q   G++DP+NTTIFVGGLDP+VSE+ 
Sbjct  238  MYC-STRAMRIGPASNKKPVTGQPYQKATYQNAQGNPGENDPSNTTIFVGGLDPSVSEDQ  296

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            ++Q+FS  GE+VHVKI A K CGFVQ++NR SAE ALS L G   G +NVRLSWGR+PS 
Sbjct  297  LKQIFSQLGEVVHVKIPANKNCGFVQYANRASAEQALSVLNGTIFGGRNVRLSWGRSPST  356

Query  467  KQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSY---------PGYTNYQQ  315
            KQ+           S Y    QGY+AYGYAPPPQDPNMYYG Y         PG   YQQ
Sbjct  357  KQAQ---PDPAQWNSGYYGYAQGYEAYGYAPPPQDPNMYYGGYPAGYGNYQQPG--AYQQ  411

Query  314  PQQ  306
            PQQ
Sbjct  412  PQQ  414


 Score = 47.4 bits (111),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEMNG+ C
Sbjct  217  YGFVRFADESEQIRAMTEMNGMYC  240



>emb|CDX92786.1| BnaC07g40440D [Brassica napus]
Length=426

 Score =   155 bits (393),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 113/154 (73%), Gaps = 2/154 (1%)
 Frame = -3

Query  812  ASSRPMRIGPAANKN-LVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
             SSRPMRIGPAANK  L   QQ   YQ++Q   G+ DP NTTIFVG LD +V+E++++ V
Sbjct  232  CSSRPMRIGPAANKKPLTMQQQPGAYQNTQGNPGEGDPTNTTIFVGALDESVTEDVLKSV  291

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD  456
            F  +GELVHVKI A KRCGFVQ++ R  AE AL+SL G QLG QN+RLSWGR PSNKQ+ 
Sbjct  292  FGQFGELVHVKIPAGKRCGFVQYAIRGCAEQALNSLNGTQLGGQNIRLSWGRTPSNKQTQ  351

Query  455  -QTqwgggvggsyygyaqqgydaygyAPPPQDPN  357
             +    GG GG YYGY  QGY+ YGY PPPQDPN
Sbjct  352  PEQAQYGGGGGGYYGYPPQGYEGYGYVPPPQDPN  385


 Score = 47.0 bits (110),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+Q+RAMTEMNG  C
Sbjct  209  YGFVKFGDESEQIRAMTEMNGQYC  232



>ref|XP_010438672.1| PREDICTED: polyadenylate-binding protein RBP45C [Camelina sativa]
Length=423

 Score =   154 bits (389),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 93/120 (78%), Gaps = 2/120 (2%)
 Frame = -3

Query  818  WCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
            +C SSRPMR GPAANK  + T Q  +YQ++Q   G+SDP NTTIFVG LD +V+E+L++ 
Sbjct  242  YC-SSRPMRTGPAANKKPL-TMQPGSYQNNQGNPGESDPTNTTIFVGALDQSVTEDLLKS  299

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            VF  +GELVHVKI A KRCGFVQF+NR  AE ALS L G QLG Q+VRLSWG +PSNKQ+
Sbjct  300  VFGQFGELVHVKIPAGKRCGFVQFANRACAEQALSMLNGTQLGGQSVRLSWGHSPSNKQT  359


 Score = 48.5 bits (114),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEMNG  C
Sbjct  220  YGFVRFGDESEQIRAMTEMNGQYC  243



>emb|CDY29263.1| BnaC01g19150D [Brassica napus]
Length=419

 Score =   155 bits (392),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/121 (61%), Positives = 91/121 (75%), Gaps = 0/121 (0%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             SSRPMR GPAANK  +  QQ   YQS+Q   G+SDP NTTIFVG LD +V+E+ ++ VF
Sbjct  235  CSSRPMRTGPAANKKPLTMQQPGAYQSTQGNPGESDPTNTTIFVGALDESVTEDGLKSVF  294

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              +GELVHVKI A KRCGFVQ++NR  AE AL+ L G QLG Q++RLSWGR+P+NKQ+  
Sbjct  295  GQFGELVHVKIPAGKRCGFVQYANRACAEQALNQLNGTQLGGQSIRLSWGRSPNNKQTHV  354

Query  452  T  450
            T
Sbjct  355  T  355


 Score = 47.0 bits (110),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+Q+RAMTEMNG  C
Sbjct  212  YGFVKFGDESEQIRAMTEMNGQYC  235



>ref|XP_010433418.1| PREDICTED: polyadenylate-binding protein RBP45C [Camelina sativa]
Length=419

 Score =   154 bits (389),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 91/118 (77%), Gaps = 1/118 (1%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             SSRPMR GPAANK  + T Q  +YQ++Q   G+SDP NTTIFVG LD +V+E+L++ VF
Sbjct  243  CSSRPMRTGPAANKKPL-TMQPGSYQNNQGNPGESDPTNTTIFVGALDQSVTEDLLKSVF  301

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
              +GELVHVKI A KRCGFVQF+NR  AE ALS L G QLG Q+VRLSWG +PSNKQ+
Sbjct  302  GQFGELVHVKIPAGKRCGFVQFANRACAEQALSMLNGTQLGGQSVRLSWGHSPSNKQT  359


 Score = 48.5 bits (114),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEMNG  C
Sbjct  220  YGFVRFGDESEQIRAMTEMNGQYC  243



>ref|XP_010448184.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Camelina 
sativa]
Length=421

 Score =   154 bits (388),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 94/121 (78%), Gaps = 3/121 (2%)
 Frame = -3

Query  818  WCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQ-GDSDPNNTTIFVGGLDPNVSEELMR  642
            +C SSRPMR GPAANK  + T Q  +YQ++Q G  G+SDP NTTIFVG LD +V+E+L++
Sbjct  242  YC-SSRPMRTGPAANKKPL-TMQPGSYQNNQGGNPGESDPTNTTIFVGALDQSVTEDLLK  299

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
             VF  +GELVHVKI A KRCGFVQF+NR  AE ALS L G QLG Q+VRLSWG +PSNKQ
Sbjct  300  SVFGQFGELVHVKIPAGKRCGFVQFANRACAEQALSMLNGTQLGGQSVRLSWGHSPSNKQ  359

Query  461  S  459
            S
Sbjct  360  S  360


 Score = 48.5 bits (114),  Expect(2) = 7e-43, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEMNG  C
Sbjct  220  YGFVRFGDESEQIRAMTEMNGQYC  243



>ref|XP_009631417.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X3 
[Nicotiana tomentosiformis]
Length=396

 Score =   154 bits (390),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 91/119 (76%), Gaps = 0/119 (0%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAANK  +  Q +A+YQ S   Q + DP+NTTIFVG +D NV++E ++Q+F
Sbjct  233  CSTRPMRIGPAANKKGMGGQSQASYQISPGAQNEDDPSNTTIFVGNVDTNVTDEHLKQIF  292

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD  456
              YG+L+HVKI   KRCGFVQF++R  AE AL SL G QLG Q++RLSWGR+P+NKQ D
Sbjct  293  GHYGQLLHVKIPVGKRCGFVQFADRSCAEEALRSLNGTQLGGQSIRLSWGRSPANKQVD  351


 Score = 47.8 bits (112),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+QLRAMTEMNG  C
Sbjct  210  YGFVKFGDESEQLRAMTEMNGQFC  233



>ref|NP_567764.1| polyadenylate-binding protein RBP45C [Arabidopsis thaliana]
 sp|Q93W34.1|RP45C_ARATH RecName: Full=Polyadenylate-binding protein RBP45C; Short=Poly(A)-binding 
protein RBP45C; AltName: Full=RNA-binding protein 
45C; Short=AtRBP45C [Arabidopsis thaliana]
 gb|AAK44154.1|AF370339_1 putative DNA binding protein [Arabidopsis thaliana]
 gb|AAK96678.1| putative DNA binding protein [Arabidopsis thaliana]
 gb|AAL34173.1| putative DNA binding protein [Arabidopsis thaliana]
 gb|AAM13291.1| putative DNA binding protein [Arabidopsis thaliana]
 gb|AEE85282.1| polyadenylate-binding protein RBP45C [Arabidopsis thaliana]
Length=415

 Score =   155 bits (393),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 117/153 (76%), Gaps = 2/153 (1%)
 Frame = -3

Query  818  WCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
            +C SSRPMR GPAANK  + T Q A+YQ++Q   G+SDP NTTIFVG +D +V+E+ ++ 
Sbjct  239  YC-SSRPMRTGPAANKKPL-TMQPASYQNTQGNSGESDPTNTTIFVGAVDQSVTEDDLKS  296

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            VF  +GELVHVKI A KRCGFVQ++NR  AE ALS L G QLG Q++RLSWGR+PSNKQ+
Sbjct  297  VFGQFGELVHVKIPAGKRCGFVQYANRACAEQALSVLNGTQLGGQSIRLSWGRSPSNKQT  356

Query  458  DQTqwgggvggsyygyaqqgydaygyAPPPQDP  360
               Q   G GG YYGY  QGY+AYGYAPPPQDP
Sbjct  357  QPDQAQYGGGGGYYGYPPQGYEAYGYAPPPQDP  389


 Score = 46.2 bits (108),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEMNG  C
Sbjct  217  YGFVRFADESEQIRAMTEMNGQYC  240



>ref|XP_010482899.1| PREDICTED: polyadenylate-binding protein RBP45A-like [Camelina 
sativa]
Length=384

 Score =   154 bits (390),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 98/123 (80%), Gaps = 4/123 (3%)
 Frame = -3

Query  818  WCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQ-GDSDPNNTTIFVGGLDPNVSEELMR  642
            +C S+RPMRIGPAANKN +   Q A YQ++Q G  GDS+PNNTT+FVGGLD NV+++ ++
Sbjct  213  YC-STRPMRIGPAANKNPL-PMQPAMYQNTQGGNPGDSNPNNTTVFVGGLDTNVTDDELK  270

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
             +F  +GEL+HVK+   KRCGFVQ++NR SAEHALS L G QLG Q++RLSWGR+P NKQ
Sbjct  271  SIFGQFGELIHVKLPPGKRCGFVQYANRASAEHALSVLHGTQLGGQSIRLSWGRSP-NKQ  329

Query  461  SDQ  453
             DQ
Sbjct  330  PDQ  332


 Score = 47.4 bits (111),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE++Q+RAMTEMNG  C
Sbjct  191  YGFVRFGDETEQMRAMTEMNGQYC  214


 Score = 53.1 bits (126),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/95 (33%), Positives = 46/95 (48%), Gaps = 8/95 (8%)
 Frame = -3

Query  746  ATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRCG----  579
            A  Q  Q G G  +P   ++++G L   + E  +  +F   GE V  K++  K  G    
Sbjct  37   ALGQQQQYGAGSQNPEVKSLWIGDLQKWMDESYIMSIFGQSGEAVTAKVIRNKLTGQSEG  96

Query  578  --FVQFSNRPSAEHALSSLQGAQL--GEQNVRLSW  486
              F++F NR  AE  L +  GAQ+   EQ  RL+W
Sbjct  97   YGFIEFVNRSVAERYLQTYNGAQMPSSEQTFRLNW  131



>emb|CAB36546.1| putative DNA binding protein [Arabidopsis thaliana]
 emb|CAB79555.1| putative DNA binding protein [Arabidopsis thaliana]
Length=427

 Score =   155 bits (393),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 117/153 (76%), Gaps = 2/153 (1%)
 Frame = -3

Query  818  WCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
            +C SSRPMR GPAANK  + T Q A+YQ++Q   G+SDP NTTIFVG +D +V+E+ ++ 
Sbjct  239  YC-SSRPMRTGPAANKKPL-TMQPASYQNTQGNSGESDPTNTTIFVGAVDQSVTEDDLKS  296

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            VF  +GELVHVKI A KRCGFVQ++NR  AE ALS L G QLG Q++RLSWGR+PSNKQ+
Sbjct  297  VFGQFGELVHVKIPAGKRCGFVQYANRACAEQALSVLNGTQLGGQSIRLSWGRSPSNKQT  356

Query  458  DQTqwgggvggsyygyaqqgydaygyAPPPQDP  360
               Q   G GG YYGY  QGY+AYGYAPPPQDP
Sbjct  357  QPDQAQYGGGGGYYGYPPQGYEAYGYAPPPQDP  389


 Score = 46.2 bits (108),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEMNG  C
Sbjct  217  YGFVRFADESEQIRAMTEMNGQYC  240



>gb|EYU27806.1| hypothetical protein MIMGU_mgv1a007668mg [Erythranthe guttata]
Length=399

 Score =   152 bits (383),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 91/120 (76%), Gaps = 1/120 (1%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            V C S+RPMRIGPAANK     Q  A+YQ+SQ    + DP+NTT+FVG LD +V++E +R
Sbjct  230  VLC-STRPMRIGPAANKQKPGGQTTASYQTSQGSPSEDDPSNTTVFVGNLDSDVTDERLR  288

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            QVF  YG+L+HVKI A KRCGFVQ+++R  AE AL  L G QLG Q++RLSWGR+PSNKQ
Sbjct  289  QVFGQYGQLLHVKIPAGKRCGFVQYADRSGAEEALRLLNGTQLGGQSIRLSWGRSPSNKQ  348


 Score = 50.1 bits (118),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE++Q+RAMTEMNGV+C
Sbjct  209  YGFVRFGDENEQIRAMTEMNGVLC  232



>gb|EPS64177.1| hypothetical protein M569_10604, partial [Genlisea aurea]
Length=438

 Score =   157 bits (396),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 96/178 (54%), Positives = 110/178 (62%), Gaps = 16/178 (9%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQ-GDSDPNNTTIFVGGLDPNVSEELMRQV  636
             S+RPMRIGPAANK  +  Q + +YQ+SQ    G+ DP NTTIFVG LD NV EE +RQV
Sbjct  249  CSTRPMRIGPAANKQKIGGQSQVSYQTSQGSNAGEDDPTNTTIFVGNLDANVIEEHLRQV  308

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD  456
            F  YGEL+HVKI   KRCGFVQF  R SAE A+  L G+QLG Q++RLSWGR+PSNK   
Sbjct  309  FGQYGELLHVKIPVGKRCGFVQFGERRSAEEAIRILNGSQLGGQSIRLSWGRSPSNKAQQ  368

Query  455  Q-------------TqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
            Q                GGG  G   G    G  +YG A   QDPNMYYG   GY NY
Sbjct  369  QQADPSQWGSGGGAGGGGGGYYGYGGGGGYDGSYSYGGASQVQDPNMYYGG--GYANY  424


 Score = 44.7 bits (104),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+Q+RAM EMNG  C
Sbjct  226  YGFVKFGDESEQIRAMAEMNGRFC  249



>emb|CDY14290.1| BnaA08g14210D [Brassica napus]
Length=417

 Score =   153 bits (386),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             SSRPMR GPAANK  +  QQ   YQ+ Q   G+SD  NTTIFVG LD +V+E++++ VF
Sbjct  227  CSSRPMRTGPAANKKPLTMQQPGGYQNPQGNAGESDLTNTTIFVGALDESVTEDVLKSVF  286

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              +GELVHVKI A KRCGFVQ++NR  AE  L++L G QLG Q++RLSWGR  SNKQ+  
Sbjct  287  GQFGELVHVKIPAGKRCGFVQYANRACAEQGLNALNGTQLGGQSIRLSWGRTTSNKQTQP  346

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPN  357
             Q   G GG YYGY  QGY+ YGYAPPPQDPN
Sbjct  347  DQAQYGGGGGYYGYPPQGYEGYGYAPPPQDPN  378


 Score = 48.5 bits (114),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEMNG  C
Sbjct  204  YGFVRFGDESEQIRAMTEMNGQYC  227



