BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2634

Length=946
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011084605.1|  PREDICTED: 60S ribosomal protein L13-1             336   4e-112   Sesamum indicum [beniseed]
ref|XP_011653106.1|  PREDICTED: 60S ribosomal protein L13-3             332   1e-110   Cucumis sativus [cucumbers]
ref|XP_011075827.1|  PREDICTED: 60S ribosomal protein L13-1-like        331   2e-110   Sesamum indicum [beniseed]
ref|XP_008453835.1|  PREDICTED: 60S ribosomal protein L13-3             330   5e-110   Cucumis melo [Oriental melon]
gb|KJB08613.1|  hypothetical protein B456_001G093800                    328   5e-109   Gossypium raimondii
ref|XP_012090947.1|  PREDICTED: 60S ribosomal protein L13-1-like        327   9e-109   Jatropha curcas
ref|XP_012071325.1|  PREDICTED: 60S ribosomal protein L13-1             326   2e-108   Jatropha curcas
emb|CDP17844.1|  unnamed protein product                                326   2e-108   Coffea canephora [robusta coffee]
gb|KHG24237.1|  60S ribosomal L13-2                                     325   7e-108   Gossypium arboreum [tree cotton]
ref|XP_007158142.1|  hypothetical protein PHAVU_002G127900g             324   1e-107   Phaseolus vulgaris [French bean]
gb|AGV54370.1|  60S ribosomal protein L13-2-like protein                324   1e-107   Phaseolus vulgaris [French bean]
ref|XP_006478303.1|  PREDICTED: 60S ribosomal protein L13-1-like        323   2e-107   Citrus sinensis [apfelsine]
gb|KJB42885.1|  hypothetical protein B456_007G172400                    323   2e-107   Gossypium raimondii
gb|KHG03134.1|  60S ribosomal L13-2                                     323   3e-107   Gossypium arboreum [tree cotton]
ref|XP_006441816.1|  hypothetical protein CICLE_v10022283mg             323   3e-107   Citrus clementina [clementine]
ref|XP_006451725.1|  hypothetical protein CICLE_v10009507mg             323   4e-107   Citrus clementina [clementine]
ref|XP_008238048.1|  PREDICTED: 60S ribosomal protein L13-1             323   4e-107   Prunus mume [ume]
ref|XP_010269352.1|  PREDICTED: 60S ribosomal protein L13-1-like        322   6e-107   Nelumbo nucifera [Indian lotus]
ref|XP_006485662.1|  PREDICTED: 60S ribosomal protein L13-1-like        322   7e-107   Citrus sinensis [apfelsine]
gb|KJB22724.1|  hypothetical protein B456_004G062900                    322   9e-107   Gossypium raimondii
ref|XP_008467320.1|  PREDICTED: 60S ribosomal protein L13-3-like        322   1e-106   Cucumis melo [Oriental melon]
ref|XP_007049063.1|  60S ribosomal protein L13                          322   1e-106   
ref|XP_002529265.1|  60S ribosomal protein L13, putative                322   1e-106   Ricinus communis
ref|XP_011028035.1|  PREDICTED: 60S ribosomal protein L13-1-like        322   1e-106   Populus euphratica
ref|XP_010054042.1|  PREDICTED: 60S ribosomal protein L13-2             322   1e-106   Eucalyptus grandis [rose gum]
ref|XP_009795347.1|  PREDICTED: 60S ribosomal protein L13-1             322   1e-106   Nicotiana sylvestris
ref|XP_004143667.1|  PREDICTED: 60S ribosomal protein L13-3-like        321   2e-106   Cucumis sativus [cucumbers]
ref|XP_004245965.1|  PREDICTED: 60S ribosomal protein L13-1-like        321   2e-106   Solanum lycopersicum
ref|XP_007209605.1|  hypothetical protein PRUPE_ppa011506mg             321   3e-106   Prunus persica
gb|KHG21579.1|  60S ribosomal L13-2                                     321   3e-106   Gossypium arboreum [tree cotton]
ref|XP_002304378.1|  60S ribosomal protein L13                          321   3e-106   Populus trichocarpa [western balsam poplar]
ref|XP_006368290.1|  60S ribosomal protein L13                          320   3e-106   Populus trichocarpa [western balsam poplar]
ref|XP_011018407.1|  PREDICTED: 60S ribosomal protein L13-1             320   4e-106   Populus euphratica
gb|AAQ96375.1|  60S ribosomal protein L13                               320   4e-106   Solanum palustre
ref|XP_011023520.1|  PREDICTED: 60S ribosomal protein L13-1-like        320   4e-106   Populus euphratica
ref|XP_009619310.1|  PREDICTED: 60S ribosomal protein L13-1             320   4e-106   Nicotiana tomentosiformis
ref|XP_003522855.1|  PREDICTED: 60S ribosomal protein L13-1-like ...    320   5e-106   Glycine max [soybeans]
ref|XP_010243468.1|  PREDICTED: 60S ribosomal protein L13-1             320   6e-106   Nelumbo nucifera [Indian lotus]
ref|XP_002519996.1|  60S ribosomal protein L13, putative                320   9e-106   Ricinus communis
emb|CDP19062.1|  unnamed protein product                                319   1e-105   Coffea canephora [robusta coffee]
ref|XP_002319032.1|  hypothetical protein POPTR_0013s02860g             319   1e-105   Populus trichocarpa [western balsam poplar]
ref|XP_007218412.1|  hypothetical protein PRUPE_ppa011512mg             319   2e-105   Prunus persica
ref|XP_010503548.1|  PREDICTED: 60S ribosomal protein L13-1             319   2e-105   Camelina sativa [gold-of-pleasure]
emb|CAN80613.1|  hypothetical protein VITISV_025451                     318   2e-105   Vitis vinifera
gb|ACJ83949.1|  unknown                                                 318   2e-105   Medicago truncatula
gb|AFK39980.1|  unknown                                                 318   2e-105   Lotus japonicus
ref|XP_003626150.1|  60S ribosomal protein L13                          318   2e-105   Medicago truncatula
ref|XP_002274000.1|  PREDICTED: 60S ribosomal protein L13-1             318   3e-105   Vitis vinifera
ref|NP_001275203.1|  60S ribosomal protein L13                          318   3e-105   Solanum tuberosum [potatoes]
ref|XP_002322840.2|  hypothetical protein POPTR_0016s08310g             318   4e-105   Populus trichocarpa [western balsam poplar]
ref|XP_010269338.1|  PREDICTED: 60S ribosomal protein L13-1-like        318   5e-105   Nelumbo nucifera [Indian lotus]
ref|XP_008234598.1|  PREDICTED: 60S ribosomal protein L13-3-like        317   5e-105   Prunus mume [ume]
emb|CAN84167.1|  hypothetical protein VITISV_018882                     317   5e-105   Vitis vinifera
gb|KHG20106.1|  60S ribosomal L13-1                                     317   9e-105   Gossypium arboreum [tree cotton]
ref|XP_011048445.1|  PREDICTED: 60S ribosomal protein L13-1-like        317   9e-105   Populus euphratica
gb|AFK45847.1|  unknown                                                 317   1e-104   Medicago truncatula
gb|AFK47578.1|  unknown                                                 317   1e-104   Medicago truncatula
ref|XP_009382822.1|  PREDICTED: 60S ribosomal protein L13-1-like        317   1e-104   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003534321.1|  PREDICTED: 60S ribosomal protein L13-1 isofo...    316   2e-104   Glycine max [soybeans]
ref|XP_002277094.1|  PREDICTED: 60S ribosomal protein L13-1             316   2e-104   Vitis vinifera
ref|XP_007156319.1|  hypothetical protein PHAVU_003G276400g             316   2e-104   Phaseolus vulgaris [French bean]
gb|ACJ83987.1|  unknown                                                 315   3e-104   Medicago truncatula
ref|XP_003547825.1|  PREDICTED: 60S ribosomal protein L13-1-like        315   3e-104   
ref|XP_010940804.1|  PREDICTED: 60S ribosomal protein L13-1             315   4e-104   Elaeis guineensis
ref|XP_010426404.1|  PREDICTED: 60S ribosomal protein L13-1-like        315   5e-104   Camelina sativa [gold-of-pleasure]
ref|XP_010056172.1|  PREDICTED: 60S ribosomal protein L13-1-like        315   5e-104   Eucalyptus grandis [rose gum]
gb|AFK36916.1|  unknown                                                 315   5e-104   Medicago truncatula
ref|XP_003612594.1|  60S ribosomal protein L13                          316   6e-104   
ref|XP_009595065.1|  PREDICTED: 60S ribosomal protein L13-2             315   6e-104   Nicotiana tomentosiformis
ref|XP_010906706.1|  PREDICTED: 60S ribosomal protein L13-1-like        315   7e-104   Elaeis guineensis
ref|XP_004499145.1|  PREDICTED: 60S ribosomal protein L13-1-like        315   7e-104   Cicer arietinum [garbanzo]
ref|XP_009348808.1|  PREDICTED: 60S ribosomal protein L13-1-like        315   7e-104   Pyrus x bretschneideri [bai li]
gb|AFK44824.1|  unknown                                                 314   1e-103   Lotus japonicus
ref|NP_001276322.1|  60S ribosomal protein L13-1-like                   315   1e-103   
ref|XP_002877641.1|  ATBBC1                                             314   1e-103   Arabidopsis lyrata subsp. lyrata
gb|KHN27522.1|  60S ribosomal protein L13-2                             314   1e-103   Glycine soja [wild soybean]
ref|XP_009773597.1|  PREDICTED: 60S ribosomal protein L13-2-like        313   2e-103   Nicotiana sylvestris
ref|XP_008369022.1|  PREDICTED: 60S ribosomal protein L13-1-like        313   2e-103   Malus domestica [apple tree]
ref|XP_010519493.1|  PREDICTED: 60S ribosomal protein L13-1             313   3e-103   Tarenaya hassleriana [spider flower]
gb|EYU19728.1|  hypothetical protein MIMGU_mgv1a013902mg                313   3e-103   Erythranthe guttata [common monkey flower]
gb|AFK40501.1|  unknown                                                 313   3e-103   Medicago truncatula
gb|ACU23653.1|  unknown                                                 313   4e-103   Glycine max [soybeans]
dbj|BAM64854.1|  RPL13 protein                                          313   4e-103   Beta vulgaris [beet]
ref|XP_006598706.1|  PREDICTED: uncharacterized protein LOC100499...    313   4e-103   
ref|XP_006291856.1|  hypothetical protein CARUB_v10018032mg             312   5e-103   Capsella rubella
ref|XP_009395324.1|  PREDICTED: 60S ribosomal protein L13-1             312   7e-103   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU45361.1|  hypothetical protein MIMGU_mgv1a013891mg                312   7e-103   Erythranthe guttata [common monkey flower]
ref|XP_008386691.1|  PREDICTED: 60S ribosomal protein L13-1             312   7e-103   
ref|XP_010671181.1|  PREDICTED: 60S ribosomal protein L13-1             312   8e-103   Beta vulgaris subsp. vulgaris [field beet]
gb|ACJ86119.1|  unknown                                                 312   8e-103   Medicago truncatula
gb|AES82369.2|  60S ribosomal L13-like protein                          312   8e-103   Medicago truncatula
ref|XP_009792303.1|  PREDICTED: 60S ribosomal protein L13-1-like        312   8e-103   Nicotiana sylvestris
ref|XP_006342488.1|  PREDICTED: 60S ribosomal protein L13-1-like        312   8e-103   Solanum tuberosum [potatoes]
ref|XP_009335726.1|  PREDICTED: 60S ribosomal protein L13-3-like        311   1e-102   Pyrus x bretschneideri [bai li]
ref|XP_009351877.1|  PREDICTED: 60S ribosomal protein L13-1             311   1e-102   Pyrus x bretschneideri [bai li]
ref|XP_006655721.1|  PREDICTED: 60S ribosomal protein L13-1-like        311   1e-102   Oryza brachyantha
ref|XP_008785029.1|  PREDICTED: 60S ribosomal protein L13-1-like        311   1e-102   Phoenix dactylifera
ref|XP_008381780.1|  PREDICTED: 60S ribosomal protein L13-3-like        311   1e-102   Malus domestica [apple tree]
ref|XP_006394649.1|  hypothetical protein EUTSA_v10004920mg             311   2e-102   Eutrema salsugineum [saltwater cress]
dbj|BAM64815.1|  RPL13                                                  311   2e-102   Beta vulgaris [beet]
ref|XP_008376874.1|  PREDICTED: 60S ribosomal protein L13-3             311   2e-102   
ref|XP_008776365.1|  PREDICTED: 60S ribosomal protein L13-1-like        311   2e-102   Phoenix dactylifera
ref|XP_009624483.1|  PREDICTED: 60S ribosomal protein L13-1-like        311   2e-102   Nicotiana tomentosiformis
gb|KJB10376.1|  hypothetical protein B456_001G197800                    311   2e-102   Gossypium raimondii
ref|XP_006404190.1|  hypothetical protein EUTSA_v10010724mg             311   2e-102   Eutrema salsugineum [saltwater cress]
emb|CDY66119.1|  BnaC01g42370D                                          311   2e-102   Brassica napus [oilseed rape]
ref|XP_009361223.1|  PREDICTED: 60S ribosomal protein L13-3-like        311   2e-102   Pyrus x bretschneideri [bai li]
ref|XP_009335696.1|  PREDICTED: 60S ribosomal protein L13-1-like        311   2e-102   Pyrus x bretschneideri [bai li]
ref|XP_009150164.1|  PREDICTED: 60S ribosomal protein L13-2             311   2e-102   Brassica rapa
ref|XP_010677493.1|  PREDICTED: 60S ribosomal protein L13-1-like        310   3e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004512380.1|  PREDICTED: 60S ribosomal protein L13-1-like ...    310   3e-102   
ref|NP_190470.1|  60S ribosomal protein L13-1                           310   3e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006659160.1|  PREDICTED: 60S ribosomal protein L13-1-like        310   3e-102   Oryza brachyantha
ref|XP_010278804.1|  PREDICTED: 60S ribosomal protein L13-2-like        310   4e-102   Nelumbo nucifera [Indian lotus]
ref|NP_001056613.1|  Os06g0115500                                       310   4e-102   
ref|NP_001288976.1|  60S ribosomal protein L13-2                        310   5e-102   Brassica rapa
ref|XP_009386549.1|  PREDICTED: 60S ribosomal protein L13-1-like        310   5e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009149775.1|  PREDICTED: 60S ribosomal protein L13-1-like        310   5e-102   Brassica rapa
sp|P41129.1|RL132_BRANA  RecName: Full=60S ribosomal protein L13-...    310   5e-102   Brassica napus [oilseed rape]
ref|XP_004253080.1|  PREDICTED: 60S ribosomal protein L13-1             310   5e-102   Solanum lycopersicum
ref|XP_008775606.1|  PREDICTED: 60S ribosomal protein L13-1             310   5e-102   Phoenix dactylifera
ref|XP_010918091.1|  PREDICTED: 60S ribosomal protein L13-1-like        310   6e-102   Elaeis guineensis
ref|XP_010102662.1|  60S ribosomal protein L13-2                        309   8e-102   Morus notabilis
ref|XP_006847908.1|  PREDICTED: 60S ribosomal protein L13-1             309   9e-102   Amborella trichopoda
ref|XP_002874151.1|  60S ribosomal protein L13                          309   1e-101   
ref|XP_010421197.1|  PREDICTED: 60S ribosomal protein L13-3             309   1e-101   Camelina sativa [gold-of-pleasure]
emb|CDY05893.1|  BnaC08g20700D                                          308   2e-101   
gb|EPS71909.1|  hypothetical protein M569_02849                         308   2e-101   Genlisea aurea
gb|AAM61490.1|  60S ribosomal protein L13, BBC1 protein                 308   2e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002456870.1|  hypothetical protein SORBIDRAFT_03g044290          308   3e-101   Sorghum bicolor [broomcorn]
sp|P41128.1|RL131_BRANA  RecName: Full=60S ribosomal protein L13-...    307   4e-101   Brassica napus [oilseed rape]
ref|XP_006288673.1|  hypothetical protein CARUB_v10001981mg             307   5e-101   Capsella rubella
ref|NP_001152730.1|  LOC100286371                                       307   6e-101   Zea mays [maize]
ref|XP_009151668.1|  PREDICTED: 60S ribosomal protein L13-1             307   6e-101   Brassica rapa
ref|XP_004969597.1|  PREDICTED: 60S ribosomal protein L13-1-like        307   7e-101   Setaria italica
ref|XP_009392764.1|  PREDICTED: 60S ribosomal protein L13-1-like        307   8e-101   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010493519.1|  PREDICTED: 60S ribosomal protein L13-3-like        307   8e-101   
ref|XP_010545924.1|  PREDICTED: 60S ribosomal protein L13-1-like        306   1e-100   Tarenaya hassleriana [spider flower]
ref|XP_010233707.1|  PREDICTED: 60S ribosomal protein L13-1-like        306   1e-100   Brachypodium distachyon [annual false brome]
ref|XP_004509537.1|  PREDICTED: 60S ribosomal protein L13-1-like        306   2e-100   Cicer arietinum [garbanzo]
ref|XP_004969592.1|  PREDICTED: 60S ribosomal protein L13-1-like        305   3e-100   Setaria italica
gb|ABK25466.1|  unknown                                                 305   3e-100   Picea sitchensis
emb|CAC27142.1|  60S ribosomal protein L13E                             305   4e-100   Picea abies
ref|XP_003573442.1|  PREDICTED: 60S ribosomal protein L13-1-like        305   4e-100   Brachypodium distachyon [annual false brome]
emb|CDY16871.1|  BnaA09g05110D                                          305   4e-100   Brassica napus [oilseed rape]
ref|NP_001148638.1|  60S ribosomal protein L13-2                        305   5e-100   Zea mays [maize]
ref|XP_010454674.1|  PREDICTED: 60S ribosomal protein L13-3-like        305   5e-100   Camelina sativa [gold-of-pleasure]
ref|XP_006404189.1|  hypothetical protein EUTSA_v10010724mg             304   6e-100   
ref|XP_008800008.1|  PREDICTED: 60S ribosomal protein L13-1-like        305   7e-100   Phoenix dactylifera
ref|NP_001078260.1|  60S ribosomal protein L13-1                        304   8e-100   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001050537.1|  Os03g0576700                                       304   9e-100   
emb|CDX87152.1|  BnaC09g04670D                                          304   1e-99    
ref|XP_002440279.1|  hypothetical protein SORBIDRAFT_09g028960          304   1e-99    Sorghum bicolor [broomcorn]
ref|XP_002439380.1|  hypothetical protein SORBIDRAFT_09g005460          303   3e-99    Sorghum bicolor [broomcorn]
ref|XP_010550553.1|  PREDICTED: 60S ribosomal protein L13-1-like        303   3e-99    Tarenaya hassleriana [spider flower]
ref|XP_009141778.1|  PREDICTED: 60S ribosomal protein L13-3             303   4e-99    Brassica rapa
ref|NP_001155192.1|  60S ribosomal protein L13 isoform 1                302   7e-99    Zea mays [maize]
ref|NP_197778.1|  60S ribosomal protein L13-3                           301   8e-99    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004982044.1|  PREDICTED: 60S ribosomal protein L13-2-like ...    300   5e-98    Setaria italica
gb|ABK24025.1|  unknown                                                 299   7e-98    Picea sitchensis
gb|AFW84113.1|  hypothetical protein ZEAMMB73_641905                    299   1e-97    
gb|EMT28307.1|  60S ribosomal protein L13-1                             298   2e-97    
ref|XP_009396207.1|  PREDICTED: 60S ribosomal protein L13-1-like        298   2e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006850159.1|  PREDICTED: 60S ribosomal protein L13-1             298   2e-97    Amborella trichopoda
gb|ABR18061.1|  unknown                                                 298   3e-97    Picea sitchensis
dbj|BAJ99213.1|  predicted protein                                      296   8e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT10064.1|  60S ribosomal protein L13-1                             297   9e-97    
gb|EMS50076.1|  60S ribosomal protein L13-1                             296   1e-95    Triticum urartu
gb|AIZ68174.1|  60S ribosomal protein L13-1-like protein                291   7e-95    Ornithogalum longebracteatum [sea-onion]
ref|XP_007040896.1|  60S ribosomal protein L13                          290   3e-94    
gb|EMS59514.1|  60S ribosomal protein L13-1                             289   9e-94    Triticum urartu
ref|XP_010539934.1|  PREDICTED: 60S ribosomal protein L13-1-like        286   6e-93    Tarenaya hassleriana [spider flower]
gb|ABF97255.1|  60S ribosomal protein L13-2, putative, expressed        273   6e-88    Oryza sativa Japonica Group [Japonica rice]
ref|NP_190465.1|  putative 60S ribosomal protein L13-2                  271   9e-87    Arabidopsis thaliana [mouse-ear cress]
ref|XP_001770513.1|  predicted protein                                  265   2e-84    
ref|XP_001762920.1|  predicted protein                                  265   2e-84    
ref|XP_001756184.1|  predicted protein                                  265   2e-84    
ref|XP_001761309.1|  predicted protein                                  260   1e-82    
ref|XP_001785308.1|  predicted protein                                  259   3e-82    
sp|P49627.1|RL13_TOBAC  RecName: Full=60S ribosomal protein L13; ...    253   5e-80    Nicotiana tabacum [American tobacco]
ref|XP_002962809.1|  hypothetical protein SELMODRAFT_266648             242   2e-75    Selaginella moellendorffii
ref|XP_002962473.1|  hypothetical protein SELMODRAFT_165483             240   1e-74    Selaginella moellendorffii
gb|AAT08722.1|  cold-induced protein                                    235   5e-73    Hyacinthus orientalis [common hyacinth]
ref|XP_011395748.1|  60S ribosomal protein L13-2                        235   7e-73    Auxenochlorella protothecoides
ref|XP_005646484.1|  ribosomal protein L13e                             234   2e-72    Coccomyxa subellipsoidea C-169
ref|XP_001633643.1|  predicted protein                                  228   4e-70    Nematostella vectensis
emb|CDP02021.1|  unnamed protein product                                223   5e-69    Coffea canephora [robusta coffee]
gb|KDD76767.1|  ribosomal protein L13e                                  225   7e-69    Helicosporidium sp. ATCC 50920
ref|XP_003626151.1|  60S ribosomal protein L13                          220   8e-68    
ref|XP_003626152.1|  60S ribosomal protein L13                          213   3e-65    
emb|CAD28610.1|  60S ribosomal protein L13                              216   4e-65    Polytomella sp. Pringsheim 198.80
gb|KCW72783.1|  hypothetical protein EUGRSUZ_E01232                     213   6e-65    Eucalyptus grandis [rose gum]
ref|XP_002154424.1|  PREDICTED: 60S ribosomal protein L13-like          213   3e-64    
ref|XP_002502525.1|  predicted protein                                  213   5e-64    Micromonas commoda
ref|NP_001238240.1|  uncharacterized protein LOC100499935               209   1e-63    
ref|XP_005843532.1|  hypothetical protein CHLNCDRAFT_33026              211   2e-63    Chlorella variabilis
emb|CCQ18590.1|  60S ribosomal protein L13                              211   2e-63    Sycon ciliatum
dbj|BAB71993.1|  BBC1-like protein                                      206   3e-62    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003056914.1|  predicted protein                                  206   2e-61    Micromonas pusilla CCMP1545
gb|AAL93210.1|AF487458_1  BBC1-like protein                             203   3e-61    Triticum aestivum [Canadian hard winter wheat]
gb|EPZ33898.1|  Ribosomal protein L13e domain-containing protein        206   3e-61    Rozella allomycis CSF55
emb|CEF98175.1|  Ribosomal protein L13e                                 205   6e-61    Ostreococcus tauri
ref|XP_001418121.1|  Ribosomal protein L13, component of cytosoli...    205   7e-61    Ostreococcus lucimarinus CCE9901
ref|XP_003382527.1|  PREDICTED: 60S ribosomal protein L13-like          203   2e-60    Amphimedon queenslandica
emb|CCI40738.1|  unnamed protein product                                202   5e-60    Albugo candida
ref|XP_005705644.1|  60S ribosomal protein L13e                         201   1e-59    Galdieria sulphuraria
gb|AAX48845.1|  L13                                                     201   1e-59    Suberites domuncula
ref|NP_937786.1|  60S ribosomal protein L13                             201   2e-59    Danio rerio [leopard danio]
ref|XP_002604928.1|  hypothetical protein BRAFLDRAFT_279721             201   2e-59    Branchiostoma floridae
ref|XP_002952518.1|  ribosomal protein L13 component of cytosolic...    201   3e-59    Volvox carteri f. nagariensis
ref|XP_001356321.1|  GA18330                                            201   3e-59    Drosophila pseudoobscura pseudoobscura
ref|XP_001969383.1|  GG10074                                            201   4e-59    Drosophila erecta
sp|O48513.1|RL13_CHLSW  RecName: Full=60S ribosomal protein L13; ...    200   4e-59    Chlamydomonas sp. W80
ref|XP_002739297.1|  PREDICTED: 60S ribosomal protein L13-like          200   5e-59    Saccoglossus kowalevskii
ref|NP_523530.1|  ribosomal protein L13, isoform A                      200   6e-59    Drosophila melanogaster
emb|CDW52162.1|  60S ribosomal protein L13                              199   6e-59    Trichuris trichiura
ref|XP_001692670.1|  ribosomal protein L13, component of cytosoli...    199   1e-58    Chlamydomonas reinhardtii
emb|CCA14227.1|  60S ribosomal protein L13 putative                     199   1e-58    Albugo laibachii Nc14
ref|XP_011440919.1|  PREDICTED: 60S ribosomal protein L13-like          199   2e-58    Crassostrea gigas
emb|CEG74076.1|  Putative 60S ribosomal protein L13                     198   2e-58    Rhizopus microsporus
emb|CBN08623.1|  small nucleolar RNA, C/D box 68                        197   7e-58    Microcosmus squamiger
gb|KDO51401.1|  hypothetical protein CISIN_1g041207mg                   194   7e-58    Citrus sinensis [apfelsine]
emb|CEG63488.1|  Putative 60S ribosomal protein L13                     197   8e-58    Rhizopus microsporus
ref|XP_008872563.1|  hypothetical protein H310_08544                    196   1e-57    Aphanomyces invadans
gb|ADD38054.1|  60S ribosomal protein L13                               196   1e-57    Lepeophtheirus salmonis
ref|XP_008286406.1|  PREDICTED: 60S ribosomal protein L13               196   2e-57    Stegastes partitus
gb|ABZ04227.1|  ribosomal protein rpl13                                 196   2e-57    Lineus viridis
ref|XP_002195773.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     196   2e-57    Taeniopygia guttata
ref|XP_005052310.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    196   2e-57    Ficedula albicollis
ref|XP_002057754.1|  GJ17923                                            196   2e-57    Drosophila virilis
gb|AEB31272.1|  60S ribosomal protein                                   196   2e-57    Epinephelus bruneus
ref|XP_002065688.1|  GK15580                                            196   2e-57    Drosophila willistoni
emb|CAF99615.1|  unnamed protein product                                196   2e-57    Tetraodon nigroviridis
ref|XP_005714141.1|  60S ribosomal protein L13                          196   2e-57    Chondrus crispus [carageen]
gb|AFM90798.1|  60S ribosomal protein L13                               196   2e-57    Callorhinchus milii [Australian ghost shark]
ref|XP_010716479.1|  PREDICTED: 60S ribosomal protein L13               195   3e-57    Meleagris gallopavo [common turkey]
ref|NP_990330.1|  60S ribosomal protein L13                             195   3e-57    Gallus gallus [bantam]
ref|XP_005188755.1|  PREDICTED: 60S ribosomal protein L13               195   4e-57    Musca domestica
gb|AIU94834.1|  60S ribosomal protein                                   195   4e-57    Phragmatopoma lapidosa
gb|AFM87368.1|  RPL13 protein isoform 1                                 195   4e-57    Callorhinchus milii [Australian ghost shark]
ref|XP_004543183.1|  PREDICTED: 60S ribosomal protein L13-like is...    195   5e-57    Maylandia zebra
gb|AFM90648.1|  60S ribosomal protein L13                               194   5e-57    Callorhinchus milii [Australian ghost shark]
gb|AFM90524.1|  RPL13 protein isoform 1                                 194   7e-57    Callorhinchus milii [Australian ghost shark]
ref|NP_001279295.1|  ribosomal protein L13                              194   7e-57    Callorhinchus milii [Australian ghost shark]
gb|AFM88842.1|  RPL13 protein isoform 1                                 194   7e-57    Callorhinchus milii [Australian ghost shark]
ref|XP_011191555.1|  PREDICTED: 60S ribosomal protein L13               194   8e-57    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_005741646.1|  PREDICTED: 60S ribosomal protein L13-like          194   8e-57    Pundamilia nyererei
gb|AFM88774.1|  RPL13 protein isoform 1                                 194   8e-57    Callorhinchus milii [Australian ghost shark]
ref|XP_009271349.1|  PREDICTED: 60S ribosomal protein L13               194   9e-57    Aptenodytes forsteri
gb|ABM55445.1|  ribosomal protein L13                                   194   9e-57    Xenopsylla cheopis
emb|CEF65706.1|  60S ribosomal protein L13                              194   9e-57    Strongyloides ratti
ref|XP_008489456.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    194   9e-57    Calypte anna
gb|ACO12533.1|  60S ribosomal protein L13                               194   9e-57    Lepeophtheirus salmonis
ref|XP_003442322.1|  PREDICTED: 60S ribosomal protein L13-like is...    194   1e-56    Oreochromis niloticus
ref|XP_005810478.1|  PREDICTED: 60S ribosomal protein L13-like          194   1e-56    Xiphophorus maculatus
ref|XP_010743079.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    194   1e-56    
ref|XP_006139461.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    193   1e-56    Pelodiscus sinensis [Chinese softshell turtle]
gb|AFM85620.1|  RPL13 protein isoform 1                                 193   2e-56    Callorhinchus milii [Australian ghost shark]
ref|XP_002002807.1|  GI17580                                            194   2e-56    Drosophila mojavensis
ref|XP_008403549.1|  PREDICTED: 60S ribosomal protein L13               193   2e-56    Poecilia reticulata
ref|XP_008335251.1|  PREDICTED: 60S ribosomal protein L13               193   2e-56    Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_003970021.1|  PREDICTED: 60S ribosomal protein L13               193   2e-56    
gb|AFM87311.1|  RPL13 protein isoform 1                                 193   2e-56    Callorhinchus milii [Australian ghost shark]
ref|XP_009839630.1|  hypothetical protein H257_13700                    193   2e-56    Aphanomyces astaci
gb|EPB81665.1|  50S ribosomal protein L13e                              193   2e-56    Mucor circinelloides f. circinelloides 1006PhL
gb|AFM89144.1|  RPL13 protein isoform 1                                 193   3e-56    Callorhinchus milii [Australian ghost shark]
ref|XP_001963023.1|  GF15733                                            193   3e-56    Drosophila ananassae
gb|AFM87461.1|  RPL13 protein isoform 1                                 192   3e-56    Callorhinchus milii [Australian ghost shark]
gb|AFM85555.1|  RPL13 protein isoform 1                                 192   3e-56    Callorhinchus milii [Australian ghost shark]
gb|AFM86534.1|  RPL13 protein isoform 1                                 192   3e-56    Callorhinchus milii [Australian ghost shark]
gb|AFM90194.1|  RPL13 protein isoform 1                                 192   4e-56    Callorhinchus milii [Australian ghost shark]
gb|ACK44340.1|  ribosomal protein L13                                   192   4e-56    Drosophila silvestris
ref|XP_001366584.1|  PREDICTED: 60S ribosomal protein L13               192   4e-56    Monodelphis domestica
gb|KFD48816.1|  hypothetical protein M513_10300                         192   4e-56    Trichuris suis
gb|KFM61038.1|  60S ribosomal protein L13                               192   4e-56    Stegodyphus mimosarum
gb|EPB87974.1|  50S ribosomal protein L13e                              192   4e-56    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_005308237.1|  PREDICTED: 60S ribosomal protein L13               192   5e-56    Chrysemys picta bellii
gb|ACH70813.1|  ribosomal protein L13                                   192   5e-56    Salmo salar
ref|XP_007059366.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    192   5e-56    Chelonia mydas [green seaturtle]
ref|XP_009675145.1|  PREDICTED: 60S ribosomal protein L13               192   5e-56    
ref|NP_001230274.1|  ribosomal protein L13                              192   5e-56    
gb|KFV82308.1|  60S ribosomal protein L13                               192   6e-56    
gb|KFH63588.1|  50S ribosomal protein L13e                              192   6e-56    
ref|XP_003758535.1|  PREDICTED: 60S ribosomal protein L13               192   6e-56    
ref|XP_007670825.1|  PREDICTED: 60S ribosomal protein L13               192   7e-56    
ref|XP_004067037.1|  PREDICTED: 60S ribosomal protein L13               192   7e-56    
ref|XP_006027900.1|  PREDICTED: 60S ribosomal protein L13               192   7e-56    
gb|EIE83814.1|  hypothetical protein RO3G_08519                         192   7e-56    
ref|XP_011201713.1|  PREDICTED: 60S ribosomal protein L13               192   8e-56    
gb|AFM89025.1|  RPL13 protein isoform 1                                 191   9e-56    
gb|EFX84971.1|  hypothetical protein DAPPUDRAFT_34614                   191   1e-55    
gb|ABI26261.1|  ribosomal protein L13                                   191   1e-55    
gb|AFM88430.1|  RPL13 protein isoform 1                                 191   1e-55    
gb|AFM90533.1|  RPL13 protein isoform 1                                 191   1e-55    
ref|XP_004392184.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     191   1e-55    
gb|AFM88766.1|  RPL13 protein isoform 1                                 191   1e-55    
ref|XP_006641265.1|  PREDICTED: 60S ribosomal protein L13-like is...    191   1e-55    
ref|NP_001134763.1|  60S ribosomal protein L13                          191   2e-55    
ref|XP_007531327.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    191   2e-55    
gb|EIE79206.1|  50S ribosomal protein L13e                              191   2e-55    
ref|XP_007468509.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    191   2e-55    
ref|NP_001086472.1|  ribosomal protein L13                              191   2e-55    
ref|XP_010789836.1|  PREDICTED: 60S ribosomal protein L13               191   2e-55    
ref|XP_001140497.2|  PREDICTED: 60S ribosomal protein L13               191   2e-55    
gb|KFO77864.1|  60S ribosomal protein L13                               191   2e-55    
gb|AAH66320.1|  Ribosomal protein L13                                   190   2e-55    
ref|NP_058018.2|  60S ribosomal protein L13                             190   2e-55    
gb|EIE85002.1|  50S ribosomal protein L13e                              190   2e-55    
dbj|BAB27309.1|  unnamed protein product                                190   3e-55    
ref|XP_008838743.1|  PREDICTED: 60S ribosomal protein L13               190   3e-55    
ref|XP_536749.1|  PREDICTED: 60S ribosomal protein L13 isoformX1        190   3e-55    
ref|NP_150254.1|  60S ribosomal protein L13 isoform 1                   190   3e-55    
gb|AFM86501.1|  RPL13 protein isoform 1                                 190   3e-55    
gb|KFH62789.1|  50S ribosomal protein L13e                              190   3e-55    
gb|KFO95639.1|  60S ribosomal protein L13                               190   3e-55    
gb|ACN10300.1|  60S ribosomal protein L13                               190   3e-55    
emb|CEP20112.1|  hypothetical protein                                   190   3e-55    
ref|XP_005345872.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    190   3e-55    
ref|XP_006751829.1|  PREDICTED: 60S ribosomal protein L13-like is...    190   3e-55    
ref|XP_005862549.1|  PREDICTED: 60S ribosomal protein L13               190   4e-55    
ref|XP_003800857.1|  PREDICTED: 60S ribosomal protein L13               190   4e-55    
ref|XP_007234286.1|  PREDICTED: 60S ribosomal protein L13               190   4e-55    
ref|XP_005608561.1|  PREDICTED: 60S ribosomal protein L13               190   4e-55    
ref|XP_006001099.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    189   4e-55    
ref|XP_005360630.1|  PREDICTED: 60S ribosomal protein L13-like is...    189   4e-55    
gb|AAX29381.1|  ribosomal protein L13                                   189   5e-55    
ref|XP_004878310.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    189   5e-55    
ref|XP_008774860.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    189   5e-55    
ref|XP_004377825.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     189   5e-55    
ref|XP_001092801.1|  PREDICTED: 60S ribosomal protein L13-like is...    189   5e-55    
ref|XP_007937363.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    189   6e-55    
dbj|BAF98660.1|  ribosomal protein L13                                  189   6e-55    
ref|XP_005892455.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    189   7e-55    
ref|XP_001988257.1|  GH11063                                            189   7e-55    
ref|NP_001015543.1|  60S ribosomal protein L13                          189   8e-55    
ref|XP_004471974.1|  PREDICTED: 60S ribosomal protein L13-like          189   8e-55    
ref|NP_001187042.1|  60S ribosomal protein L13                          189   9e-55    
ref|XP_003280664.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     189   9e-55    
ref|XP_004280098.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     189   9e-55    
ref|XP_005956611.1|  PREDICTED: 60S ribosomal protein L13-like is...    189   9e-55    
ref|XP_008988818.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    189   1e-54    
ref|XP_007992611.1|  PREDICTED: 60S ribosomal protein L13               189   1e-54    
ref|XP_004437070.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     189   1e-54    
ref|XP_010902173.1|  PREDICTED: 60S ribosomal protein L13               189   1e-54    
ref|XP_003227488.1|  PREDICTED: 60S ribosomal protein L13               188   1e-54    
gb|EIE87092.1|  hypothetical protein RO3G_11803                         188   1e-54    
gb|AAX62455.1|  ribosomal protein L13                                   189   1e-54    
ref|XP_010625865.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    189   1e-54    
emb|CAA45963.1|  BBC1                                                   188   2e-54    
ref|XP_009561513.1|  PREDICTED: 60S ribosomal protein L13               190   2e-54    
ref|XP_004666135.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    188   2e-54    
gb|AII97595.1|  BLTX199                                                 188   2e-54    
gb|ACQ58287.1|  60S ribosomal protein L13                               188   2e-54    
ref|XP_004629406.1|  PREDICTED: 60S ribosomal protein L13-like is...    188   2e-54    
ref|XP_003418096.1|  PREDICTED: 60S ribosomal protein L13               188   2e-54    
gb|ABM55560.1|  putative ribosomal protein L13                          188   3e-54    
gb|AEA39508.1|  ribosomal protein L13                                   187   3e-54    
ref|XP_008613112.1|  50S ribosomal protein L13e                         187   3e-54    
gb|KDO24006.1|  50S ribosomal protein L13e                              187   3e-54    
ref|XP_004534535.1|  PREDICTED: 60S ribosomal protein L13-like          187   3e-54    
emb|CCD27757.1|  ribosomal protein l13                                  187   3e-54    
ref|XP_011711672.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    187   3e-54    
ref|XP_010968289.1|  PREDICTED: 60S ribosomal protein L13               187   4e-54    
gb|AAH41531.1|  Similar to ribosomal protein L13                        187   4e-54    
ref|NP_112363.1|  60S ribosomal protein L13                             187   4e-54    
ref|XP_004645046.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    187   5e-54    
ref|XP_009169027.1|  hypothetical protein T265_05694                    187   5e-54    
gb|AAA69923.1|  60S ribosomal protein                                   187   5e-54    
ref|XP_006902912.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    187   5e-54    
ref|NP_989111.1|  60S ribosomal protein L13                             187   5e-54    
ref|XP_012040690.1|  PREDICTED: 60S ribosomal protein L13               187   6e-54    
ref|XP_008469641.1|  PREDICTED: 60S ribosomal protein L13-like          187   6e-54    
ref|NP_001284610.1|  60S ribosomal protein L13-like                     187   7e-54    
gb|AGH70160.1|  60S ribosomal protein L13                               186   7e-54    
dbj|GAA49202.1|  large subunit ribosomal protein L13e                   186   8e-54    
emb|CCD27761.1|  ribosomal protein l13                                  186   8e-54    
gb|ETE69154.1|  60S ribosomal protein L13                               186   9e-54    
ref|XP_005343024.1|  PREDICTED: LOW QUALITY PROTEIN: ribosomal pr...    186   1e-53    
gb|EPX71322.1|  60S ribosomal protein L13                               186   1e-53    
ref|NP_001233732.1|  60S ribosomal protein L13                          186   1e-53    
ref|XP_002723646.2|  PREDICTED: 60S ribosomal protein L13               187   1e-53    
gb|EGV94062.1|  60S ribosomal protein L13                               185   1e-53    
gb|AAI02866.1|  RPL13 protein                                           188   1e-53    
ref|XP_010996322.1|  PREDICTED: 60S ribosomal protein L13               187   1e-53    
ref|XP_007433001.1|  PREDICTED: 60S ribosomal protein L13               186   2e-53    
gb|EDL78512.1|  rCG62940                                                185   2e-53    
ref|XP_006677706.1|  hypothetical protein BATDEDRAFT_6028               185   2e-53    
ref|XP_005537717.1|  60S ribosomal protein L13                          185   2e-53    
ref|XP_010401937.1|  PREDICTED: 60S ribosomal protein L13               184   3e-53    
emb|CCD27771.1|  ribosomal protein l13                                  184   3e-53    
gb|ELU11053.1|  hypothetical protein CAPTEDRAFT_183211                  185   3e-53    
ref|XP_008552884.1|  PREDICTED: 60S ribosomal protein L13-like          185   4e-53    
ref|XP_002108220.1|  expressed hypothetical protein                     184   4e-53    
gb|AAN73374.1|  ribosomal protein L13                                   183   5e-53    
emb|CBJ27745.1|  conserved unknown protein                              184   8e-53    
emb|CDS10828.1|  Putative 60S ribosomal protein L13                     184   9e-53    
emb|CDS05093.1|  Putative 60S ribosomal protein L13                     184   9e-53    
gb|ADG29169.1|  60S ribosomal protein L13                               183   1e-52    
ref|XP_009013211.1|  hypothetical protein HELRODRAFT_105042             183   1e-52    
ref|XP_001607329.1|  PREDICTED: 60S ribosomal protein L13               184   1e-52    
emb|CEJ00025.1|  Putative 60S ribosomal protein L13                     183   1e-52    
emb|CCG83902.1|  protein of unknown function                            183   1e-52    
ref|XP_009538854.1|  hypothetical protein PHYSODRAFT_356191             183   1e-52    
tpg|DAA20190.1|  TPA: ribosomal protein L13-like                        183   2e-52    
ref|XP_009811475.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    183   2e-52    
ref|XP_011301440.1|  PREDICTED: 60S ribosomal protein L13               183   2e-52    
emb|CDH52057.1|  rpl13 protein isoform 1                                183   2e-52    
ref|XP_006879341.1|  PREDICTED: 60S ribosomal protein L13-like is...    182   2e-52    
gb|KFV54384.1|  60S ribosomal protein L13                               182   2e-52    
ref|XP_002905546.1|  60S ribosomal protein L13, putative                182   3e-52    
ref|XP_004339252.1|  ribosomal protein L13e, putative                   182   4e-52    
gb|ETN63436.1|  Ribosomal protein L13                                   182   4e-52    
ref|XP_003400747.1|  PREDICTED: 60S ribosomal protein L13 isoform 1     182   6e-52    
ref|XP_005099800.1|  PREDICTED: 60S ribosomal protein L13-like          181   6e-52    
gb|ERG83884.1|  60s ribosomal protein l13                               181   7e-52    
emb|CDH57872.1|  rpl13 protein isoform 1                                182   7e-52    
gb|AEL28872.1|  ribosomal protein L13                                   182   7e-52    
emb|CDH57871.1|  rpl13 protein isoform 1                                182   7e-52    
ref|XP_011827406.1|  PREDICTED: 60S ribosomal protein L13 isoform X2    181   9e-52    
gb|EPY53464.1|  60S ribosomal protein L13                               181   1e-51    
gb|EWM22191.1|  60s ribosomal protein l13                               181   1e-51    
ref|XP_005853485.1|  large subunit ribosomal protein L13e               181   1e-51    
emb|CBY23126.1|  unnamed protein product                                181   1e-51    
ref|XP_009066218.1|  hypothetical protein LOTGIDRAFT_197609             181   2e-51    
ref|XP_003708357.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    181   2e-51    
gb|ACY95361.1|  ribosomal protein L13                                   181   2e-51    
dbj|BAJ99030.1|  predicted protein                                      181   2e-51    
ref|XP_008959127.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    181   2e-51    
gb|AEB54639.1|  ribosomal protein L13                                   180   2e-51    
emb|CCD74666.1|  putative 60s ribosomal protein L13 (BBC1 protein...    179   3e-51    
ref|NP_001156206.1|  ribosomal protein L13-like                         180   3e-51    
emb|CDH52688.1|  rpl13 protein isoform 1                                181   3e-51    
emb|CDH52687.1|  60s ribosomal protein l13                              181   3e-51    
ref|XP_008187640.1|  PREDICTED: ribosomal protein L13-like isofor...    180   3e-51    
gb|ADT80692.1|  ribosomal protein L13                                   180   3e-51    
ref|XP_011563938.1|  PREDICTED: 60S ribosomal protein L13               180   3e-51    
gb|KHN86867.1|  60S ribosomal protein L13                               180   3e-51    
gb|EHJ77643.1|  ribosomal protein L13                                   180   3e-51    
ref|XP_624896.1|  PREDICTED: 60S ribosomal protein L13 isoform 1        180   3e-51    
ref|XP_008895254.1|  hypothetical protein PPTG_04728                    179   3e-51    
ref|XP_003694363.1|  PREDICTED: 60S ribosomal protein L13-like is...    180   4e-51    
ref|XP_003694362.1|  PREDICTED: 60S ribosomal protein L13-like is...    179   4e-51    
ref|XP_011161316.1|  PREDICTED: 60S ribosomal protein L13               179   4e-51    
gb|ABX75438.1|  60S ribosomal protein l13                               179   5e-51    
ref|XP_011141542.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    179   6e-51    
emb|CDH52686.1|  60s ribosomal protein l13                              180   7e-51    
ref|XP_004710007.1|  PREDICTED: 60S ribosomal protein L13-like is...    179   7e-51    
ref|XP_011337341.1|  PREDICTED: 60S ribosomal protein L13               179   7e-51    
ref|XP_006897765.1|  PREDICTED: 60S ribosomal protein L13-like is...    179   8e-51    
ref|NP_001037153.1|  ribosomal protein L13                              179   8e-51    
ref|XP_004584149.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    178   1e-50    
ref|XP_003144033.1|  60S ribosomal protein L13                          178   1e-50    
sp|Q962U1.1|RL13_SPOFR  RecName: Full=60S ribosomal protein L13         178   1e-50    
gb|AAV91770.1|  ribosomal protein L13                                   178   1e-50    
emb|CDQ64746.1|  unnamed protein product                                178   1e-50    
ref|XP_011061614.1|  PREDICTED: 60S ribosomal protein L13               178   1e-50    
gb|EDL36150.1|  mCG6146                                                 177   2e-50    
dbj|BAM17673.1|  ribosomal protein L13                                  178   2e-50    
ref|XP_002428060.1|  60S ribosomal protein L13, putative                178   2e-50    
ref|XP_001901016.1|  60S ribosomal protein L13                          177   2e-50    
emb|CAX71654.1|  putative ribosomal protein L13                         177   2e-50    
emb|CEP16016.1|  hypothetical protein                                   180   2e-50    
ref|XP_002128780.1|  PREDICTED: 60S ribosomal protein L13-like          177   2e-50    
emb|CAX77642.1|  putative ribosomal protein L13                         177   3e-50    
emb|CDQ62370.1|  unnamed protein product                                177   3e-50    
emb|CAX71653.1|  putative ribosomal protein L13                         177   3e-50    
gb|AAS49551.1|  ribosomal protein L13                                   176   3e-50    
emb|CAX77649.1|  putative ribosomal protein L13                         177   3e-50    
gb|ESA03652.1|  hypothetical protein GLOINDRAFT_240136                  177   3e-50    
gb|EFO20037.2|  50S ribosomal protein L13e                              178   3e-50    
ref|XP_002710580.1|  PREDICTED: 60S ribosomal protein L13               177   4e-50    
emb|CCD27769.1|  ribosomal protein l13                                  177   4e-50    
gb|KGB37304.1|  60S ribosomal protein L13                               177   4e-50    
ref|XP_011875185.1|  PREDICTED: 60S ribosomal protein L13               177   4e-50    
gb|ABR23469.1|  60S ribosomal protein L13                               177   4e-50    
emb|CDH58842.1|  60s ribosomal protein l13                              178   5e-50    
ref|XP_321255.2|  AGAP001805-PA                                         177   5e-50    
dbj|BAD18973.2|  60S ribosomal protein L13                              177   6e-50    
ref|XP_011643666.1|  PREDICTED: 60S ribosomal protein L13               176   6e-50    
ref|XP_004705772.1|  PREDICTED: 60S ribosomal protein L13-like is...    176   6e-50    
gb|AAS49590.1|  ribosomal protein L13                                   175   7e-50    
ref|XP_005956376.1|  PREDICTED: 60S ribosomal protein L13 isoform X1    176   7e-50    
emb|CDW83808.1|  60s ribosomal protein l13                              176   7e-50    
ref|XP_011699746.1|  PREDICTED: 60S ribosomal protein L13               176   9e-50    
ref|XP_007514005.1|  predicted protein                                  177   9e-50    
gb|AAS49552.1|  ribosomal protein L13                                   175   1e-49    
ref|XP_004639156.1|  PREDICTED: 60S ribosomal protein L13-like is...    175   1e-49    
gb|KIY64210.1|  ribosomal protein L13e                                  175   1e-49    
emb|CAJ17270.1|  ribosomal protein L13e                                 176   1e-49    
ref|XP_011264774.1|  PREDICTED: 60S ribosomal protein L13               176   1e-49    
gb|KFO31870.1|  Paraplegin                                              188   1e-49    
ref|XP_008063583.1|  PREDICTED: 60S ribosomal protein L13               175   2e-49    
gb|EYB89261.1|  hypothetical protein Y032_0234g3156                     175   2e-49    
gb|AAF97844.1|  breast basic conserved protein                          174   2e-49    
gb|EPB73535.1|  ribosomal protein L13e                                  175   2e-49    
gb|KII63010.1|  60S ribosomal protein L13                               174   2e-49    
ref|XP_011671822.1|  PREDICTED: 60S ribosomal protein L13-like          172   3e-49    
ref|XP_009080340.1|  PREDICTED: 60S ribosomal protein L13               173   3e-49    
gb|AAR10069.1|  similar to Drosophila melanogaster RpL13                172   3e-49    
gb|KFP71303.1|  60S ribosomal protein L13                               173   3e-49    