>emb|CDX89287.1| BnaA01g16060D [Brassica napus]
Length=414

 Score =   154 bits (390),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 111/152 (73%), Gaps = 1/152 (1%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             SSRPMR GPAANK  +  QQ   YQSSQ   G++DP NTTIFVG LD +V+E+ ++ VF
Sbjct  233  CSSRPMRTGPAANKKPLTMQQPGAYQSSQGNPGETDPTNTTIFVGALDESVTEDGLKSVF  292

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              +GELVHVKI A KRCGFVQ++NR  AE AL+ L G QLG Q++RLSWGR+ +NKQ+ Q
Sbjct  293  GQFGELVHVKIPAGKRCGFVQYANRACAEQALNQLNGTQLGGQSIRLSWGRSLNNKQT-Q  351

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPN  357
                   GG YYGY  QGY+ YGYAPPPQDPN
Sbjct  352  PDQAQYGGGGYYGYPPQGYEGYGYAPPPQDPN  383


 Score = 47.0 bits (110),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+Q+RAMTEMNG  C
Sbjct  210  YGFVKFGDESEQIRAMTEMNGQYC  233



>emb|CDY66423.1| BnaAnng22220D [Brassica napus]
Length=426

 Score =   152 bits (385),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             SSRPMR GPAANK  +  QQ   YQ+ Q   G+SD  NTTIFVG LD +V+E++++ VF
Sbjct  229  CSSRPMRTGPAANKKPLTMQQPGGYQNPQGNAGESDLTNTTIFVGALDESVTEDVLKSVF  288

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              +GELVHVKI A KRCGFVQ++NR  AE  L++L G QLG Q++RLSWGR  SNKQ+  
Sbjct  289  GQFGELVHVKIPAGKRCGFVQYANRACAEQGLNALNGTQLGGQSIRLSWGRTTSNKQTQP  348

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPN  357
             Q   G GG YYGY  QGY+ YGYAPPPQDPN
Sbjct  349  DQAQYGGGGGYYGYPPQGYEGYGYAPPPQDPN  380


 Score = 48.5 bits (114),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEMNG  C
Sbjct  206  YGFVRFGDESEQMRAMTEMNGQYC  229



>ref|XP_009109155.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Brassica 
rapa]
Length=404

 Score =   153 bits (386),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 110/152 (72%), Gaps = 0/152 (0%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             SSRPMR GPAANK  +  QQ   YQ+ Q   G+SD  NTTIFVG LD +V+E++++ VF
Sbjct  227  CSSRPMRTGPAANKKPLTMQQPGGYQNPQGNAGESDLTNTTIFVGALDESVTEDVLKSVF  286

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              +GELVHVKI A KRCGFVQ++NR  AE  L++L G QLG Q++RLSWGR  SNKQ+  
Sbjct  287  GQFGELVHVKIPAGKRCGFVQYANRACAEQGLNALNGTQLGGQSIRLSWGRTTSNKQTQP  346

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPN  357
             Q   G GG YYGY  QGY+ YGYAPPPQDPN
Sbjct  347  DQAQYGGGGGYYGYPPQGYEGYGYAPPPQDPN  378


 Score = 48.5 bits (114),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEMNG  C
Sbjct  204  YGFVRFGDESEQIRAMTEMNGQYC  227



>ref|XP_004507696.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X2 [Cicer arietinum]
Length=361

 Score =   156 bits (395),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/118 (66%), Positives = 92/118 (78%), Gaps = 2/118 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAG-QGDSDPNNTTIFVGGLDPNVSEELMRQV  636
             S+RPMRIGPA+NKNL     KA+YQ+ Q G Q ++DPNNTTIFVG LDPNV+++ +RQV
Sbjct  225  CSTRPMRIGPASNKNLNTQSSKASYQNPQGGAQNENDPNNTTIFVGNLDPNVTDDHLRQV  284

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            F  YGELVHVKI A KRCGFVQF++R  AE AL  L G  LG QNVRLSWG++P NKQ
Sbjct  285  FGQYGELVHVKIPAGKRCGFVQFADRSCAEEALRVLNGTLLGGQNVRLSWGKSP-NKQ  341


 Score = 44.3 bits (103),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DE +Q+RAMTEM GV+C
Sbjct  202  YGFVRFADEGEQMRAMTEMQGVLC  225



>ref|XP_009631415.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nicotiana tomentosiformis]
Length=399

 Score =   153 bits (386),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 116/170 (68%), Gaps = 4/170 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAANK  +  Q +A+YQ S   Q + DP+NTTIFVG +D NV++E ++Q+F
Sbjct  233  CSTRPMRIGPAANKKGMGGQSQASYQISPGAQNEDDPSNTTIFVGNVDTNVTDEHLKQIF  292

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              YG+L+HVKI   KRCGFVQF++R  AE AL SL G QLG Q++RLSWGR+P+NKQ  Q
Sbjct  293  GHYGQLLHVKIPVGKRCGFVQFADRSCAEEALRSLNGTQLGGQSIRLSWGRSPANKQQPQ  352

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPNM-YYGSYPGYTNYQQPQQ  306
                       Y     GY+AYGYAPP QD N+ Y   Y GY NY QPQQ
Sbjct  353  V---DPNQYGGYYGYTPGYEAYGYAPPTQDSNLYYAAGYAGYGNYTQPQQ  399


 Score = 47.8 bits (112),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+QLRAMTEMNG  C
Sbjct  210  YGFVKFGDESEQLRAMTEMNGQFC  233



>emb|CAC85246.1| salt tolerance protein 6 [Beta vulgaris]
Length=322

 Score =   152 bits (383),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 89/115 (77%), Gaps = 2/115 (2%)
 Frame = -3

Query  803  RPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVFSPY  624
            R MRIG AANK  V     A+YQ++Q    DSDP+NTTIFVG LD NV++E +RQ FSPY
Sbjct  153  RAMRIGAAANKKSVGG--TASYQNNQGTPNDSDPSNTTIFVGNLDSNVTDEHLRQTFSPY  210

Query  623  GELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            GELVHVKI A K+CGFVQF+NR SAE AL  L G QLG +NVRLSWGR+P+N+QS
Sbjct  211  GELVHVKIPAGKQCGFVQFTNRSSAEEALRVLNGMQLGGRNVRLSWGRSPNNRQS  265


 Score = 48.9 bits (115),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVCL  808
            YGFVRFGDES+Q RAM+EMNG++CL
Sbjct  127  YGFVRFGDESEQARAMSEMNGMMCL  151



>ref|XP_009631416.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nicotiana tomentosiformis]
Length=398

 Score =   152 bits (385),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 90/117 (77%), Gaps = 0/117 (0%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAANK  +  Q +A+YQ S   Q + DP+NTTIFVG +D NV++E ++Q+F
Sbjct  233  CSTRPMRIGPAANKKGMGGQSQASYQISPGAQNEDDPSNTTIFVGNVDTNVTDEHLKQIF  292

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
              YG+L+HVKI   KRCGFVQF++R  AE AL SL G QLG Q++RLSWGR+P+NKQ
Sbjct  293  GHYGQLLHVKIPVGKRCGFVQFADRSCAEEALRSLNGTQLGGQSIRLSWGRSPANKQ  349


 Score = 47.8 bits (112),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGDES+QLRAMTEMNG  C
Sbjct  210  YGFVKFGDESEQLRAMTEMNGQFC  233



>ref|XP_006280607.1| hypothetical protein CARUB_v10026566mg [Capsella rubella]
 gb|EOA13505.1| hypothetical protein CARUB_v10026566mg [Capsella rubella]
Length=391

 Score =   160 bits (406),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 96/122 (79%), Gaps = 3/122 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQ-GDSDPNNTTIFVGGLDPNVSEELMRQV  636
             S+RPMRIGPAANKN +  Q  A YQ++Q G  GDSDPNNTTIFVGGLD NV++E ++ +
Sbjct  219  CSTRPMRIGPAANKNPLQMQ-PAMYQNTQGGHAGDSDPNNTTIFVGGLDANVTDEELKSI  277

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD  456
            F  +GEL+HVKI   KRCGFVQF+NR +AEHALS L G QLG Q++RLSWGR+P NKQ D
Sbjct  278  FGQFGELIHVKIPPGKRCGFVQFANRANAEHALSVLNGTQLGGQSIRLSWGRSP-NKQPD  336

Query  455  QT  450
            Q 
Sbjct  337  QA  338



>ref|XP_004294372.1| PREDICTED: polyadenylate-binding protein RBP45C [Fragaria vesca 
subsp. vesca]
Length=415

 Score =   153 bits (386),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 90/120 (75%), Gaps = 3/120 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ---KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
             SSRPMRIGPAA K  V   Q   KA Y S+Q   G++DPNNTTIFVGGLDP+V +E++R
Sbjct  236  CSSRPMRIGPAATKKPVGGGQPFQKAAYPSTQGNPGEADPNNTTIFVGGLDPSVDDEMLR  295

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            Q F  +GELVHVKI   KRCGFVQF+NR  AE ALS + G  +G Q+VRLSWGR+P++KQ
Sbjct  296  QAFGIFGELVHVKIPVGKRCGFVQFANRACAEQALSVMNGRVVGSQSVRLSWGRSPTSKQ  355


 Score = 47.0 bits (110),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+QLRAM EMNG  C
Sbjct  213  YGFVRFGDESEQLRAMNEMNGQFC  236



>ref|XP_010665562.1| PREDICTED: polyadenylate-binding protein RBP45-like [Beta vulgaris 
subsp. vulgaris]
Length=414

 Score =   151 bits (381),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 89/115 (77%), Gaps = 2/115 (2%)
 Frame = -3

Query  803  RPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVFSPY  624
            R MRIG AANK  V     A+YQ++Q    DSDP+NTTIFVG LD NV++E +RQ FSPY
Sbjct  245  RAMRIGAAANKKSVGG--TASYQNNQGTPNDSDPSNTTIFVGNLDSNVTDEHLRQTFSPY  302

Query  623  GELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            GELVHVKI A K+CGFVQF+NR SAE AL  L G QLG +NVRLSWGR+P+N+QS
Sbjct  303  GELVHVKIPAGKQCGFVQFTNRSSAEEALRVLNGMQLGGRNVRLSWGRSPNNRQS  357


 Score = 48.9 bits (115),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVCL  808
            YGFVRFGDES+Q RAM+EMNG++CL
Sbjct  219  YGFVRFGDESEQARAMSEMNGMMCL  243



>ref|XP_010476096.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X1 [Camelina sativa]
Length=407

 Score =   151 bits (381),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 92/120 (77%), Gaps = 3/120 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQ--GDSDPNNTTIFVGGLDPNVSEELMRQ  639
             S+RPMRIGPAANK  V T Q+ +YQS  A     D+DPNNTT+FVGGLDP+V+++ ++ 
Sbjct  223  CSTRPMRIGPAANKKGV-TGQRDSYQSGSAXGVPTDNDPNNTTVFVGGLDPSVTDDHLKN  281

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            VFS YGE+VHVKI A KRCGFVQFS +  AE AL +L G QLG   VRLSWGR+PSNKQ+
Sbjct  282  VFSQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRALNGVQLGGTTVRLSWGRSPSNKQA  341


 Score = 48.5 bits (114),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEMNGV C
Sbjct  200  YGFVRFSDESEQIRAMTEMNGVPC  223



>gb|AAM64532.1| putative DNA binding protein [Arabidopsis thaliana]
Length=404

 Score =   151 bits (382),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 92/119 (77%), Gaps = 2/119 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAG-QGDSDPNNTTIFVGGLDPNVSEELMRQV  636
             S+RPMRIGPAA+K  V T Q+ +YQSS AG   D+DPNNTT+FVGGLD +V+++ ++ V
Sbjct  221  CSTRPMRIGPAASKKGV-TGQRDSYQSSAAGVTTDNDPNNTTVFVGGLDASVTDDHLKNV  279

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            FS YGE+VHVKI A KRCGFVQFS +  AE AL  L G QLG   VRLSWGR+PSNKQS
Sbjct  280  FSQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRMLNGVQLGGTTVRLSWGRSPSNKQS  338


 Score = 48.5 bits (114),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEMNGV C
Sbjct  198  YGFVRFSDESEQIRAMTEMNGVPC  221



>gb|KJB81764.1| hypothetical protein B456_013G160200 [Gossypium raimondii]
Length=420

 Score =   152 bits (383),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 127/184 (69%), Gaps = 20/184 (11%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            ++C S+R MRIGPAANK     QQ  K T Q+ Q   G++DPNNTTIFVGGLDP+VSE+ 
Sbjct  240  IYC-STRAMRIGPAANKKPFTGQQYQKDTSQNIQGNPGENDPNNTTIFVGGLDPSVSEDQ  298

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            ++Q+FS  GE+VHVKI A K CGFVQ++NR SAE ALS L G  LG +NVRLSWGR+PS+
Sbjct  299  LKQIFSQLGEVVHVKIPANKNCGFVQYANRTSAEQALSVLNGTILGGRNVRLSWGRSPSS  358

Query  467  KQS--DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSY--------PGYTNYQ  318
            KQ+  DQ           Y    QGY+AYGYAPPPQDP+MYYG Y        PG   YQ
Sbjct  359  KQAQPDQA-----QWNGGYYGYAQGYEAYGYAPPPQDPSMYYGGYPGYGNYQQPG--AYQ  411

Query  317  QPQQ  306
            QPQQ
Sbjct  412  QPQQ  415


 Score = 47.8 bits (112),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFG+E++Q+RAMTEMNG+ C
Sbjct  219  YGFVRFGNETEQIRAMTEMNGIYC  242



>gb|AGV54456.1| RNA-binding post-transcriptional regulator csx1-like protein 
[Phaseolus vulgaris]
Length=399

 Score =   154 bits (389),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 96/122 (79%), Gaps = 4/122 (3%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQA--GQGDSDPNNTTIFVGGLDPNVSEEL  648
            V+C S+RP+RIGPA+NK    TQ KATYQ+ QA   Q ++DPNNTTIFVG LD NVS++ 
Sbjct  223  VFC-STRPLRIGPASNKTPA-TQPKATYQNFQAQGTQNENDPNNTTIFVGNLDANVSDDH  280

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            +RQVFSPYGELVHVKI A K CGFVQF++R  AE AL  L GA LG QNV LSWGR+PSN
Sbjct  281  LRQVFSPYGELVHVKIPAGKGCGFVQFADRSCAEEALWMLNGALLGGQNVCLSWGRSPSN  340

Query  467  KQ  462
            KQ
Sbjct  341  KQ  342


 Score = 45.4 bits (106),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEM GV C
Sbjct  202  YGFVRFADESEQVRAMTEMQGVFC  225



>ref|NP_172630.1| polyadenylate-binding protein RBP45B [Arabidopsis thaliana]
 sp|Q9SAB3.1|RB45B_ARATH RecName: Full=Polyadenylate-binding protein RBP45B; Short=Poly(A)-binding 
protein RBP45B; AltName: Full=RNA-binding protein 
45B; Short=AtRBP45B [Arabidopsis thaliana]
 gb|AAD30259.1|AC007296_20 Similar to gb|U90212 DNA binding protein ACBF from Nicotiana 
tabacum and contains 3 PF|00076 RNA recognition motif domains. 
ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, 
gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, 
gb|F15495 and gb|Z30868 come from this gene [Arabidopsis 
thaliana]
 gb|AAM13200.1| similar to gb|U90212 DNA binding protein ACBF from Nicotiana 
tabacum and contains 3 PF|00076 RNA recognition motif domains 
[Arabidopsis thaliana]
 gb|AAP37853.1| At1g11650 [Arabidopsis thaliana]
 gb|AEE28764.1| polyadenylate-binding protein RBP45B [Arabidopsis thaliana]
Length=405

 Score =   151 bits (382),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 92/119 (77%), Gaps = 2/119 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAG-QGDSDPNNTTIFVGGLDPNVSEELMRQV  636
             S+RPMRIGPAA+K  V T Q+ +YQSS AG   D+DPNNTT+FVGGLD +V+++ ++ V
Sbjct  222  CSTRPMRIGPAASKKGV-TGQRDSYQSSAAGVTTDNDPNNTTVFVGGLDASVTDDHLKNV  280

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            FS YGE+VHVKI A KRCGFVQFS +  AE AL  L G QLG   VRLSWGR+PSNKQS
Sbjct  281  FSQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRMLNGVQLGGTTVRLSWGRSPSNKQS  339


 Score = 48.5 bits (114),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEMNGV C
Sbjct  199  YGFVRFSDESEQIRAMTEMNGVPC  222



>gb|EAZ27535.1| hypothetical protein OsJ_11490 [Oryza sativa Japonica Group]
Length=171

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 83/151 (55%), Positives = 104/151 (69%), Gaps = 3/151 (2%)
 Frame = -3

Query  770  NLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAA  591
            ++V+    +TYQ++Q    DSDPNNTT+FVGGLDP+V++E+++Q FSPYGELV+VKI   
Sbjct  8    SIVHVSLTSTYQNTQGTDSDSDPNNTTVFVGGLDPSVTDEVLKQAFSPYGELVYVKIPVG  67

Query  590  KRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQTqwgggvggsyygy  411
            KRCGFVQ+SNR SAE A+  L G+QLG Q++RLSWGR+P NKQ  Q Q     G   Y  
Sbjct  68   KRCGFVQYSNRASAEEAIRMLNGSQLGGQSIRLSWGRSPGNKQPQQDQNQWNAGYYGYPP  127

Query  410  aqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
                   Y    PPQDP MY Y +YPGY NY
Sbjct  128  QGYDPYGYVR--PPQDPAMYAYAAYPGYGNY  156



>ref|XP_012091367.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Jatropha 
curcas]
 gb|KDP20762.1| hypothetical protein JCGZ_21233 [Jatropha curcas]
Length=431

 Score =   151 bits (381),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 92/120 (77%), Gaps = 3/120 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ--KATYQSSQA-GQGDSDPNNTTIFVGGLDPNVSEELMR  642
             SSRPMRIG A NK  V  QQ  KA+YQ+SQ  G  ++DPNNTTIFVG LD NV+++ +R
Sbjct  253  CSSRPMRIGLATNKKAVVGQQYPKASYQNSQTQGDNENDPNNTTIFVGNLDSNVTDDHLR  312

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            ++F  YG+L+HVKI A KRCGFVQF++R  AE AL  L GAQL  QN+RLSWGR+PSNKQ
Sbjct  313  ELFGQYGQLLHVKIPAGKRCGFVQFADRSCAEEALRMLNGAQLSGQNIRLSWGRSPSNKQ  372


 Score = 48.5 bits (114),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+QLRAMTEMNG +C
Sbjct  230  YGFVRFADESEQLRAMTEMNGTLC  253


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 47/89 (53%), Gaps = 8/89 (9%)
 Frame = -3

Query  692  TIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRC------GFVQFSNRPSAEHALSS  531
            T+++G L   + E  +   F+  GE+V+VK++  K+       GF++F++  SAE  L +
Sbjct  95   TLWIGDLQYWMDESYLHSCFAQTGEVVNVKVIRNKQTGQVEGYGFIEFNSHGSAERVLQT  154

Query  530  LQGAQL--GEQNVRLSWGRNPSNKQSDQT  450
              G  +  GEQN RL+W       + D T
Sbjct  155  YNGTPMPNGEQNFRLNWASFSGGDKRDDT  183



>ref|XP_010041417.1| PREDICTED: polyadenylate-binding protein RBP45-like [Eucalyptus 
grandis]
Length=301

 Score =   155 bits (392),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 87/167 (52%), Positives = 108/167 (65%), Gaps = 10/167 (6%)
 Frame = -3

Query  809  SSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
            S+RPMRIG A NK +   QQ  KA+YQ++Q    ++DPNN T+FVGGLDPNV+++ +RQV
Sbjct  125  STRPMRIGLATNKKIATGQQYQKASYQNTQVTPNETDPNNKTVFVGGLDPNVTDDHLRQV  184

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ--  462
            F  Y E+V VKI    RCG VQF++R  AE AL  L G QLG QN+RLSWGR+P+NKQ  
Sbjct  185  FGQYSEIVQVKIPPGMRCGIVQFADRSCAEEALRMLNGTQLGGQNIRLSWGRSPANKQPQ  244

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
            SD +Q+GG  G +                  QD NMYYG Y GY NY
Sbjct  245  SDPSQYGGYYGYAAGYENYGYG------AASQDANMYYGGYAGYANY  285


 Score = 44.3 bits (103),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGV  817
            YGFV+FGDES+Q+RAM+EMNGV
Sbjct  101  YGFVKFGDESEQIRAMSEMNGV  122



>gb|KJB81761.1| hypothetical protein B456_013G160200 [Gossypium raimondii]
 gb|KJB81763.1| hypothetical protein B456_013G160200 [Gossypium raimondii]
Length=415

 Score =   151 bits (382),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 107/184 (58%), Positives = 127/184 (69%), Gaps = 20/184 (11%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            ++C S+R MRIGPAANK     QQ  K T Q+ Q   G++DPNNTTIFVGGLDP+VSE+ 
Sbjct  240  IYC-STRAMRIGPAANKKPFTGQQYQKDTSQNIQGNPGENDPNNTTIFVGGLDPSVSEDQ  298

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            ++Q+FS  GE+VHVKI A K CGFVQ++NR SAE ALS L G  LG +NVRLSWGR+PS+
Sbjct  299  LKQIFSQLGEVVHVKIPANKNCGFVQYANRTSAEQALSVLNGTILGGRNVRLSWGRSPSS  358

Query  467  KQS--DQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSY--------PGYTNYQ  318
            KQ+  DQ           Y    QGY+AYGYAPPPQDP+MYYG Y        PG   YQ
Sbjct  359  KQAQPDQA-----QWNGGYYGYAQGYEAYGYAPPPQDPSMYYGGYPGYGNYQQPG--AYQ  411

Query  317  QPQQ  306
            QPQQ
Sbjct  412  QPQQ  415


 Score = 47.8 bits (112),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFG+E++Q+RAMTEMNG+ C
Sbjct  219  YGFVRFGNETEQIRAMTEMNGIYC  242



>ref|XP_002305583.2| RNA-binding protein 45 [Populus trichocarpa]
 gb|EEE86094.2| RNA-binding protein 45 [Populus trichocarpa]
Length=409

 Score =   149 bits (376),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 92/120 (77%), Gaps = 3/120 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             S+RPMR+G A+NK  V  QQ  KA+YQ+ Q  Q D DPNNTTIFVG LD NV ++ +++
Sbjct  236  CSTRPMRVGLASNKKAVVGQQYPKASYQNPQP-QNDGDPNNTTIFVGNLDSNVMDDHLKE  294

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            +F  YG+L+HVKI A KRCGFVQF++R SAE AL  L GAQL  QN+RLSWGRNPSNKQ+
Sbjct  295  LFGQYGQLLHVKIPAGKRCGFVQFADRSSAEEALKMLNGAQLSGQNIRLSWGRNPSNKQA  354


 Score = 50.1 bits (118),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+QLRAMTEMNG  C
Sbjct  213  YGFVRFGDESEQLRAMTEMNGAFC  236



>ref|XP_004234481.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
lycopersicum]
Length=405

 Score =   155 bits (392),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 91/120 (76%), Gaps = 0/120 (0%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAANK  V  Q +A+YQS+   Q + DP+NTTIFVG LD NV+++ +RQVF
Sbjct  232  CSTRPMRIGPAANKKSVPGQVQASYQSTNGTQNEDDPSNTTIFVGNLDANVTDDHLRQVF  291

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              YG+L+HVKI   KRCGFVQF++R  AE AL +L G QLG Q +RLSWGR+PSNKQ  Q
Sbjct  292  GNYGQLLHVKIPVGKRCGFVQFADRSCAEEALRALSGTQLGGQTIRLSWGRSPSNKQQPQ  351


 Score = 43.9 bits (102),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+F DES+QL AMTEMNG  C
Sbjct  209  YGFVKFADESEQLHAMTEMNGKFC  232



>ref|XP_008796097.1| PREDICTED: polyadenylate-binding protein RBP45 [Phoenix dactylifera]
Length=420

 Score =   160 bits (405),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 96/170 (56%), Positives = 111/170 (65%), Gaps = 8/170 (5%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQ--QKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            V+C SSRPMRIG AA+K     Q    A+YQ++   + ++DPNNTTIFVGGLDP V+EE 
Sbjct  241  VYC-SSRPMRIGAAASKKAGAQQYSSNASYQTAPGAESENDPNNTTIFVGGLDPIVTEEH  299

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            +RQVFS YGELV+VKI   KRCGFVQF+ R  AE AL  L G QLG QN+RLSWGR+P+N
Sbjct  300  LRQVFSQYGELVYVKIPVGKRCGFVQFAVRSCAEEALQMLNGTQLGGQNIRLSWGRSPAN  359

Query  467  KQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY-YGSYPGYTNY  321
            KQ  Q           Y      Y       PPQDPNMY Y SYPGY NY
Sbjct  360  KQPQQDSTQWNGSYYGYTQGYDTYGYA----PPQDPNMYAYASYPGYGNY  405



>ref|XP_009352469.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Pyrus x 
bretschneideri]
Length=416

 Score =   160 bits (404),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 77/120 (64%), Positives = 96/120 (80%), Gaps = 3/120 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVN---TQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
             S+RPMRIGPAA KN  +     QKA+Y S+Q   G++DPNNTTIFVGGLDP+V+++++R
Sbjct  236  CSTRPMRIGPAATKNPASGGQQYQKASYPSTQGNPGEADPNNTTIFVGGLDPSVNDDMLR  295

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            QVFS +GELVHVKI   KRCGFVQF+NR  AE AL SL G QLG Q++RLSWGR+P++KQ
Sbjct  296  QVFSQFGELVHVKIPVGKRCGFVQFANRSCAEQALGSLNGTQLGGQSIRLSWGRSPTSKQ  355



>gb|KFK29206.1| hypothetical protein AALP_AA7G103000 [Arabis alpina]
Length=401

 Score =   152 bits (385),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 114/152 (75%), Gaps = 2/152 (1%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             SSRPMR GPAANK  + T Q A YQ++Q   G+SDP NTTIFVG LD +V+E++++ VF
Sbjct  227  CSSRPMRTGPAANKKPL-TMQPAGYQNTQGNPGESDPTNTTIFVGALDQSVTEDVLKSVF  285

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              +GELVHVKI A KRCGFVQ++NR  AE ALS L G QLG Q++RLSWGR+PS+KQ+ Q
Sbjct  286  GQFGELVHVKIPAGKRCGFVQYANRACAEQALSVLNGTQLGGQSIRLSWGRSPSSKQT-Q  344

Query  452  TqwgggvggsyygyaqqgydaygyAPPPQDPN  357
                   GG YYGY  QGY+AYGYAPP QDPN
Sbjct  345  PDQAQYGGGGYYGYPPQGYEAYGYAPPTQDPN  376


 Score = 46.2 bits (108),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEMNG  C
Sbjct  204  YGFVRFADESEQIRAMTEMNGQYC  227



>ref|XP_006401513.1| hypothetical protein EUTSA_v10013710mg [Eutrema salsugineum]
 gb|ESQ42966.1| hypothetical protein EUTSA_v10013710mg [Eutrema salsugineum]
Length=401

 Score =   150 bits (379),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 92/121 (76%), Gaps = 3/121 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQ-GDSDPNNTTIFVGGLDPNVSEELMRQV  636
             S+RPMRIGPAANK  + T Q   YQ +Q G  G+ DPNNTTIFVG LD +V+++ ++ V
Sbjct  233  CSTRPMRIGPAANKKPL-TMQPGMYQDTQGGNPGEVDPNNTTIFVGALDASVTDDELKSV  291

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD  456
            F  +GEL+HVKI   KRCGFVQ+SNR SAEHALS L G QLG Q++RLSWGR+P NKQ D
Sbjct  292  FGRFGELIHVKIPPGKRCGFVQYSNRASAEHALSMLNGTQLGGQSIRLSWGRSP-NKQPD  350

Query  455  Q  453
            Q
Sbjct  351  Q  351


 Score = 48.5 bits (114),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEMNG  C
Sbjct  210  YGFVRFGDESEQMRAMTEMNGQFC  233



>dbj|BAJ87828.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=388

 Score =   152 bits (384),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 92/118 (78%), Gaps = 1/118 (1%)
 Frame = -3

Query  815  CASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
              SSRPMRIGPAANK   N  Q+    ++Q  Q D+DP+N+TIFVGGLDP+ +E++++QV
Sbjct  239  ICSSRPMRIGPAANKQKANGVQEKV-PTAQGIQTDNDPSNSTIFVGGLDPSATEDVLKQV  297

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            F+PYGE+VHVKI   KRCGFVQ+++R SAE AL  LQG  +  QNVRLSWGR+PSNKQ
Sbjct  298  FTPYGEVVHVKIPVGKRCGFVQYASRSSAEEALLMLQGTMIEGQNVRLSWGRSPSNKQ  355


 Score = 46.2 bits (108),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD ++Q RAMTEMNG++C
Sbjct  217  YGFVKFGDPTEQTRAMTEMNGMIC  240



>dbj|BAJ85753.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=385

 Score =   152 bits (384),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 92/118 (78%), Gaps = 1/118 (1%)
 Frame = -3

Query  815  CASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
              SSRPMRIGPAANK   N  Q+    ++Q  Q D+DP+N+TIFVGGLDP+ +E++++QV
Sbjct  239  ICSSRPMRIGPAANKQKANGVQEKV-PTAQGIQTDNDPSNSTIFVGGLDPSATEDVLKQV  297

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            F+PYGE+VHVKI   KRCGFVQ+++R SAE AL  LQG  +  QNVRLSWGR+PSNKQ
Sbjct  298  FTPYGEVVHVKIPVGKRCGFVQYASRSSAEEALLMLQGTMIEGQNVRLSWGRSPSNKQ  355


 Score = 46.2 bits (108),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+FGD ++Q RAMTEMNG++C
Sbjct  217  YGFVKFGDPTEQTRAMTEMNGMIC  240



>ref|XP_010458570.1| PREDICTED: polyadenylate-binding protein RBP45B [Camelina sativa]
Length=406

 Score =   149 bits (377),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 2/119 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAG-QGDSDPNNTTIFVGGLDPNVSEELMRQV  636
             S+RPMRIGPAA+K  V T Q+ +YQ   AG   D+DPNNTT+FVGGLDP+V+++ ++ V
Sbjct  223  CSTRPMRIGPAASKKGV-TGQRDSYQGGAAGVPTDNDPNNTTVFVGGLDPSVTDDHLKNV  281

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            FS YGE+VHVKI A KRCGFVQFS +  AE AL  L G QLG   VRLSWGR+PSNKQ+
Sbjct  282  FSQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRMLNGVQLGGTTVRLSWGRSPSNKQA  340


 Score = 48.5 bits (114),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEMNGV C
Sbjct  200  YGFVRFSDESEQIRAMTEMNGVPC  223



>ref|XP_011037670.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Populus 
euphratica]
Length=409