>ref|XP_011084605.1| PREDICTED: 60S ribosomal protein L13-1 [Sesamum indicum]
Length=207

 Score =   336 bits (861),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 173/192 (90%), Positives = 182/192 (95%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHG
Sbjct  1    MVKHNNVVPNGHFRKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGISVDHRRRN SLEG Q NVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGISVDHRRRNRSLEGFQTNVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRR RKFKAGDSTPEELATATQV+GPYLPI+REK +VE VKVT+DMKSFKAYDK
Sbjct  121  AKLVVFPRRVRKFKAGDSTPEELATATQVSGPYLPIVREKPTVELVKVTEDMKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LRLERTNERH+G
Sbjct  181  LRLERTNERHVG  192



>ref|XP_011653106.1| PREDICTED: 60S ribosomal protein L13-3 [Cucumis sativus]
 gb|KGN53190.1| hypothetical protein Csa_4G025200 [Cucumis sativus]
Length=206

 Score =   332 bits (851),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 170/191 (89%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+PSGHFRKHWQNYV+TWFNQPARK RRR ARQ+KAVK FPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPSGHFRKHWQNYVRTWFNQPARKTRRRNARQEKAVKNFPRPTAGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGISVDHRRRN SLE LQANVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGISVDHRRRNRSLESLQANVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            K+VVFPRRARKFKAGDSTPEELA ATQV GPYLPI REKASVE VKVT++MKSFKAYDKL
Sbjct  121  KVVVFPRRARKFKAGDSTPEELANATQVQGPYLPIGREKASVELVKVTEEMKSFKAYDKL  180

Query  353  RLERTNERHIG  321
            R+ERTN RH+G
Sbjct  181  RVERTNARHVG  191



>ref|XP_011075827.1| PREDICTED: 60S ribosomal protein L13-1-like [Sesamum indicum]
Length=207

 Score =   331 bits (849),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/192 (90%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFRKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGISVDHRRRN SLEG Q NVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGISVDHRRRNRSLEGFQTNVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRR RKFKAGDST EELATATQV+GPYLPI+REK +VE VKVTD+MKSFKAY+K
Sbjct  121  AKLVVFPRRVRKFKAGDSTAEELATATQVSGPYLPIVREKPTVELVKVTDEMKSFKAYNK  180

Query  356  LRLERTNERHIG  321
            LRLERTNERH+G
Sbjct  181  LRLERTNERHVG  192



>ref|XP_008453835.1| PREDICTED: 60S ribosomal protein L13-3 [Cucumis melo]
Length=206

 Score =   330 bits (846),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+PSGHFRKHWQNYV+TWFNQPARK RRR ARQ+KAVK FPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPSGHFRKHWQNYVRTWFNQPARKTRRRNARQEKAVKNFPRPTAGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLE LQANVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLESLQANVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            K+VVFPRRARKFKAGDSTPEELA ATQV GPYLPI REKASVE VKVT+DMKSFKAYDKL
Sbjct  121  KVVVFPRRARKFKAGDSTPEELANATQVQGPYLPIGREKASVELVKVTEDMKSFKAYDKL  180

Query  353  RLERTNERHIG  321
            R+ER N RH+G
Sbjct  181  RVERMNARHVG  191



>gb|KJB08613.1| hypothetical protein B456_001G093800 [Gossypium raimondii]
 gb|KJB08614.1| hypothetical protein B456_001G093800 [Gossypium raimondii]
 gb|KJB08615.1| hypothetical protein B456_001G093800 [Gossypium raimondii]
Length=207

 Score =   328 bits (840),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 168/192 (88%), Positives = 182/192 (95%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+RAG+GF+LEELKAAGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFTLEELKAAGISKKLAPTIGIAVDHRRKNKSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARKFKAGDS  EELATATQV GPY+PI REK SVE VKVTDDMKSFKAY+K
Sbjct  121  AKLVVFPRRARKFKAGDSPAEELATATQVQGPYMPISREKPSVELVKVTDDMKSFKAYNK  180

Query  356  LRLERTNERHIG  321
            LR+ERTNERHIG
Sbjct  181  LRVERTNERHIG  192



>ref|XP_012090947.1| PREDICTED: 60S ribosomal protein L13-1-like [Jatropha curcas]
 gb|KDP21801.1| hypothetical protein JCGZ_00588 [Jatropha curcas]
Length=206

 Score =   327 bits (838),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQ+KAVKIFPRPTAG LRPIVHGQ
Sbjct  1    MKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRVARQQKAVKIFPRPTAGPLRPIVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ N+QRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNIQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLVVFPRRARKFKAGDS PEELATATQV G Y+PI+REK SV+ VKVT++MKSFKAYDKL
Sbjct  121  KLVVFPRRARKFKAGDSAPEELATATQVQGQYMPIVREKPSVDLVKVTEEMKSFKAYDKL  180

Query  353  RLERTNERHIG  321
            R+ER NERHIG
Sbjct  181  RVERMNERHIG  191



>ref|XP_012071325.1| PREDICTED: 60S ribosomal protein L13-1 [Jatropha curcas]
 gb|KDP38855.1| hypothetical protein JCGZ_05012 [Jatropha curcas]
Length=206

 Score =   326 bits (836),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/191 (88%), Positives = 178/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQ
Sbjct  1    MKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLVVFPRRARKFKAGDS PEELATATQV G YLPI RE+ S+E VKVT++MKSFKAYDKL
Sbjct  121  KLVVFPRRARKFKAGDSAPEELATATQVQGEYLPIARERPSIELVKVTEEMKSFKAYDKL  180

Query  353  RLERTNERHIG  321
            R+ER N RHIG
Sbjct  181  RVERMNTRHIG  191



>emb|CDP17844.1| unnamed protein product [Coffea canephora]
 emb|CDP08129.1| unnamed protein product [Coffea canephora]
 emb|CDP04953.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   326 bits (836),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 169/192 (88%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVPSGHFRKHWQNYVKTWFNQPARK RRR ARQKKA KIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPSGHFRKHWQNYVKTWFNQPARKTRRRNARQKKAAKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGF+LEELKAAGI KKL PTIG+SVDHRR+N SLEG QANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFTLEELKAAGIPKKLGPTIGVSVDHRRKNRSLEGFQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARKFKAGDS PEELATATQV G YLPI+ EK  VE VKVT++MKSFKAYDK
Sbjct  121  AKLVVFPRRARKFKAGDSAPEELATATQVQGAYLPIVCEKPCVELVKVTEEMKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LRLERTNERHIG
Sbjct  181  LRLERTNERHIG  192



>gb|KHG24237.1| 60S ribosomal L13-2 [Gossypium arboreum]
Length=207

 Score =   325 bits (832),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR +RQKKAV+IFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKARRRISRQKKAVRIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+RAG+GF+LEELKAAGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFTLEELKAAGISKKLAPTIGIAVDHRRKNKSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARKFKAGDST EELATATQV GPY+ I REK SVE VKVT+DMKSFKAY+K
Sbjct  121  AKLVVFPRRARKFKAGDSTAEELATATQVQGPYMRISREKPSVELVKVTEDMKSFKAYNK  180

Query  356  LRLERTNERHIG  321
            LR+ER NERHIG
Sbjct  181  LRVERANERHIG  192



>ref|XP_007158142.1| hypothetical protein PHAVU_002G127900g [Phaseolus vulgaris]
 gb|ESW30136.1| hypothetical protein PHAVU_002G127900g [Phaseolus vulgaris]
Length=207

 Score =   324 bits (831),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/192 (87%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+PSGHFRKHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHG
Sbjct  1    MVKHNNVIPSGHFRKHWQNYVRTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPVVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGISVDHRRRN SLE +Q+NVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGISVDHRRRNRSLESMQSNVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLPI REKA VE VK+TDDMK+FKAY K
Sbjct  121  AKLVVFPRRARKVKAGDSTPEELANATQVQGSYLPIAREKAPVELVKITDDMKAFKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH G
Sbjct  181  LRLERTNKRHFG  192



>gb|AGV54370.1| 60S ribosomal protein L13-2-like protein [Phaseolus vulgaris]
Length=207

 Score =   324 bits (831),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 167/192 (87%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+PSGHFRKHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHG
Sbjct  1    MVKHNNVIPSGHFRKHWQNYVRTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPVVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGISVDHRRRN SLE +Q+NVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGISVDHRRRNRSLESMQSNVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLPI REKA VE VK+TDDMK+FKAY K
Sbjct  121  AKLVVFPRRARKVKAGDSTPEELANATQVQGSYLPIAREKAPVELVKITDDMKAFKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH G
Sbjct  181  LRLERTNKRHFG  192



>ref|XP_006478303.1| PREDICTED: 60S ribosomal protein L13-1-like [Citrus sinensis]
Length=206

 Score =   323 bits (829),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKNRRRVARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMK+RAGRGF+LEELKAAGI KKLAPTIG+SVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLVVFPRRARKFKAGDS PEELATATQV GPY+PI  EK +VE VKVT DMKSFKAYDKL
Sbjct  121  KLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPEKPTVELVKVTQDMKSFKAYDKL  180

Query  353  RLERTNERHIG  321
            R+ER NERH G
Sbjct  181  RIERVNERHFG  191



>gb|KJB42885.1| hypothetical protein B456_007G172400 [Gossypium raimondii]
 gb|KJB42886.1| hypothetical protein B456_007G172400 [Gossypium raimondii]
Length=207

 Score =   323 bits (829),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 182/192 (95%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPT+G LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTSGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+RAG+GF+LEELKAAGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFTLEELKAAGISKKLAPTIGIAVDHRRKNKSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARKFKAGDST EELATATQV G Y+PI REK SVE VKVT++MKSFKAY+K
Sbjct  121  AKLVVFPRRARKFKAGDSTAEELATATQVQGSYMPISREKPSVELVKVTEEMKSFKAYNK  180

Query  356  LRLERTNERHIG  321
            LR+ERTNERHIG
Sbjct  181  LRVERTNERHIG  192



>gb|KHG03134.1| 60S ribosomal L13-2 [Gossypium arboreum]
Length=207

 Score =   323 bits (828),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 182/192 (95%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPT+G LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTSGTLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+RAG+GF+LEELKAAGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFTLEELKAAGISKKLAPTIGIAVDHRRKNKSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFP+RARKFKAGDST EELATATQV G Y+PI REK SVE VKVT++MKSFKAY+K
Sbjct  121  AKLVVFPKRARKFKAGDSTAEELATATQVQGSYMPISREKPSVELVKVTEEMKSFKAYNK  180

Query  356  LRLERTNERHIG  321
            LR+ERTNERHIG
Sbjct  181  LRVERTNERHIG  192



>ref|XP_006441816.1| hypothetical protein CICLE_v10022283mg [Citrus clementina]
 gb|ESR55056.1| hypothetical protein CICLE_v10022283mg [Citrus clementina]
Length=206

 Score =   323 bits (828),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKSRRRVARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMK+RAGRGF+LEELKAAGI KKLAPTIG+SVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLVVFPRRARKFKAGDS PEELATATQV GPY+PI  E+ +VE VKVT DMKSFKAYDKL
Sbjct  121  KLVVFPRRARKFKAGDSAPEELATATQVQGPYMPIAPERPTVELVKVTQDMKSFKAYDKL  180

Query  353  RLERTNERHIG  321
            R+ER NERH G
Sbjct  181  RIERVNERHFG  191



>ref|XP_006451725.1| hypothetical protein CICLE_v10009507mg [Citrus clementina]
 gb|ESR64965.1| hypothetical protein CICLE_v10009507mg [Citrus clementina]
Length=206

 Score =   323 bits (827),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKNRRRVARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMK+RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLVVFPRRARKFKAGDS PEELATATQV GPY+PI  EK +V+ VKVT DMKSFKAYDKL
Sbjct  121  KLVVFPRRARKFKAGDSAPEELATATQVQGPYMPITLEKPTVDLVKVTQDMKSFKAYDKL  180

Query  353  RLERTNERHIG  321
            R+ER NERH G
Sbjct  181  RIERANERHFG  191



>ref|XP_008238048.1| PREDICTED: 60S ribosomal protein L13-1 [Prunus mume]
Length=207

 Score =   323 bits (827),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQ+KAVKIFPRPT+G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRKARQEKAVKIFPRPTSGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVR+GRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRSGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDS+PEELA ATQ+ GPY+PI+REK +VE VKVT+DMK+FKAYDK
Sbjct  121  AKLVVFPRRARKLKAGDSSPEELANATQIQGPYMPIVREKPTVELVKVTNDMKAFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ER NERH+G
Sbjct  181  LRVERMNERHVG  192



>ref|XP_010269352.1| PREDICTED: 60S ribosomal protein L13-1-like [Nelumbo nucifera]
Length=207

 Score =   322 bits (826),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARKFKAGDS+ EELATATQV GPY+ I REK S+E VKVTDDMKSFKAY K
Sbjct  121  AKLVVFPRRARKFKAGDSSAEELATATQVQGPYMCIEREKPSIELVKVTDDMKSFKAYAK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+R +G
Sbjct  181  LRVERMNQRQVG  192



>ref|XP_006485662.1| PREDICTED: 60S ribosomal protein L13-1-like [Citrus sinensis]
 gb|KDO48329.1| hypothetical protein CISIN_1g028624mg [Citrus sinensis]
Length=206

 Score =   322 bits (826),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKNRRRVARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMK+RAGRGF+LEELKAAGI KKLAPTIG+SVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLVVFPRRARKFKAGDS PEELATATQV GPY+PI  EK +V+ VKVT DMKSFKAYDKL
Sbjct  121  KLVVFPRRARKFKAGDSAPEELATATQVQGPYMPITLEKPTVDLVKVTQDMKSFKAYDKL  180

Query  353  RLERTNERHIG  321
            R+ER NERH G
Sbjct  181  RIERANERHFG  191



>gb|KJB22724.1| hypothetical protein B456_004G062900 [Gossypium raimondii]
 gb|KJB22725.1| hypothetical protein B456_004G062900 [Gossypium raimondii]
Length=207

 Score =   322 bits (825),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+RAG+GF+LEELKAAGI+KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFTLEELKAAGISKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDST EELATATQ+ GPY+PI REK SVE VKVT++MKSFKAY+K
Sbjct  121  AKLVVFPRRARKSKAGDSTAEELATATQMQGPYMPIYREKPSVELVKVTEEMKSFKAYNK  180

Query  356  LRLERTNERHIG  321
            LR+ERTN RHIG
Sbjct  181  LRVERTNARHIG  192



>ref|XP_008467320.1| PREDICTED: 60S ribosomal protein L13-3-like [Cucumis melo]
Length=206

 Score =   322 bits (825),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+PSGHFRKHWQNYV+TWFNQPARK RRR ARQ+KAVK FPRPTAG LRPIVHGQ
Sbjct  1    MKHNNVIPSGHFRKHWQNYVRTWFNQPARKTRRRNARQEKAVKAFPRPTAGPLRPIVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAGRGFSLEELKAAGI KK APTIGI+VDHRRRN SLE LQANVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKYAPTIGIAVDHRRRNRSLESLQANVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            K+VVFPRRARKFKAGDSTPEELATATQV G Y+PI  EK SVE VKVT+DMKSFKAYDKL
Sbjct  121  KVVVFPRRARKFKAGDSTPEELATATQVQGSYMPIGLEKPSVELVKVTEDMKSFKAYDKL  180

Query  353  RLERTNERHIG  321
            R+ER N RH+G
Sbjct  181  RVERANARHVG  191



>ref|XP_007049063.1| 60S ribosomal protein L13 [Theobroma cacao]
 gb|EOX93220.1| 60S ribosomal protein L13 [Theobroma cacao]
Length=207

 Score =   322 bits (824),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPT+G LRPIVHG
Sbjct  1    MVKHNNVIPNGHFRKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTSGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+RAG+GF+LEELKAAGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFTLEELKAAGISKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARKFKAGDST EELATATQV GPY+PI  EK SVE VKVT++MKSFKAY+K
Sbjct  121  AKLVVFPRRARKFKAGDSTAEELATATQVQGPYMPISLEKPSVELVKVTEEMKSFKAYNK  180

Query  356  LRLERTNERHIG  321
            LR+ER NERHIG
Sbjct  181  LRVERMNERHIG  192



>ref|XP_002529265.1| 60S ribosomal protein L13, putative [Ricinus communis]
 gb|EEF33097.1| 60S ribosomal protein L13, putative [Ricinus communis]
Length=207

 Score =   322 bits (824),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+RAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDS PEELATATQV G Y+PI+REK SVE VKVT++MKSFKAYDK
Sbjct  121  AKLVVFPRRARKSKAGDSAPEELATATQVQGKYMPIVREKPSVELVKVTEEMKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+RH+G
Sbjct  181  LRVERMNQRHLG  192