 Score =   148 bits (373),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 92/120 (77%), Gaps = 3/120 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
             S+RPMR+G A+NK  V  QQ  KA+Y++ Q  Q D DPNNTTIFVG LD NV ++ +++
Sbjct  236  CSTRPMRVGLASNKKAVVGQQYPKASYENPQP-QNDGDPNNTTIFVGNLDSNVMDDHLKE  294

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            +F  YG+L+HVKI A KRCGFVQF++R SAE AL  L GAQL  QN+RLSWGRNPSNKQ+
Sbjct  295  LFGQYGQLLHVKIPAGKRCGFVQFADRSSAEEALKMLNGAQLNGQNIRLSWGRNPSNKQA  354


 Score = 50.1 bits (118),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+QLRAMTEMNG  C
Sbjct  213  YGFVRFGDESEQLRAMTEMNGAFC  236



>ref|XP_010327242.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X3 [Solanum lycopersicum]
Length=354

 Score =   148 bits (374),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/120 (60%), Positives = 90/120 (75%), Gaps = 1/120 (1%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPAANK     Q +A+YQS+   Q + DP NTTIFVG LD +V+++ +RQVF
Sbjct  236  CSTRPMRIGPAANKKNSGGQMQASYQST-GTQNEDDPTNTTIFVGNLDASVTDDHLRQVF  294

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              YG+L+HVKI   KRCGFVQF++R  AE AL++L G QLG Q +RLSWGR+PSNKQ  Q
Sbjct  295  GNYGQLLHVKIPLGKRCGFVQFTDRSCAEEALNALSGTQLGGQTIRLSWGRSPSNKQQPQ  354


 Score = 49.3 bits (116),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 21/24 (88%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+QLRAMTEMNG  C
Sbjct  213  YGFVRFGDESEQLRAMTEMNGKFC  236



>ref|XP_009372712.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Pyrus x 
bretschneideri]
Length=408

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 113/158 (72%), Gaps = 5/158 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVN---TQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
             S+RPMRIGPAA K   +     QKA+Y S+Q   G++DPNNTTIFVGGLDP+V+++++R
Sbjct  228  CSTRPMRIGPAATKKPASGGQQYQKASYPSTQGNPGEADPNNTTIFVGGLDPSVNDDMLR  287

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            QVFS +GELVHVKI   KRCGFVQF+NR  AE AL SL G QLG Q++RLSWGR+P++KQ
Sbjct  288  QVFSQFGELVHVKIPVGKRCGFVQFANRSCAEQALGSLNGTQLGGQSIRLSWGRSPTSKQ  347

Query  461  S--DQTqwgggvggsyygyaqqgydaygyAPPPQDPNM  354
            +  DQ QW G  G  +YGY Q         PP QDP M
Sbjct  348  NQPDQAQWNGAGGAGFYGYPQGYDAYSYAPPPAQDPAM  385



>ref|XP_008385660.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Malus domestica]
Length=408

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 112/158 (71%), Gaps = 5/158 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVN---TQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
             S+RPMRIGPAA K   +     QKA+Y S+Q   G++DPNNTTIFVGGLDP+V+++++R
Sbjct  228  CSTRPMRIGPAATKKPASGGQQYQKASYPSTQGNPGEADPNNTTIFVGGLDPSVNDDMLR  287

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            QVFS +GELVHVKI   KRCGFVQF+NR  AE AL SL G QLG Q++RLSWGR+P+ KQ
Sbjct  288  QVFSQFGELVHVKIPVGKRCGFVQFANRSCAEQALGSLNGTQLGGQSIRLSWGRSPTXKQ  347

Query  461  S--DQTqwgggvggsyygyaqqgydaygyAPPPQDPNM  354
            +  DQ QW G  G  +YGY Q         PP QDP M
Sbjct  348  NQPDQAQWNGAGGAGFYGYPQGYDAYSYAPPPAQDPAM  385



>ref|NP_001168401.1| hypothetical protein [Zea mays]
 gb|ACN28105.1| unknown [Zea mays]
 tpg|DAA35923.1| TPA: hypothetical protein ZEAMMB73_028165 [Zea mays]
Length=432

 Score =   159 bits (402),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/118 (65%), Positives = 91/118 (77%), Gaps = 0/118 (0%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             SSRPMRIGPAA++       +    +SQ  Q ++DPNNTTIFVGGLDPNV+E+ ++QVF
Sbjct  249  CSSRPMRIGPAASRKNTGGVVQERVPNSQGAQSENDPNNTTIFVGGLDPNVTEDTLKQVF  308

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            SPYGE+VHVKI   KRCGFVQF  RPSAE AL  LQGA +G QNVRLSWGR+ SNKQ+
Sbjct  309  SPYGEVVHVKIPVGKRCGFVQFVTRPSAEQALLMLQGALIGAQNVRLSWGRSLSNKQA  366



>ref|XP_006307499.1| hypothetical protein CARUB_v10009124mg, partial [Capsella rubella]
 gb|EOA40397.1| hypothetical protein CARUB_v10009124mg, partial [Capsella rubella]
Length=448

 Score =   149 bits (375),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 91/119 (76%), Gaps = 2/119 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAG-QGDSDPNNTTIFVGGLDPNVSEELMRQV  636
             S+RPMRIGPAA+K  V T Q+ +YQ + AG   D+DPNNTT+FVGGLDP+V+++ ++ V
Sbjct  263  CSTRPMRIGPAASKKGV-TGQRDSYQGAAAGVPTDNDPNNTTVFVGGLDPSVTDDHLKNV  321

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            F  YGE+VHVKI A KRCGFVQFS +  AE AL  L G QLG   VRLSWGR+PSNKQ+
Sbjct  322  FGQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRMLNGVQLGGTTVRLSWGRSPSNKQT  380


 Score = 48.5 bits (114),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEMNGV C
Sbjct  240  YGFVRFSDESEQMRAMTEMNGVPC  263



>gb|KCW44364.1| hypothetical protein EUGRSUZ_L02167 [Eucalyptus grandis]
Length=270

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 109/167 (65%), Gaps = 10/167 (6%)
 Frame = -3

Query  809  SSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
            S+RPMRIG A NK +   QQ  KA+YQ++Q    ++DPNN T+FVGGLDPNV+++ +RQV
Sbjct  94   STRPMRIGLATNKKIATGQQYQKASYQNTQVTPNETDPNNKTVFVGGLDPNVTDDHLRQV  153

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ--  462
            F  Y E+V VKI    RCG VQF++R  AE AL  L G QLG QN+RLSWGR+P+NKQ  
Sbjct  154  FGQYSEIVQVKIPPGMRCGIVQFADRSCAEEALRMLNGTQLGGQNIRLSWGRSPANKQPQ  213

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNY  321
            SD +Q+GG  G +          A       QD NMYYG Y GY NY
Sbjct  214  SDPSQYGGYYGYAAGYENYGYGAAS------QDANMYYGGYAGYANY  254



>ref|XP_010054589.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
RBP45B-like [Eucalyptus grandis]
Length=260

 Score =   152 bits (385),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/118 (61%), Positives = 90/118 (76%), Gaps = 2/118 (2%)
 Frame = -3

Query  809  SSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQV  636
            S+RPMRIG A NK +   QQ  KA+YQ++Q    ++DPNN T+FVGGLDPNV+++ +RQV
Sbjct  135  STRPMRIGLATNKKIATGQQYQKASYQNTQVTPNETDPNNKTVFVGGLDPNVTDDHLRQV  194

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            F  YGE+V VKI   KRCGFVQF++R  AE AL  L G QLG QN+RLSWGR+P+NKQ
Sbjct  195  FGQYGEIVQVKIPPGKRCGFVQFADRSCAEEALRMLNGTQLGGQNIRLSWGRSPANKQ  252


 Score = 44.3 bits (103),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGV  817
            YGFV+FGDES+Q+RAM+EMNGV
Sbjct  111  YGFVKFGDESEQIRAMSEMNGV  132



>ref|XP_006417333.1| hypothetical protein EUTSA_v10007819mg [Eutrema salsugineum]
 gb|ESQ35686.1| hypothetical protein EUTSA_v10007819mg [Eutrema salsugineum]
Length=397

 Score =   148 bits (373),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 72/119 (61%), Positives = 92/119 (77%), Gaps = 2/119 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAG-QGDSDPNNTTIFVGGLDPNVSEELMRQV  636
             S+RPMRIGPAANK  V++Q + +YQS+ +G   D+DPNNTT+F+GGLDP V+++ ++ V
Sbjct  223  CSTRPMRIGPAANKKGVSSQ-RDSYQSAASGVPSDNDPNNTTVFIGGLDPTVTDDHLKNV  281

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            F  YGE+VHVKI A KRCGFVQFS +  AE AL  L G QLG   VRLSWGR+PS+KQ+
Sbjct  282  FGQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRMLNGMQLGGTTVRLSWGRSPSSKQA  340


 Score = 48.5 bits (114),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEMNGV C
Sbjct  200  YGFVRFSDESEQIRAMTEMNGVPC  223



>ref|XP_006401514.1| hypothetical protein EUTSA_v10013710mg [Eutrema salsugineum]
 gb|ESQ42967.1| hypothetical protein EUTSA_v10013710mg [Eutrema salsugineum]
Length=403

 Score =   148 bits (373),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 3/119 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQ-GDSDPNNTTIFVGGLDPNVSEELMRQV  636
             S+RPMRIGPAANK  + T Q   YQ +Q G  G+ DPNNTTIFVG LD +V+++ ++ V
Sbjct  233  CSTRPMRIGPAANKKPL-TMQPGMYQDTQGGNPGEVDPNNTTIFVGALDASVTDDELKSV  291

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            F  +GEL+HVKI   KRCGFVQ+SNR SAEHALS L G QLG Q++RLSWGR+P NKQS
Sbjct  292  FGRFGELIHVKIPPGKRCGFVQYSNRASAEHALSMLNGTQLGGQSIRLSWGRSP-NKQS  349


 Score = 48.5 bits (114),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAMTEMNG  C
Sbjct  210  YGFVRFGDESEQMRAMTEMNGQFC  233



>ref|XP_008365193.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Malus domestica]
Length=408

 Score =   158 bits (399),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 76/120 (63%), Positives = 95/120 (79%), Gaps = 3/120 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVN---TQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
             S+RPMRIGPAA K   +     QKA+Y S+Q   G++DPNNTTIFVGGLDP+V+++++R
Sbjct  228  CSTRPMRIGPAATKKPASGGQQYQKASYPSTQGNPGEADPNNTTIFVGGLDPSVNDDMLR  287

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            QVFS +GELVHVKI   KRCGFVQF+NR  AE AL SL G QLG Q++RLSWGR+P++KQ
Sbjct  288  QVFSQFGELVHVKIPVGKRCGFVQFANRSCAEQALGSLNGTQLGGQSIRLSWGRSPTSKQ  347



>ref|XP_010493089.1| PREDICTED: polyadenylate-binding protein RBP45B-like [Camelina 
sativa]
Length=406

 Score =   147 bits (372),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 91/119 (76%), Gaps = 2/119 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAG-QGDSDPNNTTIFVGGLDPNVSEELMRQV  636
             S+RPMRIGPAA+K  V T Q+ +YQS  A    D+DPNNTT+FVGGLDP+V+++ ++ V
Sbjct  223  CSTRPMRIGPAASKKGV-TGQRDSYQSGAAVVPTDNDPNNTTVFVGGLDPSVTDDHLKNV  281

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            FS YGE+VHVKI A KRCGFVQFS +  AE AL  L G QLG   VRLSWGR+PSNKQ+
Sbjct  282  FSQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRMLNGVQLGGTTVRLSWGRSPSNKQA  340


 Score = 48.5 bits (114),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEMNGV C
Sbjct  200  YGFVRFSDESEQIRAMTEMNGVPC  223



>ref|XP_002864364.1| hypothetical protein ARALYDRAFT_495572 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40623.1| hypothetical protein ARALYDRAFT_495572 [Arabidopsis lyrata subsp. 
lyrata]
Length=398

 Score =   157 bits (398),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 98/124 (79%), Gaps = 4/124 (3%)
 Frame = -3

Query  818  WCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQ-GDSDPNNTTIFVGGLDPNVSEELMR  642
            +C S+RPMRIGPAANKN +   Q A YQ++Q G  GDSDPNNTTIFVGGLD NV+++ ++
Sbjct  224  YC-STRPMRIGPAANKNAL-PMQPAMYQNTQGGNAGDSDPNNTTIFVGGLDANVTDDELK  281

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
             +F  +GEL+HVKI   KRCGFVQ++NR +AEHALS L G QLG Q++RLSWGR+P NKQ
Sbjct  282  SIFGQFGELLHVKIPPGKRCGFVQYANRATAEHALSVLNGTQLGGQSIRLSWGRSP-NKQ  340

Query  461  SDQT  450
             DQ 
Sbjct  341  PDQA  344



>ref|XP_006343293.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
tuberosum]
Length=411

 Score =   152 bits (384),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIG AANK  V  Q +A+YQS+   Q + DP+NTTIFVG LD NV+++ +RQVF
Sbjct  238  CSTRPMRIGHAANKKSVPGQVQASYQSTNGTQNEDDPSNTTIFVGNLDANVTDDHLRQVF  297

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSDQ  453
              YG+L+HVKI   KRCGFVQF++R  AE AL +L G QLG Q +RLSWGR+PSNKQ  Q
Sbjct  298  GNYGQLLHVKIPVGKRCGFVQFADRSCAEEALRALSGTQLGGQTIRLSWGRSPSNKQQPQ  357


 Score = 43.9 bits (102),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV+F DES+QL AMTEMNG  C
Sbjct  215  YGFVKFADESEQLHAMTEMNGKFC  238



>gb|KFK43438.1| hypothetical protein AALP_AA1G125300 [Arabis alpina]
Length=403

 Score =   147 bits (372),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 73/119 (61%), Positives = 90/119 (76%), Gaps = 2/119 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAG-QGDSDPNNTTIFVGGLDPNVSEELMRQV  636
             S+RPMRIGPAANK  V   Q+ +YQS+ +G   D+DPNNTT+F+GGLDP V+E+ ++ V
Sbjct  222  CSTRPMRIGPAANKKGV-PGQRDSYQSTGSGVPTDNDPNNTTVFIGGLDPTVTEDHLKNV  280

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            F  YGE+VHVKI A KRCGFVQFS +  AE AL  L G QLG   VRLSWGR+P+NKQ+
Sbjct  281  FGQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRMLNGMQLGGTTVRLSWGRSPANKQA  339


 Score = 48.5 bits (114),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEMNGV C
Sbjct  199  YGFVRFSDESEQIRAMTEMNGVPC  222



>gb|ABR18422.1| unknown [Picea sitchensis]
Length=418

 Score =   149 bits (376),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 111/179 (62%), Gaps = 13/179 (7%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ-----KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
             SSRPMR GPA  K     QQ      A     Q    D+DPNNTTIFVGGLDP+V++E+
Sbjct  239  CSSRPMRTGPATTKKTTGFQQPYPKAAAAAVPPQVVASDNDPNNTTIFVGGLDPSVTDEM  298

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            +RQ+F  +GELVHVKI   KRCGFVQF+NR SAE AL  L G  LG+Q +RLSWGR+P+N
Sbjct  299  LRQLFGQFGELVHVKIPVGKRCGFVQFNNRASAEEALQMLHGTVLGQQAIRLSWGRSPAN  358

Query  467  KQSD--------QTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQQ  315
            KQ          Q       G +YYGY Q     YGYAP PQDPNMY  +   Y NYQQ
Sbjct  359  KQVQTPGWVQPQQPDPNQWNGAAYYGYGQGYDAGYGYAPQPQDPNMYSYAPYAYGNYQQ  417