>ref|XP_011028035.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
 ref|XP_011028036.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
Length=207

 Score =   322 bits (824),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEG+QAN++RL TYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGIQANIRRLNTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDS PEELATATQV G +LPI+REKASVE VKVT++MKSFKAYDK
Sbjct  121  AKLVVFPRRARKLKAGDSAPEELATATQVQGQFLPIVREKASVELVKVTEEMKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR ERTN RH+G
Sbjct  181  LRAERTNARHVG  192



>ref|XP_010054042.1| PREDICTED: 60S ribosomal protein L13-2 [Eucalyptus grandis]
 gb|KCW78426.1| hypothetical protein EUGRSUZ_D02588 [Eucalyptus grandis]
Length=206

 Score =   322 bits (824),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNVVPSGHFRKHWQNYVKTWFNQPARK RRR ARQ+KAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVVPSGHFRKHWQNYVKTWFNQPARKSRRRQARQQKAVKIFPRPTAGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAG+GFSLEELK+AGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYKA
Sbjct  61   TLKYNMKVRAGKGFSLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLVVFPRRARKFKAGDST EELA+ATQV G Y+PI+REK +VE VKVT++MKSF AY KL
Sbjct  121  KLVVFPRRARKFKAGDSTAEELASATQVQGSYMPIVREKPAVELVKVTEEMKSFNAYAKL  180

Query  353  RLERTNERHIG  321
            R+ER N RH+G
Sbjct  181  RVERMNTRHVG  191



>ref|XP_009795347.1| PREDICTED: 60S ribosomal protein L13-1 [Nicotiana sylvestris]
Length=206

 Score =   322 bits (824),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/191 (87%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGTLRPIVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVR+GRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRSGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLVVFPRRARK KAGDS PEELATATQV+G Y+PI REK SV+ VKVT++MKSF AY KL
Sbjct  121  KLVVFPRRARKVKAGDSAPEELATATQVHGAYMPIAREKPSVDLVKVTEEMKSFNAYGKL  180

Query  353  RLERTNERHIG  321
            R+ERTNERHIG
Sbjct  181  RVERTNERHIG  191



>ref|XP_004143667.1| PREDICTED: 60S ribosomal protein L13-3-like [Cucumis sativus]
 gb|KGN50340.1| hypothetical protein Csa_5G168780 [Cucumis sativus]
Length=206

 Score =   321 bits (823),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+PSGHFRKHWQNYV+TWFNQPARK RRR ARQ+KAVK FPRPTAG LRPIVHGQ
Sbjct  1    MKHNNVIPSGHFRKHWQNYVRTWFNQPARKTRRRNARQEKAVKAFPRPTAGPLRPIVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAGRGFSLEELKAAGI KK APTIGI+VDHRRRN SLE LQANVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKYAPTIGIAVDHRRRNRSLESLQANVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            K+VVFPRRARKFKAGDSTPEELATATQV G Y+PI  EK SVE VK+T+DMKSFKAYDKL
Sbjct  121  KVVVFPRRARKFKAGDSTPEELATATQVQGSYMPIGLEKPSVELVKITEDMKSFKAYDKL  180

Query  353  RLERTNERHIG  321
            R+ER N RH+G
Sbjct  181  RVERANARHVG  191



>ref|XP_004245965.1| PREDICTED: 60S ribosomal protein L13-1-like [Solanum lycopersicum]
Length=206

 Score =   321 bits (823),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/191 (86%), Positives = 180/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYV+TWFNQPARK RRRAARQ+KAVKIFPRPTAG+LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRAARQQKAVKIFPRPTAGSLRPIVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRA+K KAGDS+ EELATATQV GPYLPI RE+ +V+FVKVTD+MKSFKAY KL
Sbjct  121  KLVIFPRRAKKVKAGDSSAEELATATQVQGPYLPITREQPAVDFVKVTDEMKSFKAYGKL  180

Query  353  RLERTNERHIG  321
            R+ERTN RH+G
Sbjct  181  RIERTNARHMG  191



>ref|XP_007209605.1| hypothetical protein PRUPE_ppa011506mg [Prunus persica]
 gb|EMJ10804.1| hypothetical protein PRUPE_ppa011506mg [Prunus persica]
Length=207

 Score =   321 bits (822),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQ+KAVKIFPRPT+G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRKARQEKAVKIFPRPTSGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVR+GRGF+LEELK AGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRSGRGFTLEELKTAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDS+PEELA ATQ+ GPY+PI+REK +VE VKVT+DMK+FKAYDK
Sbjct  121  AKLVVFPRRARKLKAGDSSPEELANATQIQGPYMPIVREKPTVELVKVTNDMKAFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ER NERH+G
Sbjct  181  LRVERMNERHVG  192



>gb|KHG21579.1| 60S ribosomal L13-2 [Gossypium arboreum]
Length=207

 Score =   321 bits (822),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 181/192 (94%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+RAG+GF+LEELKAAGI+KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFTLEELKAAGISKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDST EELATATQV GPY+PI REK SVE VKVT++MKSFKAY+K
Sbjct  121  AKLVVFPRRARKSKAGDSTAEELATATQVQGPYMPISREKPSVELVKVTEEMKSFKAYNK  180

Query  356  LRLERTNERHIG  321
            LR+ERTN R+IG
Sbjct  181  LRVERTNARYIG  192



>ref|XP_002304378.1| 60S ribosomal protein L13 [Populus trichocarpa]
 gb|ABK93509.1| unknown [Populus trichocarpa]
 gb|EEE79357.1| 60S ribosomal protein L13 [Populus trichocarpa]
Length=207

 Score =   321 bits (822),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEG+QAN++RL TYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGIQANIRRLNTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDS PEELATATQV G ++PI+REKASVE VKVT++MKSFKAYDK
Sbjct  121  AKLVVFPRRARKLKAGDSAPEELATATQVQGQFMPIVREKASVELVKVTEEMKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR ERTN RH+G
Sbjct  181  LRAERTNARHVG  192



>ref|XP_006368290.1| 60S ribosomal protein L13 [Populus trichocarpa]
 gb|ERP64859.1| 60S ribosomal protein L13 [Populus trichocarpa]
Length=207

 Score =   320 bits (821),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDS PEELATATQV G ++PI+REK SVE VKVT++MKSF+AYDK
Sbjct  121  AKLVVFPRRARKSKAGDSAPEELATATQVQGHFMPIVREKPSVELVKVTEEMKSFRAYDK  180

Query  356  LRLERTNERHIG  321
            LR ERTN RH+G
Sbjct  181  LRAERTNARHVG  192



>ref|XP_011018407.1| PREDICTED: 60S ribosomal protein L13-1 [Populus euphratica]
Length=207

 Score =   320 bits (821),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 167/192 (87%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDS PEELATATQV G ++PI+REK SVE VKVT +MKSFKAYDK
Sbjct  121  AKLVVFPRRARKSKAGDSAPEELATATQVQGHFMPIVREKPSVELVKVTAEMKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR ERTN RH+G
Sbjct  181  LRAERTNARHVG  192



>gb|AAQ96375.1| 60S ribosomal protein L13 [Solanum palustre]
Length=200

 Score =   320 bits (820),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYV+TWFNQPARK RRRAARQ+KAVKIFPRPTAG+LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRAARQQKAVKIFPRPTAGSLRPIVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRA+K KAGDS+ EELATATQV GPYLPI RE+ +V+FVKVTD+MKSF AY KL
Sbjct  121  KLVIFPRRAKKVKAGDSSAEELATATQVQGPYLPITREQPAVDFVKVTDEMKSFXAYGKL  180

Query  353  RLERTNERHIG  321
            R+ERTN RH+G
Sbjct  181  RIERTNARHVG  191



>ref|XP_011023520.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
 ref|XP_011023521.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
 ref|XP_011013522.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
 ref|XP_011013523.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
Length=207

 Score =   320 bits (821),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARKFKAGDS PEELATATQV G  +PI+ EK SVE VKVT++MKSF+AYDK
Sbjct  121  AKLVVFPRRARKFKAGDSAPEELATATQVQGQIMPIVLEKPSVELVKVTEEMKSFRAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ERT+ RH+G
Sbjct  181  LRVERTSARHVG  192



>ref|XP_009619310.1| PREDICTED: 60S ribosomal protein L13-1 [Nicotiana tomentosiformis]
Length=206

 Score =   320 bits (821),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 165/191 (86%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGTLRPIVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVR+GRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRSGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLVVFPRRAR+ KAGDS PEELATATQV+G Y+PI REK SV+ VKVT++MKSF AY KL
Sbjct  121  KLVVFPRRARQVKAGDSAPEELATATQVHGAYMPIAREKPSVDLVKVTEEMKSFNAYGKL  180

Query  353  RLERTNERHIG  321
            R+ERTNERHIG
Sbjct  181  RVERTNERHIG  191



>ref|XP_003522855.1| PREDICTED: 60S ribosomal protein L13-1-like isoform X1 [Glycine 
max]
 ref|XP_006578380.1| PREDICTED: 60S ribosomal protein L13-1-like isoform X2 [Glycine 
max]
 gb|KHN06098.1| 60S ribosomal protein L13-2 [Glycine soja]
Length=207

 Score =   320 bits (820),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNGHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLESLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRA+K KAGDSTPEELA ATQV G +LPI+REK +VE VKVTDDMK+FKAY K
Sbjct  121  AKLVVFPRRAQKVKAGDSTPEELANATQVQGSFLPIVREKPTVELVKVTDDMKAFKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH G
Sbjct  181  LRLERTNKRHYG  192



>ref|XP_010243468.1| PREDICTED: 60S ribosomal protein L13-1 [Nelumbo nucifera]
Length=207

 Score =   320 bits (819),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARKFKAGDS+ EELATATQV G Y+PI REK S+E VKVTD+MKSFKAY K
Sbjct  121  AKLVVFPRRARKFKAGDSSAEELATATQVQGAYMPIEREKPSIELVKVTDEMKSFKAYAK  180

Query  356  LRLERTNERHIG  321
            LR+ER N R +G
Sbjct  181  LRVERMNTRQVG  192



>ref|XP_002519996.1| 60S ribosomal protein L13, putative [Ricinus communis]
 gb|EEF42320.1| 60S ribosomal protein L13, putative [Ricinus communis]
Length=207

 Score =   320 bits (819),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 166/192 (86%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRRAARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRAARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+RAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARKFKAGDS  EELATATQV G Y+PI REK SVE VKVT++MKSFKAYDK
Sbjct  121  AKLVVFPRRARKFKAGDSAAEELATATQVQGQYMPIAREKPSVELVKVTEEMKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+RH+G
Sbjct  181  LRVERMNQRHLG  192



>emb|CDP19062.1| unnamed protein product [Coffea canephora]
Length=207

 Score =   319 bits (818),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVPS HFRKHWQNYVKTWFNQPARK RRR ARQKKAV IFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPSSHFRKHWQNYVKTWFNQPARKTRRRNARQKKAVAIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI  KLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPTKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLV+FPRRA+K K+GDS+PEELATATQV G Y+PI REK +VE VKVT +MKSFKAYDK
Sbjct  121  AKLVIFPRRAKKIKSGDSSPEELATATQVQGSYMPITREKPTVELVKVTQEMKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LRLERTN RH+G
Sbjct  181  LRLERTNARHVG  192



>ref|XP_002319032.1| hypothetical protein POPTR_0013s02860g [Populus trichocarpa]
 ref|XP_006375784.1| 60S ribosomal protein L13 [Populus trichocarpa]
 gb|EEE94955.1| hypothetical protein POPTR_0013s02860g [Populus trichocarpa]
 gb|ERP53581.1| 60S ribosomal protein L13 [Populus trichocarpa]
Length=207

 Score =   319 bits (818),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARKFKAGDS PEELATATQV G  +PI+ EK  VE VKVT++MKSF+AYDK
Sbjct  121  AKLVVFPRRARKFKAGDSAPEELATATQVQGQIMPIVLEKPCVELVKVTEEMKSFRAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ERT+ RH+G
Sbjct  181  LRVERTSARHVG  192



>ref|XP_007218412.1| hypothetical protein PRUPE_ppa011512mg [Prunus persica]
 ref|XP_007218413.1| hypothetical protein PRUPE_ppa011512mg [Prunus persica]
 ref|XP_007218414.1| hypothetical protein PRUPE_ppa011512mg [Prunus persica]
 gb|EMJ19611.1| hypothetical protein PRUPE_ppa011512mg [Prunus persica]
 gb|EMJ19612.1| hypothetical protein PRUPE_ppa011512mg [Prunus persica]
 gb|EMJ19613.1| hypothetical protein PRUPE_ppa011512mg [Prunus persica]
Length=207

 Score =   319 bits (817),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+RAGRGF+LEELK+AGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKIRAGRGFTLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRA KFKAGDS PEELA ATQ+ G YLPI REK SVE VKVTDD+KSFKAYDK
Sbjct  121  AKLVVFPRRAGKFKAGDSAPEELANATQLQGSYLPIAREKPSVELVKVTDDLKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+RH+G
Sbjct  181  LRVERMNQRHVG  192



>ref|XP_010503548.1| PREDICTED: 60S ribosomal protein L13-1 [Camelina sativa]
 ref|XP_010515238.1| PREDICTED: 60S ribosomal protein L13-1 [Camelina sativa]
Length=206

 Score =   319 bits (817),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQTNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRARK KAGDSTPEELA ATQV G Y+PI+REK ++E VK+T DMKSFKAYDKL
Sbjct  121  KLVIFPRRARKVKAGDSTPEELANATQVQGDYMPIVREKPTMELVKLTSDMKSFKAYDKL  180

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  181  RLERTNKRHAG  191



>emb|CAN80613.1| hypothetical protein VITISV_025451 [Vitis vinifera]
Length=207

 Score =   318 bits (816),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRP+VHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTVGPLRPLVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGISVDHRR+N SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLESLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARKFKAGDS PEEL TATQV G Y+P+++EK  VE VKVTD+MKSFKAY K
Sbjct  121  AKLVVFPRRARKFKAGDSAPEELGTATQVQGQYMPVVQEKPXVELVKVTDEMKSFKAYGK  180

Query  356  LRLERTNERHIG  321
            LR+ER NERH+G
Sbjct  181  LRVERMNERHVG  192



>gb|ACJ83949.1| unknown [Medicago truncatula]
 gb|AFK42168.1| unknown [Medicago truncatula]
 gb|KEH40126.1| 60S ribosomal L13-like protein [Medicago truncatula]
Length=207

 Score =   318 bits (816),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMK+RAG+GFSLEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTAKYNMKLRAGKGFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLPI+REK +VE VKVTD+MK+FKAY K
Sbjct  121  AKLVVFPRRARKTKAGDSTPEELANATQVQGSYLPIVREKPTVELVKVTDEMKAFKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH+G
Sbjct  181  LRLERTNKRHLG  192



>gb|AFK39980.1| unknown [Lotus japonicus]
Length=207

 Score =   318 bits (816),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/190 (87%), Positives = 177/190 (93%), Gaps = 0/190 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG+LRP+VHG
Sbjct  1    MVKHNNVIPNGHFRKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGSLRPMVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAG+GFSLEELKAAGI +KLAPTIGISVDHRRRN SLEGLQANV RLKTYK
Sbjct  61   QTLKYNMKVRAGKGFSLEELKAAGIPRKLAPTIGISVDHRRRNRSLEGLQANVHRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLPI+RE+ SVE VKVTD+MK FKAY K
Sbjct  121  AKLVVFPRRARKVKAGDSTPEELANATQVQGTYLPIVRERPSVELVKVTDEMKEFKAYYK  180

Query  356  LRLERTNERH  327
            LRLERTN+RH
Sbjct  181  LRLERTNKRH  190



>ref|XP_003626150.1| 60S ribosomal protein L13 [Medicago truncatula]
 gb|AES82368.1| 60S ribosomal L13-like protein [Medicago truncatula]
 gb|AFK42534.1| unknown [Medicago truncatula]
Length=207

 Score =   318 bits (816),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMK+RAG+GFSLEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTQKYNMKLRAGKGFSLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLPI+REK SVE VK+TD+MK+FKAY K
Sbjct  121  AKLVVFPRRARKVKAGDSTPEELANATQVQGSYLPIVREKPSVELVKITDEMKAFKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH+G
Sbjct  181  LRLERTNKRHLG  192



>ref|XP_002274000.1| PREDICTED: 60S ribosomal protein L13-1 [Vitis vinifera]
 emb|CBI29087.3| unnamed protein product [Vitis vinifera]
Length=207

 Score =   318 bits (815),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRP+VHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTVGPLRPLVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGISVDHRR+N SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLESLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARKFKAGDS PEEL TATQV G Y+P+++EK  VE VKVTD+MKSFKAY K
Sbjct  121  AKLVVFPRRARKFKAGDSAPEELGTATQVQGQYMPVVQEKPVVELVKVTDEMKSFKAYGK  180

Query  356  LRLERTNERHIG  321
            LR+ER NERH+G
Sbjct  181  LRVERMNERHVG  192



>ref|NP_001275203.1| 60S ribosomal protein L13 [Solanum tuberosum]
 ref|XP_006364452.1| PREDICTED: 60S ribosomal protein L13-1-like [Solanum tuberosum]
 gb|ABA46764.1| unknown [Solanum tuberosum]
 gb|AFW90558.1| 60S ribosomal protein L13 [Solanum tuberosum]
Length=206

 Score =   318 bits (815),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 163/191 (85%), Positives = 179/191 (94%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYV+TWFNQPARK RRRAARQ+KAVKIFPRPTAG+LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRAARQQKAVKIFPRPTAGSLRPIVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRA+K KAGDS+ EELATATQV G YLPI RE+ +V+FVKVTD+MKSFKAY KL
Sbjct  121  KLVIFPRRAKKVKAGDSSAEELATATQVQGSYLPITREQPAVDFVKVTDEMKSFKAYGKL  180

Query  353  RLERTNERHIG  321
            R+ERTN RH+G
Sbjct  181  RIERTNARHMG  191



>ref|XP_002322840.2| hypothetical protein POPTR_0016s08310g [Populus trichocarpa]
 gb|EEF04601.2| hypothetical protein POPTR_0016s08310g [Populus trichocarpa]
Length=207

 Score =   318 bits (814),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQAN+QRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNHSLEGLQANIQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPR ARKFKAGDS PEELATATQV G  +PI  EK SVE VKVT++MKSFKAYDK
Sbjct  121  AKLVVFPRHARKFKAGDSAPEELATATQVQGHIMPIACEKPSVELVKVTEEMKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ERTN RH+G
Sbjct  181  LRVERTNARHVG  192



>ref|XP_010269338.1| PREDICTED: 60S ribosomal protein L13-1-like [Nelumbo nucifera]
Length=207

 Score =   318 bits (814),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRA KFKAGDS+ EELATATQV G Y+PI REK SVE VKVTDDMKSFKAY K
Sbjct  121  AKLVVFPRRACKFKAGDSSAEELATATQVQGLYMPIEREKPSVELVKVTDDMKSFKAYAK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+R +G
Sbjct  181  LRVERMNQRQVG  192



>ref|XP_008234598.1| PREDICTED: 60S ribosomal protein L13-3-like [Prunus mume]
 ref|XP_008234599.1| PREDICTED: 60S ribosomal protein L13-3-like [Prunus mume]
Length=207

 Score =   317 bits (813),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+RAGRGF+LEELK+AGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKIRAGRGFTLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRA KFKAGDS PEELA ATQ+ G YLPI REK SVE VKVT+D+KSFKAYDK
Sbjct  121  AKLVVFPRRAGKFKAGDSAPEELANATQLQGSYLPIAREKPSVELVKVTEDLKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+RH+G
Sbjct  181  LRVERMNQRHVG  192



>emb|CAN84167.1| hypothetical protein VITISV_018882 [Vitis vinifera]
Length=207

 Score =   317 bits (813),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLESLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRR RKFKAGDS+ EELATATQV G Y+PI+REK +VE VKVTD+MKSFKAY K
Sbjct  121  AKLVVFPRRTRKFKAGDSSVEELATATQVQGLYMPIVREKPTVELVKVTDEMKSFKAYGK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+RH+G
Sbjct  181  LRVERMNQRHVG  192



>gb|KHG20106.1| 60S ribosomal L13-1 [Gossypium arboreum]
Length=207

 Score =   317 bits (812),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 180/192 (94%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPTAG LRP+VHG
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTAGPLRPVVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+RAG+GF+LEELKAAGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFTLEELKAAGISKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPR ARKFKAGDST EELATATQV G Y+PI REK SV+ VKVT++MKSFKAY+K
Sbjct  121  AKLVVFPRCARKFKAGDSTAEELATATQVQGSYMPISREKPSVDLVKVTEEMKSFKAYNK  180

Query  356  LRLERTNERHIG  321
            LR+ER NERHIG
Sbjct  181  LRVERMNERHIG  192



>ref|XP_011048445.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
 ref|XP_011048446.1| PREDICTED: 60S ribosomal protein L13-1-like [Populus euphratica]
Length=207

 Score =   317 bits (812),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQAN+QRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNHSLEGLQANIQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRA KFKAGDS PEELATATQV G  +PI  EK SVE VKVT++MKSFKAYDK
Sbjct  121  AKLVVFPRRAHKFKAGDSAPEELATATQVQGHIMPIACEKPSVELVKVTEEMKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR ERTN RH+G
Sbjct  181  LRAERTNARHVG  192



>gb|AFK45847.1| unknown [Medicago truncatula]
 gb|AES95552.2| 60S ribosomal L13-like protein [Medicago truncatula]
Length=207

 Score =   317 bits (811),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMK+RAG+GFSLEELKAAGI KKLAPTIGIS+DHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTQKYNMKLRAGKGFSLEELKAAGIPKKLAPTIGISIDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLPI+ EK SVE VK+TD+MK+FKAY K
Sbjct  121  AKLVVFPRRARKVKAGDSTPEELANATQVQGSYLPIVSEKPSVELVKITDEMKAFKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH+G
Sbjct  181  LRLERTNKRHLG  192



>gb|AFK47578.1| unknown [Medicago truncatula]
Length=207

 Score =   317 bits (811),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMK+RAG+GFSLEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTAKYNMKLRAGKGFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLPI+REK +VE VKVTD+MK+ KAY K
Sbjct  121  AKLVVFPRRARKTKAGDSTPEELANATQVQGSYLPIVREKPTVELVKVTDEMKALKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH+G
Sbjct  181  LRLERTNKRHLG  192



>ref|XP_009382822.1| PREDICTED: 60S ribosomal protein L13-1-like [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   317 bits (811),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK R+GRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRSGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLV+FPRR RKFKAGDS+PEELATATQV GPYLPI+RE+ SVE VKVTD+MKSFKAY K
Sbjct  121  AKLVIFPRRTRKFKAGDSSPEELATATQVQGPYLPIVREQPSVELVKVTDEMKSFKAYAK  180

Query  356  LRLERTNERHIG  321
            LR+ER NER +G
Sbjct  181  LRVERMNERQVG  192



>ref|XP_003534321.1| PREDICTED: 60S ribosomal protein L13-1 isoformX1 [Glycine max]
 ref|XP_006587640.1| PREDICTED: 60S ribosomal protein L13-1 isoform X2 [Glycine max]
 gb|KHN11825.1| 60S ribosomal protein L13-2 [Glycine soja]
Length=207

 Score =   316 bits (810),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNGHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVR GRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRGGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLESLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRA K KAGDSTPEELA ATQV G +LPI+REK +VE VKVTDDMK+FKAY K
Sbjct  121  AKLVVFPRRAHKVKAGDSTPEELANATQVQGAFLPIVREKPTVELVKVTDDMKAFKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH G
Sbjct  181  LRLERTNKRHHG  192



>ref|XP_002277094.1| PREDICTED: 60S ribosomal protein L13-1 [Vitis vinifera]
 emb|CBI33499.3| unnamed protein product [Vitis vinifera]
Length=207

 Score =   316 bits (809),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELK AGI KKLAPTIGI+VDHRRRN SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKVAGIPKKLAPTIGIAVDHRRRNRSLESLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRR RKFKAGDS+ EELATATQV G Y+PI+REK +VE VKVTD+MKSFKAY K
Sbjct  121  AKLVVFPRRTRKFKAGDSSVEELATATQVQGLYMPIVREKPTVELVKVTDEMKSFKAYGK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+RH+G
Sbjct  181  LRVERMNQRHVG  192



>ref|XP_007156319.1| hypothetical protein PHAVU_003G276400g [Phaseolus vulgaris]
 ref|XP_007156320.1| hypothetical protein PHAVU_003G276500g [Phaseolus vulgaris]
 gb|ESW28313.1| hypothetical protein PHAVU_003G276400g [Phaseolus vulgaris]
 gb|ESW28314.1| hypothetical protein PHAVU_003G276500g [Phaseolus vulgaris]
Length=206

 Score =   316 bits (809),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+PSGHFRKHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPSGHFRKHWQNYVRTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMK+RAGRGFSLEELK+AGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKIRAGRGFSLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQGNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLVVFPR+ARK K GDS+ EELA+ATQV GP+LPI+REK +V+ VKVTD+MK+FKAY KL
Sbjct  121  KLVVFPRQARKVKTGDSSAEELASATQVQGPFLPIVREKPTVDLVKVTDEMKAFKAYYKL  180

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  181  RLERTNQRHYG  191



>gb|ACJ83987.1| unknown [Medicago truncatula]
Length=207

 Score =   315 bits (808),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMK+RAG+GFSLEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKT K
Sbjct  61   QTAKYNMKLRAGKGFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTCK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLPI+REK +VE VKVTD+MK+FKAY K
Sbjct  121  AKLVVFPRRARKTKAGDSTPEELANATQVQGSYLPIVREKPTVELVKVTDEMKAFKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH+G
Sbjct  181  LRLERTNKRHLG  192



>ref|XP_003547825.1| PREDICTED: 60S ribosomal protein L13-1-like [Glycine max]
 gb|KHM99443.1| 60S ribosomal protein L13-2 [Glycine soja]
Length=207

 Score =   315 bits (808),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG+LRPIVHG
Sbjct  1    MVKHNNVIPNGHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGSLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGISVDHRR+N SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLESLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRA K KAGDS+ EELA ATQV GP+LPI+REK +V+ VKVTD+MK+FKAY K
Sbjct  121  AKLVVFPRRAHKVKAGDSSLEELANATQVQGPFLPIVREKPTVDLVKVTDEMKAFKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH G
Sbjct  181  LRLERTNKRHHG  192



>ref|XP_010940804.1| PREDICTED: 60S ribosomal protein L13-1 [Elaeis guineensis]
 ref|XP_010940805.1| PREDICTED: 60S ribosomal protein L13-1 [Elaeis guineensis]
Length=207

 Score =   315 bits (808),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVRTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLV+FPRRARKFKAGDS PEELATATQV GPY+P++REK +VE VKVTD+MKSF+AY K
Sbjct  121  AKLVIFPRRARKFKAGDSAPEELATATQVQGPYMPVVREKPTVELVKVTDEMKSFRAYAK  180

Query  356  LRLERTNERHIG  321
            LR+ER NER +G
Sbjct  181  LRVERMNERQVG  192



>ref|XP_010426404.1| PREDICTED: 60S ribosomal protein L13-1-like [Camelina sativa]
Length=206

 Score =   315 bits (807),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQTNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRARK KAGDSTPEELA ATQV G Y+PI+REK ++E VK+T +M SFKAYDKL
Sbjct  121  KLVIFPRRARKVKAGDSTPEELANATQVQGDYMPIVREKPTMELVKLTSEMTSFKAYDKL  180

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  181  RLERTNKRHAG  191



>ref|XP_010056172.1| PREDICTED: 60S ribosomal protein L13-1-like [Eucalyptus grandis]
 ref|XP_010056173.1| PREDICTED: 60S ribosomal protein L13-1-like [Eucalyptus grandis]
 gb|KCW72772.1| hypothetical protein EUGRSUZ_E01220 [Eucalyptus grandis]
 gb|KCW72773.1| hypothetical protein EUGRSUZ_E01220 [Eucalyptus grandis]
 gb|KCW72774.1| hypothetical protein EUGRSUZ_E01220 [Eucalyptus grandis]
 gb|KCW72775.1| hypothetical protein EUGRSUZ_E01220 [Eucalyptus grandis]
Length=207

 Score =   315 bits (807),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVPSGHFRKHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPTAG LRP+VHG
Sbjct  1    MVKHNNVVPSGHFRKHWQNYVKTWFNQPARKARRRLARQKKAVRIFPRPTAGPLRPVVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT+KYNMKVRAG+GFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQAN+QRLKTY+
Sbjct  61   QTVKYNMKVRAGKGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANMQRLKTYR  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPR ARKFKAGDSTPEELA ATQV G YLPI+REK +VE VKVTD+MKSF AY K
Sbjct  121  AKLVVFPRHARKFKAGDSTPEELANATQVQGTYLPIVREKPAVELVKVTDEMKSFNAYAK  180

Query  356  LRLERTNERHIG  321
            LR+ER N RH+G
Sbjct  181  LRVERMNIRHVG  192



>gb|AFK36916.1| unknown [Medicago truncatula]
Length=207

 Score =   315 bits (807),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMK+RAG+GFSLEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTAKYNMKLRAGKGFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLPI+REK +V  VKVTD+MK+FKAY K
Sbjct  121  AKLVVFPRRARKTKAGDSTPEELANATQVQGSYLPIVREKPTVGLVKVTDEMKAFKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH+G
Sbjct  181  LRLERTNKRHLG  192



>ref|XP_003612594.1| 60S ribosomal protein L13 [Medicago truncatula]
Length=240

 Score =   316 bits (810),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  34   MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  93

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMK+RAG+GFSLEELKAAGI KKLAPTIGIS+DHRR+N SLEGLQANVQRLKTYK
Sbjct  94   QTQKYNMKLRAGKGFSLEELKAAGIPKKLAPTIGISIDHRRKNRSLEGLQANVQRLKTYK  153

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLPI+ EK SVE VK+TD+MK+FKAY K
Sbjct  154  AKLVVFPRRARKVKAGDSTPEELANATQVQGSYLPIVSEKPSVELVKITDEMKAFKAYYK  213

Query  356  LRLERTNERHIG  321
            LRLERTN+RH+G
Sbjct  214  LRLERTNKRHLG  225



>ref|XP_009595065.1| PREDICTED: 60S ribosomal protein L13-2 [Nicotiana tomentosiformis]
Length=206

 Score =   315 bits (806),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 161/191 (84%), Positives = 177/191 (93%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYV+TWFNQPARK RRRAARQ+KAVKIFPRPTAG+LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRAARQQKAVKIFPRPTAGSLRPIVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRA+K KAGDS+ EELATATQV G Y+PI RE+ +V+ VKVTD+MKSF AY KL
Sbjct  121  KLVIFPRRAKKVKAGDSSAEELATATQVQGSYMPITREQPAVDLVKVTDEMKSFNAYGKL  180

Query  353  RLERTNERHIG  321
            R+ERTN RHIG
Sbjct  181  RIERTNARHIG  191



>ref|XP_010906706.1| PREDICTED: 60S ribosomal protein L13-1-like [Elaeis guineensis]
Length=207

 Score =   315 bits (806),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVRTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLV+FPRRARKFKAGDS PEELATATQV GPY+PI+ EK SVE VKVTD+MKSF+AY K
Sbjct  121  AKLVIFPRRARKFKAGDSAPEELATATQVQGPYMPIVCEKPSVELVKVTDEMKSFRAYAK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+R +G
Sbjct  181  LRVERMNQRQVG  192



>ref|XP_004499145.1| PREDICTED: 60S ribosomal protein L13-1-like [Cicer arietinum]
Length=207

 Score =   315 bits (806),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPLVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMK+RAG+GFSLEELKAAGI KKLAPTIGI++DHRRRN SLEGLQANVQRLKTYK
Sbjct  61   QTAKYNMKLRAGKGFSLEELKAAGIPKKLAPTIGIAIDHRRRNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDSTPEELA ATQV G YLP++REK +VE VK+TD+MK+FKAY K
Sbjct  121  AKLVVFPRRARKTKAGDSTPEELANATQVQGSYLPVVREKPTVELVKITDEMKAFKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH G
Sbjct  181  LRLERTNKRHYG  192



>ref|XP_009348808.1| PREDICTED: 60S ribosomal protein L13-1-like [Pyrus x bretschneideri]
Length=207

 Score =   315 bits (806),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 179/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGF+LEELK+AGI+KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFTLEELKSAGISKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRA++FKAGDS  EE+A ATQ++GPYLPI REK +VE VKVTD++KSFKAYDK
Sbjct  121  AKLVVFPRRAKQFKAGDSPAEEIANATQLHGPYLPIAREKPTVELVKVTDELKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+RH+G
Sbjct  181  LRVERMNKRHVG  192



>gb|AFK44824.1| unknown [Lotus japonicus]
Length=207

 Score =   314 bits (805),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFP+PTAG LRPIVHG
Sbjct  1    MVKHNNVIPNGHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPKPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAG+ +KLAPTIGISVDHRRRN SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGVPRKLAPTIGISVDHRRRNRSLESLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDS+PEE A ATQV G YLPI++E+  VE VK+TD+MK+FKAY K
Sbjct  121  AKLVVFPRRARKVKAGDSSPEERANATQVQGQYLPIVKERPPVELVKITDEMKAFKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH G
Sbjct  181  LRLERTNQRHFG  192



>ref|NP_001276322.1| 60S ribosomal protein L13-1-like [Glycine max]
 gb|ACU14467.1| unknown [Glycine max]
Length=231

 Score =   315 bits (807),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 164/192 (85%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG+LRPIVHG
Sbjct  1    MVKHNNVIPNGHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGSLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGISVDHRR+N SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLESLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRA K KAGDS+ EELA ATQV GP+LPI+REK +V+ VKVTD+MK+FKAY K
Sbjct  121  AKLVVFPRRAHKVKAGDSSLEELANATQVQGPFLPIVREKPTVDLVKVTDEMKAFKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH G
Sbjct  181  LRLERTNKRHHG  192



>ref|XP_002877641.1| ATBBC1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53900.1| ATBBC1 [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   314 bits (804),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYK 
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKT  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRARK KAGDSTPEELA ATQV G YLPI+REK ++E VK+T +MKSFKAYDK+
Sbjct  121  KLVIFPRRARKVKAGDSTPEELANATQVQGDYLPIVREKPTMELVKLTSEMKSFKAYDKI  180

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  181  RLERTNKRHAG  191



>gb|KHN27522.1| 60S ribosomal protein L13-2 [Glycine soja]
Length=207

 Score =   314 bits (804),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNGHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVR+GRGFSLEELKAAGI KKL PTIGISVDHRR+N SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRSGRGFSLEELKAAGIPKKLGPTIGISVDHRRKNRSLESLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRA K KAGDSTPEELA ATQV G +LPI+REK +V+ +KVTD+MK+FKAY K
Sbjct  121  AKLVVFPRRAHKVKAGDSTPEELANATQVQGSFLPIVREKPTVDLIKVTDEMKAFKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH G
Sbjct  181  LRLERTNKRHYG  192



>ref|XP_009773597.1| PREDICTED: 60S ribosomal protein L13-2-like [Nicotiana sylvestris]
Length=206

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYV+TWFNQPARK RRRAARQ+KAVKIFPRPTAG+LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRAARQQKAVKIFPRPTAGSLRPIVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRA+K KAGDS+ EELA ATQV G Y+PI RE+ +V+ VKVTD+MKSF AY KL
Sbjct  121  KLVIFPRRAKKVKAGDSSAEELAIATQVQGSYMPITREQPAVDLVKVTDEMKSFNAYGKL  180

Query  353  RLERTNERHIG  321
            R+ERTN RHIG
Sbjct  181  RIERTNARHIG  191



>ref|XP_008369022.1| PREDICTED: 60S ribosomal protein L13-1-like [Malus domestica]
Length=207

 Score =   313 bits (803),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRA++FKAGDS  EELA ATQ++ PYLPI REK +VE VKVTD++KSFKAYDK
Sbjct  121  AKLVVFPRRAKQFKAGDSPAEELANATQLHAPYLPIAREKPTVELVKVTDELKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+RH+G
Sbjct  181  LRVERMNKRHVG  192



>ref|XP_010519493.1| PREDICTED: 60S ribosomal protein L13-1 [Tarenaya hassleriana]
 ref|XP_010519494.1| PREDICTED: 60S ribosomal protein L13-1 [Tarenaya hassleriana]
 ref|XP_010519495.1| PREDICTED: 60S ribosomal protein L13-1 [Tarenaya hassleriana]
Length=206

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 159/191 (83%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLK YKA
Sbjct  61   TLKYNMKVRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKMYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRARK KAGDS PEELA ATQV G ++PI+REK + E VKVT+ MKSFKAYDK+
Sbjct  121  KLVIFPRRARKVKAGDSAPEELANATQVQGEHMPIVREKPASELVKVTEAMKSFKAYDKI  180

Query  353  RLERTNERHIG  321
            RLERTN+RH+G
Sbjct  181  RLERTNQRHVG  191



>gb|EYU19728.1| hypothetical protein MIMGU_mgv1a013902mg [Erythranthe guttata]
Length=207

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+PSGHFRKHWQNYVKTWFNQPARK RRRAARQKKAVKIFPRP AG LRP VHG
Sbjct  1    MVKHNNVIPSGHFRKHWQNYVKTWFNQPARKTRRRAARQKKAVKIFPRPPAGPLRPTVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+R+G+GFSLEELKAAGI KKLAPT+GISVDHRRRN SLEG Q NVQRLKTYK
Sbjct  61   QTLKYNMKLRSGKGFSLEELKAAGIPKKLAPTVGISVDHRRRNRSLEGFQTNVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRR  KFKAGDSTPEELATATQV+GP LPI+ EK SVE VKVT+++KSF+AYDK
Sbjct  121  AKLVVFPRRNGKFKAGDSTPEELATATQVSGPILPIVHEKPSVELVKVTEELKSFRAYDK  180

Query  356  LRLERTNERHIG  321
            LRLERTN RH+G
Sbjct  181  LRLERTNARHVG  192



>gb|AFK40501.1| unknown [Medicago truncatula]
Length=207

 Score =   313 bits (802),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQK+AVKIFPRPT G LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKRAVKIFPRPTVGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMK+RAG+GFSLEELKAAGI KKLAPTIGIS+DHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTQKYNMKLRAGKGFSLEELKAAGIPKKLAPTIGISIDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKL VFPRRARK KAGDSTPEELA ATQV G YLPI+ EK SVE VK+TD+MK+FKAY K
Sbjct  121  AKLAVFPRRARKVKAGDSTPEELANATQVQGSYLPIVSEKPSVELVKITDEMKAFKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH+G
Sbjct  181  LRLERTNKRHLG  192



>gb|ACU23653.1| unknown [Glycine max]
Length=207

 Score =   313 bits (801),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHFRKHWQNYVKTWFNQPARK  RR ARQKKAVKIFPRPTAG+LRPIVHG
Sbjct  1    MVKHNNVIPNGHFRKHWQNYVKTWFNQPARKTGRRLARQKKAVKIFPRPTAGSLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGISVDHRR+N SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGISVDHRRKNRSLESLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVV PRRA K KAGDS+ EELA ATQV GP+LPI+REK +V+ VKVTD+MK+FKAY K
Sbjct  121  AKLVVLPRRAHKVKAGDSSLEELANATQVQGPFLPIVREKPTVDLVKVTDEMKAFKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH G
Sbjct  181  LRLERTNKRHHG  192



>dbj|BAM64854.1| RPL13 protein [Beta vulgaris]
Length=207

 Score =   313 bits (801),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            +++HNNVVP+GHF+KHWQNYVKTWFNQPARK +RR ARQKKAVKIFPRPTAG LRP+VH 
Sbjct  1    MVRHNNVVPNGHFKKHWQNYVKTWFNQPARKTKRRVARQKKAVKIFPRPTAGPLRPVVHA  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+RAG+GFSLEEL+AAGITKKLAPTIGI+VDHRRRN SLE LQ N QRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFSLEELEAAGITKKLAPTIGIAVDHRRRNRSLESLQTNTQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARKFKAGDS PEELATATQV G ++PI+RE+   E VKVTD+MKSF AY K
Sbjct  121  AKLVVFPRRARKFKAGDSAPEELATATQVQGDFMPIVRERPISELVKVTDEMKSFNAYAK  180

Query  356  LRLERTNERHIG  321
            LRLERTNERH+G
Sbjct  181  LRLERTNERHMG  192



>ref|XP_006598706.1| PREDICTED: uncharacterized protein LOC100499935 isoform X1 [Glycine 
max]
Length=207

 Score =   313 bits (801),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNGHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVR+GRGFSLEELKA GI KKL PTIGISVDHRR+N SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRSGRGFSLEELKAVGIPKKLGPTIGISVDHRRKNRSLESLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRA K KAGDSTPEELA ATQV G +LPI+REK +V+ VKVTD+MK+FKAY K
Sbjct  121  AKLVVFPRRAHKVKAGDSTPEELANATQVQGSFLPIVREKPTVDLVKVTDEMKAFKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH G
Sbjct  181  LRLERTNKRHYG  192



>ref|XP_006291856.1| hypothetical protein CARUB_v10018032mg [Capsella rubella]
 gb|EOA24754.1| hypothetical protein CARUB_v10018032mg [Capsella rubella]
Length=206

 Score =   312 bits (800),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G +RP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPIRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQTNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRARK KAGDSTPEELA ATQV G Y+PI+RE+ ++E VK+T +MKSFKAYDK+
Sbjct  121  KLVIFPRRARKVKAGDSTPEELANATQVQGDYMPIVREQPTMELVKLTSEMKSFKAYDKI  180

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  181  RLERTNKRHAG  191



>ref|XP_009395324.1| PREDICTED: 60S ribosomal protein L13-1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395325.1| PREDICTED: 60S ribosomal protein L13-1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395326.1| PREDICTED: 60S ribosomal protein L13-1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009395327.1| PREDICTED: 60S ribosomal protein L13-1 [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   312 bits (799),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+V  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLV+FPRRARK KAGDS PEELATATQV G Y+PI+REK +VE VKVTD+MKSFKAY K
Sbjct  121  AKLVIFPRRARKIKAGDSAPEELATATQVQGQYMPIVREKPTVELVKVTDEMKSFKAYAK  180

Query  356  LRLERTNERHIG  321
            LR+ER NER +G
Sbjct  181  LRVERMNERQVG  192



>gb|EYU45361.1| hypothetical protein MIMGU_mgv1a013891mg [Erythranthe guttata]
Length=207

 Score =   312 bits (799),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+PSGHFRKHWQNYVK WFNQPARK RRRAARQKKAVKIFPRPT G LRP+VH 
Sbjct  1    MVKHNNVIPSGHFRKHWQNYVKCWFNQPARKTRRRAARQKKAVKIFPRPTDGRLRPVVHC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVR+G+GFSLEELKAAGI KKLAPT+GISVDHRRRN SLEG Q NVQRLKTYK
Sbjct  61   QTLKYNMKVRSGKGFSLEELKAAGIPKKLAPTVGISVDHRRRNRSLEGFQTNVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            A+LVVFPRR  KFKAGDSTPE+LATATQV+GP LPI+ EK SVE VKVT +MKSFKAYDK
Sbjct  121  AQLVVFPRRNNKFKAGDSTPEQLATATQVSGPILPIVHEKPSVELVKVTSEMKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LRLERTN RH+G
Sbjct  181  LRLERTNARHVG  192



>ref|XP_008386691.1| PREDICTED: 60S ribosomal protein L13-1 [Malus domestica]
Length=207

 Score =   312 bits (799),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGF+LEELK+AGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFTLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRA++FK GDS  EELA ATQ++GPYLPI REK +VE VKVTD++KSFKAYDK
Sbjct  121  AKLVVFPRRAKQFKXGDSPAEELANATQLHGPYLPIAREKPTVELVKVTDELKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+RH+G
Sbjct  181  LRVERMNKRHVG  192



>ref|XP_010671181.1| PREDICTED: 60S ribosomal protein L13-1 [Beta vulgaris subsp. 
vulgaris]
Length=207

 Score =   312 bits (799),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            +++HNNVVP+GHF+KHWQNYVKTWFNQPARK +RR ARQKKAVKIFPRPTAG LRP+VH 
Sbjct  1    MVRHNNVVPNGHFKKHWQNYVKTWFNQPARKTKRRVARQKKAVKIFPRPTAGPLRPVVHA  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+RAG+GFSLEEL+AAGITKKLAPTIGI+VDHRRRN SLE LQ N QRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFSLEELEAAGITKKLAPTIGIAVDHRRRNRSLESLQTNTQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARKFKAGDS PEELATATQV G ++PI+RE    E VKVTD+MKSF AY K
Sbjct  121  AKLVVFPRRARKFKAGDSAPEELATATQVQGDFMPIVREAPISELVKVTDEMKSFNAYAK  180

Query  356  LRLERTNERHIG  321
            LRLERTNERH+G
Sbjct  181  LRLERTNERHMG  192



>gb|ACJ86119.1| unknown [Medicago truncatula]
Length=207

 Score =   312 bits (799),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+ HFRKH QNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHSQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMK+RAG+GFSLEELK AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTAKYNMKLRAGKGFSLEELKTAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKL+VFPRRARK KAGDSTPEELA ATQV G YLPI+REK +VE VKVTD+MK+FKAY K
Sbjct  121  AKLIVFPRRARKTKAGDSTPEELANATQVQGSYLPIVREKPTVELVKVTDEMKAFKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH+G
Sbjct  181  LRLERTNKRHLG  192



>gb|AES82369.2| 60S ribosomal L13-like protein [Medicago truncatula]
Length=205

 Score =   312 bits (799),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 163/192 (85%), Positives = 177/192 (92%), Gaps = 2/192 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMK+RAG+GFSLEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTQKYNMKLRAGKGFSLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRAR  KAGDSTPEELA ATQV G YLPI+REK SVE VK+TD+MK+FKAY K
Sbjct  121  AKLVVFPRRAR--KAGDSTPEELANATQVQGSYLPIVREKPSVELVKITDEMKAFKAYYK  178

Query  356  LRLERTNERHIG  321
            LRLERTN+RH+G
Sbjct  179  LRLERTNKRHLG  190



>ref|XP_009792303.1| PREDICTED: 60S ribosomal protein L13-1-like [Nicotiana sylvestris]
Length=206

 Score =   312 bits (799),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYV+TWFNQPARK RRR ARQKKA  IFPRPTAG LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRIARQKKAATIFPRPTAGPLRPIVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVR+GRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRSGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPR A+K KAGDS+PEELATATQV G Y+PI RE+ ++E VKVTD+MKSF AY KL
Sbjct  121  KLVIFPRHAKKVKAGDSSPEELATATQVQGTYMPITREQPTIELVKVTDEMKSFNAYGKL  180

Query  353  RLERTNERHIG  321
            R+ERTN RHIG
Sbjct  181  RIERTNARHIG  191



>ref|XP_006342488.1| PREDICTED: 60S ribosomal protein L13-1-like [Solanum tuberosum]
Length=206

 Score =   312 bits (799),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 160/191 (84%), Positives = 176/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYV+TWFNQPARK RRRAARQKKA  IFPRPTAG+LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRAARQKKAATIFPRPTAGSLRPIVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPR A+K KAGDS+ EELA ATQV GPYLPI+R++ +VE VKVTD+MKSFKAY KL
Sbjct  121  KLVIFPRHAKKVKAGDSSAEELANATQVQGPYLPIVRDQPAVELVKVTDEMKSFKAYGKL  180

Query  353  RLERTNERHIG  321
            R+ERTN RH+G
Sbjct  181  RIERTNARHVG  191



>ref|XP_009335726.1| PREDICTED: 60S ribosomal protein L13-3-like [Pyrus x bretschneideri]
Length=207

 Score =   311 bits (798),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRR ++FKAGDS  EELA ATQ++ PYLPI REK +VE VKVTD++KSFKAYDK
Sbjct  121  AKLVVFPRRTKQFKAGDSPAEELANATQLHAPYLPIAREKPTVELVKVTDELKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+RH+G
Sbjct  181  LRVERMNKRHVG  192



>ref|XP_009351877.1| PREDICTED: 60S ribosomal protein L13-1 [Pyrus x bretschneideri]
 ref|XP_009351878.1| PREDICTED: 60S ribosomal protein L13-1 [Pyrus x bretschneideri]
Length=207

 Score =   311 bits (798),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRA+  KAGDS+ EELA ATQ+  PYLPI REK +VE VK+TD++KSFKAYDK
Sbjct  121  AKLVVFPRRAKHIKAGDSSAEELANATQLQAPYLPIAREKPTVELVKITDELKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+RH+G
Sbjct  181  LRVERMNQRHVG  192



>ref|XP_006655721.1| PREDICTED: 60S ribosomal protein L13-1-like [Oryza brachyantha]
Length=208

 Score =   311 bits (798),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 164/193 (85%), Positives = 177/193 (92%), Gaps = 1/193 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD  360
            AKLV+FPRRARK KAGDSTPEELATATQV G Y+PI R EK SVE VKVTD+MKSFKAY 
Sbjct  121  AKLVIFPRRARKVKAGDSTPEELATATQVQGDYMPITRGEKRSVEVVKVTDEMKSFKAYA  180

Query  359  KLRLERTNERHIG  321
            KLR+ER N+RH+G
Sbjct  181  KLRVERMNQRHVG  193



>ref|XP_008785029.1| PREDICTED: 60S ribosomal protein L13-1-like [Phoenix dactylifera]
Length=207

 Score =   311 bits (798),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK R GRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQAN+QRLKTYK
Sbjct  61   QTLKYNMKPRVGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANIQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLV+FPRRARKFKAGDS PEELATATQV GPY+PI+ EK SVE VKVTD+MKSF+AY K
Sbjct  121  AKLVIFPRRARKFKAGDSAPEELATATQVQGPYMPIVHEKPSVELVKVTDEMKSFRAYAK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+R +G
Sbjct  181  LRVERMNQRQVG  192



>ref|XP_008381780.1| PREDICTED: 60S ribosomal protein L13-3-like [Malus domestica]
 ref|XP_008381788.1| PREDICTED: 60S ribosomal protein L13-3-like [Malus domestica]
Length=207

 Score =   311 bits (797),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRA+  KAGDS+ EELA ATQ++ PYLPI REK +VE VK+TD++KSFKAYDK
Sbjct  121  AKLVVFPRRAKHTKAGDSSAEELANATQLHAPYLPIAREKPTVELVKITDELKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+RH+G
Sbjct  181  LRVERMNQRHVG  192



>ref|XP_006394649.1| hypothetical protein EUTSA_v10004920mg [Eutrema salsugineum]
 ref|XP_006394650.1| hypothetical protein EUTSA_v10004920mg [Eutrema salsugineum]
 ref|XP_006394651.1| hypothetical protein EUTSA_v10004920mg [Eutrema salsugineum]
 gb|ESQ31935.1| hypothetical protein EUTSA_v10004920mg [Eutrema salsugineum]
 gb|ESQ31936.1| hypothetical protein EUTSA_v10004920mg [Eutrema salsugineum]
 gb|ESQ31937.1| hypothetical protein EUTSA_v10004920mg [Eutrema salsugineum]
Length=206

 Score =   311 bits (797),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNN +P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNEIPNSHFRKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMK+RAG+GF+LEELKAA I KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKLRAGKGFTLEELKAACIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLVVFPRR+RK KAGDSTPEELA ATQV G Y+PI REKA ++ VKVT DMK+FKAYDK+
Sbjct  121  KLVVFPRRSRKVKAGDSTPEELANATQVQGDYMPIAREKAPMDLVKVTADMKAFKAYDKI  180

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  181  RLERTNQRHAG  191



>dbj|BAM64815.1| RPL13 [Beta vulgaris]
Length=207

 Score =   311 bits (797),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            +++HNNVVP+GHF+KHWQNYVKTWFNQPARK +R+ ARQKKAVKIFPRPTAG LRP+VH 
Sbjct  1    MVRHNNVVPNGHFKKHWQNYVKTWFNQPARKTKRKVARQKKAVKIFPRPTAGPLRPVVHA  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+RAG+GFSLEEL+AAGITKKLAPTIGI+VDHRRRN SLE LQ N QRLKTYK
Sbjct  61   QTLKYNMKLRAGKGFSLEELEAAGITKKLAPTIGIAVDHRRRNRSLESLQTNTQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARKFKAGDS PEELATATQV G ++PI+RE    E VKVTD+MKSF AY K
Sbjct  121  AKLVVFPRRARKFKAGDSAPEELATATQVQGDFMPIVREAPIPELVKVTDEMKSFNAYAK  180

Query  356  LRLERTNERHIG  321
            LRLERTNERH+G
Sbjct  181  LRLERTNERHMG  192



>ref|XP_008376874.1| PREDICTED: 60S ribosomal protein L13-3 [Malus domestica]
Length=207

 Score =   311 bits (797),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRA+  KAGDS  EE+A ATQ+ GPYLPI REK +VE VKVTD++KSFKAYDK
Sbjct  121  AKLVVFPRRAKHIKAGDSPAEEIANATQLQGPYLPIAREKPTVELVKVTDELKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ER N RHIG
Sbjct  181  LRVERMNTRHIG  192



>ref|XP_008776365.1| PREDICTED: 60S ribosomal protein L13-1-like [Phoenix dactylifera]
 ref|XP_008776366.1| PREDICTED: 60S ribosomal protein L13-1-like [Phoenix dactylifera]
Length=207

 Score =   311 bits (797),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+V  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIRKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLV+FPRRARKFKAGDS PEELATATQV GPY+PI+ EK +VE VKVTD MKSF+AY K
Sbjct  121  AKLVIFPRRARKFKAGDSAPEELATATQVQGPYMPIVHEKPTVELVKVTDQMKSFRAYAK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+R +G
Sbjct  181  LRVERMNQRQVG  192



>ref|XP_009624483.1| PREDICTED: 60S ribosomal protein L13-1-like [Nicotiana tomentosiformis]
 ref|XP_009624484.1| PREDICTED: 60S ribosomal protein L13-1-like [Nicotiana tomentosiformis]
Length=206

 Score =   311 bits (796),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYV+TWFNQPARK RRR ARQKKA  IFPRPTAG LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRIARQKKAATIFPRPTAGPLRPIVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVR+GRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRSGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPR A+K KAGDS+PEELATATQV G Y+PI RE+ ++E VKVTD+MKSF AY KL
Sbjct  121  KLVIFPRHAKKVKAGDSSPEELATATQVQGTYMPITREQPAIELVKVTDEMKSFNAYGKL  180

Query  353  RLERTNERHIG  321
            R+ERTN RHIG
Sbjct  181  RIERTNARHIG  191



>gb|KJB10376.1| hypothetical protein B456_001G197800 [Gossypium raimondii]
Length=207

 Score =   311 bits (796),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 178/192 (93%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAV+IFPRPTAG +RP+VHG
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKARRRIARQKKAVRIFPRPTAGPIRPVVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+RAG GF+LEELKAAGI+KKLAPTI I+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGNGFTLEELKAAGISKKLAPTIAIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPR ARKFKAGDST +ELATATQV G Y+PI REK SV+ VKVT++MKSFKAY+K
Sbjct  121  AKLVVFPRCARKFKAGDSTAKELATATQVQGSYMPISREKPSVDLVKVTEEMKSFKAYNK  180

Query  356  LRLERTNERHIG  321
            LR+ER NERHIG
Sbjct  181  LRVERMNERHIG  192



>ref|XP_006404190.1| hypothetical protein EUTSA_v10010724mg [Eutrema salsugineum]
 gb|ESQ45643.1| hypothetical protein EUTSA_v10010724mg [Eutrema salsugineum]
Length=206

 Score =   311 bits (796),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGL +NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLNSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRARK KAGDS PEELA ATQV G Y+PI+REK +   VK+T DMKSFKAYDK+
Sbjct  121  KLVIFPRRARKVKAGDSAPEELANATQVQGDYMPIVREKPTTSLVKLTADMKSFKAYDKI  180

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  181  RLERTNKRHAG  191



>emb|CDY66119.1| BnaC01g42370D [Brassica napus]
Length=206

 Score =   311 bits (796),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRARK KAGDST EELA ATQV G Y+PI+REK ++E VK+T +MKS KA+DK+
Sbjct  121  KLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVREKPTMELVKLTSEMKSVKAFDKI  180

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  181  RLERTNKRHAG  191



>ref|XP_009361223.1| PREDICTED: 60S ribosomal protein L13-3-like [Pyrus x bretschneideri]
Length=207

 Score =   311 bits (796),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 161/192 (84%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRA+  KAGDS  EE+A ATQ++GPYLPI REK +VE VKVTD++KSFKAYDK
Sbjct  121  AKLVVFPRRAKLIKAGDSPAEEIANATQLHGPYLPIAREKPTVELVKVTDELKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ER N RHIG
Sbjct  181  LRVERMNTRHIG  192



>ref|XP_009335696.1| PREDICTED: 60S ribosomal protein L13-1-like [Pyrus x bretschneideri]
Length=207

 Score =   311 bits (796),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 176/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT G LRPIVHG
Sbjct  1    MVKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRTARQKKAVKIFPRPTTGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRA++FKAGDS  EELA ATQ++ PYLPI REK +VE VKVTD++KSFKAYDK
Sbjct  121  AKLVVFPRRAKQFKAGDSPAEELANATQLHAPYLPIAREKPTVELVKVTDELKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            L +ER N+RH+G
Sbjct  181  LCVERMNKRHVG  192



>ref|XP_009150164.1| PREDICTED: 60S ribosomal protein L13-2 [Brassica rapa]
 emb|CDY37902.1| BnaA06g19150D [Brassica napus]
Length=206

 Score =   311 bits (796),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRARK KAGDST EELA ATQV G Y+PI+REK + E VK+T +MKS  AYDK+
Sbjct  121  KLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVREKQATELVKLTSEMKSVNAYDKI  180

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  181  RLERTNKRHAG  191



>ref|XP_010677493.1| PREDICTED: 60S ribosomal protein L13-1-like [Beta vulgaris subsp. 
vulgaris]
Length=207

 Score =   310 bits (795),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            +++HNNV+P+GHF+KHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VH 
Sbjct  1    MVRHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPVVHC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAG+GFSLEEL AAGI KKLAPTIGI+VDHRRRNSSLEGLQ NVQRLKTYK
Sbjct  61   QTLKYNMKVRAGKGFSLEELAAAGIPKKLAPTIGIAVDHRRRNSSLEGLQTNVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPR ARKFKAGDSTPEELA ATQV G +LPI  EKA VE +KVT+DMKSF AY K
Sbjct  121  AKLVVFPRHARKFKAGDSTPEELANATQVQGEFLPIKSEKAPVEVIKVTEDMKSFNAYSK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH G
Sbjct  181  LRLERTNKRHQG  192



>ref|XP_004512380.1| PREDICTED: 60S ribosomal protein L13-1-like isoform X1 [Cicer 
arietinum]
 ref|XP_004512381.1| PREDICTED: 60S ribosomal protein L13-1-like isoform X2 [Cicer 
arietinum]
Length=207

 Score =   310 bits (795),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 162/192 (84%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMKVR G+GFSLEELKAAGI KKLAPTIGI+VDHRRRN SLE LQANVQRLKTYK
Sbjct  61   QTAKYNMKVRDGKGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLESLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRA K KAGDSTPEELA ATQV G YLP +REK SVE VK+TD+MK+FKAY K
Sbjct  121  AKLVVFPRRAHKVKAGDSTPEELANATQVTGSYLPTVREKPSVELVKITDEMKAFKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH G
Sbjct  181  LRLERTNKRHYG  192



>ref|NP_190470.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
 ref|NP_850672.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
 ref|NP_001030831.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
 sp|P41127.1|RL131_ARATH RecName: Full=60S ribosomal protein L13-1; AltName: Full=Protein 
BBC1 homolog [Arabidopsis thaliana]
 gb|AAL16152.1|AF428384_1 AT3g49010/T2J13_150 [Arabidopsis thaliana]
 emb|CAA53005.1| BBC1 protein [Arabidopsis thaliana]
 emb|CAB62009.1| 60S ribosomal protein L13, BBC1 protein [Arabidopsis thaliana]
 gb|AAK92791.1| putative 60S ribosomal protein L13, BBC1 protein [Arabidopsis 
thaliana]
 gb|AAL38313.1| 60S ribosomal protein L13, BBC1 protein [Arabidopsis thaliana]
 gb|AAL85112.1| putative 60S ribosomal protein L13, BBC1 protein [Arabidopsis 
thaliana]
 gb|AAM10157.1| 60S ribosomal protein L13, BBC1 protein [Arabidopsis thaliana]
 dbj|BAH19771.1| AT3G49010 [Arabidopsis thaliana]
 gb|AEE78482.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
 gb|AEE78483.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
 gb|AEE78484.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
Length=206

 Score =   310 bits (795),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYK 
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKT  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRARK KAGDSTPEELA ATQV G YLPI+REK ++E VK+T +MKSFKA+DK+
Sbjct  121  KLVIFPRRARKVKAGDSTPEELANATQVQGDYLPIVREKPTMELVKLTSEMKSFKAFDKI  180

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  181  RLERTNKRHAG  191



>ref|XP_006659160.1| PREDICTED: 60S ribosomal protein L13-1-like [Oryza brachyantha]
Length=208

 Score =   310 bits (795),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 177/193 (92%), Gaps = 1/193 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD  360
            AKLV+FPRRARK KAGDSTPEELATATQV G Y+PI R EK SVE VKVTD+MKSFKAY 
Sbjct  121  AKLVIFPRRARKVKAGDSTPEELATATQVQGDYMPIARGEKRSVEVVKVTDEMKSFKAYA  180

Query  359  KLRLERTNERHIG  321
            KLR+ER N+RH+G
Sbjct  181  KLRVERMNQRHVG  193



>ref|XP_010278804.1| PREDICTED: 60S ribosomal protein L13-2-like [Nelumbo nucifera]
Length=207

 Score =   310 bits (794),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 172/192 (90%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            + KHNNVVP+ HFRKHWQNYVKTWFNQPARK RRR  RQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MAKHNNVVPNSHFRKHWQNYVKTWFNQPARKTRRRIDRQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLE LQANVQRLKTYK
Sbjct  61   QTLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLESLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKL+VFPRRA +FKAGDS  EELATATQV GPY+PI REK S++ VKVTD+MKSF AY K
Sbjct  121  AKLIVFPRRACEFKAGDSGAEELATATQVQGPYMPIEREKPSIDLVKVTDEMKSFNAYAK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+R +G
Sbjct  181  LRVERMNQRQVG  192



>ref|NP_001056613.1| Os06g0115500 [Oryza sativa Japonica Group]
 dbj|BAA92738.1| putative 60S ribosomal protein L13E [Oryza sativa Japonica Group]
 dbj|BAC22205.1| putative 60S ribosomal protein L13E [Oryza sativa Japonica Group]
 dbj|BAF18527.1| Os06g0115500 [Oryza sativa Japonica Group]
 gb|EAY99411.1| hypothetical protein OsI_21382 [Oryza sativa Indica Group]
 gb|EAZ35612.1| hypothetical protein OsJ_19902 [Oryza sativa Japonica Group]
 gb|ABR25544.1| 60S ribosomal protein l13-2 [Oryza sativa Indica Group]
 dbj|BAG92251.1| unnamed protein product [Oryza sativa Japonica Group]
Length=208

 Score =   310 bits (794),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 163/193 (84%), Positives = 176/193 (91%), Gaps = 1/193 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KK APTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKFAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD  360
            AKLV+FPRRARK KAGDSTPEELATATQV G Y+PI R EK SVE VKVTDDMK+FKAY 
Sbjct  121  AKLVIFPRRARKVKAGDSTPEELATATQVQGDYMPITRGEKRSVEVVKVTDDMKAFKAYA  180

Query  359  KLRLERTNERHIG  321
            KLR+ER N+RHIG
Sbjct  181  KLRVERMNQRHIG  193



>ref|NP_001288976.1| 60S ribosomal protein L13-2 [Brassica rapa]
 gb|ABL97945.1| cold induced protein [Brassica rapa]
Length=206

 Score =   310 bits (794),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRARK KAGDST EELA ATQV G Y+PI+REK + E VK+T +MKS  AYDK+
Sbjct  121  KLVIFPRRARKVKAGDSTAEELAYATQVQGDYMPIVREKQATELVKLTSEMKSVNAYDKI  180

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  181  RLERTNKRHAG  191



>ref|XP_009386549.1| PREDICTED: 60S ribosomal protein L13-1-like [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   310 bits (794),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 174/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLV+FPRRARK KAGDS PEELATATQV GPY+PI R+K +VE VKVTD+MKSFKAY  
Sbjct  121  AKLVIFPRRARKVKAGDSAPEELATATQVQGPYMPIARQKPTVELVKVTDEMKSFKAYAT  180

Query  356  LRLERTNERHIG  321
            LR+ER N+R +G
Sbjct  181  LRVERMNKRQVG  192



>ref|XP_009149775.1| PREDICTED: 60S ribosomal protein L13-1-like [Brassica rapa]
 emb|CDY08101.1| BnaA06g16250D [Brassica napus]
Length=206

 Score =   310 bits (794),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRRAARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRAARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRARK KAGDSTPEELA ATQV G Y+PI+REK + E VK+T +MKS  AYDK+
Sbjct  121  KLVIFPRRARKVKAGDSTPEELANATQVQGDYMPIVREKHATELVKLTTEMKSVNAYDKI  180

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  181  RLERTNKRHAG  191



>sp|P41129.1|RL132_BRANA RecName: Full=60S ribosomal protein L13-2; AltName: Full=Cold-induced 
protein C24B [Brassica napus]
 emb|CAA80343.1| cold induced protein (BnC24B) [Brassica napus]
 emb|CDX86997.1| BnaC03g52670D [Brassica napus]
Length=206

 Score =   310 bits (793),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGIS+DHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISLDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRARK KAGDST EELA ATQV G Y+PI+REK ++E VK+T +MKS  AYDK+
Sbjct  121  KLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVREKQAMELVKLTSEMKSVNAYDKI  180

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  181  RLERTNKRHAG  191



>ref|XP_004253080.1| PREDICTED: 60S ribosomal protein L13-1 [Solanum lycopersicum]
 ref|XP_010314813.1| PREDICTED: 60S ribosomal protein L13-1 [Solanum lycopersicum]
Length=206

 Score =   310 bits (793),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 158/191 (83%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYV+TWFNQPARK RRRAARQKKA  IFPRPTAG+LRPIVHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVRTWFNQPARKTRRRAARQKKAATIFPRPTAGSLRPIVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPR A+K KAGDS+ EELA ATQV GPYLPI+R++ ++E VK+TD+MKSFKAY KL
Sbjct  121  KLVIFPRHAKKVKAGDSSAEELANATQVQGPYLPIVRDQPAIELVKITDEMKSFKAYGKL  180

Query  353  RLERTNERHIG  321
            R+ERTN RH G
Sbjct  181  RIERTNARHFG  191



>ref|XP_008775606.1| PREDICTED: 60S ribosomal protein L13-1 [Phoenix dactylifera]
 ref|XP_008775608.1| PREDICTED: 60S ribosomal protein L13-1 [Phoenix dactylifera]
Length=207