 Score = 47.0 bits (110),  Expect(2) = 5e-41, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE++Q+RAMTEMNG+ C
Sbjct  216  YGFVRFGDENEQVRAMTEMNGMFC  239



>dbj|BAB08769.1| unnamed protein product [Arabidopsis thaliana]
Length=390

 Score =   156 bits (395),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 99/123 (80%), Gaps = 4/123 (3%)
 Frame = -3

Query  818  WCASSRPMRIGPAANKNLVNTQQKATYQSSQ-AGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            +C S+RPMRIGPAANKN +   Q A YQ++Q A  GD+DPNNTTIFVGGLD NV+++ ++
Sbjct  220  YC-STRPMRIGPAANKNAL-PMQPAMYQNTQGANAGDNDPNNTTIFVGGLDANVTDDELK  277

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
             +F  +GEL+HVKI   KRCGFVQ++N+ SAEHALS L G QLG Q++RLSWGR+P NKQ
Sbjct  278  SIFGQFGELLHVKIPPGKRCGFVQYANKASAEHALSVLNGTQLGGQSIRLSWGRSP-NKQ  336

Query  461  SDQ  453
            SDQ
Sbjct  337  SDQ  339



>ref|NP_568815.1| RNA-binding protein 45A [Arabidopsis thaliana]
 sp|Q9FPJ8.1|RB45A_ARATH RecName: Full=Polyadenylate-binding protein RBP45A; Short=Poly(A)-binding 
protein RBP45A; AltName: Full=RNA-binding protein 
45A; Short=AtRBP45A [Arabidopsis thaliana]
 gb|AAG40335.1|AF324983_1 AT5g54900 [Arabidopsis thaliana]
 gb|ABL66801.1| At5g54900 [Arabidopsis thaliana]
 gb|AED96554.1| RNA-binding protein 45A [Arabidopsis thaliana]
Length=387

 Score =   156 bits (395),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 99/124 (80%), Gaps = 4/124 (3%)
 Frame = -3

Query  818  WCASSRPMRIGPAANKNLVNTQQKATYQSSQ-AGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            +C S+RPMRIGPAANKN +   Q A YQ++Q A  GD+DPNNTTIFVGGLD NV+++ ++
Sbjct  220  YC-STRPMRIGPAANKNAL-PMQPAMYQNTQGANAGDNDPNNTTIFVGGLDANVTDDELK  277

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
             +F  +GEL+HVKI   KRCGFVQ++N+ SAEHALS L G QLG Q++RLSWGR+P NKQ
Sbjct  278  SIFGQFGELLHVKIPPGKRCGFVQYANKASAEHALSVLNGTQLGGQSIRLSWGRSP-NKQ  336

Query  461  SDQT  450
            SDQ 
Sbjct  337  SDQA  340



>ref|XP_002889883.1| ATRBP45B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66142.1| ATRBP45B [Arabidopsis lyrata subsp. lyrata]
Length=408

 Score =   146 bits (368),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 90/119 (76%), Gaps = 2/119 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAG-QGDSDPNNTTIFVGGLDPNVSEELMRQV  636
             S+RPMRIGPAA+K  V T Q+ +YQS+  G   D+DPNNTT+FVGGLD +V+++ ++ V
Sbjct  224  CSTRPMRIGPAASKKGV-TGQRDSYQSAAGGVPTDNDPNNTTVFVGGLDQSVTDDHLKNV  282

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            F  YGE+VHVKI A KRCGFVQFS +  AE AL  L G QLG   VRLSWGR+PSNKQS
Sbjct  283  FGQYGEIVHVKIPAGKRCGFVQFSEKSCAEEALRMLNGVQLGGTTVRLSWGRSPSNKQS  341


 Score = 48.5 bits (114),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEMNGV C
Sbjct  201  YGFVRFSDESEQIRAMTEMNGVPC  224



>ref|XP_007026047.1| RNA-binding family protein [Theobroma cacao]
 gb|EOY28669.1| RNA-binding family protein [Theobroma cacao]
Length=421

 Score =   149 bits (376),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 92/122 (75%), Gaps = 6/122 (5%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQ--KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEEL  648
            V+C S+RPMR GPA NK  +  QQ  KA   SSQ  Q ++DPNNTTIFVG LD NV+++ 
Sbjct  247  VFC-STRPMRTGPATNKKTITAQQYPKA---SSQGAQNENDPNNTTIFVGNLDSNVTDDH  302

Query  647  MRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSN  468
            +R+VFSPYG+LVHVKI   KRCGFVQF++R  AE AL  L G QLG Q++RLSWGR+ SN
Sbjct  303  LREVFSPYGQLVHVKIPQNKRCGFVQFADRSCAEEALRMLNGTQLGGQSIRLSWGRSTSN  362

Query  467  KQ  462
            KQ
Sbjct  363  KQ  364


 Score = 45.1 bits (105),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE++  RAMTEMNGV C
Sbjct  226  YGFVRFGDEAEHNRAMTEMNGVFC  249


 Score = 50.8 bits (120),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 48/89 (54%), Gaps = 8/89 (9%)
 Frame = -3

Query  692  TIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRC------GFVQFSNRPSAEHALSS  531
            T+++G L   + E  +   F+  GE+V VK++  K+       GF++F +R +AE  L +
Sbjct  91   TLWIGDLQYYMDENYLLGCFAQTGEVVSVKVIRNKQTGQVEGYGFIEFVSRGAAERVLQT  150

Query  530  LQGAQL--GEQNVRLSWGRNPSNKQSDQT  450
              G  +  GE N RL+W    S ++ D+T
Sbjct  151  YNGTPMPNGENNYRLNWASFSSGERRDET  179



>gb|ABK25253.1| unknown [Picea sitchensis]
Length=487

 Score =   147 bits (370),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 105/166 (63%), Gaps = 12/166 (7%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQ----KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELM  645
             SSRPMR GPA  K     QQ     A     Q    D+DPNNTTIFVGGLDP+V++E++
Sbjct  239  CSSRPMRTGPATTKKTTGFQQPYPKAAAAVPPQVVASDNDPNNTTIFVGGLDPSVTDEML  298

Query  644  RQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNK  465
            RQ+F  +GELVHVKI   KRCGFVQF+NR SAE AL  L G  LG+Q +RLSWGR+P+NK
Sbjct  299  RQLFGQFGELVHVKIPVGKRCGFVQFNNRASAEEALQMLHGTVLGQQAIRLSWGRSPANK  358

Query  464  QSD--------QTqwgggvggsyygyaqqgydaygyAPPPQDPNMY  351
            Q          Q       G +YYGY Q     YGYAP PQDPNMY
Sbjct  359  QVQTPGWVQPQQPDPNQWNGAAYYGYGQGYDAGYGYAPQPQDPNMY  404


 Score = 46.6 bits (109),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 23/24 (96%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE++Q+RAMTEMNG+ C
Sbjct  216  YGFVRFGDENEQVRAMTEMNGMFC  239



>ref|XP_004957865.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X2 [Setaria italica]
Length=497

 Score =   152 bits (384),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = -3

Query  809  SSRPMRIGPAANKNLVNTQQ----KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            S+R MRIGPAANK  ++ QQ       YQSSQ    ++DPNNTT+FVGGLD NV+EE +R
Sbjct  284  STRQMRIGPAANKKNMDAQQTYATNGAYQSSQGNLSENDPNNTTVFVGGLDSNVNEEYLR  343

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            Q F+PYGE+ +VKI   KRCGFVQF++R SAE A+  L G+ +G QNVRLSWGR+P NKQ
Sbjct  344  QTFTPYGEIAYVKIPVGKRCGFVQFTSRSSAEEAIRMLNGSLIGGQNVRLSWGRSPQNKQ  403

Query  461  SDQ  453
            + Q
Sbjct  404  APQ  406


 Score = 40.0 bits (92),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVV  814
            YGFVRFGD ++Q RAMTEMNG++
Sbjct  260  YGFVRFGDLNEQARAMTEMNGMM  282



>emb|CBI19566.3| unnamed protein product [Vitis vinifera]
Length=324

 Score =   149 bits (375),  Expect(2) = 7e-40, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 104/177 (59%), Gaps = 11/177 (6%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQG-----DSDPNNTTIFVGGLDPNVS  657
            V+C SSRPMRIG A  +     QQ+ +     A  G     D D  NTTIFVGGLDPNVS
Sbjct  148  VYC-SSRPMRIGAATPRKSSGYQQQYSSHGGYASNGASVQSDGDSMNTTIFVGGLDPNVS  206

Query  656  EELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRN  477
            +E +RQ FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLSWGRN
Sbjct  207  DEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEDALQKLNGTVIGKQTVRLSWGRN  266

Query  476  PSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQQ  315
            P+NKQ       G      Y   Q         PPP DP MY   YG+YP Y N+QQ
Sbjct  267  PANKQ--MRADFGNQWSGAYYGGQVYDGYGYALPPPHDPTMYAAAYGAYPVYGNHQQ  321


 Score = 43.5 bits (101),  Expect(2) = 7e-40, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE+++ +AMTEMNGV C
Sbjct  127  YGFVRFGDENERSQAMTEMNGVYC  150



>ref|XP_004957864.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X1 [Setaria italica]
Length=517

 Score =   152 bits (383),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 92/123 (75%), Gaps = 4/123 (3%)
 Frame = -3

Query  809  SSRPMRIGPAANKNLVNTQQ----KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            S+R MRIGPAANK  ++ QQ       YQSSQ    ++DPNNTT+FVGGLD NV+EE +R
Sbjct  284  STRQMRIGPAANKKNMDAQQTYATNGAYQSSQGNLSENDPNNTTVFVGGLDSNVNEEYLR  343

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            Q F+PYGE+ +VKI   KRCGFVQF++R SAE A+  L G+ +G QNVRLSWGR+P NKQ
Sbjct  344  QTFTPYGEIAYVKIPVGKRCGFVQFTSRSSAEEAIRMLNGSLIGGQNVRLSWGRSPQNKQ  403

Query  461  SDQ  453
            + Q
Sbjct  404  APQ  406


 Score = 40.0 bits (92),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVV  814
            YGFVRFGD ++Q RAMTEMNG++
Sbjct  260  YGFVRFGDLNEQARAMTEMNGMM  282



>ref|XP_003634360.1| PREDICTED: polyadenylate-binding protein RBP47-like [Vitis vinifera]
Length=418

 Score =   148 bits (373),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 104/177 (59%), Gaps = 11/177 (6%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQG-----DSDPNNTTIFVGGLDPNVS  657
            V+C SSRPMRIG A  +     QQ+ +     A  G     D D  NTTIFVGGLDPNVS
Sbjct  242  VYC-SSRPMRIGAATPRKSSGYQQQYSSHGGYASNGASVQSDGDSMNTTIFVGGLDPNVS  300

Query  656  EELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRN  477
            +E +RQ FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLSWGRN
Sbjct  301  DEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEDALQKLNGTVIGKQTVRLSWGRN  360

Query  476  PSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQQ  315
            P+NKQ       G      Y   Q         PPP DP MY   YG+YP Y N+QQ
Sbjct  361  PANKQ--MRADFGNQWSGAYYGGQVYDGYGYALPPPHDPTMYAAAYGAYPVYGNHQQ  415


 Score = 43.9 bits (102),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE+++ +AMTEMNGV C
Sbjct  221  YGFVRFGDENERSQAMTEMNGVYC  244



>emb|CAN81343.1| hypothetical protein VITISV_008697 [Vitis vinifera]
Length=536

 Score =   147 bits (372),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 90/180 (50%), Positives = 106/180 (59%), Gaps = 12/180 (7%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQG-----DSDPNNTTIFVGGLDPNVS  657
            V+C SSRPMRIG A  +     QQ+ +     A  G     D D  NTTIFVGGLDPNVS
Sbjct  130  VYC-SSRPMRIGAATPRKSSGYQQQYSSHGGYASNGASVQSDGDSMNTTIFVGGLDPNVS  188

Query  656  EELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRN  477
            +E +RQ FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLSWGRN
Sbjct  189  DEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEDALQKLNGTVIGKQTVRLSWGRN  248

Query  476  PSNKQSDQTqwgggvg---gsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQQ  315
            P+NKQ++        G      Y   Q         PPP DP MY   YG+YP Y N+QQ
Sbjct  249  PANKQANSLFMRADFGNQWSGAYYGGQVYDGYGYALPPPHDPTMYAAAYGAYPVYGNHQQ  308


 Score = 43.5 bits (101),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE+++ +AMTEMNGV C
Sbjct  109  YGFVRFGDENERSQAMTEMNGVYC  132



>ref|XP_011013053.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=427

 Score =   148 bits (373),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 105/176 (60%), Gaps = 10/176 (6%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATY----QSSQAGQGDSDPNNTTIFVGGLDPNVSE  654
            ++C SSRPMRIG A  +     QQ+  Y     SSQ  Q D D +N TIFVGGLDPNV++
Sbjct  252  IYC-SSRPMRIGAATPRKSSGYQQQGGYGSNGASSQGFQSDGDSSNATIFVGGLDPNVTD  310

Query  653  ELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNP  474
            E ++Q FS YGE+V VKI  +K CGFVQF+NR +AE AL  L G  +G+Q VRLSWGRNP
Sbjct  311  EDLKQPFSQYGEIVSVKIPVSKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSWGRNP  370

Query  473  SNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQQ  315
             NKQ              Y   Q         PPP DP+ Y   YG+YP Y N+QQ
Sbjct  371  GNKQ--HRADFSSPWNGAYYGGQVYDGYGYALPPPHDPSTYAAAYGAYPMYGNHQQ  424


 Score = 43.1 bits (100),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGD++++ +AMTEMNG+ C
Sbjct  231  YGFVRFGDDTERTQAMTEMNGIYC  254



>gb|KJB69303.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=419

 Score =   147 bits (372),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/118 (63%), Positives = 88/118 (75%), Gaps = 1/118 (1%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPA NK     QQ     SSQ  Q ++DPNNTTIFVG LD NV+E+ +R+VF
Sbjct  249  CSTRPMRIGPATNKKTGAAQQYPA-ASSQGTQNENDPNNTTIFVGNLDSNVTEDHLREVF  307

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            SPYG+LVHVKI   KRCGFVQF++R  AE AL  L G QLG Q++RLSWGR+ SNKQ+
Sbjct  308  SPYGQLVHVKIPQNKRCGFVQFADRSCAEEALRILNGTQLGGQSIRLSWGRSTSNKQA  365


 Score = 43.1 bits (100),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE++  RAMTEMNG  C
Sbjct  226  YGFVRFGDETEYNRAMTEMNGAFC  249


 Score = 50.8 bits (120),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 50/100 (50%), Gaps = 8/100 (8%)
 Frame = -3

Query  725  AGQGDSDPNNTTIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRC------GFVQFS  564
            AGQ  +     T+++G L   + E  +   F+  GE+  VK++  K+       GF++F 
Sbjct  80   AGQPANADEVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFV  139

Query  563  NRPSAEHALSSLQGAQL--GEQNVRLSWGRNPSNKQSDQT  450
            +R +AE  L +  G  +  GE N RL+W    S  + D+T
Sbjct  140  SRAAAERVLQTYNGTPMPNGESNYRLNWASFSSGDRRDET  179



>ref|XP_006658612.1| PREDICTED: polyadenylate-binding protein RBP45-like [Oryza brachyantha]
Length=461

 Score =   148 bits (374),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = -3

Query  809  SSRPMRIGPAANKNLVNTQQKAT---YQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQ  639
            S+R MR+GPAANK  + TQQ  +   YQSSQ    +SDPNNTTIFVGGLD NV+E+ ++Q
Sbjct  269  STRQMRLGPAANKKNMGTQQTYSTNGYQSSQGNDSESDPNNTTIFVGGLDSNVNEDHLKQ  328

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPS-NKQ  462
            VF+PYGE+ +VKI   KRCGFVQF++R SAE A+  L G+Q+G Q VRLSWGR P  NKQ
Sbjct  329  VFAPYGEIGYVKIPVGKRCGFVQFTSRSSAEEAIRVLNGSQIGGQQVRLSWGRTPHQNKQ  388

Query  461  SDQ  453
            + Q
Sbjct  389  APQ  391


 Score = 42.0 bits (97),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE++Q RAMT+MNG + 
Sbjct  245  YGFVRFGDENEQTRAMTDMNGTML  268



>gb|KJB59840.1| hypothetical protein B456_009G275200 [Gossypium raimondii]
 gb|KJB59841.1| hypothetical protein B456_009G275200 [Gossypium raimondii]
Length=419

 Score =   148 bits (373),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 107/177 (60%), Gaps = 11/177 (6%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQG-----DSDPNNTTIFVGGLDPNVS  657
            V+C SSRPMRIG A  +     QQ+ + Q   A  G     D D +NTTIFVGGLDPNV+
Sbjct  243  VYC-SSRPMRIGAATPRKSSGYQQQYSLQGGYASNGNSTQSDGDSSNTTIFVGGLDPNVT  301

Query  656  EELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRN  477
            EE +RQ FS YGE+V VKI   K CGFVQ++NR +AE AL  L G  +G+Q VRLSWGRN
Sbjct  302  EEDLRQSFSQYGEIVSVKIPVGKGCGFVQYANRKNAEEALQKLNGMVIGKQTVRLSWGRN  361

Query  476  PSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQQ  315
            P+NKQ       G   G  Y   Q         PPP DP MY   YG+YP Y ++QQ
Sbjct  362  PANKQF--RGDYGNQWGGAYYGGQVYDGYRYAVPPPHDPGMYAAAYGTYPIYGSHQQ  416


 Score = 42.4 bits (98),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE+++ +AM EMNGV C
Sbjct  222  YGFVRFGDETERSQAMNEMNGVYC  245



>gb|KJB69301.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=427

 Score =   147 bits (371),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/117 (63%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMRQVF  633
             S+RPMRIGPA NK     QQ     SSQ  Q ++DPNNTTIFVG LD NV+E+ +R+VF
Sbjct  249  CSTRPMRIGPATNKKTGAAQQYPA-ASSQGTQNENDPNNTTIFVGNLDSNVTEDHLREVF  307

Query  632  SPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            SPYG+LVHVKI   KRCGFVQF++R  AE AL  L G QLG Q++RLSWGR+ SNKQ
Sbjct  308  SPYGQLVHVKIPQNKRCGFVQFADRSCAEEALRILNGTQLGGQSIRLSWGRSTSNKQ  364


 Score = 43.1 bits (100),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE++  RAMTEMNG  C
Sbjct  226  YGFVRFGDETEYNRAMTEMNGAFC  249


 Score = 50.8 bits (120),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 50/100 (50%), Gaps = 8/100 (8%)
 Frame = -3

Query  725  AGQGDSDPNNTTIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRC------GFVQFS  564
            AGQ  +     T+++G L   + E  +   F+  GE+  VK++  K+       GF++F 
Sbjct  80   AGQPANADEVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFV  139

Query  563  NRPSAEHALSSLQGAQL--GEQNVRLSWGRNPSNKQSDQT  450
            +R +AE  L +  G  +  GE N RL+W    S  + D+T
Sbjct  140  SRAAAERVLQTYNGTPMPNGESNYRLNWASFSSGDRRDET  179



>ref|XP_011017227.1| PREDICTED: polyadenylate-binding protein RBP47-like [Populus 
euphratica]
Length=427

 Score =   147 bits (371),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 105/176 (60%), Gaps = 10/176 (6%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATY----QSSQAGQGDSDPNNTTIFVGGLDPNVSE  654
            ++C SSRPMRIG A  +     QQ+  Y     SSQ  Q D D +N TIFVGGLDPNV++
Sbjct  252  IYC-SSRPMRIGAATPRKSSGYQQQGGYGSNGASSQGFQSDGDSSNATIFVGGLDPNVND  310

Query  653  ELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNP  474
            E ++Q FS YGE+V VKI  +K CGFVQF+NR +AE AL  L G  +G+Q VRLSWGRNP
Sbjct  311  EDLKQPFSQYGEIVSVKIPVSKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSWGRNP  370

Query  473  SNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQQ  315
             NKQ              Y   Q         PPP DP+ Y   YG+YP Y N+QQ
Sbjct  371  GNKQ--HRADFSSPWNGAYYGGQVYDGYGYALPPPHDPSTYAAAYGAYPMYGNHQQ  424


 Score = 43.1 bits (100),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGD++++ +AMTEMNG+ C
Sbjct  231  YGFVRFGDDTERTQAMTEMNGIYC  254



>gb|KFK27101.1| hypothetical protein AALP_AA8G334500 [Arabis alpina]
Length=405

 Score =   145 bits (366),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 91/122 (75%), Gaps = 3/122 (2%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQ-GDSDPNNTTIFVGGLDPNVSEELMRQV  636
             S+RPMRIGPAANK  + T Q A YQ  Q G  G+SDPNNTTIFVG LD +V+++ ++  
Sbjct  234  CSTRPMRIGPAANKKPL-TMQPAMYQDPQGGNPGESDPNNTTIFVGALDASVTDDELKSQ  292

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD  456
            F  +GEL+HVKI   KRCGFVQ++NR  AEHALS L G QLG Q++RLSWGR+P NKQ +
Sbjct  293  FGQFGELIHVKIPPGKRCGFVQYANRACAEHALSVLNGTQLGGQSIRLSWGRSP-NKQPE  351

Query  455  QT  450
            Q 
Sbjct  352  QA  353


 Score = 45.1 bits (105),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DE++Q+RAMTEMNG  C
Sbjct  211  YGFVRFADENEQMRAMTEMNGQYC  234


 Score = 52.0 bits (123),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 46/83 (55%), Gaps = 8/83 (10%)
 Frame = -3

Query  710  SDPNNTTIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRC------GFVQFSNRPSA  549
            SD    ++++G L P + E  +  +F+  GE+  VK++  K+       GF++F+N  +A
Sbjct  69   SDGEIRSLWIGDLQPWMDENYLNSIFAQSGEVQSVKVIRNKQSGQTEGYGFIEFANHAAA  128

Query  548  EHALSSLQGAQL--GEQNVRLSW  486
            E  L S  G  +  G+QN RL+W
Sbjct  129  ERFLQSYNGTPMPSGDQNFRLNW  151



>ref|XP_002302445.2| RNA-binding protein 47 [Populus trichocarpa]
 gb|EEE81718.2| RNA-binding protein 47 [Populus trichocarpa]
Length=429

 Score =   147 bits (370),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 105/176 (60%), Gaps = 10/176 (6%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATY----QSSQAGQGDSDPNNTTIFVGGLDPNVSE  654
            V+C SSRPMRIG A  +     QQ+  Y     SSQ  Q D D +N TIFVGGLDPNV++
Sbjct  254  VYC-SSRPMRIGAATPRKSSGYQQQGGYGSNGASSQGFQSDGDSSNATIFVGGLDPNVTD  312

Query  653  ELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNP  474
            E ++Q FS YGE+V VKI  +K CGFVQF+NR +AE AL  L G  +G+Q VRLSWGRNP
Sbjct  313  EDLKQPFSQYGEIVSVKIPVSKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSWGRNP  372

Query  473  SNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQQ  315
             +KQ              Y   Q         PPP DP+ Y   YG+YP Y N+QQ
Sbjct  373  GHKQ--HRADFSSPWNGAYYGGQVYDGYGYALPPPHDPSTYAAAYGAYPMYGNHQQ  426


 Score = 43.1 bits (100),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGD++++ +AMTEMNGV C
Sbjct  233  YGFVRFGDDTERTQAMTEMNGVYC  256



>gb|KFK27100.1| hypothetical protein AALP_AA8G334500 [Arabis alpina]
Length=407

 Score =   145 bits (365),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 90/119 (76%), Gaps = 3/119 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQ-GDSDPNNTTIFVGGLDPNVSEELMRQV  636
             S+RPMRIGPAANK  + T Q A YQ  Q G  G+SDPNNTTIFVG LD +V+++ ++  
Sbjct  234  CSTRPMRIGPAANKKPL-TMQPAMYQDPQGGNPGESDPNNTTIFVGALDASVTDDELKSQ  292

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            F  +GEL+HVKI   KRCGFVQ++NR  AEHALS L G QLG Q++RLSWGR+P NKQS
Sbjct  293  FGQFGELIHVKIPPGKRCGFVQYANRACAEHALSVLNGTQLGGQSIRLSWGRSP-NKQS  350


 Score = 45.1 bits (105),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DE++Q+RAMTEMNG  C
Sbjct  211  YGFVRFADENEQMRAMTEMNGQYC  234


 Score = 52.4 bits (124),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 46/83 (55%), Gaps = 8/83 (10%)
 Frame = -3

Query  710  SDPNNTTIFVGGLDPNVSEELMRQVFSPYGELVHVKIVAAKRC------GFVQFSNRPSA  549
            SD    ++++G L P + E  +  +F+  GE+  VK++  K+       GF++F+N  +A
Sbjct  69   SDGEIRSLWIGDLQPWMDENYLNSIFAQSGEVQSVKVIRNKQSGQTEGYGFIEFANHAAA  128

Query  548  EHALSSLQGAQL--GEQNVRLSW  486
            E  L S  G  +  G+QN RL+W
Sbjct  129  ERFLQSYNGTPMPSGDQNFRLNW  151



>ref|XP_002510266.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF52453.1| nuclear acid binding protein, putative [Ricinus communis]
Length=443

 Score =   146 bits (368),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 88/176 (50%), Positives = 108/176 (61%), Gaps = 9/176 (5%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATY----QSSQAGQGDSDPNNTTIFVGGLDPNVSE  654
            V+C SSR MRIG A  +     Q +  Y     S QA Q D D  NTTIFVGGLDPNV++
Sbjct  267  VYC-SSRAMRIGAATPRKSTGYQHQGGYVSNGASGQAFQADGDSTNTTIFVGGLDPNVTD  325

Query  653  ELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNP  474
            E ++Q FS YGE+V VKI   K CGFVQF++R +AE AL  L G  +G+Q VRLSWGRNP
Sbjct  326  EDLKQPFSQYGEIVSVKIPVGKGCGFVQFASRSNAEEALQKLNGTVIGKQTVRLSWGRNP  385

Query  473  SNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQQ  315
            +NKQ  ++   G   G  Y   Q         PPP DP+MY   YG+YP Y ++QQ
Sbjct  386  ANKQQLRS-DFGNQWGGAYYGGQIYDGYGYALPPPHDPSMYAAPYGAYPVYGSHQQ  440


 Score = 42.7 bits (99),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGD++++ +AMTEMNGV C
Sbjct  246  YGFVRFGDDNERTQAMTEMNGVYC  269



>gb|EMS56663.1| Uncharacterized RNA-binding protein C23E6.01c [Triticum urartu]
Length=459

 Score =   147 bits (372),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 94/168 (56%), Positives = 114/168 (68%), Gaps = 6/168 (4%)
 Frame = -3

Query  809  SSRPMRIGPAANKNLVNTQQ----KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            S+R MRIGPAANK  + TQQ     A YQSSQ  +  +DPNNTTIFVGGLD N+ E  +R
Sbjct  264  STRQMRIGPAANKKNIGTQQTYSTNAGYQSSQVNEAANDPNNTTIFVGGLDSNIDENYLR  323

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            QVF+PYGE+ +VKI   KRCGFVQF++R  AE A+S+L G+Q+G  NVRLSWGR+  NKQ
Sbjct  324  QVFTPYGEVGYVKIPVGKRCGFVQFTSRVCAEQAISALNGSQIGSSNVRLSWGRS-QNKQ  382

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQ  318
              Q Q      G+ Y   QQG DAY  AP  QDP+M    Y GY +Y+
Sbjct  383  PPQ-QDANQGNGNSYYGYQQGPDAYYGAPNAQDPSMQNYGYSGYGSYE  429


 Score = 41.2 bits (95),  Expect(2) = 7e-39, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 20/22 (91%), Gaps = 0/22 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGV  817
            YGFVRFGD ++Q RAMTEMNGV
Sbjct  240  YGFVRFGDLNEQTRAMTEMNGV  261



>ref|XP_009120017.1| PREDICTED: polyadenylate-binding protein RBP45A [Brassica rapa]
Length=396

 Score =   142 bits (358),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 90/120 (75%), Gaps = 4/120 (3%)
 Frame = -3

Query  818  WCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQ--GDSDPNNTTIFVGGLDPNVSEELM  645
            +C SSRPMR+GPAANK  +   Q   YQ +Q G   G+SDP+NTTIFVG LD +V++E +
Sbjct  223  YC-SSRPMRLGPAANKKPL-AMQPGMYQDTQGGGNPGESDPSNTTIFVGALDASVTDEEL  280

Query  644  RQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNK  465
            R VF  +GEL HVKI   KRCGFVQ++ R SAEHAL +L G QLG Q++RLSWGR+P+N+
Sbjct  281  RAVFGQFGELTHVKIPPGKRCGFVQYATRASAEHALLNLNGTQLGGQSIRLSWGRSPNNQ  340


 Score = 45.8 bits (107),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAM EMNG  C
Sbjct  201  YGFVRFGDESEQMRAMGEMNGQYC  224



>emb|CDY17286.1| BnaA10g09200D [Brassica napus]
Length=405

 Score =   142 bits (357),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 90/120 (75%), Gaps = 4/120 (3%)
 Frame = -3

Query  818  WCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQ--GDSDPNNTTIFVGGLDPNVSEELM  645
            +C SSRPMR+GPAANK  +   Q   YQ +Q G   G+SDP+NTTIFVG LD +V++E +
Sbjct  223  YC-SSRPMRLGPAANKKPL-AMQPGMYQDTQGGGNPGESDPSNTTIFVGALDASVTDEEL  280

Query  644  RQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNK  465
            R VF  +GEL HVKI   KRCGFVQ++ R SAEHAL +L G QLG Q++RLSWGR+P+N+
Sbjct  281  RAVFGQFGELTHVKIPPGKRCGFVQYATRASAEHALLNLNGTQLGGQSIRLSWGRSPNNQ  340


 Score = 45.8 bits (107),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAM EMNG  C
Sbjct  201  YGFVRFGDESEQMRAMGEMNGQYC  224



>emb|CDY34639.1| BnaC08g41980D [Brassica napus]
Length=507

 Score =   140 bits (352),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 99/156 (63%), Gaps = 9/156 (6%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQ-GDSDPNNTTIFVGGLDPNVSEELMRQV  636
             SSRPMRIGPAA+K  V + Q+ +YQS+  G   D+DPNNTT+FVGGLDP ++++ ++ V
Sbjct  329  CSSRPMRIGPAASKKGV-SGQRDSYQSAALGVPTDNDPNNTTVFVGGLDPTITDDHLKNV  387

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD  456
            FS YGE+VHVKI A KRCGFVQFS +  AE A+  L G QLG   VRLSWGR+PS+KQ+ 
Sbjct  388  FSQYGEIVHVKIPAGKRCGFVQFSEKSCAEEAIRMLNGTQLGGTTVRLSWGRSPSSKQAA  447

Query  455  QTqwgggvggsyygyaqqgydaygyAPPPQDPNMYY  348
                    G                   PQDPN YY
Sbjct  448  DPSQYYYGGYGQGQEHYGYSM-------PQDPNAYY  476