 Score =   310 bits (793),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+V  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK R GRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRVGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLV+FPRRARKFKAGDS PEELATATQV GPY+PI+REK +VE VKVTD+MKSF+AY K
Sbjct  121  AKLVIFPRRARKFKAGDSAPEELATATQVQGPYMPIVREKPTVELVKVTDEMKSFRAYAK  180

Query  356  LRLERTNERHIG  321
            LR+E+ N+R  G
Sbjct  181  LRVEQMNKRQAG  192



>ref|XP_010918091.1| PREDICTED: 60S ribosomal protein L13-1-like [Elaeis guineensis]
Length=207

 Score =   310 bits (793),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYV+TWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVRTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLV+FPR ARKFKAGDS PEELATA+QV GPY+PI+ EK SVE VKVTD+MKSF+AY K
Sbjct  121  AKLVIFPRHARKFKAGDSAPEELATASQVQGPYMPIVHEKPSVELVKVTDEMKSFRAYAK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+R +G
Sbjct  181  LRVERMNQRQVG  192



>ref|XP_010102662.1| 60S ribosomal protein L13-2 [Morus notabilis]
 gb|EXB93844.1| 60S ribosomal protein L13-2 [Morus notabilis]
Length=207

 Score =   309 bits (792),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHG
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMKV AGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQAN QRLKTYK
Sbjct  61   QTLKYNMKVGAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANAQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRR  KFKAGDSTPEELA+ATQV G  LPI+REK +VE VKVT++++SFKAYDK
Sbjct  121  AKLVVFPRRPHKFKAGDSTPEELASATQVQGELLPIVREKPTVELVKVTNELRSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ERTN+R +G
Sbjct  181  LRVERTNQRRLG  192



>ref|XP_006847908.1| PREDICTED: 60S ribosomal protein L13-1 [Amborella trichopoda]
 ref|XP_011624662.1| PREDICTED: 60S ribosomal protein L13-1 [Amborella trichopoda]
 gb|ERN09489.1| hypothetical protein AMTR_s00029p00111280 [Amborella trichopoda]
Length=207

 Score =   309 bits (792),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+RAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYK
Sbjct  61   QTLKYNMKLRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRR +KFK GDS+ EELATATQVNG ++PI  EK +VE V++TD+MK+FKAYDK
Sbjct  121  AKLVVFPRRPKKFKGGDSSAEELATATQVNGEFMPITHEKPTVEMVRITDEMKAFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+R +G
Sbjct  181  LRVERMNQRQLG  192



>ref|XP_002874151.1| 60S ribosomal protein L13 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50410.1| 60S ribosomal protein L13 [Arabidopsis lyrata subsp. lyrata]
Length=206

 Score =   309 bits (792),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 158/186 (85%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAG+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLVVFPRR+RK KAGDSTPEELA ATQV G Y+PI  EKA++E VK+T DMK+FKAYDK+
Sbjct  121  KLVVFPRRSRKVKAGDSTPEELANATQVQGDYMPIASEKAAMELVKLTADMKAFKAYDKI  180

Query  353  RLERTN  336
            RLERTN
Sbjct  181  RLERTN  186



>ref|XP_010421197.1| PREDICTED: 60S ribosomal protein L13-3 [Camelina sativa]
Length=206

 Score =   309 bits (791),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQ KAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRVARQTKAVKIFPRPTSGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAG+GF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGKGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLVVFPRR+RK KAGDSTPEELA ATQV G Y+PI+ +KA++E VKV+ DMK+FKAYDKL
Sbjct  121  KLVVFPRRSRKVKAGDSTPEELANATQVQGDYMPIVSQKAAMELVKVSADMKAFKAYDKL  180

Query  353  RLERTN  336
            RLERTN
Sbjct  181  RLERTN  186



>emb|CDY05893.1| BnaC08g20700D [Brassica napus]
Length=206

 Score =   308 bits (790),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/191 (82%), Positives = 175/191 (92%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRRAARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRAARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMK+R G+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKLRTGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRARK KAGDSTPEELA ATQV G Y+PI+REK + E VK+T +MKS  AYDK+
Sbjct  121  KLVIFPRRARKVKAGDSTPEELANATQVQGDYMPIVREKHATELVKLTTEMKSVNAYDKI  180

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  181  RLERTNKRHAG  191



>gb|EPS71909.1| hypothetical protein M569_02849 [Genlisea aurea]
Length=207

 Score =   308 bits (790),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 177/192 (92%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+ HFRKHWQ+YVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VH 
Sbjct  1    MVKHNNVVPNSHFRKHWQDYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVHC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMKVRAG+GFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTRKYNMKVRAGKGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARKFKAGDST EELA+ATQV+GP LPI+ EK +VE VKVT+++KSF+AYDK
Sbjct  121  AKLVVFPRRARKFKAGDSTAEELASATQVSGPVLPIVGEKPNVELVKVTEELKSFRAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+RH G
Sbjct  181  LRVERMNKRHAG  192



>gb|AAM61490.1| 60S ribosomal protein L13, BBC1 protein [Arabidopsis thaliana]
Length=206

 Score =   308 bits (789),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYK 
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKT  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRARK KAGDSTPEELA ATQV G YLPI+REK ++E VK+T +MKSF A+DK+
Sbjct  121  KLVIFPRRARKVKAGDSTPEELANATQVQGDYLPIVREKPTMELVKLTSEMKSFMAFDKI  180

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  181  RLERTNKRHAG  191



>ref|XP_002456870.1| hypothetical protein SORBIDRAFT_03g044290 [Sorghum bicolor]
 gb|EES01990.1| hypothetical protein SORBIDRAFT_03g044290 [Sorghum bicolor]
Length=208

 Score =   308 bits (789),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 175/193 (91%), Gaps = 1/193 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD  360
            AKLV+FPRRARK KAGDSTPEELATATQV G Y+PI R EK SVE VKVTD+MK F AY 
Sbjct  121  AKLVIFPRRARKVKAGDSTPEELATATQVQGDYMPITRGEKRSVEVVKVTDEMKEFAAYG  180

Query  359  KLRLERTNERHIG  321
            KLRLER N++H+G
Sbjct  181  KLRLERMNKKHLG  193



>sp|P41128.1|RL131_BRANA RecName: Full=60S ribosomal protein L13-1; AltName: Full=Cold-induced 
protein C24A [Brassica napus]
 emb|CAA80341.1| cold induced protein (BnC24A) [Brassica napus]
 emb|CDX83063.1| BnaA01g20630D [Brassica napus]
Length=206

 Score =   307 bits (787),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 155/191 (81%), Positives = 174/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVR G+GF+LEELK+AGI KKLAPTIGI+VDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKSAGIPKKLAPTIGIAVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRARK KAGDST EELA ATQV G Y+PI+REK + E VK+T +MKS KA+DK+
Sbjct  121  KLVIFPRRARKVKAGDSTAEELANATQVQGDYMPIVREKHATELVKLTTEMKSVKAFDKI  180

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  181  RLERTNKRHAG  191



>ref|XP_006288673.1| hypothetical protein CARUB_v10001981mg [Capsella rubella]
 gb|EOA21571.1| hypothetical protein CARUB_v10001981mg [Capsella rubella]
Length=206

 Score =   307 bits (787),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 156/186 (84%), Positives = 172/186 (92%), Gaps = 0/186 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VH Q
Sbjct  1    MKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHAQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAG+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLVVFPRR+R+ KAGDSTPEELA ATQV G Y+PI+ +KA++E VKVT DMK+FKAYDK+
Sbjct  121  KLVVFPRRSRQVKAGDSTPEELANATQVQGDYMPIVSQKAAMELVKVTADMKAFKAYDKI  180

Query  353  RLERTN  336
            RLERTN
Sbjct  181  RLERTN  186



>ref|NP_001152730.1| LOC100286371 [Zea mays]
 gb|ACG49179.1| 60S ribosomal protein L13-2 [Zea mays]
 gb|ACR37981.1| unknown [Zea mays]
 gb|AFW77302.1| 60S ribosomal protein L13 isoform 1 [Zea mays]
 gb|AFW77303.1| 60S ribosomal protein L13 isoform 2 [Zea mays]
Length=208

 Score =   307 bits (787),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 175/193 (91%), Gaps = 1/193 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD  360
            AKLV+FPRRARK  AGDSTPEELATATQV G Y+PI R EK SVE VKVTD+MKSF AY 
Sbjct  121  AKLVIFPRRARKANAGDSTPEELATATQVQGDYMPITRGEKRSVEVVKVTDEMKSFAAYG  180

Query  359  KLRLERTNERHIG  321
            KLRLER N++H+G
Sbjct  181  KLRLERMNKKHLG  193



>ref|XP_009151668.1| PREDICTED: 60S ribosomal protein L13-1 [Brassica rapa]
Length=206

 Score =   307 bits (787),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRARK K GDST EELA ATQV G Y+PI+REK + E VK+T +MKS KA+DK+
Sbjct  121  KLVIFPRRARKVKPGDSTAEELANATQVQGDYMPIVREKHATELVKLTTEMKSVKAFDKI  180

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  181  RLERTNKRHAG  191



>ref|XP_004969597.1| PREDICTED: 60S ribosomal protein L13-1-like [Setaria italica]
Length=208

 Score =   307 bits (786),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 162/193 (84%), Positives = 176/193 (91%), Gaps = 1/193 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD  360
            AKLV+FPRRARK KAGDSTPEELATATQV G Y+PI R EK SVE VKVTD+MK+F AY 
Sbjct  121  AKLVIFPRRARKVKAGDSTPEELATATQVQGDYMPITRGEKRSVEVVKVTDEMKTFAAYG  180

Query  359  KLRLERTNERHIG  321
            KLRLER N++H+G
Sbjct  181  KLRLERMNKKHLG  193



>ref|XP_009392764.1| PREDICTED: 60S ribosomal protein L13-1-like [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   307 bits (786),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 157/192 (82%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK R+GRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRSGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLV+FPRRARK KAGDS PEELATATQV G Y+PI+REK S+E VKVTD+M+SFKAY K
Sbjct  121  AKLVIFPRRARKLKAGDSAPEELATATQVQGQYMPIVREKPSIELVKVTDEMRSFKAYAK  180

Query  356  LRLERTNERHIG  321
            LR+ER N   +G
Sbjct  181  LRVERMNRCQVG  192



>ref|XP_010493519.1| PREDICTED: 60S ribosomal protein L13-3-like [Camelina sativa]
Length=206

 Score =   307 bits (786),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 155/186 (83%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQ KAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRVARQTKAVKIFPRPTSGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAG+GF+LEELK+AGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRL TYKA
Sbjct  61   TLKYNMKVRAGKGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLNTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLVVFPRR+RK KAGDSTPEELA ATQV G Y+PI+ +KA++E VKV+ DMK+FKAYDKL
Sbjct  121  KLVVFPRRSRKVKAGDSTPEELANATQVQGDYMPIVSQKAAMELVKVSADMKAFKAYDKL  180

Query  353  RLERTN  336
            RLERTN
Sbjct  181  RLERTN  186



>ref|XP_010545924.1| PREDICTED: 60S ribosomal protein L13-1-like [Tarenaya hassleriana]
Length=206

 Score =   306 bits (784),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 173/191 (91%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQ+KAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQEKAVKIFPRPTAGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRARK KAGDS  EELA ATQV G ++ I REK +V+ VK+T D+KSFKAY K+
Sbjct  121  KLVIFPRRARKVKAGDSAAEELANATQVQGDHMLIAREKPAVDLVKITQDLKSFKAYGKI  180

Query  353  RLERTNERHIG  321
            RLERTNERH+G
Sbjct  181  RLERTNERHVG  191



>ref|XP_010233707.1| PREDICTED: 60S ribosomal protein L13-1-like [Brachypodium distachyon]
Length=208

 Score =   306 bits (784),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 176/193 (91%), Gaps = 1/193 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEG+Q+NVQRLKTYK
Sbjct  61   QTLKYNMKARAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGMQSNVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD  360
            AKLV+FPRRARK KAGDSTPEELATATQV G Y+PI R EK S+E VKVTD+MK+FKAY 
Sbjct  121  AKLVIFPRRARKVKAGDSTPEELATATQVQGEYMPITRGEKRSIEVVKVTDEMKAFKAYG  180

Query  359  KLRLERTNERHIG  321
            KLR+ER N+R +G
Sbjct  181  KLRVERMNQRQVG  193



>ref|XP_004509537.1| PREDICTED: 60S ribosomal protein L13-1-like [Cicer arietinum]
Length=207

 Score =   306 bits (783),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 158/192 (82%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+ HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFP+PTAG LRPIVHG
Sbjct  1    MVKHNNVIPNEHFRKHWQNYVKTWFNQPARKTRRRLARQKKAVKIFPKPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT+KYNMK+R+G+GFSLEELKAA I KKLAPTIGI+VDHRRRN SLE LQ NVQRLKTYK
Sbjct  61   QTVKYNMKLRSGKGFSLEELKAANIPKKLAPTIGIAVDHRRRNRSLESLQTNVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGDS+PEE A ATQV G YLPI+ EK SVE VKVTD+MK+FKAY K
Sbjct  121  AKLVVFPRRARKVKAGDSSPEERANATQVQGSYLPIVTEKPSVELVKVTDEMKAFKAYYK  180

Query  356  LRLERTNERHIG  321
            LRLERTN+RH G
Sbjct  181  LRLERTNQRHFG  192



>ref|XP_004969592.1| PREDICTED: 60S ribosomal protein L13-1-like [Setaria italica]
Length=208

 Score =   305 bits (782),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 176/193 (91%), Gaps = 1/193 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD  360
            AKLV+FPRRARK KAGDSTPEELATATQV G Y+PI R EK SVE VKVT++MK+F AY 
Sbjct  121  AKLVIFPRRARKVKAGDSTPEELATATQVQGDYMPITRGEKRSVEVVKVTEEMKTFAAYG  180

Query  359  KLRLERTNERHIG  321
            KLRLER N++H+G
Sbjct  181  KLRLERMNKKHLG  193



>gb|ABK25466.1| unknown [Picea sitchensis]
Length=207

 Score =   305 bits (782),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK+RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKKRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLE LQANVQRLKTYK
Sbjct  61   QTQKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLESLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPR ARK KAGDS+PEELATATQV G Y+ I +EK S+E VKVTD+MK+FKAY K
Sbjct  121  AKLVVFPRTARKLKAGDSSPEELATATQVQGKYMTITQEKPSLELVKVTDEMKNFKAYAK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+R +G
Sbjct  181  LRVERMNKRLVG  192



>emb|CAC27142.1| 60S ribosomal protein L13E [Picea abies]
Length=207

 Score =   305 bits (781),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 160/192 (83%), Positives = 175/192 (91%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK+RRR ARQKKAVKIFPRPTAG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKKRRRIARQKKAVKIFPRPTAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMKVRAGRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLE LQANVQRLKTYK
Sbjct  61   QTQKYNMKVRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLESLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPR ARK KAGDS+PEELATATQV G Y+ I +EK S+E VKVTD+MK+FKAY K
Sbjct  121  AKLVVFPRTARKLKAGDSSPEELATATQVQGKYMTITQEKPSLELVKVTDEMKNFKAYAK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+R +G
Sbjct  181  LRVERMNKRLVG  192



>ref|XP_003573442.1| PREDICTED: 60S ribosomal protein L13-1-like [Brachypodium distachyon]
Length=208

 Score =   305 bits (781),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 158/193 (82%), Positives = 176/193 (91%), Gaps = 1/193 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEG+Q+NVQRLKTYK
Sbjct  61   QTLKYNMKARAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGMQSNVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD  360
            AKLV+FPRRARK KAGDSTPEELATATQV G ++PI R EK SVE VKVTD+MK+FKAY 
Sbjct  121  AKLVIFPRRARKVKAGDSTPEELATATQVQGDFMPIARGEKRSVEVVKVTDEMKAFKAYG  180

Query  359  KLRLERTNERHIG  321
            KLR+ER N+R +G
Sbjct  181  KLRVERMNQRQVG  193



>emb|CDY16871.1| BnaA09g05110D [Brassica napus]
Length=206

 Score =   305 bits (781),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNN +P  HFRKHWQN VKTWFNQPARK RRR ARQ+KAVKIFPRPT+G+LRP+VHGQ
Sbjct  1    MKHNNEIPGSHFRKHWQNSVKTWFNQPARKTRRRVARQEKAVKIFPRPTSGSLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            T+KYNMKVRAG+GF+LEELKAAGI KKLA TIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TIKYNMKVRAGKGFTLEELKAAGIAKKLASTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLVVFPRR+R  KAGDST EELA ATQ+ G Y+PI REK ++E V VT DMKSFKAYDK+
Sbjct  121  KLVVFPRRSRVVKAGDSTSEELANATQMQGEYMPIAREKVAMELVNVTSDMKSFKAYDKI  180

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  181  RLERTNKRHAG  191



>ref|NP_001148638.1| 60S ribosomal protein L13-2 [Zea mays]
 ref|XP_008654954.1| PREDICTED: 60S ribosomal protein L13-2 isoform X1 [Zea mays]
 gb|ACG32335.1| 60S ribosomal protein L13-2 [Zea mays]
 gb|ACG35809.1| 60S ribosomal protein L13-2 [Zea mays]
 gb|ACG48210.1| 60S ribosomal protein L13-2 [Zea mays]
 gb|AFW84112.1| 60S ribosomal protein L13 [Zea mays]
Length=208

 Score =   305 bits (781),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 174/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD  360
            AKLV+FPRRA K KAGDSTPEELATATQV G Y+P  R EK SVE VKVTD+MKSF AY 
Sbjct  121  AKLVIFPRRAHKVKAGDSTPEELATATQVQGDYMPFTRGEKRSVEVVKVTDEMKSFAAYG  180

Query  359  KLRLERTNERHIG  321
            KLRLER N++H+G
Sbjct  181  KLRLERMNKKHLG  193



>ref|XP_010454674.1| PREDICTED: 60S ribosomal protein L13-3-like [Camelina sativa]
Length=206

 Score =   305 bits (780),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 171/186 (92%), Gaps = 0/186 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQ KAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRVARQTKAVKIFPRPTSGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAG+GF+ EELK+AGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGKGFTREELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLVVFPRR+RK KAGDSTPEELA ATQV G Y+PI+ +KA++E VK++ DMK+FKAYDKL
Sbjct  121  KLVVFPRRSRKVKAGDSTPEELANATQVQGDYMPIVSQKAAMELVKLSADMKAFKAYDKL  180

Query  353  RLERTN  336
            RLERTN
Sbjct  181  RLERTN  186



>ref|XP_006404189.1| hypothetical protein EUTSA_v10010724mg [Eutrema salsugineum]
 gb|ESQ45642.1| hypothetical protein EUTSA_v10010724mg [Eutrema salsugineum]
Length=204

 Score =   304 bits (779),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 172/191 (90%), Gaps = 2/191 (1%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTAGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGL +NVQRLKTYKA
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLNSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRAR  KAGDS PEELA ATQV G Y+PI+REK +   VK+T DMKSFKAYDK+
Sbjct  121  KLVIFPRRAR--KAGDSAPEELANATQVQGDYMPIVREKPTTSLVKLTADMKSFKAYDKI  178

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  179  RLERTNKRHAG  189



>ref|XP_008800008.1| PREDICTED: 60S ribosomal protein L13-1-like [Phoenix dactylifera]
Length=207

 Score =   305 bits (780),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 156/192 (81%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+V  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KK APTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKPRAGRGFTLEELKAAGIPKKFAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLV+FPR A K+KAGDS PEELATATQV GPYLPI+ EK SVE VKVTD+MKSF+AY K
Sbjct  121  AKLVIFPRHAHKYKAGDSAPEELATATQVQGPYLPIVCEKPSVELVKVTDEMKSFRAYAK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+R +G
Sbjct  181  LRVERMNQRQVG  192



>ref|NP_001078260.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
 gb|AEE78485.1| 60S ribosomal protein L13-1 [Arabidopsis thaliana]
Length=204

 Score =   304 bits (779),  Expect = 8e-100, Method: Compositional matrix adjust.
 Identities = 156/191 (82%), Positives = 174/191 (91%), Gaps = 2/191 (1%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVR G+GF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ NVQRLKTYK 
Sbjct  61   TLKYNMKVRTGKGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNVQRLKTYKT  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRAR  KAGDSTPEELA ATQV G YLPI+REK ++E VK+T +MKSFKA+DK+
Sbjct  121  KLVIFPRRAR--KAGDSTPEELANATQVQGDYLPIVREKPTMELVKLTSEMKSFKAFDKI  178

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  179  RLERTNKRHAG  189



>ref|NP_001050537.1| Os03g0576700 [Oryza sativa Japonica Group]
 pdb|3J61|L Chain L, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 emb|CAC81268.1| putative cold-induced protein [Oryza sativa Indica Group]
 gb|AAP85547.1| ribosomal protein large subunit 13 [Oryza sativa Japonica Group]
 gb|AAR10856.1| putative 60S ribosomal protein [Oryza sativa Japonica Group]
 gb|ABF97254.1| 60S ribosomal protein L13-2, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF12451.1| Os03g0576700 [Oryza sativa Japonica Group]
 gb|EAY90745.1| hypothetical protein OsI_12345 [Oryza sativa Indica Group]
 gb|EAZ27573.1| hypothetical protein OsJ_11521 [Oryza sativa Japonica Group]
 dbj|BAG91910.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG96551.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97015.1| unnamed protein product [Oryza sativa Japonica Group]
Length=208

 Score =   304 bits (779),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 175/193 (91%), Gaps = 1/193 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KK APTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKYAPTIGISVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD  360
            AKLV+FPRRARK KAGDST EELATATQV G Y+PI R EK SVE VKVTD+MK+FKAY 
Sbjct  121  AKLVIFPRRARKVKAGDSTAEELATATQVQGDYMPIARGEKRSVEVVKVTDEMKAFKAYA  180

Query  359  KLRLERTNERHIG  321
            KLR+ER N+RH+G
Sbjct  181  KLRVERMNQRHVG  193



>emb|CDX87152.1| BnaC09g04670D [Brassica napus]
Length=206

 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 153/191 (80%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNN +P  HFRKHWQN VKTWFNQPARK RRR ARQ+KAVKIFPRP +G+LRP+VHGQ
Sbjct  1    MKHNNEIPGSHFRKHWQNSVKTWFNQPARKTRRRVARQEKAVKIFPRPASGSLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            T+KYNMKVRAG+GF+LEELKAAGI KKLA TIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TIKYNMKVRAGKGFTLEELKAAGIAKKLASTIGISVDHRRKNHSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLVVFPRR+R  KAGDSTPEELA ATQV G Y+PI  EK ++E VKVT DMK+FKAYDK+
Sbjct  121  KLVVFPRRSRVVKAGDSTPEELANATQVQGDYMPIAGEKVAMELVKVTSDMKAFKAYDKI  180

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  181  RLERTNKRHAG  191



>ref|XP_002440279.1| hypothetical protein SORBIDRAFT_09g028960 [Sorghum bicolor]
 gb|EES18709.1| hypothetical protein SORBIDRAFT_09g028960 [Sorghum bicolor]
Length=208

 Score =   304 bits (778),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 175/193 (91%), Gaps = 1/193 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD  360
            AKLV+FPRRARK KAGDST EELATATQV G Y+PI R EK SVE VKVT++MKSF AY 
Sbjct  121  AKLVIFPRRARKVKAGDSTAEELATATQVQGDYMPITRGEKRSVEVVKVTEEMKSFAAYG  180

Query  359  KLRLERTNERHIG  321
            KLRLER N++H+G
Sbjct  181  KLRLERMNKKHLG  193



>ref|XP_002439380.1| hypothetical protein SORBIDRAFT_09g005460 [Sorghum bicolor]
 gb|EES17810.1| hypothetical protein SORBIDRAFT_09g005460 [Sorghum bicolor]
Length=208

 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 161/193 (83%), Positives = 173/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD  360
            AKLV+FPRRARK KAGDST EELAT TQV G Y+PI R EK SVE VKVTD+MKSF AY 
Sbjct  121  AKLVIFPRRARKVKAGDSTVEELATVTQVQGDYMPITRGEKRSVEVVKVTDEMKSFAAYG  180

Query  359  KLRLERTNERHIG  321
            KLRLER N++H G
Sbjct  181  KLRLERMNKKHQG  193



>ref|XP_010550553.1| PREDICTED: 60S ribosomal protein L13-1-like [Tarenaya hassleriana]
Length=206

 Score =   303 bits (775),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/191 (81%), Positives = 172/191 (90%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARK RRR ARQ+KAVKIFPRPTAG LRP+V GQ
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKTRRRIARQEKAVKIFPRPTAGPLRPVVRGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQ N+QRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQTNIQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPRRARKFKAGDS PEELA  TQV G ++ I REK +V+ VKVT+DMKS  AY K+
Sbjct  121  KLVIFPRRARKFKAGDSAPEELANTTQVQGDHMRIGREKVAVDLVKVTEDMKSSMAYGKI  180

Query  353  RLERTNERHIG  321
            RLERTN+RH+G
Sbjct  181  RLERTNQRHVG  191



>ref|XP_009141778.1| PREDICTED: 60S ribosomal protein L13-3 [Brassica rapa]
 ref|XP_009141788.1| PREDICTED: 60S ribosomal protein L13-3 [Brassica rapa]
Length=206

 Score =   303 bits (775),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 151/191 (79%), Positives = 170/191 (89%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNN +P  HFRKHWQN VKTWFNQPARK RRR ARQ+KAVKIFPRPT+G+LRP+VHGQ
Sbjct  1    MKHNNEIPGSHFRKHWQNSVKTWFNQPARKTRRRVARQEKAVKIFPRPTSGSLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            T+KYNMKVRAG+GF+LEELKAAGI KK+A TIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TIKYNMKVRAGKGFTLEELKAAGIAKKMASTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLVVFPRR+R  KAGDST EELA ATQ+ G Y+PI REK +++ V VT DMKSFKAYDK+
Sbjct  121  KLVVFPRRSRVVKAGDSTSEELANATQMQGEYMPIAREKVAMKLVNVTSDMKSFKAYDKI  180

Query  353  RLERTNERHIG  321
            RLERTN+RH G
Sbjct  181  RLERTNKRHAG  191



>ref|NP_001155192.1| 60S ribosomal protein L13 isoform 1 [Zea mays]
 gb|ACF86560.2| unknown [Zea mays]
 tpg|DAA56068.1| TPA: 60S ribosomal protein L13 isoform 1 [Zea mays]
 tpg|DAA56069.1| TPA: 60S ribosomal protein L13 isoform 2 [Zea mays]
 tpg|DAA56070.1| TPA: 60S ribosomal protein L13 isoform 3 [Zea mays]
Length=208

 Score =   302 bits (773),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 159/193 (82%), Positives = 174/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI K+LAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKRLAPTIGISVDHRRKNKSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD  360
            AKLV+FPRRARK KAGDST EEL TATQV G Y+PI R EK SVE VKVTD+MK+F AY 
Sbjct  121  AKLVIFPRRARKVKAGDSTLEELTTATQVQGDYMPITRGEKRSVEVVKVTDEMKAFAAYG  180

Query  359  KLRLERTNERHIG  321
            KLRLER N++H+G
Sbjct  181  KLRLERMNKKHLG  193



>ref|NP_197778.1| 60S ribosomal protein L13-3 [Arabidopsis thaliana]
 sp|Q9FF90.1|RL133_ARATH RecName: Full=60S ribosomal protein L13-3 [Arabidopsis thaliana]
 gb|AAK55698.1|AF378895_1 AT5g23900/MRO11_6 [Arabidopsis thaliana]
 dbj|BAB10063.1| 60S ribosomal protein L13 [Arabidopsis thaliana]
 gb|AAK96460.1| AT5g23900/MRO11_6 [Arabidopsis thaliana]
 gb|AED93230.1| 60S ribosomal protein L13-3 [Arabidopsis thaliana]
Length=206

 Score =   301 bits (772),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 154/186 (83%), Positives = 170/186 (91%), Gaps = 0/186 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+PS HFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRPT+G LRP+VHGQ
Sbjct  1    MKHNNVIPSSHFRKHWQNYVKTWFNQPARKTRRRVARQKKAVKIFPRPTSGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAG+GF+LEELK AGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGKGFTLEELKVAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLVVFPRR+R+ KAGDSTPEELA ATQV G Y+PI   KA++E VK+T D+K+FKAYDK+
Sbjct  121  KLVVFPRRSRQVKAGDSTPEELANATQVQGDYMPIASVKAAMELVKLTADLKAFKAYDKI  180

Query  353  RLERTN  336
            RLERTN
Sbjct  181  RLERTN  186



>ref|XP_004982044.1| PREDICTED: 60S ribosomal protein L13-2-like isoform X1 [Setaria 
italica]
 ref|XP_004982045.1| PREDICTED: 60S ribosomal protein L13-2-like isoform X2 [Setaria 
italica]
Length=207

 Score =   300 bits (767),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 159/192 (83%), Positives = 171/192 (89%), Gaps = 1/192 (1%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  Q
Sbjct  1    MKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQCQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            + KYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQ+NVQRLKTYKA
Sbjct  61   SRKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNRSLEGLQSNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDK  357
            KLV+FPRRARK KAGDSTPEELATATQV G Y+PI R EK S+E VKVTD+MK   AY K
Sbjct  121  KLVIFPRRARKVKAGDSTPEELATATQVQGEYMPITRGEKRSIEVVKVTDEMKESGAYKK  180

Query  356  LRLERTNERHIG  321
            LRLER N+RH G
Sbjct  181  LRLERMNKRHQG  192



>gb|ABK24025.1| unknown [Picea sitchensis]
 gb|ABK27069.1| unknown [Picea sitchensis]
Length=209

 Score =   299 bits (766),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 157/194 (81%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK+RRR ARQKKAVKIFPRPT+G LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKKRRRIARQKKAVKIFPRPTSGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMK+RAGRGFSLEELKAAGI KK APTIGI+VDHRRRN SLEGLQ NVQRLKTYK
Sbjct  61   QTQKYNMKIRAGRGFSLEELKAAGIPKKYAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYK  120

Query  536  AKLVVFPR--RARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAY  363
            AKLVVFPR  RARK KAGDS+ EELATATQ+ G Y+PI +EK SVE +KVTD+MK+FKAY
Sbjct  121  AKLVVFPRSARARKLKAGDSSKEELATATQIQGTYMPISQEKPSVEIIKVTDEMKNFKAY  180

Query  362  DKLRLERTNERHIG  321
             KLR+ER N+R +G
Sbjct  181  AKLRVERMNKRLVG  194



>gb|AFW84113.1| hypothetical protein ZEAMMB73_641905 [Zea mays]
Length=206

 Score =   299 bits (765),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 160/193 (83%), Positives = 173/193 (90%), Gaps = 3/193 (2%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPTAG LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTAGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGISVDHRRKNKSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD  360
            AKLV+FPRRA   KAGDSTPEELATATQV G Y+P  R EK SVE VKVTD+MKSF AY 
Sbjct  121  AKLVIFPRRA--HKAGDSTPEELATATQVQGDYMPFTRGEKRSVEVVKVTDEMKSFAAYG  178

Query  359  KLRLERTNERHIG  321
            KLRLER N++H+G
Sbjct  179  KLRLERMNKKHLG  191



>gb|EMT28307.1| 60S ribosomal protein L13-1 [Aegilops tauschii]
Length=208

 Score =   298 bits (764),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 175/193 (91%), Gaps = 1/193 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMK RAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEG+Q+N+QRLKTYK
Sbjct  61   QTRKYNMKARAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGMQSNIQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD  360
            AKLV+FPRRARK KAGDSTPEELATATQV G Y+PI R EK SVE +KVT++MK+FKAY 
Sbjct  121  AKLVIFPRRARKVKAGDSTPEELATATQVQGDYMPITRGEKRSVELMKVTEEMKAFKAYG  180

Query  359  KLRLERTNERHIG  321
            KLR+ER N+R +G
Sbjct  181  KLRVERMNQRQLG  193



>ref|XP_009396207.1| PREDICTED: 60S ribosomal protein L13-1-like [Musa acuminata subsp. 
malaccensis]
Length=207

 Score =   298 bits (764),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 170/192 (89%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWF+QPARK RRR ARQKKAVKIFPRPT+G L PIV  
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFSQPARKTRRRIARQKKAVKIFPRPTSGPLCPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK RAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKSRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLV+FPRR  KFKAGDS PEEL  ATQV G Y+PI+ EK SVE VKVTD+MKSFKAY K
Sbjct  121  AKLVIFPRRVCKFKAGDSAPEELTAATQVTGQYMPIVHEKPSVELVKVTDEMKSFKAYAK  180

Query  356  LRLERTNERHIG  321
            LR+ER NER +G
Sbjct  181  LRVERMNERLVG  192



>ref|XP_006850159.1| PREDICTED: 60S ribosomal protein L13-1 [Amborella trichopoda]
 gb|ERN11740.1| hypothetical protein AMTR_s00022p00239970 [Amborella trichopoda]
Length=207

 Score =   298 bits (763),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 169/192 (88%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYV+TWFNQPARK RRR AR KKAVKIFPRP AG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVRTWFNQPARKVRRRIARTKKAVKIFPRPVAGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+RAGRGFSLEELKAAGI KKLAPTIGI+VDHRR+N SLEGLQANVQRLKTYK
Sbjct  61   QTLKYNMKLRAGRGFSLEELKAAGIPKKLAPTIGIAVDHRRKNRSLEGLQANVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            A LVVFPRR  KFK GDS PEEL  A+QV   Y+ I REK  VE VK+T++MKSFKAYDK
Sbjct  121  ANLVVFPRRPSKFKVGDSGPEELVNASQVLDKYMAITREKPGVEMVKITEEMKSFKAYDK  180