 Score = 47.4 bits (111),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAM+EMNGV C
Sbjct  306  YGFVRFSDESEQIRAMSEMNGVPC  329



>emb|CDY19874.1| BnaC09g31400D [Brassica napus]
Length=419

 Score =   141 bits (355),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 88/118 (75%), Gaps = 3/118 (3%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQ--GDSDPNNTTIFVGGLDPNVSEELMRQ  639
             SSRPMR+GPAANK  + T     YQ +Q G   G+SDP+NTTIFVG LD +V++E +R 
Sbjct  231  CSSRPMRLGPAANKKPL-TMLPGMYQDTQGGGNPGESDPSNTTIFVGALDASVTDEELRA  289

Query  638  VFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNK  465
            VF  +GEL HVKI   KRCGFVQ++ R SAEHAL +L G QLG Q++RLSWGR+P+N+
Sbjct  290  VFGQFGELTHVKIPPGKRCGFVQYATRASAEHALLNLNGTQLGGQSIRLSWGRSPNNQ  347


 Score = 45.8 bits (107),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDES+Q+RAM EMNG  C
Sbjct  208  YGFVRFGDESEQMRAMVEMNGQYC  231



>gb|ABK24911.1| unknown [Picea sitchensis]
Length=397

 Score =   141 bits (356),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 73/133 (55%), Positives = 92/133 (69%), Gaps = 13/133 (10%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKAT---------YQSSQAGQG---DSDPNNTTIFVG  678
            V+C S RPMRI  A  K  +  QQ  +         Y  + AGQG   D+DPNNTTIFVG
Sbjct  210  VYCCS-RPMRINEATPKKSLGLQQSYSMKGNYYTQAYGGAVAGQGFQSDNDPNNTTIFVG  268

Query  677  GLDPNVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNV  498
            GLDPN ++E +RQVF P+GE+V+VKI   K CGFVQF+NR SAE AL  L G  +G+Q++
Sbjct  269  GLDPNATDEDLRQVFGPFGEIVYVKIPVGKGCGFVQFTNRSSAEEALQKLHGTIIGQQSI  328

Query  497  RLSWGRNPSNKQS  459
            RLSWGR+P+NKQ+
Sbjct  329  RLSWGRSPANKQT  341


 Score = 45.4 bits (106),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE+++ RAMTEMNGV C
Sbjct  189  YGFVRFGDENEKNRAMTEMNGVYC  212



>emb|CDY34835.1| BnaA09g47610D [Brassica napus]
Length=393

 Score =   139 bits (349),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 100/156 (64%), Gaps = 9/156 (6%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQ-GDSDPNNTTIFVGGLDPNVSEELMRQV  636
             SSRPMRIGPAA+K    + Q+ +YQS+ +G   D+DPNNTT+FVGGLDP ++++ ++ V
Sbjct  219  CSSRPMRIGPAASKK-GESGQRDSYQSAASGVPTDNDPNNTTVFVGGLDPTITDDHLKNV  277

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD  456
            FS YGE+VHVKI A KRCGFVQFS +  AE A+ +L G QLG   VRLSWGR+PS+KQ+ 
Sbjct  278  FSQYGEIVHVKIPAGKRCGFVQFSEKSCAEEAIRNLNGMQLGGTTVRLSWGRSPSSKQAA  337

Query  455  QTqwgggvggsyygyaqqgydaygyAPPPQDPNMYY  348
                    G                   PQDPN YY
Sbjct  338  DPSQYYYGGYGQGQEHYGYSM-------PQDPNAYY  366


 Score = 47.8 bits (112),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 19/24 (79%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAM+EMNGV C
Sbjct  196  YGFVRFADESEQIRAMSEMNGVPC  219



>dbj|BAD33940.1| putative nucleic acid binding protein [Oryza sativa Japonica 
Group]
 dbj|BAD38554.1| putative nucleic acid binding protein [Oryza sativa Japonica 
Group]
Length=316

 Score =   143 bits (361),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 102/172 (59%), Gaps = 8/172 (5%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            V+C S+RPMRIGPA  +    T       +  A + D D  NTT+FVGGLDPNVSE+ +R
Sbjct  148  VYC-STRPMRIGPATPRKTSGTSGP----TGSAARSDGDLTNTTVFVGGLDPNVSEDDLR  202

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            Q FS YGE+  VKI   K+CGFVQF  R +AE AL  L G+ +G+Q VRLSWGRNP+NKQ
Sbjct  203  QTFSQYGEISSVKIPVGKQCGFVQFVQRKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQ  262

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQQ  315
                       G YY  +         AP P DP MY   YG+YP Y N QQ
Sbjct  263  LRSDNGSQWNNGMYYAASPFYSGYGYPAPFPADPGMYAAAYGAYPFYGNQQQ  314


 Score = 42.7 bits (99),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGD++++  AMTEMNGV C
Sbjct  127  YGFVRFGDDNEKTHAMTEMNGVYC  150



>gb|EEE69858.1| hypothetical protein OsJ_29658 [Oryza sativa Japonica Group]
Length=310

 Score =   143 bits (360),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 102/172 (59%), Gaps = 8/172 (5%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            V+C S+RPMRIGPA  +    T       +  A + D D  NTT+FVGGLDPNVSE+ +R
Sbjct  142  VYC-STRPMRIGPATPRKTSGTSGP----TGSAARSDGDLTNTTVFVGGLDPNVSEDDLR  196

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            Q FS YGE+  VKI   K+CGFVQF  R +AE AL  L G+ +G+Q VRLSWGRNP+NKQ
Sbjct  197  QTFSQYGEISSVKIPVGKQCGFVQFVQRKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQ  256

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQQ  315
                       G YY  +         AP P DP MY   YG+YP Y N QQ
Sbjct  257  LRSDNGSQWNNGMYYAASPFYSGYGYPAPFPADPGMYAAAYGAYPFYGNQQQ  308


 Score = 42.7 bits (99),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGD++++  AMTEMNGV C
Sbjct  121  YGFVRFGDDNEKTHAMTEMNGVYC  144



>gb|KJB58432.1| hypothetical protein B456_009G209600 [Gossypium raimondii]
Length=432

 Score =   144 bits (363),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 107/177 (60%), Gaps = 11/177 (6%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQ-----SSQAGQGDSDPNNTTIFVGGLDPNVS  657
            V+C SSRPMRIG A  +   + QQ+ + Q     +S + Q D D +NTTIFVGGLDPNV+
Sbjct  256  VYC-SSRPMRIGAATPRKSSSYQQQYSLQGGYASNSASSQSDGDSSNTTIFVGGLDPNVT  314

Query  656  EELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRN  477
            EE +RQ FS YGE+V VKI   K CGFVQF+ R +AE AL  L G  +G+Q VRLSWGRN
Sbjct  315  EEDLRQPFSQYGEIVSVKIPVGKGCGFVQFAGRNNAEEALQKLNGTIIGKQTVRLSWGRN  374

Query  476  PSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQQ  315
            P+NKQ       G   G  Y             PPP +P +Y   YG YP Y +YQQ
Sbjct  375  PTNKQF--RADYGNQWGGAYYGGAVYDGYGYAFPPPHNPGIYTAAYGVYPFYGSYQQ  429


 Score = 41.2 bits (95),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGD++++  AMTEMNGV C
Sbjct  235  YGFVRFGDDTERSLAMTEMNGVYC  258



>dbj|BAG87507.1| unnamed protein product [Oryza sativa Japonica Group]
Length=345

 Score =   143 bits (360),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 102/172 (59%), Gaps = 8/172 (5%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            V+C S+RPMRIGPA  +    T       +  A + D D  NTT+FVGGLDPNVSE+ +R
Sbjct  177  VYC-STRPMRIGPATPRKTSGTSGP----TGSAARSDGDLTNTTVFVGGLDPNVSEDDLR  231

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            Q FS YGE+  VKI   K+CGFVQF  R +AE AL  L G+ +G+Q VRLSWGRNP+NKQ
Sbjct  232  QTFSQYGEISSVKIPVGKQCGFVQFVQRKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQ  291

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQQ  315
                       G YY  +         AP P DP MY   YG+YP Y N QQ
Sbjct  292  LRSDNGSQWNNGMYYAASPFYSGYGYPAPFPADPGMYAAAYGAYPFYGNQQQ  343


 Score = 42.7 bits (99),  Expect(2) = 6e-38, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGD++++  AMTEMNGV C
Sbjct  156  YGFVRFGDDNEKTHAMTEMNGVYC  179



>ref|NP_001063403.1| Os09g0462700 [Oryza sativa Japonica Group]
 dbj|BAF25317.1| Os09g0462700, partial [Oryza sativa Japonica Group]
Length=441

 Score =   142 bits (359),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 102/172 (59%), Gaps = 8/172 (5%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            V+C S+RPMRIGPA  +    T       +  A + D D  NTT+FVGGLDPNVSE+ +R
Sbjct  273  VYC-STRPMRIGPATPRKTSGTSGP----TGSAARSDGDLTNTTVFVGGLDPNVSEDDLR  327

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            Q FS YGE+  VKI   K+CGFVQF  R +AE AL  L G+ +G+Q VRLSWGRNP+NKQ
Sbjct  328  QTFSQYGEISSVKIPVGKQCGFVQFVQRKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQ  387

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQQ  315
                       G YY  +         AP P DP MY   YG+YP Y N QQ
Sbjct  388  LRSDNGSQWNNGMYYAASPFYSGYGYPAPFPADPGMYAAAYGAYPFYGNQQQ  439


 Score = 42.7 bits (99),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGD++++  AMTEMNGV C
Sbjct  252  YGFVRFGDDNEKTHAMTEMNGVYC  275



>ref|XP_006374988.1| RNA-binding protein 47 [Populus trichocarpa]
 gb|ERP52785.1| RNA-binding protein 47 [Populus trichocarpa]
Length=429

 Score =   141 bits (355),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 87/124 (70%), Gaps = 5/124 (4%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATY----QSSQAGQGDSDPNNTTIFVGGLDPNVSE  654
            V+C SSRPMRIG A  +     QQ+  Y     S+Q  Q D D NNTTIFVGGLDPNV++
Sbjct  251  VYC-SSRPMRIGAATPRKSSGYQQQGGYGSNGASAQGFQSDGDSNNTTIFVGGLDPNVTD  309

Query  653  ELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNP  474
            E ++Q FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLSWGRNP
Sbjct  310  EDLKQPFSQYGEIVSVKIPVGKGCGFVQFANRDNAEEALQKLNGTVIGKQTVRLSWGRNP  369

Query  473  SNKQ  462
            +NKQ
Sbjct  370  ANKQ  373


 Score = 44.3 bits (103),  Expect(2) = 8e-38, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGD+S++ +AMTEMNGV C
Sbjct  230  YGFVRFGDDSERTQAMTEMNGVYC  253



>ref|XP_009118181.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Brassica 
rapa]
Length=394

 Score =   140 bits (353),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 101/156 (65%), Gaps = 9/156 (6%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQ-GDSDPNNTTIFVGGLDPNVSEELMRQV  636
             SSRPMRIGPAA+K  V + Q+ +YQS+ +G   D+DPNNTT+FVGGLDP ++++ ++ V
Sbjct  220  CSSRPMRIGPAASKKGV-SGQRDSYQSAASGVPTDNDPNNTTVFVGGLDPTITDDHLKNV  278

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD  456
            FS YGE+VHVKI A KRCGFVQFS +  AE A+ +L G QLG   VRLSWGR+PS+KQ+ 
Sbjct  279  FSQYGEIVHVKIPAGKRCGFVQFSEKSCAEEAIRNLNGMQLGGTTVRLSWGRSPSSKQAA  338

Query  455  QTqwgggvggsyygyaqqgydaygyAPPPQDPNMYY  348
                    G                   PQDPN YY
Sbjct  339  DPSQYYYGGYGQGQEHYGYSM-------PQDPNAYY  367


 Score = 44.7 bits (104),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV F DES+Q+RAM+EMNGV C
Sbjct  197  YGFVWFSDESEQIRAMSEMNGVPC  220



>gb|EEC84714.1| hypothetical protein OsI_31675 [Oryza sativa Indica Group]
Length=377

 Score =   142 bits (359),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 102/172 (59%), Gaps = 8/172 (5%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            V+C S+RPMRIGPA  +    T       +  A + D D  NTT+FVGGLDPNVSE+ +R
Sbjct  209  VYC-STRPMRIGPATPRKTSGTSGP----TGSAARSDGDLTNTTVFVGGLDPNVSEDDLR  263

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            Q FS YGE+  VKI   K+CGFVQF  R +AE AL  L G+ +G+Q VRLSWGRNP+NKQ
Sbjct  264  QTFSQYGEISSVKIPVGKQCGFVQFVQRKNAEDALQGLNGSTIGKQTVRLSWGRNPANKQ  323

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQQ  315
                       G +Y  +         AP P DP MY   YG+YP Y N QQ
Sbjct  324  LRSDNGSQWNNGMFYAASPFYSGYGYPAPFPADPGMYAAAYGAYPFYGNQQQ  375


 Score = 42.4 bits (98),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGD++++  AMTEMNGV C
Sbjct  188  YGFVRFGDDNEKTHAMTEMNGVYC  211



>gb|KHN12758.1| Polyadenylate-binding protein RBP47C [Glycine soja]
Length=318

 Score =   143 bits (360),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 103/172 (60%), Gaps = 7/172 (4%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            V+C SSRPMRIG A  +     QQ     +  A Q ++D  NTTIFVGGLDPNVS+E +R
Sbjct  148  VYC-SSRPMRIGAATPRKSSGHQQGGL-SNGTANQSEADSTNTTIFVGGLDPNVSDEDLR  205

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            Q FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLSWGRNP+NKQ
Sbjct  206  QPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTTIGKQTVRLSWGRNPANKQ  265

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQQ  315
                   G      Y  A          PP  DP++Y   YG+YP Y  +QQ
Sbjct  266  FRMD--FGSPWTGAYYGAPMYDGYGYALPPRHDPSIYAAAYGAYPLYGGHQQ  315


 Score = 41.6 bits (96),  Expect(2) = 1e-37, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGD++++ +AMT+MNGV C
Sbjct  127  YGFVRFGDDNERTQAMTQMNGVYC  150



>ref|XP_003560152.2| PREDICTED: polyadenylate-binding protein RBP45-like [Brachypodium 
distachyon]
Length=467

 Score =   142 bits (359),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 111/169 (66%), Gaps = 6/169 (4%)
 Frame = -3

Query  809  SSRPMRIGPAANKNLVNTQQKATY-----QSSQAGQGDSDPNNTTIFVGGLDPNVSEELM  645
            SSR +RIGPAANK  + TQQ  +      QSSQ     +DPNNTTIFVGGLD N+ E  +
Sbjct  277  SSRQLRIGPAANKKNMGTQQTYSTNGYQSQSSQGNDVQNDPNNTTIFVGGLDSNIDENYL  336

Query  644  RQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNK  465
            RQVF+PYGE+ +VKI   KRCGFVQF++R  AE A+++L G  +G  NVRLSWGR+  NK
Sbjct  337  RQVFTPYGEVGYVKIPVGKRCGFVQFTSRSCAEEAINALNGTPIGGNNVRLSWGRSTQNK  396

Query  464  QSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMYYGSYPGYTNYQ  318
            Q+ Q Q      GS Y   QQG DAY  AP  QDP+M    Y GY NY+
Sbjct  397  QAPQ-QDANQGNGSNYYGYQQGNDAYYGAPNAQDPSMQNYGYSGYGNYE  444


 Score = 41.6 bits (96),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 18/23 (78%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVV  814
            YGFVRFGD ++Q RAMTEMNGV 
Sbjct  253  YGFVRFGDVNEQTRAMTEMNGVT  275