Query  356  LRLERTNERHIG  321
            LR+ERTN+RH G
Sbjct  181  LRIERTNKRHFG  192



>gb|ABR18061.1| unknown [Picea sitchensis]
Length=207

 Score =   298 bits (762),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/192 (81%), Positives = 173/192 (90%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQNYVKTWFNQPARK+RRR ARQKKAVKIFPRPT+G LRPIVHG
Sbjct  1    MVKHNNVVPNGHFKKHWQNYVKTWFNQPARKKRRRIARQKKAVKIFPRPTSGPLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMK+RAGRGFSLEELKAAGI KK APTIGI+VDHRRRN SLEGLQ NVQRLKTYK
Sbjct  61   QTQKYNMKIRAGRGFSLEELKAAGIPKKYAPTIGIAVDHRRRNRSLEGLQTNVQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPR A K KAGDS+ EELATATQV G Y+PI +EK SV+ +KVTD+MK+FKAY K
Sbjct  121  AKLVVFPRSAGKLKAGDSSQEELATATQVQGTYMPISQEKPSVDIIKVTDEMKNFKAYAK  180

Query  356  LRLERTNERHIG  321
            LR+ER N+R +G
Sbjct  181  LRVERMNKRLVG  192



>dbj|BAJ99213.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=208

 Score =   296 bits (759),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 173/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMK RAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEG+Q+N+QRLKTYK
Sbjct  61   QTRKYNMKARAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGMQSNIQRLKTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD  360
            AKLV+FPRRARK KAGDSTPEELA ATQV G Y+PI R EK SVE VKVT++MK FKAY 
Sbjct  121  AKLVIFPRRARKVKAGDSTPEELANATQVQGDYMPIARGEKRSVEVVKVTEEMKEFKAYG  180

Query  359  KLRLERTNERHIG  321
            KLR+ER N+R +G
Sbjct  181  KLRVERMNQRQLG  193



>gb|EMT10064.1| 60S ribosomal protein L13-1 [Aegilops tauschii]
Length=225

 Score =   297 bits (761),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 173/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  
Sbjct  18   MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC  77

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMK RAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEG+Q+N+QRLKTYK
Sbjct  78   QTRKYNMKARAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGMQSNIQRLKTYK  137

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD  360
            AKLV+FPRRARK KAGDSTPEELA ATQV G Y+PI R EK SVE VKVT++MK FKAY 
Sbjct  138  AKLVIFPRRARKVKAGDSTPEELANATQVQGDYMPIARGEKRSVEVVKVTEEMKEFKAYG  197

Query  359  KLRLERTNERHIG  321
            KLR+ER N+R +G
Sbjct  198  KLRVERMNQRQLG  210



>gb|EMS50076.1| 60S ribosomal protein L13-1 [Triticum urartu]
Length=267

 Score =   296 bits (758),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/193 (80%), Positives = 173/193 (90%), Gaps = 1/193 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  
Sbjct  60   MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC  119

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT KYNMK RAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEG+Q+N+QRLKTYK
Sbjct  120  QTRKYNMKARAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGMQSNIQRLKTYK  179

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYD  360
            AKLV+FPRRARK KAGDSTPEELA ATQV G Y+PI R EK SVE VKVT++MK FKAY 
Sbjct  180  AKLVIFPRRARKVKAGDSTPEELANATQVQGDYMPIARGEKRSVEVVKVTEEMKEFKAYG  239

Query  359  KLRLERTNERHIG  321
            KLR+ER N+R +G
Sbjct  240  KLRVERMNQRQLG  252



>gb|AIZ68174.1| 60S ribosomal protein L13-1-like protein [Ornithogalum saundersiae]
Length=207

 Score =   291 bits (746),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 151/192 (79%), Positives = 171/192 (89%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHF+KHWQ+YV+TWF+QPARK RRR ARQKKAVK FPRPTAG LRP+VH 
Sbjct  1    MVKHNNVVPNGHFKKHWQDYVRTWFDQPARKTRRRIARQKKAVKEFPRPTAGPLRPVVHC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+RAGRGFSLEELKAAGI KK APTIGI++DHRR+N SLEGLQANVQRLKTY 
Sbjct  61   QTLKYNMKLRAGRGFSLEELKAAGIPKKWAPTIGIAIDHRRKNRSLEGLQANVQRLKTYM  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLV+FPRRA KFKAGDS PEELA ATQV+G Y+PI +EK SV  VKVTD+MK+F+AY K
Sbjct  121  AKLVIFPRRAGKFKAGDSPPEELANATQVHGEYMPIQQEKPSVNLVKVTDEMKAFRAYAK  180

Query  356  LRLERTNERHIG  321
            LR+ER N R IG
Sbjct  181  LRVERMNARQIG  192



>ref|XP_007040896.1| 60S ribosomal protein L13 [Theobroma cacao]
 gb|EOY25397.1| 60S ribosomal protein L13 [Theobroma cacao]
Length=197

 Score =   290 bits (741),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 154/192 (80%), Positives = 168/192 (88%), Gaps = 10/192 (5%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHFRKHWQNYVKTWFNQPARK RRR ARQKKAVKIFPRP+AG LRPIVHG
Sbjct  1    MVKHNNVVPNGHFRKHWQNYVKTWFNQPARKARRRLARQKKAVKIFPRPSAGHLRPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYNMK+RAGRGFSLEELKAAGI+KKLAPTI  +VDHRR+N SLE LQANVQRLKT K
Sbjct  61   QTLKYNMKLRAGRGFSLEELKAAGISKKLAPTIDTAVDHRRKNRSLESLQANVQRLKTCK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLV          AGDSTPEELATATQV GPY+PI  +K SVE VKVT++MKSFKAY+K
Sbjct  121  AKLV----------AGDSTPEELATATQVQGPYIPIAGDKPSVELVKVTEEMKSFKAYNK  170

Query  356  LRLERTNERHIG  321
            LR+ER NERHIG
Sbjct  171  LRVERMNERHIG  182



>gb|EMS59514.1| 60S ribosomal protein L13-1 [Triticum urartu]
Length=215

 Score =   289 bits (740),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 154/200 (77%), Positives = 174/200 (87%), Gaps = 8/200 (4%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+KHWQNYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  
Sbjct  1    MVKHNNVIPNGHFKKHWQNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQC  60

Query  716  QTLKYNMKVRAGRGFSLEELK-------AAGITKKLAPTIGISVDHRRRNSSLEGLQANV  558
            QT KYNMK RAGRGF+LEELK       +AGI KKLAPTIGISVDHRR+N SLEG+Q+N+
Sbjct  61   QTRKYNMKARAGRGFTLEELKLLSCVFLSAGIPKKLAPTIGISVDHRRKNRSLEGMQSNI  120

Query  557  QRLKTYKAKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDM  381
            QRLKTYKAKLV+FPR ARK KAGDSTPEELATATQV G YLPI R EK SVE +KVT++M
Sbjct  121  QRLKTYKAKLVIFPRCARKVKAGDSTPEELATATQVQGDYLPITRGEKRSVELMKVTEEM  180

Query  380  KSFKAYDKLRLERTNERHIG  321
            K+FKAY KLR+ER N+R +G
Sbjct  181  KAFKAYGKLRVERMNQRQLG  200



>ref|XP_010539934.1| PREDICTED: 60S ribosomal protein L13-1-like [Tarenaya hassleriana]
Length=206

 Score =   286 bits (733),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 146/190 (77%), Positives = 165/190 (87%), Gaps = 0/190 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+KHWQ+YVKTWFNQPARK RRR ARQ+KAVKIFPRPTAG LRP+VHGQ
Sbjct  1    MKHNNVIPNGHFKKHWQHYVKTWFNQPARKTRRRIARQEKAVKIFPRPTAGPLRPVVHGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TLKYNMKVRAGRGF+LEEL AAG+ KKLAPTIGI VDHRR+N SLEGLQ NVQRLKTYKA
Sbjct  61   TLKYNMKVRAGRGFTLEELMAAGVPKKLAPTIGIVVDHRRKNRSLEGLQTNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FP   RK  AGDS  EELA  +Q+   Y+PI+REK ++EFVKV + M SFKAYDK+
Sbjct  121  KLVIFPHCTRKVNAGDSAAEELANTSQMQEVYMPIVREKPALEFVKVAEGMTSFKAYDKV  180

Query  353  RLERTNERHI  324
            RLERT ERH+
Sbjct  181  RLERTIERHV  190



>gb|ABF97255.1| 60S ribosomal protein L13-2, putative, expressed [Oryza sativa 
Japonica Group]
Length=196

 Score =   273 bits (699),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 149/179 (83%), Positives = 159/179 (89%), Gaps = 1/179 (1%)
 Frame = -3

Query  854  KHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKVRAGRG  675
            KH  NYVKTWFNQPARKQRRR ARQKKAVKIFPRPT+G LRPIV  QTLKYNMK RAGRG
Sbjct  3    KHNNNYVKTWFNQPARKQRRRIARQKKAVKIFPRPTSGPLRPIVQCQTLKYNMKSRAGRG  62

Query  674  FSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFK  495
            F+LEELKAAGI KK APTIGISVDHRR+N SLEGLQANVQRLKTYKAKLV+FPRRARK K
Sbjct  63   FTLEELKAAGIPKKYAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVIFPRRARKVK  122

Query  494  AGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  321
            AGDST EELATATQV G Y+PI R EK SVE VKVTD+MK+FKAY KLR+ER N+RH+G
Sbjct  123  AGDSTAEELATATQVQGDYMPIARGEKRSVEVVKVTDEMKAFKAYAKLRVERMNQRHVG  181



>ref|NP_190465.1| putative 60S ribosomal protein L13-2 [Arabidopsis thaliana]
 sp|Q9SMT4.1|RL132_ARATH RecName: Full=Putative 60S ribosomal protein L13-2 [Arabidopsis 
thaliana]
 emb|CAB62014.1| 60S ribosomal protein L13 (BBC1)-like [Arabidopsis thaliana]
 gb|AEE78477.1| putative 60S ribosomal protein L13-2 [Arabidopsis thaliana]
Length=206

 Score =   271 bits (692),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 139/191 (73%), Positives = 158/191 (83%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF+K W+NYVKT FNQPA K RRR ARQ KAVKIFPRPTAG +RP+VH Q
Sbjct  1    MKHNNVIPNGHFKKKWENYVKTSFNQPAMKTRRRIARQNKAVKIFPRPTAGPIRPVVHAQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            TL YNMKVRAG+GF+LEELKAAGI KKLAPTIGISVDH R+N SLEG Q NVQRLKTYKA
Sbjct  61   TLTYNMKVRAGKGFTLEELKAAGIPKKLAPTIGISVDHHRKNRSLEGFQTNVQRLKTYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KLV+FPR AR  K GDS  +ELA ATQV   ++PI+RE  ++E VK+T DMK F AYDK+
Sbjct  121  KLVIFPRCARTVKVGDSAQQELANATQVQVDHMPIVREMPTMELVKLTSDMKLFNAYDKI  180

Query  353  RLERTNERHIG  321
            RLE  N+RH G
Sbjct  181  RLEGINKRHAG  191



>ref|XP_001770513.1| predicted protein [Physcomitrella patens]
 gb|EDQ64682.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   265 bits (678),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 136/192 (71%), Positives = 164/192 (85%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+K WQNYV+TWFNQPARK+RRR ARQKKAV +FPRPTAG LRP+VH 
Sbjct  1    MVKHNNVIPNGHFKKDWQNYVRTWFNQPARKKRRRTARQKKAVAVFPRPTAGPLRPVVHS  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYN K+R+GRGF+LEELKAAGI KKLAPTIGI+VDHRR+N  LE LQ NV RL TY+
Sbjct  61   QTLKYNSKIRSGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRCLESLQENVNRLNTYR  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRR++K KAGDS+ EEL++ TQV GP LPI++ + +V+ V +TD+MKS K Y K
Sbjct  121  AKLVVFPRRSKKTKAGDSSAEELSSFTQVIGPVLPIVKPRPTVDIVSITDEMKSQKGYYK  180

Query  356  LRLERTNERHIG  321
            LR ER NER +G
Sbjct  181  LRQERMNERLVG  192



>ref|XP_001762920.1| predicted protein [Physcomitrella patens]
 gb|EDQ72125.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   265 bits (677),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 134/192 (70%), Positives = 163/192 (85%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+K WQNYV+TWFNQPARK+RRR ARQKKAV +FPRPTAG LRP+VH 
Sbjct  1    MVKHNNVIPNGHFKKDWQNYVRTWFNQPARKKRRRTARQKKAVAVFPRPTAGPLRPVVHS  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYN K+R+GRGF+LEELKAAGI KKLAPTIGI+VDHRR+N  LE LQ N+ RL TY+
Sbjct  61   QTLKYNSKIRSGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRCLESLQENINRLNTYR  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRR++K KAGD+T EEL++ TQ+  P LPI++ + + E V +TD+MKS K Y K
Sbjct  121  AKLVVFPRRSKKTKAGDATAEELSSVTQLTRPVLPIVKPQPTAEIVSITDEMKSQKGYYK  180

Query  356  LRLERTNERHIG  321
            LRLER NER +G
Sbjct  181  LRLERMNERLVG  192



>ref|XP_001756184.1| predicted protein [Physcomitrella patens]
 gb|EDQ79050.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   265 bits (676),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 137/192 (71%), Positives = 162/192 (84%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+K WQNYV+TWFNQPARK+RRR ARQKKA  +FPRPTAG LRP+VH 
Sbjct  1    MVKHNNVIPNGHFKKDWQNYVRTWFNQPARKKRRRTARQKKAAAVFPRPTAGPLRPVVHS  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTL+YN K+RAGRGF+L+ELKAAGI KKLAPTIGI+VDHRR+N  LE LQ NV RL TY+
Sbjct  61   QTLRYNAKIRAGRGFTLDELKAAGIPKKLAPTIGIAVDHRRKNRCLESLQENVNRLNTYR  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRRARK KAGD+T EEL++ATQV    LPI++ + +VE V VTD+MKS K Y K
Sbjct  121  AKLVVFPRRARKSKAGDATAEELSSATQVTRSVLPIVKPRPTVEIVSVTDEMKSQKGYYK  180

Query  356  LRLERTNERHIG  321
            LR ER NER +G
Sbjct  181  LRQERMNERLVG  192



>ref|XP_001761309.1| predicted protein [Physcomitrella patens]
 gb|EDQ74031.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   260 bits (665),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 161/192 (84%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+K WQNYV+TWFNQPARK+RRR ARQKK+V +FPRPTAG LRP+VH 
Sbjct  1    MVKHNNVIPNGHFKKDWQNYVRTWFNQPARKKRRRTARQKKSVAVFPRPTAGPLRPVVHS  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYN K+RAGRGF+LEELKAAG+ KKLAPTIGI+VDHRR+N  LE LQ NV RL TY+
Sbjct  61   QTLKYNAKIRAGRGFTLEELKAAGVPKKLAPTIGIAVDHRRKNRCLESLQENVNRLNTYR  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPR ++K KAGD++ EEL++ TQ  G +LPI++ + S E V +TD+MKS + Y K
Sbjct  121  AKLVVFPRLSKKTKAGDASAEELSSVTQATGEFLPIVKPRPSAEIVSITDEMKSQRGYYK  180

Query  356  LRLERTNERHIG  321
            LR ER NER +G
Sbjct  181  LRQERMNERLVG  192



>ref|XP_001785308.1| predicted protein [Physcomitrella patens]
 gb|EDQ49876.1| predicted protein [Physcomitrella patens]
Length=207

 Score =   259 bits (662),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 131/192 (68%), Positives = 160/192 (83%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+GHF+K WQNYV+TWFNQPARK+RRR ARQ+KAV +FPRPTAG LRP+VH 
Sbjct  1    MVKHNNVIPNGHFKKDWQNYVRTWFNQPARKKRRRTARQRKAVAVFPRPTAGPLRPVVHS  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTL+YN K+RAGRGF+LEELKAAGI KKLAPTIGI+VDHRR+N  LE LQ NV RL  Y+
Sbjct  61   QTLRYNAKIRAGRGFTLEELKAAGIPKKLAPTIGIAVDHRRKNRCLESLQENVNRLNMYR  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFPRR++K KAGD++ EEL++ TQV G  LPI++ + S E V +TD+MK+   Y K
Sbjct  121  AKLVVFPRRSKKTKAGDASAEELSSVTQVTGDVLPIVKSRPSAEIVSITDEMKAQMGYYK  180

Query  356  LRLERTNERHIG  321
            LR ER NER +G
Sbjct  181  LRQERMNERLVG  192



>sp|P49627.1|RL13_TOBAC RecName: Full=60S ribosomal protein L13; AltName: Full=Clone 
6.2.1 protein [Nicotiana tabacum]
 gb|AAA72054.1| unnamed protein product [Nicotiana tabacum]
Length=202

 Score =   253 bits (647),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 137/183 (75%), Positives = 150/183 (82%), Gaps = 0/183 (0%)
 Frame = -3

Query  869  SGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLKYNMKV  690
            +GHF+KHWQNYVKTWFNQPARK RRR ARQKKAVKI PRPTAG LRPIVHGQTLKYNMKV
Sbjct  5    NGHFKKHWQNYVKTWFNQPARKTRRRIARQKKAVKISPRPTAGTLRPIVHGQTLKYNMKV  64

Query  689  RAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRR  510
            R+GRGFSLEELKAAGI KKLAPTIGI+VDHRRRN SLEGLQ NVQRL+  + +LVVFPRR
Sbjct  65   RSGRGFSLEELKAAGIPKKLAPTIGIAVDHRRRNRSLEGLQTNVQRLEDLQGQLVVFPRR  124

Query  509  ARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNER  330
            A + +     P    TATQV+G Y+PI REK  +   KV   MKSF AY KLR+ERTNER
Sbjct  125  ASRSRLVILPPRNCLTATQVHGAYMPIEREKHQLILSKVLKKMKSFNAYAKLRVERTNER  184

Query  329  HIG  321
            HIG
Sbjct  185  HIG  187



>ref|XP_002962809.1| hypothetical protein SELMODRAFT_266648 [Selaginella moellendorffii]
 gb|EFJ36272.1| hypothetical protein SELMODRAFT_266648 [Selaginella moellendorffii]
Length=208

 Score =   242 bits (617),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/192 (66%), Positives = 153/192 (80%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++K NNV+P+ HF+K W+  V+TWFNQPARK RRR AR  KA KIFPRP +G LRP+VH 
Sbjct  1    MVKGNNVIPNQHFKKDWEKLVRTWFNQPARKVRRRKARSIKAAKIFPRPPSGPLRPVVHC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
             T+KYN KV+ GRGFSLEELK AGI+KKLA TIGI++DHRR+N SLE LQ NVQRL TYK
Sbjct  61   PTVKYNSKVKYGRGFSLEELKEAGISKKLARTIGIALDHRRKNRSLESLQTNVQRLNTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
             KL+VFPR+A+K K GDS PE L+TATQ  GP LPI+ +K  V  V VTD+MK+ KAY K
Sbjct  121  TKLIVFPRKAKKTKMGDSQPEVLSTATQFQGPVLPIVPKKPEVGIVTVTDEMKAVKAYQK  180

Query  356  LRLERTNERHIG  321
            LR+E+TN+R +G
Sbjct  181  LRIEQTNKRLVG  192



>ref|XP_002962473.1| hypothetical protein SELMODRAFT_165483 [Selaginella moellendorffii]
 gb|EFJ35936.1| hypothetical protein SELMODRAFT_165483 [Selaginella moellendorffii]
Length=208

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 125/192 (65%), Positives = 152/192 (79%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++K NNV+P+ HF+K W+  V+TWFNQPARK RRR AR  KA KIFPRP +G LRP+VH 
Sbjct  1    MVKGNNVIPNQHFKKDWEKLVRTWFNQPARKVRRRKARSIKAAKIFPRPPSGPLRPVVHC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
             T+KYN KV+ GRGFSLEELK AGI+K LA TIGI++DHRR+N SLE LQ NVQRL TYK
Sbjct  61   PTVKYNSKVKYGRGFSLEELKEAGISKNLARTIGIALDHRRKNRSLESLQTNVQRLNTYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
             KL+VFPR+A+K K GDS PE L+TATQ  GP LPI+ +K  V  V VTD+MK+ KAY K
Sbjct  121  TKLIVFPRKAKKTKMGDSQPEVLSTATQFQGPVLPIVPKKPEVGIVTVTDEMKAVKAYQK  180

Query  356  LRLERTNERHIG  321
            LR+E+TN+R +G
Sbjct  181  LRIEQTNKRLVG  192



>gb|AAT08722.1| cold-induced protein [Hyacinthus orientalis]
Length=185

 Score =   235 bits (599),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = -3

Query  770  VKIFPRPTAGALRPIVHGQTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRR  591
            VKIFPRPTAG LRP+VH QTLKYNMK RAGRGFSLEELK AGI KK APT+GI+VDHRRR
Sbjct  33   VKIFPRPTAGPLRPVVHCQTLKYNMKTRAGRGFSLEELKMAGIPKKWAPTVGIAVDHRRR  92

Query  590  NSSLEGLQANVQRLKTYKAKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKAS  411
            N SLEGLQANVQRLK YKAKLV+FPRR  KFK+GDS+ EELA+ TQV G Y+P+++EK  
Sbjct  93   NRSLEGLQANVQRLKEYKAKLVIFPRRPGKFKSGDSSAEELASITQVQGEYMPLVKEKPV  152

Query  410  VEFVKVTDDMKSFKAYDKLRLERTNERHIG  321
            V  VKVT +M +FKAY KL +ERTNERH+G
Sbjct  153  VNLVKVTAEMNAFKAYHKLPVERTNERHLG  182



>ref|XP_011395748.1| 60S ribosomal protein L13-2 [Auxenochlorella protothecoides]
 gb|KFM22882.1| 60S ribosomal protein L13-2 [Auxenochlorella protothecoides]
Length=208

 Score =   235 bits (600),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            +++HNNVVP+ HFRK WQ  V+TWFNQPARK RRR AR +KA  +FPRPTAG LRPIVH 
Sbjct  1    MVRHNNVVPNQHFRKKWQTNVRTWFNQPARKLRRRQARAEKAKTVFPRPTAGPLRPIVHS  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT+KYN K R GRGF+LEELK AGI+ KLAPT+GI+VDHRRRN SLEGLQ NV RLK YK
Sbjct  61   QTVKYNRKKRTGRGFTLEELKEAGISAKLAPTVGIAVDHRRRNRSLEGLQENVARLKAYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            A LV+FPRRA K +AG+++ EELA   Q+ GP LP+   K  +E VK+T + K+  AY  
Sbjct  121  ANLVLFPRRAGKPRAGEASAEELAAVAQLTGPVLPLTHTKPKLELVKLTAEQKAATAYAT  180

Query  356  LRLERTNERHIG  321
            LRLER N R  G
Sbjct  181  LRLERMNVRMAG  192



>ref|XP_005646484.1| ribosomal protein L13e [Coccomyxa subellipsoidea C-169]
 gb|EIE21940.1| ribosomal protein L13e [Coccomyxa subellipsoidea C-169]
Length=217

 Score =   234 bits (598),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/199 (63%), Positives = 150/199 (75%), Gaps = 7/199 (4%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQ-------NYVKTWFNQParkqrrraarqkkAVKIFPRPTAGA  738
            ++KHNNV+P+ HF+KHW        +YV+TWFNQPARK RR  AR +KA K+FPRP AG 
Sbjct  1    MVKHNNVIPNQHFKKHWHGGKNGKGSYVRTWFNQPARKHRRATARIEKAKKVFPRPAAGP  60

Query  737  LRPIVHGQTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANV  558
            LRPIVHGQT+KYN+K R GRGF+LEELK AGI  KLAPTIGI+VDHRR N SLE LQ N 
Sbjct  61   LRPIVHGQTIKYNLKKRLGRGFTLEELKEAGIAVKLAPTIGIAVDHRRHNRSLESLQENA  120

Query  557  QRLKTYKAKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMK  378
             RLK YKAKLV+FP R+   K+GDST EEL  A Q  GP LP++     +E VK+TD++K
Sbjct  121  ARLKAYKAKLVIFPTRSNMPKSGDSTAEELKVAQQHKGPLLPLVHAAHKLESVKLTDELK  180

Query  377  SFKAYDKLRLERTNERHIG  321
            + KAY KLRLERTN + +G
Sbjct  181  AEKAYYKLRLERTNAKLVG  199



>ref|XP_001633643.1| predicted protein [Nematostella vectensis]
 gb|EDO41580.1| predicted protein [Nematostella vectensis]
Length=211

 Score =   228 bits (582),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 118/190 (62%), Positives = 144/190 (76%), Gaps = 0/190 (0%)
 Frame = -3

Query  890  KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQT  711
            K NN++P+GHF K WQ YVKTWF+QP RK+RRR ARQ KA KI PRP AG+LRPIV   T
Sbjct  4    KRNNIIPNGHFHKDWQRYVKTWFDQPGRKKRRRVARQTKAAKIAPRPVAGSLRPIVRCPT  63

Query  710  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  531
             KYN KVRAGRGF+L+ELKAAGI +K+APTIGI+VDHRR+N S E LQANVQRLK YK+K
Sbjct  64   FKYNTKVRAGRGFTLDELKAAGIPRKVAPTIGIAVDHRRKNRSAESLQANVQRLKEYKSK  123

Query  530  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLR  351
            L+VFPR+A K K GDS   +LA A Q+ GP +PI +E   ++   +T+D K F  +  +R
Sbjct  124  LIVFPRKANKPKQGDSEAADLANAVQLQGPVMPIPQESVPIKARPITEDEKKFSVFKTMR  183

Query  350  LERTNERHIG  321
            +ER N R IG
Sbjct  184  IERANARLIG  193



>emb|CDP02021.1| unnamed protein product [Coffea canephora]
Length=141

 Score =   223 bits (568),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/126 (87%), Positives = 115/126 (91%), Gaps = 0/126 (0%)
 Frame = -3

Query  698  MKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVF  519
            MKVRAGRGF+LEELKAAGI KKL PTIG+SVDHRR+N SLEG QANVQRLKTYKAKLVVF
Sbjct  1    MKVRAGRGFTLEELKAAGIPKKLGPTIGVSVDHRRKNRSLEGFQANVQRLKTYKAKLVVF  60

Query  518  PRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERT  339
            PRRARKFKAGDS PEELATATQV G YLPI+ EK  VE VKVT++MKSFKAYDKLRLERT
Sbjct  61   PRRARKFKAGDSAPEELATATQVQGAYLPIVCEKPCVELVKVTEEMKSFKAYDKLRLERT  120

Query  338  NERHIG  321
            NERHIG
Sbjct  121  NERHIG  126



>gb|KDD76767.1| ribosomal protein L13e [Helicosporidium sp. ATCC 50920]
Length=212

 Score =   225 bits (574),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 120/192 (63%), Positives = 145/192 (76%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            +++HNNVVP+ HF+K WQ  V+TWFNQPARK RR+ AR  KA   FPRPTAG LRP+VH 
Sbjct  1    MVRHNNVVPNQHFKKKWQFNVRTWFNQPARKLRRKNARVAKARSTFPRPTAGPLRPVVHC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
             T+KYN +VRAG+GFSL ELK AGI  KLAPTIGI+VDHRRRN SLEGLQANVQRLK YK
Sbjct  61   PTVKYNRRVRAGKGFSLAELKEAGIAAKLAPTIGIAVDHRRRNKSLEGLQANVQRLKAYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            A+LV+FPR+A+  KAGD++ EE+A ATQ  G  +PI      VE VK+T +M+   AY  
Sbjct  121  AQLVLFPRKAKSPKAGDASAEEVAAATQHKGYVMPIKTVHPEVEMVKITKEMQEASAYAT  180

Query  356  LRLERTNERHIG  321
            LR  R++ R  G
Sbjct  181  LRKARSDARLAG  192



>ref|XP_003626151.1| 60S ribosomal protein L13 [Medicago truncatula]
Length=141

 Score =   220 bits (560),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/126 (85%), Positives = 117/126 (93%), Gaps = 0/126 (0%)
 Frame = -3

Query  698  MKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVF  519
            MK+RAG+GFSLEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLVVF
Sbjct  1    MKLRAGKGFSLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVVF  60

Query  518  PRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERT  339
            PRRARK KAGDSTPEELA ATQV G YLPI+REK SVE VK+TD+MK+FKAY KLRLERT
Sbjct  61   PRRARKVKAGDSTPEELANATQVQGSYLPIVREKPSVELVKITDEMKAFKAYYKLRLERT  120

Query  338  NERHIG  321
            N+RH+G
Sbjct  121  NKRHLG  126



>ref|XP_003626152.1| 60S ribosomal protein L13 [Medicago truncatula]
Length=139

 Score =   213 bits (543),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 2/126 (2%)
 Frame = -3

Query  698  MKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVF  519
            MK+RAG+GFSLEELK+AGI KKLAPTIGISVDHRR+N SLEGLQANVQRLKTYKAKLVVF
Sbjct  1    MKLRAGKGFSLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVVF  60

Query  518  PRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERT  339
            PRRAR  KAGDSTPEELA ATQV G YLPI+REK SVE VK+TD+MK+FKAY KLRLERT
Sbjct  61   PRRAR--KAGDSTPEELANATQVQGSYLPIVREKPSVELVKITDEMKAFKAYYKLRLERT  118

Query  338  NERHIG  321
            N+RH+G
Sbjct  119  NKRHLG  124



>emb|CAD28610.1| 60S ribosomal protein L13 [Polytomella sp. Pringsheim 198.80]
Length=207

 Score =   216 bits (549),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 147/192 (77%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            +++HNNVVP+ HF+K WQ YVKTWFNQ ARK RRR+AR +KA K+FPRP AG+L+PIVHG
Sbjct  1    MVRHNNVVPNNHFKKKWQFYVKTWFNQAARKLRRRSARAEKAKKVFPRPVAGSLKPIVHG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT+KYN K+R GRGF+L ELK AGI  K APTIGISVD+RRRN S+EGLQ N  RLK Y+
Sbjct  61   QTVKYNSKLRLGRGFTLAELKEAGIPAKFAPTIGISVDYRRRNKSVEGLQENANRLKAYR  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            + LV+FPR  +K KA +++ EE A+A Q  G  LPI R K +VE   +T +MK F AY K
Sbjct  121  SNLVIFPRNVKKPKAFEASAEEKASAAQFAGEILPIARCKPTVETAAITAEMKEFNAYAK  180

Query  356  LRLERTNERHIG  321
            LR+ER N R +G
Sbjct  181  LRVERMNVRQVG  192



>gb|KCW72783.1| hypothetical protein EUGRSUZ_E01232 [Eucalyptus grandis]
Length=154

 Score =   213 bits (542),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 119/181 (66%), Positives = 134/181 (74%), Gaps = 31/181 (17%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNVVP+GHFRKHWQNY+KT FNQPARK RRR A+QKKAVKIFPRPTA         
Sbjct  1    MVKHNNVVPNGHFRKHWQNYIKTCFNQPARKARRRLAQQKKAVKIFPRPTA---------  51

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
                                  AGI KKL PTIGI+VDHRR+N SLEGL ANVQRLKTY+
Sbjct  52   ----------------------AGIPKKLPPTIGIAVDHRRKNQSLEGLHANVQRLKTYR  89

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKLVVFP+ ARKFKAG+STPEELA ATQV G YLPI+REK +VE V+VTD+MKSF AY+ 
Sbjct  90   AKLVVFPKCARKFKAGNSTPEELANATQVQGTYLPIVREKPAVELVEVTDEMKSFNAYES  149

Query  356  L  354
             
Sbjct  150  C  150



>ref|XP_002154424.1| PREDICTED: 60S ribosomal protein L13-like [Hydra vulgaris]
Length=210

 Score =   213 bits (542),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 111/191 (58%), Positives = 140/191 (73%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF KHWQNYV+TWFNQP RK+RRR ARQKKA+ I PRP AG+LRP+V   
Sbjct  1    MKHNNVLPNGHFHKHWQNYVRTWFNQPGRKKRRRTARQKKALAIAPRPVAGSLRPVVRCP  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            T KY+ KVR+GRGF+LEELK A I  + A T+GI+VDHRR+N S E LQANVQRL+ Y++
Sbjct  61   TFKYHTKVRSGRGFTLEELKTAQIKLRFAKTVGIAVDHRRKNKSTESLQANVQRLQEYQS  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KL++FPR+  K KAGDS    L  ATQ+ GP LPI + K   +   +TD+ +    +  +
Sbjct  121  KLIIFPRKQNKPKAGDSEASVLTVATQLKGPVLPITQIKTDTKARMITDEERKISVFRSM  180

Query  353  RLERTNERHIG  321
            R+ R N R IG
Sbjct  181  RVARANARLIG  191



>ref|XP_002502525.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO63783.1| predicted protein [Micromonas sp. RCC299]
Length=220

 Score =   213 bits (543),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 118/194 (61%), Positives = 137/194 (71%), Gaps = 5/194 (3%)
 Frame = -3

Query  887  HNNVVPSGHFRKHWQN-----YVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIV  723
            HNN +P+ HF+K WQ       V+TWFNQ  RK+ RR AR+KKA  IFPRPTAGALRP+V
Sbjct  4    HNNQLPNAHFKKDWQGNAGACRVRTWFNQAGRKKSRRIAREKKAKAIFPRPTAGALRPVV  63

Query  722  HGQTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKT  543
               T +YN K R GRGF+LEELKAAGI KKLAPTIGI+VDHRRRN S E L  N +RLK 
Sbjct  64   RPPTQRYNFKTRLGRGFTLEELKAAGIPKKLAPTIGIAVDHRRRNRSEESLALNSKRLKE  123

Query  542  YKAKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAY  363
            YKA L++FPRR  K KAGDS   ELA A Q  G  +PI +E   +E V VT++MK F AY
Sbjct  124  YKASLILFPRRTAKPKAGDSDAGELAMAKQFKGALMPITKEDKPLEMVSVTEEMKGFNAY  183

Query  362  DKLRLERTNERHIG  321
             KLR ER N R +G
Sbjct  184  QKLRTERMNVRQVG  197



>ref|NP_001238240.1| uncharacterized protein LOC100499935 [Glycine max]
 gb|ACU14254.1| unknown [Glycine max]
Length=141

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/126 (82%), Positives = 112/126 (89%), Gaps = 0/126 (0%)
 Frame = -3

Query  698  MKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVF  519
            MKVR+GRGFSLEELKA GI KKL PTIGISVDHRR+N SLE LQANVQRLKTYKAKLVVF
Sbjct  1    MKVRSGRGFSLEELKAVGIPKKLGPTIGISVDHRRKNRSLESLQANVQRLKTYKAKLVVF  60

Query  518  PRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERT  339
            PRRA K KAGDSTPEELA ATQV G +LPI+REK +V+ VKVTD+MK+FKAY KLRLERT
Sbjct  61   PRRAHKVKAGDSTPEELANATQVQGSFLPIVREKPTVDLVKVTDEMKAFKAYYKLRLERT  120

Query  338  NERHIG  321
            N+RH G
Sbjct  121  NKRHYG  126



>ref|XP_005843532.1| hypothetical protein CHLNCDRAFT_33026 [Chlorella variabilis]
 gb|EFN51430.1| hypothetical protein CHLNCDRAFT_33026 [Chlorella variabilis]
Length=207

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 120/191 (63%), Positives = 138/191 (72%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            M +N +     +RK WQ+ V TWFNQPARK+RRRAAR +KA ++ PRP AG LRP+V GQ
Sbjct  1    MPNNQISSIRKYRKKWQDKVVTWFNQPARKERRRAARAEKATRVAPRPVAGLLRPVVSGQ  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            T+KYN K RAGRGF+LEELK AGI  KLAPTIGI+VDHRR N SLE LQ N  RLK YKA
Sbjct  61   TVKYNTKKRAGRGFTLEELKEAGIPAKLAPTIGIAVDHRRTNRSLESLQENANRLKAYKA  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
             LVVFPRRA K KAGD++  EL TA Q+ G  LP +   A+VE V VT DMK   AY  L
Sbjct  121  NLVVFPRRAGKPKAGDASAAELGTAQQLKGALLPFVPTAAAVEKVAVTADMKKESAYGVL  180

Query  353  RLERTNERHIG  321
            RLER N+R  G
Sbjct  181  RLERMNKRMAG  191



>emb|CCQ18590.1| 60S ribosomal protein L13 [Sycon ciliatum]
Length=208

 Score =   211 bits (537),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/188 (57%), Positives = 140/188 (74%), Gaps = 0/188 (0%)
 Frame = -3

Query  884  NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLK  705
            NN++P+ HF K W   VK WF+QP RK RRR AR+KKA+++ PRP AG+LRP+V  QT K
Sbjct  3    NNIIPNAHFHKDWDKRVKCWFDQPGRKSRRRQAREKKALRVAPRPVAGSLRPVVRCQTFK  62

Query  704  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  525
            YN KVRAGRGF+LEELKAAGI++K+APTIGI+VDHRRRN S E LQANVQRLK Y++KL+
Sbjct  63   YNTKVRAGRGFTLEELKAAGISRKVAPTIGITVDHRRRNRSSESLQANVQRLKEYRSKLI  122

Query  524  VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE  345
            VFPR+  K K GDS   EL  A+Q+ GP LPI +   +++   +TD+ K+   +  +R+ 
Sbjct  123  VFPRKLSKPKRGDSDAAELKVASQLAGPILPIRQVHPTIKARAITDEEKTTSVFRSMRIA  182

Query  344  RTNERHIG  321
            R N R +G
Sbjct  183  RANARLVG  190



>dbj|BAB71993.1| BBC1-like protein [Oryza sativa Japonica Group]
Length=142

 Score =   206 bits (523),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 112/127 (88%), Gaps = 1/127 (1%)
 Frame = -3

Query  698  MKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVF  519
            MK RAGRGF+LEELKAAGI KK APTIGISVDHRR+N SLEGLQANVQRLKTYKAKLV+F
Sbjct  1    MKSRAGRGFTLEELKAAGIPKKYAPTIGISVDHRRKNRSLEGLQANVQRLKTYKAKLVIF  60

Query  518  PRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLER  342
            PRRARK KA DST EELATATQV G Y+PI R EK SVE VKVTD+MK+FKAY KLR+ER
Sbjct  61   PRRARKVKAXDSTAEELATATQVQGDYMPIARGEKRSVEVVKVTDEMKAFKAYAKLRVER  120

Query  341  TNERHIG  321
             N+RH+G
Sbjct  121  MNQRHVG  127



>ref|XP_003056914.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58559.1| predicted protein [Micromonas pusilla CCMP1545]
Length=220

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/194 (60%), Positives = 134/194 (69%), Gaps = 5/194 (3%)
 Frame = -3

Query  887  HNNVVPSGHFRKHWQN-----YVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIV  723
            HNN + + HF+K WQ       VKTWFNQ  RK+ RR AR+KKA  IFPRPTAGALRPIV
Sbjct  4    HNNQIANAHFKKDWQGNAGACRVKTWFNQAGRKKSRRIAREKKAKAIFPRPTAGALRPIV  63

Query  722  HGQTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKT  543
               T +YN K R GRGF+LEELK AGI KKLAPTIGI+VDHRRRN S E L  N +RLK 
Sbjct  64   RPPTQRYNFKTRLGRGFTLEELKVAGIPKKLAPTIGIAVDHRRRNRSEESLALNSKRLKA  123

Query  542  YKAKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAY  363
            YKA L++FPRR  K K GDS   EL+ A Q+ G  +PI +E   +E V VT +MK FKAY
Sbjct  124  YKASLILFPRRTAKPKHGDSEAGELSMAKQLKGKLMPITKETKPLEMVAVTGEMKDFKAY  183

Query  362  DKLRLERTNERHIG  321
              LR ER N R +G
Sbjct  184  QTLRTERMNVRQVG  197



>gb|AAL93210.1|AF487458_1 BBC1-like protein [Triticum aestivum]
Length=142

 Score =   203 bits (517),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/127 (78%), Positives = 112/127 (88%), Gaps = 1/127 (1%)
 Frame = -3

Query  698  MKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVF  519
            MK RAGRGF+LEELK+AGI KKLAPTIGISVDHRR+N SLEG+Q+N+QRLKTYKAKLV+F
Sbjct  1    MKARAGRGFTLEELKSAGIPKKLAPTIGISVDHRRKNRSLEGMQSNIQRLKTYKAKLVIF  60

Query  518  PRRARKFKAGDSTPEELATATQVNGPYLPILR-EKASVEFVKVTDDMKSFKAYDKLRLER  342
            PRRARK KAGDSTPEELA ATQV G Y+PI R EK SVE VKVT++MK FKAY KLR+ER
Sbjct  61   PRRARKVKAGDSTPEELANATQVQGDYMPIARGEKRSVEVVKVTEEMKEFKAYGKLRVER  120

Query  341  TNERHIG  321
             N+R +G
Sbjct  121  MNQRQLG  127



>gb|EPZ33898.1| Ribosomal protein L13e domain-containing protein [Rozella allomycis 
CSF55]
Length=212

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/183 (58%), Positives = 138/183 (75%), Gaps = 1/183 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            ++KHNNV+P+ HFRKHWQ  VKTWF+QP +K+ RR AR KKA  I PRP  G LRP V G
Sbjct  1    MVKHNNVLPNQHFRKHWQTRVKTWFDQPGKKKSRRLARMKKAELIAPRPVDGLLRPAVRG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT++YNMK+RAGRGFSLEELKAAG+ KK A  +GISVDHRR+N S+E LQ N++RLK YK
Sbjct  61   QTVRYNMKLRAGRGFSLEELKAAGVRKKEARVLGISVDHRRKNRSVESLQLNIERLKAYK  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVK-VTDDMKSFKAYD  360
            +KL+VFPR+A+  K  +S+ EE+  ATQ+    +PI+ +  + E +K +T   K FKAY+
Sbjct  121  SKLIVFPRKAKNIKKSESSLEEVKQATQLKTELMPIVNDNTAFEGIKNITAAEKEFKAYE  180

Query  359  KLR  351
             LR
Sbjct  181  TLR  183



>emb|CEF98175.1| Ribosomal protein L13e [Ostreococcus tauri]
Length=221

 Score =   205 bits (522),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 117/199 (59%), Positives = 139/199 (70%), Gaps = 8/199 (4%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQN-------YVKTWFNQParkqrrraarqkkAVKIFPRPTAGAL  735
            MK NN +P+ HF+K WQ         V+TW NQ  RK+ RR AR+ KA K FPRP AGAL
Sbjct  1    MKGNNQLPNAHFKKDWQGNTINGQCRVRTWLNQAGRKKSRRNARELKAKKTFPRPVAGAL  60

Query  734  RPIVHGQTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQ  555
            RPIVH  T +YN K R GRGF+LEELKAAGI KKLAPTIGI VDHRRRN S E L  N +
Sbjct  61   RPIVHPPTQRYNFKTRLGRGFTLEELKAAGIPKKLAPTIGICVDHRRRNRSEESLALNKK  120

Query  554  RLKTYKAKLVVFPRRARKFKAGDSTPEELATATQVNG-PYLPILREKASVEFVKVTDDMK  378
            RL+ YKAKL++FPR+  K K GDS   +LA ATQ  G   +PI + + +VE V VTD+MK
Sbjct  121  RLEEYKAKLILFPRKNSKPKNGDSPAADLAAATQHKGQTIMPIEKVEKAVEMVTVTDEMK  180

Query  377  SFKAYDKLRLERTNERHIG  321
            +F AY KLR+ER N R +G
Sbjct  181  NFGAYKKLRVERMNVRQVG  199



>ref|XP_001418121.1| Ribosomal protein L13, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO96414.1| Ribosomal protein L13, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=221

 Score =   205 bits (521),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 115/199 (58%), Positives = 141/199 (71%), Gaps = 8/199 (4%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQN-------YVKTWFNQParkqrrraarqkkAVKIFPRPTAGAL  735
            MK NN +P+ HF+K WQ         V+TW NQ  RK+ RR AR+ KA K FPRP AG+L
Sbjct  1    MKGNNQLPNAHFKKDWQGNTINGQCRVRTWLNQAGRKKSRRNARELKAKKTFPRPVAGSL  60

Query  734  RPIVHGQTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQ  555
            RP+VH  T +YN K R GRGF+LEELKAAGI+KK+APTIGI VDHRRRN S E L  N +
Sbjct  61   RPLVHPPTQRYNFKTRLGRGFTLEELKAAGISKKMAPTIGICVDHRRRNRSEESLALNKK  120

Query  554  RLKTYKAKLVVFPRRARKFKAGDSTPEELATATQVNGP-YLPILREKASVEFVKVTDDMK  378
            RL+ YKAKL++FPR+  K K GDS   +LATATQ  G   +PI + + +VE V VTD+MK
Sbjct  121  RLEEYKAKLILFPRKNSKPKHGDSPAADLATATQHKGSVIMPIEKVEKAVEMVAVTDEMK  180

Query  377  SFKAYDKLRLERTNERHIG  321
            +F AY KLR+ER N R +G
Sbjct  181  NFGAYRKLRVERMNVRQVG  199



>ref|XP_003382527.1| PREDICTED: 60S ribosomal protein L13-like [Amphimedon queenslandica]
Length=215

 Score =   203 bits (517),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 134/188 (71%), Gaps = 0/188 (0%)
 Frame = -3

Query  884  NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLK  705
            N+V+P+ HF+KHWQ YVKTWF+QPARK++RR  R KKA K+ PRP  G LRPIVH  T K
Sbjct  6    NHVIPNAHFKKHWQRYVKTWFDQPARKKKRRMNRLKKAAKLAPRPAKGPLRPIVHCPTRK  65

Query  704  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  525
            YNMKVRAG+GFS EEL+AAGI  ++APTIGISVDHRR N S E LQ NVQRLK YK +L+
Sbjct  66   YNMKVRAGKGFSFEELRAAGIPPRVAPTIGISVDHRRHNKSYESLQTNVQRLKEYKTRLI  125

Query  524  VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE  345
            +FPR+ +K +  DS  E    A Q+ GP LPI + +   EF  +TD+ +    ++ LR  
Sbjct  126  LFPRKGKKPRKEDSDLEACKLAKQLKGPVLPIRQPRKVFEFRAITDEERKESVFEALRKA  185

Query  344  RTNERHIG  321
            + + R +G
Sbjct  186  KADSRLVG  193



>emb|CCI40738.1| unnamed protein product [Albugo candida]
Length=216

 Score =   202 bits (515),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 135/192 (70%), Gaps = 1/192 (1%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF K WQN +KTWF+Q A+K+ RR  R+ K     PRP AG LRP VH  
Sbjct  12   MKHNNVIPNGHFHKDWQNRIKTWFDQAAKKKSRRLRRKAKVAAYAPRPAAGLLRPAVHCP  71

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            T+KY  KVRAG+GF+LEELKAAGI++K A TIGI+VD+RR N S+E LQANV RLKTYKA
Sbjct  72   TIKYASKVRAGKGFTLEELKAAGISRKQALTIGIAVDYRRTNKSVESLQANVNRLKTYKA  131

Query  533  KLVVFPRRA-RKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            KL++FPR+   K K GDS+ EE   A Q  GP LPI R     E   +T++M+S  AY  
Sbjct  132  KLIIFPRKGLNKPKHGDSSMEETRKAVQHMGPILPITRAAPKSETAVITEEMRSASAYST  191

Query  356  LRLERTNERHIG  321
            +R+ R + R  G
Sbjct  192  VRVARADARMAG  203



>ref|XP_005705644.1| 60S ribosomal protein L13e [Galdieria sulphuraria]
 gb|EME29124.1| 60S ribosomal protein L13e [Galdieria sulphuraria]
Length=209

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 139/193 (72%), Gaps = 1/193 (1%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            +++HNNVVP+GHF K WQ  VKTWFNQP RK+RRR ARQKKA ++ PRP  G LRPIVH 
Sbjct  1    MVRHNNVVPNGHFHKDWQRRVKTWFNQPMRKKRRRLARQKKAARLAPRPAKGPLRPIVHC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
             T+KYNM VR GRGF+LEELK A I  + A TIGISVD RR+N S+E LQ NVQRLK Y 
Sbjct  61   PTVKYNMNVRLGRGFTLEELKEAKINPQFARTIGISVDRRRKNRSVESLQTNVQRLKEYL  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKA-SVEFVKVTDDMKSFKAYD  360
            ++L++FPRR  K K+GDS P ELA A QV G  LPI    + SVE   VT++ +S  AY 
Sbjct  121  SRLILFPRRHGKPKSGDSDPSELAMAKQVFGDVLPIQSTTSTSVETRTVTEEERSKSAYQ  180

Query  359  KLRLERTNERHIG  321
             LR+ R   ++IG
Sbjct  181  TLRVARKQAKNIG  193



>gb|AAX48845.1| L13 [Suberites domuncula]
Length=211

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 134/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  890  KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQT  711
            K N VVP+ HF+KHW+ YVKTWFNQP +K+RRR  R +KA  + PRP  G LRP+V  QT
Sbjct  4    KRNGVVPNAHFKKHWERYVKTWFNQPGQKKRRRTKRLQKAAAVAPRPANGPLRPVVRCQT  63

Query  710  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  531
             KYN KVR+GRGF+ EELKAAG++KK A  IGI+VDHRRRN SLE LQ N QRLK YK+K
Sbjct  64   FKYNTKVRSGRGFTFEELKAAGVSKKQALKIGIAVDHRRRNRSLESLQTNTQRLKEYKSK  123

Query  530  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLR  351
            L++FPR+  K + GDS  +    ATQ++G  LPI R+    +   VT D K +  ++ +R
Sbjct  124  LILFPRKMSKPRPGDSDADACKMATQLSGTILPIRRQVMRQKARAVTADEKKYSVFETMR  183

Query  350  LERTNERHIG  321
            + R +++ IG
Sbjct  184  VARIDKKLIG  193



>ref|NP_937786.1| 60S ribosomal protein L13 [Danio rerio]
 ref|XP_005166723.1| PREDICTED: 60S ribosomal protein L13 isoform X1 [Danio rerio]
 sp|Q90Z10.3|RL13_DANRE RecName: Full=60S ribosomal protein L13 [Danio rerio]
 gb|AAK63073.1|AF385081_1 60S ribosomal protein L13 [Danio rerio]
 gb|AAS66969.1| ribosomal protein L13 [Danio rerio]
 gb|AAH75977.1| Ribosomal protein L13 [Danio rerio]
Length=211

 Score =   201 bits (511),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 140/192 (73%), Gaps = 8/192 (4%)
 Frame = -3

Query  884  NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLK  705
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ KA +I PRP +G LRP+V   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPVSGPLRPVVRCPTIR  65

Query  704  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  525
            Y+ KVRAGRGF+LEELKAAGI KK+A TIGISVD RRRN S E LQANVQRLK Y+ KL+
Sbjct  66   YHTKVRAGRGFTLEELKAAGINKKVARTIGISVDSRRRNRSTESLQANVQRLKEYRTKLI  125

Query  524  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK  357
            +FPR+A K K GDST EEL  ATQ+ GP +PI     +EKA V    +++D K+FKA+  
Sbjct  126  IFPRKAAKPKKGDSTEEELKMATQLTGPVMPIKKVHKKEKARV----ISEDEKNFKAFAS  181

Query  356  LRLERTNERHIG  321
            LR+ R N R  G
Sbjct  182  LRMARANARLFG  193



>ref|XP_002604928.1| hypothetical protein BRAFLDRAFT_279721 [Branchiostoma floridae]
 gb|EEN60938.1| hypothetical protein BRAFLDRAFT_279721 [Branchiostoma floridae]
Length=212

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 110/194 (57%), Positives = 139/194 (72%), Gaps = 8/194 (4%)
 Frame = -3

Query  890  KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQT  711
            KHNNV+P+GHF K WQN V+TWFNQPARK RRR +R +KA ++ PRP  GALRPIV   T
Sbjct  4    KHNNVIPNGHFHKDWQNRVRTWFNQPARKIRRRKSRVEKARRVAPRPAGGALRPIVRCST  63

Query  710  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  531
             KY+ KVRAGRGF+LEE+KAAG+ KK A TIGISVD RRRN S E LQANVQRLK YK+K
Sbjct  64   FKYHTKVRAGRGFTLEEIKAAGLNKKYARTIGISVDPRRRNKSTESLQANVQRLKEYKSK  123

Query  530  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAY  363
            L++FP++    + GDS  EEL  ATQ+ G  +P+     +EKA       T++ K ++A+
Sbjct  124  LILFPKKLSAPRKGDSGAEELKMATQLQGAVMPVRTLHKKEKARAP----TEEEKKYQAF  179

Query  362  DKLRLERTNERHIG  321
              +R+ R N R +G
Sbjct  180  QSMRMARANCRLLG  193



>ref|XP_002952518.1| ribosomal protein L13 component of cytosolic 80S ribosome and 
60S large subunit [Volvox carteri f. nagariensis]
 gb|EFJ46365.1| ribosomal protein L13 component of cytosolic 80S ribosome and 
60S large subunit [Volvox carteri f. nagariensis]
Length=218

 Score =   201 bits (510),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 114/203 (56%), Positives = 145/203 (71%), Gaps = 11/203 (5%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            +++HNNVVP+ HF+K WQ YV+TWFNQ ARK+RRR AR  KA K+FPRP+AG LRP+V G
Sbjct  1    MVRHNNVVPNNHFKKKWQFYVRTWFNQAARKERRRNARAAKAAKVFPRPSAGLLRPVVRG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYN K R G+GF+L+ELK AGI  ++A ++GI+VDHRRRN SLE LQ NVQRLK Y+
Sbjct  61   QTLKYNSKQRLGKGFTLDELKEAGIAVRMASSLGIAVDHRRRNKSLESLQENVQRLKAYR  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGP-YLPILREKASVEFVKVTDDMKS-----  375
            + LVVFPR  +K KA ++   E     Q  G   +PI+R + ++E VKVT +MK+     
Sbjct  121  SNLVVFPRNVKKPKAFETPLAEAKVVPQATGAVVMPIVRTQPALETVKVTSEMKANAGKE  180

Query  374  -----FKAYDKLRLERTNERHIG  321
                   AY KLRLERTN R +G
Sbjct  181  LSEIKATAYAKLRLERTNVRLVG  203



>ref|XP_001356321.1| GA18330 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_002014440.1| GL18951 [Drosophila persimilis]
 gb|EAL33384.1| GA18330 [Drosophila pseudoobscura pseudoobscura]
 gb|EDW28436.1| GL18951 [Drosophila persimilis]
Length=217

 Score =   201 bits (510),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 137/190 (72%), Gaps = 0/190 (0%)
 Frame = -3

Query  890  KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQT  711
            K NN++P+ H+ K WQ +VKTWFNQPARK RR   R KKA  +FPRP +GALRP+V   T
Sbjct  3    KGNNMIPNQHYHKWWQRHVKTWFNQPARKHRRHENRVKKAKAVFPRPASGALRPVVRCPT  62

Query  710  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  531
            ++Y+ K+R GRGF+LEELK AG++ K A TIGI+VD RR+N SLE  Q N+QRLK Y++K
Sbjct  63   IRYHTKLRTGRGFTLEELKGAGVSAKFAKTIGIAVDFRRKNKSLESRQRNIQRLKEYRSK  122

Query  530  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLR  351
            L++FP   +K + G+S+ EE   ATQ+ GP +PI  EK  VEF +VT D K FKA+  LR
Sbjct  123  LILFPINEKKIRKGESSVEECKLATQLRGPIMPIKAEKPVVEFREVTKDEKKFKAFATLR  182

Query  350  LERTNERHIG  321
              RT+ R +G
Sbjct  183  KARTDARLVG  192



>ref|XP_001969383.1| GG10074 [Drosophila erecta]
 ref|XP_002036415.1| GM17848 [Drosophila sechellia]
 ref|XP_002089010.1| RpL13 [Drosophila yakuba]
 ref|XP_002078850.1| GD23645 [Drosophila simulans]
 gb|AAR09840.1| similar to Drosophila melanogaster RpL13, partial [Drosophila 
yakuba]
 gb|EDV58442.1| GG10074 [Drosophila erecta]
 gb|EDW52338.1| GM17848 [Drosophila sechellia]
 gb|EDW88722.1| RpL13 [Drosophila yakuba]
 gb|EDX04435.1| GD23645 [Drosophila simulans]
Length=218

 Score =   201 bits (510),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 139/191 (73%), Gaps = 1/191 (1%)
 Frame = -3

Query  890  KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQT  711
            K NN++P+ H+ K WQ +VKTWFNQPARK RR A R KKA  +FPRP +GALRP+V   T
Sbjct  3    KGNNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPT  62

Query  710  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  531
            ++Y+ K+RAGRGF+LEELK AGI    A TIGI+VD RR+N SLE  Q N+QRLK Y++K
Sbjct  63   IRYHTKLRAGRGFTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSK  122

Query  530  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREK-ASVEFVKVTDDMKSFKAYDKL  354
            L++FP   +K +AG+S+ EE   ATQ+ GP LPI  E+ A VEF +VT D K FKA+  L
Sbjct  123  LILFPINEKKIRAGESSLEECKLATQLKGPVLPITNEQPAVVEFREVTKDEKKFKAFATL  182

Query  353  RLERTNERHIG  321
            R  RT+ R +G
Sbjct  183  RKARTDARLVG  193



>sp|O48513.1|RL13_CHLSW RecName: Full=60S ribosomal protein L13; AltName: Full=BBC1 protein 
homolog [Chlamydomonas sp. W80]
 dbj|BAA23724.1| BBC1 protein [Chlamydomonas sp. W80]
Length=208

 Score =   200 bits (508),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 143/192 (74%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            +++ N+++P+GHF K WQ +VKTWFNQPARKQRRR AR +KA   FPRP AG+L+PIV  
Sbjct  1    MVRGNDMLPNGHFHKKWQFHVKTWFNQPARKQRRRNARAEKAKATFPRPVAGSLKPIVRC  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QT+KYN K R GRGF+LEELK AGI  K APT+GI+VDHRR+N SLE LQANVQRLKTY+
Sbjct  61   QTVKYNTKQRLGRGFTLEELKEAGIPAKFAPTVGIAVDHRRKNRSLETLQANVQRLKTYR  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            A LV+FPR  +K KA +++  + + A+Q  G  LP+   K ++E VK+T DMK    Y K
Sbjct  121  ASLVIFPRNMKKPKAFEASAADCSAASQAKGELLPLKGTKPALELVKITADMKEGSQYGK  180

Query  356  LRLERTNERHIG  321
            LR+ER N R  G
Sbjct  181  LRIERVNARLKG  192



>ref|XP_002739297.1| PREDICTED: 60S ribosomal protein L13-like [Saccoglossus kowalevskii]
Length=212

 Score =   200 bits (508),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 107/188 (57%), Positives = 132/188 (70%), Gaps = 0/188 (0%)
 Frame = -3

Query  884  NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLK  705
            N+V+P+GHF K W+ +VKTWFNQP RK RRR  R KKA KI PRP  G +RP+V   T K
Sbjct  6    NSVIPNGHFHKDWERWVKTWFNQPMRKVRRRKNRIKKARKIAPRPVGGPVRPMVRCPTAK  65

Query  704  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  525
            YN K R+GRGFSLEELKAAGI KK APTIGI+VDHRRRN S E LQANVQRLK Y+ KL+
Sbjct  66   YNTKTRSGRGFSLEELKAAGIYKKFAPTIGIAVDHRRRNKSAESLQANVQRLKEYRTKLI  125

Query  524  VFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLE  345
            +FP++A K   GDST EEL  A Q++GP +PI R     +   +TD+ K    +  + + 
Sbjct  126  LFPKKASKPSKGDSTEEELKMAKQLSGPVMPITRVYKKDKARAITDEEKKHSVFQAMCVA  185

Query  344  RTNERHIG  321
            R++ R  G
Sbjct  186  RSHARLFG  193



>ref|NP_523530.1| ribosomal protein L13, isoform A [Drosophila melanogaster]
 ref|NP_001033891.1| ribosomal protein L13, isoform B [Drosophila melanogaster]
 ref|NP_001260312.1| ribosomal protein L13, isoform C [Drosophila melanogaster]
 sp|P41126.1|RL13_DROME RecName: Full=60S ribosomal protein L13; AltName: Full=BBC1 protein 
homolog [Drosophila melanogaster]
 pdb|3J39|L Chain L, Structure Of The D. Melanogaster 60s Ribosomal Proteins
 emb|CAA54898.1| BBC1 protein [Drosophila melanogaster]
 gb|AAF52842.1| ribosomal protein L13, isoform A [Drosophila melanogaster]
 gb|ABC65888.1| ribosomal protein L13, isoform B [Drosophila melanogaster]
 gb|ACK77643.1| LD24350p [Drosophila melanogaster]
 gb|AEM72508.1| MIP11288p1 [Drosophila melanogaster]
 gb|AGB92847.1| ribosomal protein L13, isoform C [Drosophila melanogaster]
Length=218

 Score =   200 bits (508),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 109/191 (57%), Positives = 139/191 (73%), Gaps = 1/191 (1%)
 Frame = -3

Query  890  KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQT  711
            K NN++P+ H+ K WQ +VKTWFNQPARK RR A R KKA  +FPRP +GALRP+V   T
Sbjct  3    KGNNMIPNQHYHKWWQRHVKTWFNQPARKVRRHANRVKKAKAVFPRPASGALRPVVRCPT  62

Query  710  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  531
            ++Y+ K+RAGRGF+LEELK AGI    A TIGI+VD RR+N SLE  Q N+QRLK Y++K
Sbjct  63   IRYHTKLRAGRGFTLEELKGAGIGANFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSK  122

Query  530  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREK-ASVEFVKVTDDMKSFKAYDKL  354
            L++FP   +K +AG+S+ EE   ATQ+ GP LPI  E+ A VEF +VT D K FKA+  L
Sbjct  123  LILFPINEKKIRAGESSLEECKLATQLKGPVLPIKNEQPAVVEFREVTKDEKKFKAFATL  182

Query  353  RLERTNERHIG  321
            R  RT+ R +G
Sbjct  183  RKARTDARLVG  193



>emb|CDW52162.1| 60S ribosomal protein L13 [Trichuris trichiura]
Length=210

 Score =   199 bits (507),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 132/190 (69%), Gaps = 0/190 (0%)
 Frame = -3

Query  890  KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQT  711
            K N ++P+ HF KHWQ YVKTWFNQP R +RRR  R  KA +I PRP  G LRP+V   T
Sbjct  4    KRNGMIPNAHFHKHWQRYVKTWFNQPMRHRRRRIRRVIKARRIAPRPARGPLRPVVRCPT  63

Query  710  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  531
            ++YN K+R GRGFSL+ELKAAGI+KK+APTIGISVDHRRRN SLE +Q NVQRLK Y++K
Sbjct  64   IRYNQKLRLGRGFSLQELKAAGISKKMAPTIGISVDHRRRNKSLESMQQNVQRLKEYRSK  123

Query  530  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLR  351
            L++FPR+  K + GDST EE   A Q+ G  +PI R     +   +T   K F AY  +R
Sbjct  124  LILFPRKMDKPRKGDSTAEECKLAEQLKGVLMPIKRTIPREKARPITQKEKKFSAYAAVR  183

Query  350  LERTNERHIG  321
              R ++R  G
Sbjct  184  HARADQRLFG  193



>ref|XP_001692670.1| ribosomal protein L13, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP03689.1| ribosomal protein L13 [Chlamydomonas reinhardtii]
Length=218

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 115/203 (57%), Positives = 143/203 (70%), Gaps = 11/203 (5%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            +++HNNVVP+ HF+K WQ YVKTWFNQPARK+RRRAAR KKA   FPRP AG LRPIV G
Sbjct  1    MVRHNNVVPNNHFKKKWQFYVKTWFNQPARKERRRAARAKKAEAQFPRPAAGLLRPIVRG  60

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
            QTLKYN K R G+GF+L+ELK AGI  ++A ++GI++DHRRRN SLE LQ N QRLK Y+
Sbjct  61   QTLKYNTKQRIGKGFTLDELKEAGIPVRMAASLGIAIDHRRRNKSLESLQENAQRLKAYR  120

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGP-YLPILREKASVEFVKVTDDMKSFK---  369
            + LVVFPR  +K KA ++   E     QV G   LP+++   ++E VKVT +MK+     
Sbjct  121  SNLVVFPRNVKKPKAFETPLAEANAVAQVKGAVVLPLVKAAPALETVKVTSEMKATAGKE  180

Query  368  -------AYDKLRLERTNERHIG  321
                   AY KLRLER N R +G
Sbjct  181  LAEIKATAYAKLRLERMNVRQVG  203



>emb|CCA14227.1| 60S ribosomal protein L13 putative [Albugo laibachii Nc14]
Length=205

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 133/192 (69%), Gaps = 1/192 (1%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF K WQN +KTWF+Q A+K+ RR  R+ K     PRP AG LRP VH  
Sbjct  1    MKHNNVIPNGHFHKDWQNRIKTWFDQAAKKKSRRLRRKAKVAAYAPRPAAGLLRPAVHCP  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            T+KY  KVRAG+GF+LEELKAAGI++K A +IGI+VD RR N S+E LQANV RLKT+KA
Sbjct  61   TIKYASKVRAGKGFTLEELKAAGISRKQALSIGIAVDFRRTNKSVESLQANVNRLKTFKA  120

Query  533  KLVVFPRRA-RKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            KL++FPR+   K K GDS+ EE   A Q  G  LPI R     E   +T++M+S  AY  
Sbjct  121  KLIIFPRKGLNKPKQGDSSAEETKKAVQHVGAILPITRAAPKSESAVITEEMRSTSAYST  180

Query  356  LRLERTNERHIG  321
            LR+ R + R  G
Sbjct  181  LRVARADARMAG  192



>ref|XP_011440919.1| PREDICTED: 60S ribosomal protein L13-like [Crassostrea gigas]
 gb|EKC32302.1| 60S ribosomal protein L13 [Crassostrea gigas]
Length=212

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  890  KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQT  711
            K NNV+P+GHF K WQ YV+ WFNQPARKQRR   R KKA +I PRP AG+LRPIV   T
Sbjct  4    KRNNVIPNGHFHKDWQRYVRNWFNQPARKQRRHDNRVKKARRIAPRPVAGSLRPIVRCPT  63

Query  710  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  531
             KYN K+RAG+GF+L+ELKAAGI KKLA TIGI+VD+RR+N SLE  Q N QRLK YK+K
Sbjct  64   FKYNTKIRAGKGFTLDELKAAGINKKLALTIGIAVDYRRKNKSLESQQQNTQRLKEYKSK  123

Query  530  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLR  351
            L++FP++  K K GD+T EE+  ATQ+ G  +PI +     +  K+TD  + F A+  LR
Sbjct  124  LILFPKKQSKPKKGDATEEEIKMATQLTGLVMPIKKAYKPEKARKITDAERKFSAFTALR  183

Query  350  LERTNERHIG  321
              R  +R  G
Sbjct  184  QARAAKRLQG  193



>emb|CEG74076.1| Putative 60S ribosomal protein L13 [Rhizopus microsporus]
 emb|CEG70848.1| Putative 60S ribosomal protein L13 [Rhizopus microsporus]
 emb|CEI92149.1| Putative 60S ribosomal protein L13 [Rhizopus microsporus]
 emb|CEI90012.1| Putative 60S ribosomal protein L13 [Rhizopus microsporus]
Length=211