>ref|XP_006354957.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Solanum 
tuberosum]
Length=438

 Score =   144 bits (363),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/179 (49%), Positives = 103/179 (58%), Gaps = 13/179 (7%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSS-------QAGQGDSDPNNTTIFVGGLDPN  663
            V+C SSRPMRIG A  +      Q+ + Q         Q  Q D+D  NTTIFVGGLDPN
Sbjct  260  VYC-SSRPMRIGAATPRKSSGYPQQYSSQGGYSNGGPVQGSQPDADSTNTTIFVGGLDPN  318

Query  662  VSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWG  483
            VS+E +RQ F+ YGE+V VKI   K CGFVQF+NR  AE AL  L G  +G+Q VRLSWG
Sbjct  319  VSDEDLRQPFAQYGEIVSVKIPVGKGCGFVQFANRNDAEEALQKLNGTAIGKQTVRLSWG  378

Query  482  RNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQQ  315
            RNP+NKQS      G      Y             PPP DP MY   YG+YP Y  +QQ
Sbjct  379  RNPANKQS--RSDFGNQWTGPYYGGHFYDGYGYAFPPPHDPGMYAAAYGAYPVYGTHQQ  435


 Score = 40.0 bits (92),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 20/24 (83%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGD++++  AM EMNGV C
Sbjct  239  YGFVRFGDDNERSSAMNEMNGVYC  262



>ref|XP_003549410.2| PREDICTED: polyadenylate-binding protein RBP47C-like [Glycine 
max]
Length=413

 Score =   142 bits (357),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 104/172 (60%), Gaps = 7/172 (4%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            V+C SSRPMRIG AA     +  Q+    +  A Q ++D  NTTIFVGGLDPNVS+E +R
Sbjct  243  VYC-SSRPMRIG-AATPRKSSGHQQGGLSNGTANQSEADSTNTTIFVGGLDPNVSDEDLR  300

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            Q FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLSWGRNP+NKQ
Sbjct  301  QPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTTIGKQTVRLSWGRNPANKQ  360

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQQ  315
                   G      Y  A          PP  DP++Y   YG+YP Y  +QQ
Sbjct  361  FRMD--FGSPWTGAYYGAPMYDGYGYALPPRHDPSIYAAAYGAYPLYGGHQQ  410


 Score = 42.0 bits (97),  Expect(2) = 2e-37, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGD++++ +AMT+MNGV C
Sbjct  222  YGFVRFGDDNERTQAMTQMNGVYC  245



>gb|EYU25396.1| hypothetical protein MIMGU_mgv1a006186mg [Erythranthe guttata]
Length=454

 Score =   143 bits (360),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 107/180 (59%), Gaps = 13/180 (7%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKAT----YQSSQAGQG----DSDPNNTTIFVGGLDP  666
            V+C SSRPMRIGPA  +     QQ+ +    Y +  +  G    D D  NTTIFVGGLDP
Sbjct  274  VYC-SSRPMRIGPATPRKSSGYQQQYSPQGGYSNGFSAHGSQLSDGDSVNTTIFVGGLDP  332

Query  665  NVSEELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSW  486
            +V++E +RQ FS YGE+V VKI   K CGFVQF NR  AE AL  L G  +G+Q VRLSW
Sbjct  333  SVTDEELRQPFSEYGEIVSVKIPVGKGCGFVQFVNRNDAEEALQQLSGKTIGKQTVRLSW  392

Query  485  GRNPSNKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQQ  315
            G +P+NKQS +  +     G+ Y             PPP DPNMY   YG+YP Y  +QQ
Sbjct  393  GHSPANKQS-RVDYAHQWTGAAYYGGPYFDGYGYALPPPHDPNMYAAAYGAYPFYGTHQQ  451


 Score = 40.4 bits (93),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF D+S++ +AMTEMNGV C
Sbjct  253  YGFVRFEDDSERSQAMTEMNGVYC  276



>tpg|DAA62918.1| TPA: hypothetical protein ZEAMMB73_604225 [Zea mays]
Length=484

 Score =   144 bits (363),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 89/123 (72%), Gaps = 4/123 (3%)
 Frame = -3

Query  809  SSRPMRIGPAANKNLVNTQQ----KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            S+R MRIG AANK   + QQ       YQSS+    ++DPNNTT+FVGGLD NV+EE +R
Sbjct  277  STRQMRIGAAANKKNRDAQQTYATDGAYQSSKGNSSENDPNNTTVFVGGLDSNVNEEYLR  336

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            Q+F+PYGE+ +VKI   K CGFVQF++R  AE A+  L G+Q+G Q VRLSWGR+P N+Q
Sbjct  337  QIFTPYGEISYVKIPVGKHCGFVQFTSRSCAEEAIRMLNGSQVGGQKVRLSWGRSPQNRQ  396

Query  461  SDQ  453
            + Q
Sbjct  397  ASQ  399


 Score = 38.5 bits (88),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVV  814
            +GFVRFGD ++Q RAMTEMNG++
Sbjct  253  FGFVRFGDLNEQARAMTEMNGML  275



>ref|NP_001142233.1| hypothetical protein [Zea mays]
 gb|ACF87948.1| unknown [Zea mays]
 tpg|DAA62917.1| TPA: hypothetical protein ZEAMMB73_604225 [Zea mays]
Length=465

 Score =   144 bits (363),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 89/123 (72%), Gaps = 4/123 (3%)
 Frame = -3

Query  809  SSRPMRIGPAANKNLVNTQQ----KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            S+R MRIG AANK   + QQ       YQSS+    ++DPNNTT+FVGGLD NV+EE +R
Sbjct  277  STRQMRIGAAANKKNRDAQQTYATDGAYQSSKGNSSENDPNNTTVFVGGLDSNVNEEYLR  336

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            Q+F+PYGE+ +VKI   K CGFVQF++R  AE A+  L G+Q+G Q VRLSWGR+P N+Q
Sbjct  337  QIFTPYGEISYVKIPVGKHCGFVQFTSRSCAEEAIRMLNGSQVGGQKVRLSWGRSPQNRQ  396

Query  461  SDQ  453
            + Q
Sbjct  397  ASQ  399


 Score = 38.5 bits (88),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVV  814
            +GFVRFGD ++Q RAMTEMNG++
Sbjct  253  FGFVRFGDLNEQARAMTEMNGML  275



>ref|XP_008651136.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=466

 Score =   144 bits (363),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 89/123 (72%), Gaps = 4/123 (3%)
 Frame = -3

Query  809  SSRPMRIGPAANKNLVNTQQ----KATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            S+R MRIG AANK   + QQ       YQSS+    ++DPNNTT+FVGGLD NV+EE +R
Sbjct  277  STRQMRIGAAANKKNRDAQQTYATDGAYQSSKGNSSENDPNNTTVFVGGLDSNVNEEYLR  336

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            Q+F+PYGE+ +VKI   K CGFVQF++R  AE A+  L G+Q+G Q VRLSWGR+P N+Q
Sbjct  337  QIFTPYGEISYVKIPVGKHCGFVQFTSRSCAEEAIRMLNGSQVGGQKVRLSWGRSPQNRQ  396

Query  461  SDQ  453
            + Q
Sbjct  397  ASQ  399


 Score = 38.5 bits (88),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 16/23 (70%), Positives = 21/23 (91%), Gaps = 0/23 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVV  814
            +GFVRFGD ++Q RAMTEMNG++
Sbjct  253  FGFVRFGDLNEQARAMTEMNGML  275



>ref|XP_007017333.1| RNA-binding protein 47C isoform 5 [Theobroma cacao]
 gb|EOY14558.1| RNA-binding protein 47C isoform 5 [Theobroma cacao]
Length=380

 Score =   140 bits (352),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/126 (59%), Positives = 87/126 (69%), Gaps = 6/126 (5%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQG-----DSDPNNTTIFVGGLDPNVS  657
            V+C SSRPMRIG A  +     QQ+ + Q   A  G     D D +NTTIFVGGLDPNV+
Sbjct  256  VYC-SSRPMRIGAATPRKSSGYQQQYSSQGGYASNGASNQSDGDSSNTTIFVGGLDPNVT  314

Query  656  EELMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRN  477
            EE +RQ FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLSWGRN
Sbjct  315  EEDLRQPFSQYGEIVSVKIPVGKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSWGRN  374

Query  476  PSNKQS  459
            P+NKQS
Sbjct  375  PANKQS  380


 Score = 42.7 bits (99),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGD++++ +AMTEMNGV C
Sbjct  235  YGFVRFGDDTERSQAMTEMNGVYC  258



>ref|XP_010098709.1| Polyadenylate-binding protein RBP47C [Morus notabilis]
 gb|EXB75612.1| Polyadenylate-binding protein RBP47C [Morus notabilis]
Length=423

 Score =   141 bits (355),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 88/175 (50%), Positives = 106/175 (61%), Gaps = 9/175 (5%)
 Frame = -3

Query  821  VWCASSRPMRIG---PAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEE  651
            V+C SSRPMRIG   P  +    N    +   S+Q  Q D D +NTTIFVGGLDP+V +E
Sbjct  249  VYC-SSRPMRIGAATPRKSSGYHNGGYASNGASTQGFQSDGDSSNTTIFVGGLDPSVIDE  307

Query  650  LMRQVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPS  471
             +RQ FS YGE+V VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLSWGRNP+
Sbjct  308  DLRQPFSQYGEIVSVKIPTGKGCGFVQFANRNNAEEALQKLNGTVIGKQTVRLSWGRNPA  367

Query  470  NKQSDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQQ  315
            NKQ       G   G  Y   Q         PPP DP+MY   YG+YP Y ++QQ
Sbjct  368  NKQ--YRGDFGNQWGGAYYGGQVYDGYGYALPPPHDPSMYAASYGAYPLYGSHQQ  420


 Score = 41.6 bits (96),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGD++++ +AM+EMNGV C
Sbjct  228  YGFVRFGDDNERSQAMSEMNGVYC  251



>ref|XP_009118182.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X2 [Brassica 
rapa]
Length=388

 Score =   137 bits (346),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 79/156 (51%), Positives = 98/156 (63%), Gaps = 15/156 (10%)
 Frame = -3

Query  812  ASSRPMRIGPAANKNLVNTQQKATYQSSQAGQ-GDSDPNNTTIFVGGLDPNVSEELMRQV  636
             SSRPMRIGPAA+K       K +YQS+ +G   D+DPNNTT+FVGGLDP ++++ ++ V
Sbjct  220  CSSRPMRIGPAASK-------KDSYQSAASGVPTDNDPNNTTVFVGGLDPTITDDHLKNV  272

Query  635  FSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQSD  456
            FS YGE+VHVKI A KRCGFVQFS +  AE A+ +L G QLG   VRLSWGR+PS+KQ+ 
Sbjct  273  FSQYGEIVHVKIPAGKRCGFVQFSEKSCAEEAIRNLNGMQLGGTTVRLSWGRSPSSKQAA  332

Query  455  QTqwgggvggsyygyaqqgydaygyAPPPQDPNMYY  348
                    G                   PQDPN YY
Sbjct  333  DPSQYYYGGYGQGQEHYGYSM-------PQDPNAYY  361


 Score = 44.7 bits (104),  Expect(2) = 7e-37, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFV F DES+Q+RAM+EMNGV C
Sbjct  197  YGFVWFSDESEQIRAMSEMNGVPC  220



>ref|XP_010476097.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X2 [Camelina sativa]
Length=397

 Score =   133 bits (334),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 83/111 (75%), Gaps = 3/111 (3%)
 Frame = -3

Query  785  PAANKNLVNTQQKATYQSSQAGQ--GDSDPNNTTIFVGGLDPNVSEELMRQVFSPYGELV  612
            P +NK  V T Q+ +YQS  A     D+DPNNTT+FVGGLDP+V+++ ++ VFS YGE+V
Sbjct  222  PCSNKKGV-TGQRDSYQSGSAXGVPTDNDPNNTTVFVGGLDPSVTDDHLKNVFSQYGEIV  280

Query  611  HVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQS  459
            HVKI A KRCGFVQFS +  AE AL +L G QLG   VRLSWGR+PSNKQ+
Sbjct  281  HVKIPAGKRCGFVQFSEKSCAEEALRALNGVQLGGTTVRLSWGRSPSNKQA  331


 Score = 48.5 bits (114),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 20/24 (83%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRF DES+Q+RAMTEMNGV C
Sbjct  200  YGFVRFSDESEQIRAMTEMNGVPC  223



>ref|XP_004499084.1| PREDICTED: polyadenylate-binding protein RBP47C-like [Cicer arietinum]
Length=426

 Score =   138 bits (348),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 102/172 (59%), Gaps = 7/172 (4%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            V+C SSRPMRIG A  +     QQ     +  + Q ++D  NTTIFVGGLDPNV++E +R
Sbjct  256  VYC-SSRPMRIGAATPRKSTGHQQGGQ-SNGTSSQSEADNTNTTIFVGGLDPNVTDEDLR  313

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            Q FS YGE+  VKI   K CGFVQF+NR +AE AL  L G  +G+Q VRLSWGRNP+NKQ
Sbjct  314  QAFSQYGEIASVKIPVGKGCGFVQFANRNNAEEALQKLNGTMIGKQTVRLSWGRNPANKQ  373

Query  461  SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY---YGSYPGYTNYQQ  315
                   G   G Y+         Y    P  DPNMY   YG YP Y  +QQ
Sbjct  374  F--RFDFGSWAGPYFPSPIYDGYGYAMPSPHHDPNMYPLAYGGYPFYGGHQQ  423


 Score = 43.1 bits (100),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 17/24 (71%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGDE+++ +AMT+MNGV C
Sbjct  235  YGFVRFGDENERSQAMTQMNGVYC  258



>gb|ACF83065.1| unknown [Zea mays]
 tpg|DAA61809.1| TPA: hypothetical protein ZEAMMB73_995180 [Zea mays]
Length=320

 Score =   137 bits (344),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 101/175 (58%), Gaps = 10/175 (6%)
 Frame = -3

Query  821  VWCASSRPMRIGPAANKNLVNTQQKATYQSSQAGQGDSDPNNTTIFVGGLDPNVSEELMR  642
            V+C SSRPMRIGPA  +    T       +   G    D  NTT+FVGGLDPNVSEE +R
Sbjct  148  VYC-SSRPMRIGPATPRKSSGTSGSNGSAARSDG---GDLTNTTVFVGGLDPNVSEEDLR  203

Query  641  QVFSPYGELVHVKIVAAKRCGFVQFSNRPSAEHALSSLQGAQLGEQNVRLSWGRNPSNKQ  462
            Q FS YGE+  VKI   K+CGFVQF+ R +AE AL  L G+ +G+QNVRLSWGRNP+NKQ
Sbjct  204  QTFSQYGEISSVKIPIGKQCGFVQFAQRKNAEDALQGLNGSTIGKQNVRLSWGRNPANKQ  263

Query  461  --SDQTqwgggvggsyygyaqqgydaygyAPPPQDPNMY----YGSYPGYTNYQQ  315
               D        G  Y          Y  A P  DP MY    YG+YP Y N QQ
Sbjct  264  FRGDNGNQWNNGGMYYAAPPFYNGYGYPAAAPFPDPGMYAAPAYGAYPFYGNQQQ  318


 Score = 44.3 bits (103),  Expect(2) = 1e-36, Method: Compositional matrix adjust.
 Identities = 18/24 (75%), Positives = 22/24 (92%), Gaps = 0/24 (0%)
 Frame = -2

Query  882  YGFVRFGDESDQLRAMTEMNGVVC  811
            YGFVRFGD+S++ +AMTEMNGV C
Sbjct  127  YGFVRFGDDSEKTQAMTEMNGVYC  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2004804698818