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 109/192 (57%), Positives = 135/192 (70%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            V+KHNN +P+ HFRK W   VKTWF+Q  RK+ RR AR +KA +I PRP  G LRP V  
Sbjct  2    VLKHNNQLPNQHFRKQWDRRVKTWFDQAGRKKSRRIARVQKAGRIAPRPIDGLLRPAVRC  61

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
             T++YNMK+RAGRGF+LEELK AGI +K A +IGI+VDHRRRN S E L+ NVQRLK YK
Sbjct  62   PTVRYNMKLRAGRGFTLEELKEAGIRRKEARSIGIAVDHRRRNRSNESLELNVQRLKAYK  121

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKL+VFPR+A K K GDS   E+A+A Q  GP  P+ +  A+ E  ++T D K   AY K
Sbjct  122  AKLIVFPRKAGKPKKGDSEAAEVASAVQFRGPLFPVEQVAAAPEAREITADEKKVNAYMK  181

Query  356  LRLERTNERHIG  321
            LR  R+  R +G
Sbjct  182  LRYARSAARTLG  193



>emb|CBN08623.1| small nucleolar RNA, C/D box 68 [Microcosmus squamiger]
Length=214

 Score =   197 bits (500),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 133/187 (71%), Gaps = 0/187 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
             +KHNN++ + HF K WQ  VKTWFNQPARKQRR   R +KA K+ PRP  G LRPIV  
Sbjct  2    AIKHNNIICNNHFHKKWQTRVKTWFNQPARKQRRYNRRAEKAKKVAPRPVKGPLRPIVRC  61

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
             T+KYNMK R GRGFSLEELKAAGI ++ A TIGI+VD RRRNSS E LQ NVQRLK Y+
Sbjct  62   PTVKYNMKRRFGRGFSLEELKAAGINRRFAQTIGIAVDRRRRNSSYESLQENVQRLKEYR  121

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            ++L++FP++  + K GDST EE+  A+Q  G  LP+ R+    +   VTD+ K + A+  
Sbjct  122  SRLILFPKKPSQPKKGDSTAEEIKMASQHTGAVLPLKRKVVREKARAVTDEEKKYSAFQD  181

Query  356  LRLERTN  336
            +R+ R+N
Sbjct  182  MRVSRSN  188



>gb|KDO51401.1| hypothetical protein CISIN_1g041207mg, partial [Citrus sinensis]
Length=126

 Score =   194 bits (493),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = -3

Query  653  AAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLVVFPRRARKFKAGDSTPE  474
            AAGI KKLAPTIG+SVDHRR+N SLEGLQ+NVQRLKTYKAKLVVFPRRARKFKAGDS PE
Sbjct  1    AAGIPKKLAPTIGVSVDHRRKNRSLEGLQSNVQRLKTYKAKLVVFPRRARKFKAGDSAPE  60

Query  473  ELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLRLERTNERHIG  321
            ELATATQV GPY+PI  E+ +VE VKVT DMKSFKAYDKLR+ER NERH G
Sbjct  61   ELATATQVQGPYMPIAPERPTVELVKVTQDMKSFKAYDKLRIERVNERHFG  111



>emb|CEG63488.1| Putative 60S ribosomal protein L13 [Rhizopus microsporus]
Length=211

 Score =   197 bits (500),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 108/192 (56%), Positives = 135/192 (70%), Gaps = 0/192 (0%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
            V+KHNN +P+ HFRK W   VKTWF+Q  RK+ RR AR +KA +I PRP  G LRP V  
Sbjct  2    VLKHNNQLPNQHFRKQWDRRVKTWFDQAGRKKSRRIARVQKAGRIAPRPIDGLLRPAVRC  61

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
             T++YNMK+RAGRGF+LEELK AGI +K A +IGI+VDHRRRN S E L+ NVQRLK YK
Sbjct  62   PTVRYNMKLRAGRGFTLEELKEAGIRRKEARSIGIAVDHRRRNRSNESLELNVQRLKAYK  121

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            AKL+VFPR+A K K GDS   E+A+A Q  GP  P+ +  A+ E  ++T + K   AY K
Sbjct  122  AKLIVFPRKAGKPKKGDSEAAEVASAVQFRGPLFPVEQVAAAPEAREITAEEKKVNAYMK  181

Query  356  LRLERTNERHIG  321
            LR  R+  R +G
Sbjct  182  LRYARSAARTLG  193



>ref|XP_008872563.1| hypothetical protein H310_08544 [Aphanomyces invadans]
 gb|ETV99135.1| hypothetical protein H310_08544 [Aphanomyces invadans]
Length=206

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 139/192 (72%), Gaps = 1/192 (1%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+GHF K WQN +KTWF+Q ++K+ RR  R+ KA  I PRP AG LRP VH  
Sbjct  1    MKHNNVIPNGHFHKDWQNRIKTWFDQASKKKSRRLTRKAKAAAIAPRPAAGLLRPAVHCP  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            T+KY  KVRAGRGF+L+ELK AGI++K A TIG+SVD+RR N S+E LQANVQRLKTYK+
Sbjct  61   TIKYGSKVRAGRGFTLDELKEAGISRKQALTIGVSVDYRRTNKSVESLQANVQRLKTYKS  120

Query  533  KLVVFPR-RARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDK  357
            KLV+FPR RA K KAGDS  EE   ATQ+ G  LPI R    V   K+T+++K+      
Sbjct  121  KLVLFPRKRASKPKAGDSKVEETKNATQLIGAVLPIARPSKEVPTAKITEELKNNSVVKT  180

Query  356  LRLERTNERHIG  321
            LRL R + R +G
Sbjct  181  LRLARADARLVG  192



>gb|ADD38054.1| 60S ribosomal protein L13 [Lepeophtheirus salmonis]
Length=211

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/190 (58%), Positives = 136/190 (72%), Gaps = 1/190 (1%)
 Frame = -3

Query  890  KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQT  711
            K N +VP+ HF K WQ YVKTWFNQPARK+RRR AR  KA KI PRP   +LRP+V   T
Sbjct  4    KRNQMVPNEHFHKDWQRYVKTWFNQPARKERRRKARMAKASKISPRPME-SLRPVVRCPT  62

Query  710  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  531
             +YN+K R GRGF+LEELKAAG+ KK A TIGISVDHRRRN S+E LQ NVQRLK Y++K
Sbjct  63   NRYNVKSRIGRGFTLEELKAAGLAKKYAQTIGISVDHRRRNKSVESLQYNVQRLKEYQSK  122

Query  530  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLR  351
            L++FP +A K + GDSTPEE+  ATQ  G   P+ +    V+ ++VTDD+K FKA+  +R
Sbjct  123  LILFPIKANKPRKGDSTPEEIKEATQFVGTVSPVAKSGKRVKAMEVTDDLKKFKAFHSIR  182

Query  350  LERTNERHIG  321
              R   R  G
Sbjct  183  QARAVARLWG  192



>ref|XP_008286406.1| PREDICTED: 60S ribosomal protein L13 [Stegastes partitus]
Length=211

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 139/192 (72%), Gaps = 8/192 (4%)
 Frame = -3

Query  884  NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLK  705
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ KA +I PRP AG LRP V   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPVAGPLRPQVRCPTVR  65

Query  704  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  525
            Y+ KVRAGRGF+LEELKAAGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct  66   YHTKVRAGRGFTLEELKAAGIHKKTARTIGISVDPRRRNRSTESLQANVQRLKEYRSKLI  125

Query  524  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK  357
            +FPR+A   K GDST EEL  ATQ++GP +PI     +EKA V    +++D K+FKA+  
Sbjct  126  LFPRKASAPKKGDSTEEELKMATQLSGPVMPIKTVHKKEKARV----ISEDEKNFKAFAS  181

Query  356  LRLERTNERHIG  321
            LR+ R N R  G
Sbjct  182  LRMARANARLFG  193



>gb|ABZ04227.1| ribosomal protein rpl13 [Lineus viridis]
Length=207

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  890  KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQT  711
            K NN+VP+GHF K WQ YV+TWFNQP RK+RR   RQKKA  I PRP  G LRP+V   T
Sbjct  4    KRNNMVPNGHFHKEWQKYVRTWFNQPMRKKRRHDNRQKKARAIMPRPVGGPLRPVVRCPT  63

Query  710  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  531
             +YN +VR GRGFSL+ELKAAGI+KK A TIGI+ D RRRN S+E LQ NVQRLK YK+K
Sbjct  64   FRYNTRVRTGRGFSLDELKAAGISKKYARTIGIAFDFRRRNMSVESLQQNVQRLKEYKSK  123

Query  530  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLR  351
            L++FP++  K K GD++ EEL  ATQ++G  +P+ +        KVTD+ K F A++ +R
Sbjct  124  LILFPKKLSKPKKGDASAEELKMATQLSGEVMPVNQVTKKERARKVTDEEKKFSAFNTIR  183

Query  350  LERTNERHIG  321
              R +++  G
Sbjct  184  QARAHKKWNG  193



>ref|XP_002195773.1| PREDICTED: 60S ribosomal protein L13 isoform 1 [Taeniopygia guttata]
 ref|XP_004176272.1| PREDICTED: 60S ribosomal protein L13 [Taeniopygia guttata]
Length=211

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 112/192 (58%), Positives = 133/192 (69%), Gaps = 8/192 (4%)
 Frame = -3

Query  884  NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLK  705
            N ++   HF K WQ  V TWFNQPARK RR  AR+ K  +I PRP AG +RPIV   T++
Sbjct  6    NGMILKPHFHKDWQRRVATWFNQPARKLRRGKARRNKTRRIAPRPVAGPIRPIVRCPTIR  65

Query  704  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  525
            Y+ KVRAGRGFSLEELK AGI KK A TIGISVD RRRN S E LQANVQRLK Y +KL+
Sbjct  66   YHKKVRAGRGFSLEELKLAGINKKFARTIGISVDPRRRNKSTESLQANVQRLKEYHSKLI  125

Query  524  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK  357
            +FPR+    K GDS+PEEL  ATQ+ GP +PI     REKA V    +++D K+FKA+  
Sbjct  126  LFPRKPAMPKKGDSSPEELKMATQLTGPVMPIKNVFKREKARV----ISEDEKNFKAFAS  181

Query  356  LRLERTNERHIG  321
            LR+ R N R  G
Sbjct  182  LRMARANARLFG  193



>ref|XP_005052310.1| PREDICTED: 60S ribosomal protein L13 isoform X1 [Ficedula albicollis]
 ref|XP_005531944.1| PREDICTED: 60S ribosomal protein L13 isoform X1 [Pseudopodoces 
humilis]
 ref|XP_009089034.1| PREDICTED: 60S ribosomal protein L13 isoform X1 [Serinus canaria]
Length=211

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 135/192 (70%), Gaps = 8/192 (4%)
 Frame = -3

Query  884  NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLK  705
            N ++   HF K WQ  V TWFNQPARK RRR ARQ KA +I PRP AG +RPIV   T++
Sbjct  6    NGMILKPHFHKDWQRRVATWFNQPARKLRRRKARQAKARRIAPRPVAGPIRPIVRCPTIR  65

Query  704  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  525
            Y+ KVRAGRGFSLEELK AGI KK A TIGISVD RRRN S E LQANVQRLK Y +KL+
Sbjct  66   YHKKVRAGRGFSLEELKLAGINKKFARTIGISVDPRRRNKSTESLQANVQRLKEYHSKLI  125

Query  524  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK  357
            +FPR+    K GDS+PEEL  ATQ+ GP +PI     REKA V    +++D K+FKA+  
Sbjct  126  LFPRKPAMPKKGDSSPEELKMATQLTGPVMPIKNVFKREKARV----ISEDEKNFKAFAS  181

Query  356  LRLERTNERHIG  321
            LR+ R N R  G
Sbjct  182  LRMARANARLFG  193



>ref|XP_002057754.1| GJ17923 [Drosophila virilis]
 gb|EDW57827.1| GJ17923 [Drosophila virilis]
Length=217

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 137/190 (72%), Gaps = 0/190 (0%)
 Frame = -3

Query  890  KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQT  711
            K NN++P+ H+ K WQ +V+TWFNQPARK RR   R KKA  +FPRP +G LRP+V   T
Sbjct  3    KGNNMIPNQHYHKWWQRHVRTWFNQPARKIRRHENRVKKAKAVFPRPASGPLRPVVRCPT  62

Query  710  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  531
            ++Y+ K+R GRGF++EELK AG+++  A TIGI+VD RR+N SLE  Q N+QRLK Y++K
Sbjct  63   IRYHTKLRTGRGFTIEELKGAGLSQAFAKTIGIAVDRRRKNKSLESRQRNIQRLKEYRSK  122

Query  530  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLR  351
            L++FP   +K + G+ST EE   ATQ+ GP +P+ +E+  VEF +VT D K FKA+  LR
Sbjct  123  LILFPINEKKIRKGESTVEECKLATQLQGPIMPLKKEQPVVEFREVTKDEKKFKAFATLR  182

Query  350  LERTNERHIG  321
              RT+ R +G
Sbjct  183  KARTDARLVG  192



>gb|AEB31272.1| 60S ribosomal protein, partial [Epinephelus bruneus]
Length=211

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 139/192 (72%), Gaps = 8/192 (4%)
 Frame = -3

Query  884  NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLK  705
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ KA +I PRP AG LRP V   T++
Sbjct  6    NGMLLNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPVAGPLRPQVRCPTIR  65

Query  704  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  525
            Y+ KVRAGRGF+LEELKAAGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct  66   YHTKVRAGRGFTLEELKAAGIHKKTARTIGISVDPRRRNRSTESLQANVQRLKEYRSKLI  125

Query  524  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK  357
            +FPR+A   K GDST EEL  ATQ++GP +PI     +EKA V    +++D K+FKA+  
Sbjct  126  LFPRKASAPKKGDSTEEELKMATQLSGPVMPIKTVHKKEKARV----ISEDEKNFKAFAS  181

Query  356  LRLERTNERHIG  321
            LR+ R N R  G
Sbjct  182  LRMARANARLFG  193



>ref|XP_002065688.1| GK15580 [Drosophila willistoni]
 gb|EDW76674.1| GK15580 [Drosophila willistoni]
Length=217

 Score =   196 bits (498),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 133/190 (70%), Gaps = 0/190 (0%)
 Frame = -3

Query  890  KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQT  711
            K NN++P+ H+ K WQ +VKTWFNQPARK RR   R  KA  +FPRP +G LRP+V   T
Sbjct  3    KGNNMIPNQHYHKWWQRHVKTWFNQPARKLRRHQTRVTKAKAVFPRPASGPLRPVVRCPT  62

Query  710  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  531
            ++Y+ K+RAGRGF++EELK AGI+   A TIGISVD RR+N SLE  Q N+QRLK Y++K
Sbjct  63   IRYHTKLRAGRGFTVEELKGAGISYGFAKTIGISVDRRRKNKSLESRQRNIQRLKEYRSK  122

Query  530  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLR  351
            L++FP   +K + G+S+ EE   ATQ  GP +PI  E   VEF +VT D K FKA+  LR
Sbjct  123  LILFPINEKKVRKGESSVEECKLATQFKGPVMPIKNETPVVEFREVTQDEKKFKAFATLR  182

Query  350  LERTNERHIG  321
              RT+ R +G
Sbjct  183  KARTDARLVG  192



>emb|CAF99615.1| unnamed protein product [Tetraodon nigroviridis]
Length=211

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 115/192 (60%), Positives = 138/192 (72%), Gaps = 8/192 (4%)
 Frame = -3

Query  884  NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLK  705
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ KA +I PRP AG LRP V   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPAAGPLRPQVRCPTVR  65

Query  704  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  525
            Y+ KVRAGRGF+LEELKAAGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct  66   YHTKVRAGRGFTLEELKAAGIHKKTARTIGISVDPRRRNRSTESLQANVQRLKEYRSKLI  125

Query  524  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK  357
            +FPR+A   K GDS+ EEL  ATQ+ GP +PI     REKA V    +++D K+FKA+  
Sbjct  126  LFPRKASAPKKGDSSEEELKMATQLTGPVMPIKTVHKREKARV----ISEDEKNFKAFAS  181

Query  356  LRLERTNERHIG  321
            LR+ R N R  G
Sbjct  182  LRMARANARLFG  193



>ref|XP_005714141.1| 60S ribosomal protein L13 [Chondrus crispus]
 emb|CDF34322.1| 60S ribosomal protein L13 [Chondrus crispus]
Length=212

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 134/191 (70%), Gaps = 0/191 (0%)
 Frame = -3

Query  893  MKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQ  714
            MKHNNV+P+ HFRK WQ  V+TWF QP RK+RRR+AR  K  K  PRP  G LRPIV   
Sbjct  1    MKHNNVIPNNHFRKEWQLRVRTWFEQPMRKRRRRSARVLKYAKSAPRPIDGLLRPIVRCP  60

Query  713  TLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKA  534
            T KYNM VR GRGFSLEELK AGI  + APTIGI+VD RR+N SL+ +Q NVQRLK +K 
Sbjct  61   TNKYNMHVRLGRGFSLEELKEAGIAVRYAPTIGIAVDPRRKNRSLDAMQDNVQRLKEFKT  120

Query  533  KLVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKL  354
            KL+VFP+   K K G++  EELA A Q+ G  +PI +  A +E   +T+D ++  AY  L
Sbjct  121  KLIVFPKNPAKPKEGEAKKEELAMAAQLEGKLMPIQKTTAEIEVRPITNDDRAKTAYRSL  180

Query  353  RLERTNERHIG  321
            R+E++N++  G
Sbjct  181  RIEKSNKKLEG  191



>gb|AFM90798.1| 60S ribosomal protein L13 [Callorhinchus milii]
Length=211

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 139/192 (72%), Gaps = 8/192 (4%)
 Frame = -3

Query  884  NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLK  705
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRREARQAKSRRIAPRPVAGPLRPIVRCPTIR  65

Query  704  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  525
            Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+
Sbjct  66   YHTKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLI  125

Query  524  VFPRRARKFKAGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDK  357
            +FP++A   K GD++PEE+  ATQ++GP +PI     +EKA V    +++D K F A+  
Sbjct  126  IFPKKASAPKKGDASPEEMKLATQLSGPVMPIKNVFEKEKARV----ISEDEKKFMAFVS  181

Query  356  LRLERTNERHIG  321
            LR+ R N R  G
Sbjct  182  LRMARANARLFG  193



>ref|XP_010716479.1| PREDICTED: 60S ribosomal protein L13 [Meleagris gallopavo]
Length=211

 Score =   195 bits (496),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 137/192 (71%), Gaps = 8/192 (4%)
 Frame = -3

Query  884  NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLK  705
            N ++   HF K WQ  V TWFNQPARK RRR ARQ KA +I PRP AG +RPIV   T++
Sbjct  6    NGMILKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPVAGPIRPIVRCPTIR  65

Query  704  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  525
            Y+ KVRAGRGFSLEELK AGI K+ A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct  66   YHKKVRAGRGFSLEELKLAGINKRFARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI  125

Query  524  VFPRRARKFKAGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDK  357
            +FPR+    K GDS+PEEL  ATQ++GP +PI     REKA V    ++++ K+FKA+  
Sbjct  126  LFPRKPSAPKKGDSSPEELKMATQLSGPVMPIRNVFKREKARV----ISEEEKNFKAFAS  181

Query  356  LRLERTNERHIG  321
            LR+ R N R  G
Sbjct  182  LRMARANARLFG  193



>ref|NP_990330.1| 60S ribosomal protein L13 [Gallus gallus]
 sp|P41125.2|RL13_CHICK RecName: Full=60S ribosomal protein L13; AltName: Full=Breast 
basic conserved protein 1 [Gallus gallus]
 dbj|BAA05377.1| unnamed protein product [Gallus gallus]
Length=211

 Score =   195 bits (496),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 137/192 (71%), Gaps = 8/192 (4%)
 Frame = -3

Query  884  NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLK  705
            N ++   HF K WQ  V TWFNQPARK RRR ARQ KA +I PRP AG +RPIV   T++
Sbjct  6    NGMILKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPVAGPIRPIVRCPTVR  65

Query  704  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  525
            Y+ KVRAGRGFSLEELK AGI K+ A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct  66   YHKKVRAGRGFSLEELKLAGINKRFARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI  125

Query  524  VFPRRARKFKAGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDK  357
            +FPR+    K GDS+PEEL  ATQ++GP +PI     REKA V    ++++ K+FKA+  
Sbjct  126  LFPRKPSAPKKGDSSPEELKMATQLSGPVMPIRNVFKREKARV----ISEEEKNFKAFAS  181

Query  356  LRLERTNERHIG  321
            LR+ R N R  G
Sbjct  182  LRMARANARLFG  193



>ref|XP_005188755.1| PREDICTED: 60S ribosomal protein L13 [Musca domestica]
Length=211

 Score =   195 bits (496),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 103/190 (54%), Positives = 136/190 (72%), Gaps = 0/190 (0%)
 Frame = -3

Query  890  KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQT  711
            K NN++P+ HF K WQ +VKTWFNQPARK RRR  R KKA  +FPRP AG LRP+V   T
Sbjct  3    KGNNMIPNAHFHKWWQRHVKTWFNQPARKIRRRQNRIKKAKAVFPRPAAGPLRPVVRCPT  62

Query  710  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  531
            ++Y+ K+RAGRGF+LEELK AGI    A T+GI+VD RR+N S+E  Q N+QRLK YK+K
Sbjct  63   IRYHTKLRAGRGFTLEELKGAGIPAGFAKTVGIAVDRRRKNKSIESRQRNIQRLKEYKSK  122

Query  530  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLR  351
            L++FP   +K + G+S+ EE   ATQ+ G  +PI +E+  VEF +V+ D K FKA+  LR
Sbjct  123  LILFPINEKKIRKGESSLEECKLATQLKGEVMPIKKEQPVVEFREVSKDEKKFKAFATLR  182

Query  350  LERTNERHIG  321
              R++ R +G
Sbjct  183  KARSDARLVG  192



>gb|AIU94834.1| 60S ribosomal protein [Phragmatopoma lapidosa]
 gb|AIU94836.1| 60S ribosomal protein [Phragmatopoma lapidosa]
Length=212

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 108/190 (57%), Positives = 135/190 (71%), Gaps = 0/190 (0%)
 Frame = -3

Query  890  KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQT  711
            K NNV+P+GHF K WQ YV+TWFNQPARKQRRR  R KKA  I PRP  G LRP+V   T
Sbjct  4    KRNNVLPNGHFHKDWQRYVRTWFNQPARKQRRRTTRIKKARSIAPRPVGGNLRPVVRCPT  63

Query  710  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  531
             KYN K R GRGF+LEELKAA I K++A TIGI+VDHRRRN S+E LQ NVQRLK YK+K
Sbjct  64   AKYNTKSRLGRGFTLEELKAAEINKRVAATIGITVDHRRRNKSVESLQLNVQRLKEYKSK  123

Query  530  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLR  351
            L++FP++A   K GD++ EE+  ATQ+ G  +P+ R   S +  K+TD+ +   A+  LR
Sbjct  124  LILFPKKAGAPKKGDASEEEIKMATQLQGTVMPVSRVVKSEKARKITDEERKGSAFVALR  183

Query  350  LERTNERHIG  321
              R ++R  G
Sbjct  184  QARAHKRLFG  193



>gb|AFM87368.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/196 (55%), Positives = 140/196 (71%), Gaps = 8/196 (4%)
 Frame = -3

Query  896  VMKHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHG  717
             +  N ++ + HF K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV  
Sbjct  2    ALSRNGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRC  61

Query  716  QTLKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYK  537
             T++Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y+
Sbjct  62   PTIRYHTKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYR  121

Query  536  AKLVVFPRRARKFKAGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFK  369
            +KL++FP++A   K GD++PEE+  ATQ++GP +PI     +EKA V    +++D K F 
Sbjct  122  SKLIIFPKKASAPKKGDASPEEMKLATQLSGPVMPIKNVFEKEKARV----ISEDEKKFM  177

Query  368  AYDKLRLERTNERHIG  321
            A+  LR+ R N R  G
Sbjct  178  AFVSLRMARANARLFG  193



>ref|XP_004543183.1| PREDICTED: 60S ribosomal protein L13-like isoform X1 [Maylandia 
zebra]
 ref|XP_004543184.1| PREDICTED: 60S ribosomal protein L13-like isoform X2 [Maylandia 
zebra]
 ref|XP_004543185.1| PREDICTED: 60S ribosomal protein L13-like isoform X3 [Maylandia 
zebra]
Length=211

 Score =   195 bits (495),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 138/192 (72%), Gaps = 8/192 (4%)
 Frame = -3

Query  884  NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLK  705
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ KA +I PRP AG LRP V   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPVAGPLRPQVRCPTIR  65

Query  704  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  525
            Y+ KVR+GRGF+LEELKAAGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct  66   YHTKVRSGRGFTLEELKAAGIHKKTARTIGISVDPRRRNRSTESLQANVQRLKEYRSKLI  125

Query  524  VFPRRARKFKAGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDK  357
            +FPR+A   K GDST EEL  ATQ+ GP +PI     +EKA V    +++D K+FKA+  
Sbjct  126  LFPRKASAPKKGDSTEEELKMATQLTGPVMPIRTVHKKEKARV----ISEDEKNFKAFAS  181

Query  356  LRLERTNERHIG  321
            LR+ R N R  G
Sbjct  182  LRMARANARLFG  193



>gb|AFM90648.1| 60S ribosomal protein L13 [Callorhinchus milii]
Length=211

 Score =   194 bits (494),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 139/192 (72%), Gaps = 8/192 (4%)
 Frame = -3

Query  884  NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLK  705
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++
Sbjct  6    NGMILNPHFHKDWQQRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIR  65

Query  704  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  525
            Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+
Sbjct  66   YHTKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLI  125

Query  524  VFPRRARKFKAGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDK  357
            +FP++A   K GD++PEE+  ATQ++GP +PI     +EKA V    +++D K F A+  
Sbjct  126  IFPKKASAPKKGDASPEEMKLATQLSGPVMPIKNVFEKEKARV----ISEDEKKFMAFVS  181

Query  356  LRLERTNERHIG  321
            LR+ R N R  G
Sbjct  182  LRMARANARLFG  193



>gb|AFM90524.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   194 bits (494),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 139/192 (72%), Gaps = 8/192 (4%)
 Frame = -3

Query  884  NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLK  705
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIR  65

Query  704  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  525
            Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+
Sbjct  66   YHTKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLI  125

Query  524  VFPRRARKFKAGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDK  357
            +FP++A   K GD++PEE+  ATQ++GP +PI     +EKA V    +++D K F A+  
Sbjct  126  IFPKKASAPKKGDASPEEMKLATQLSGPVMPIKNVFEKEKARV----ISEDEKKFMAFVS  181

Query  356  LRLERTNERHIG  321
            LR+ R N R  G
Sbjct  182  LRMARANARLFG  193



>ref|NP_001279295.1| ribosomal protein L13 [Callorhinchus milii]
 gb|AFK10534.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM85509.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM85568.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM85759.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM85945.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86154.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86270.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86328.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86550.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86703.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86779.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM86835.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87213.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87279.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87297.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87356.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87371.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87377.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87462.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM87482.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM88692.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89532.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89705.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89736.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89820.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89836.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89903.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM89920.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM90045.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM90135.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM90583.1| RPL13 protein isoform 1 [Callorhinchus milii]
 gb|AFM90686.1| 60S ribosomal protein L13 [Callorhinchus milii]
 gb|AFM90856.1| 60S ribosomal protein L13 [Callorhinchus milii]
Length=211

 Score =   194 bits (494),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 139/192 (72%), Gaps = 8/192 (4%)
 Frame = -3

Query  884  NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLK  705
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIR  65

Query  704  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  525
            Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+
Sbjct  66   YHTKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLI  125

Query  524  VFPRRARKFKAGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDK  357
            +FP++A   K GD++PEE+  ATQ++GP +PI     +EKA V    +++D K F A+  
Sbjct  126  IFPKKASAPKKGDASPEEMKLATQLSGPVMPIKNVFEKEKARV----ISEDEKKFMAFVS  181

Query  356  LRLERTNERHIG  321
            LR+ R N R  G
Sbjct  182  LRMARANARLFG  193



>gb|AFM88842.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   194 bits (494),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 139/192 (72%), Gaps = 8/192 (4%)
 Frame = -3

Query  884  NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLK  705
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIR  65

Query  704  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  525
            Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+
Sbjct  66   YHAKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLI  125

Query  524  VFPRRARKFKAGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDK  357
            +FP++A   K GD++PEE+  ATQ++GP +PI     +EKA V    +++D K F A+  
Sbjct  126  IFPKKASAPKKGDASPEEMKLATQLSGPVMPIKNVFEKEKARV----ISEDEKKFMAFVS  181

Query  356  LRLERTNERHIG  321
            LR+ R N R  G
Sbjct  182  LRMARANARLFG  193



>ref|XP_011191555.1| PREDICTED: 60S ribosomal protein L13 [Bactrocera cucurbitae]
 ref|XP_011191556.1| PREDICTED: 60S ribosomal protein L13 [Bactrocera cucurbitae]
Length=216

 Score =   194 bits (494),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 106/190 (56%), Positives = 136/190 (72%), Gaps = 1/190 (1%)
 Frame = -3

Query  890  KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQT  711
            K NN++P+ HF K WQ  VKTWFNQPARK RRR  R KKA  +FPRP A ALRP+V   T
Sbjct  3    KGNNMIPNAHFHKWWQRNVKTWFNQPARKIRRRQNRVKKAKAVFPRP-AQALRPVVRCPT  61

Query  710  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  531
            ++Y+ K+RAGRGF+LEELK AG+T   A TIGI+VD RR+N SLE  Q NVQRLK YK+K
Sbjct  62   IRYHTKLRAGRGFTLEELKGAGLTYGFARTIGIAVDKRRKNKSLESRQRNVQRLKEYKSK  121

Query  530  LVVFPRRARKFKAGDSTPEELATATQVNGPYLPILREKASVEFVKVTDDMKSFKAYDKLR  351
            L++FP   +K + G+ST EE   ATQ+ GP +PI +E+  +EF ++  D + FKA+  LR
Sbjct  122  LILFPINEKKIRKGESTVEECKLATQIKGPVMPIKKEQPVIEFREIAKDEQKFKAFATLR  181

Query  350  LERTNERHIG  321
              RT+ R +G
Sbjct  182  KARTDARLVG  191



>ref|XP_005741646.1| PREDICTED: 60S ribosomal protein L13-like [Pundamilia nyererei]
 ref|XP_005929607.1| PREDICTED: 60S ribosomal protein L13-like [Haplochromis burtoni]
Length=211

 Score =   194 bits (493),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 113/192 (59%), Positives = 138/192 (72%), Gaps = 8/192 (4%)
 Frame = -3

Query  884  NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLK  705
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ KA +I PRP AG LRP V   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKARRIAPRPVAGPLRPQVRCPTIR  65

Query  704  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  525
            Y+ K+R+GRGF+LEELKAAGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct  66   YHTKIRSGRGFTLEELKAAGIHKKTARTIGISVDPRRRNRSTESLQANVQRLKEYRSKLI  125

Query  524  VFPRRARKFKAGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDK  357
            +FPR+A   K GDST EEL  ATQ+ GP +PI     +EKA V    +++D K+FKA+  
Sbjct  126  LFPRKASAPKKGDSTEEELKMATQLTGPVMPIRTVHKKEKARV----ISEDEKNFKAFAS  181

Query  356  LRLERTNERHIG  321
            LR+ R N R  G
Sbjct  182  LRMARANARLFG  193



>gb|AFM88774.1| RPL13 protein isoform 1 [Callorhinchus milii]
Length=211

 Score =   194 bits (493),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 107/192 (56%), Positives = 139/192 (72%), Gaps = 8/192 (4%)
 Frame = -3

Query  884  NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLK  705
            N ++ + HF K WQ  V+TWFNQPARK RRR ARQ K+ +I PRP AG LRPIV   T++
Sbjct  6    NGMILNPHFHKDWQKRVRTWFNQPARKIRRRKARQAKSRRIAPRPVAGPLRPIVRCPTIR  65

Query  704  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  525
            Y+ KVRAGRGFSLEELKAAGI +K+A TIGI+VDHRRRN S + +Q N QRLK Y++KL+
Sbjct  66   YHTKVRAGRGFSLEELKAAGINRKVARTIGIAVDHRRRNRSTKSIQCNAQRLKEYRSKLI  125

Query  524  VFPRRARKFKAGDSTPEELATATQVNGPYLPIL----REKASVEFVKVTDDMKSFKAYDK  357
            +FP++A   K GD++PEE+  ATQ++GP +PI     +EKA V    +++D K F A+  
Sbjct  126  IFPKKASAPKKGDASPEEMKLATQLSGPVMPIKNVFEKEKARV----ISEDEKRFMAFVS  181

Query  356  LRLERTNERHIG  321
            LR+ R N R  G
Sbjct  182  LRMARANARLFG  193



>ref|XP_009271349.1| PREDICTED: 60S ribosomal protein L13 [Aptenodytes forsteri]
 ref|XP_009475678.1| PREDICTED: 60S ribosomal protein L13 isoform X1 [Nipponia nippon]
 ref|XP_010577863.1| PREDICTED: 60S ribosomal protein L13 [Haliaeetus leucocephalus]
 ref|XP_010577864.1| PREDICTED: 60S ribosomal protein L13 [Haliaeetus leucocephalus]
 ref|XP_011585714.1| PREDICTED: 60S ribosomal protein L13 [Aquila chrysaetos canadensis]
 gb|KFM03354.1| 60S ribosomal protein L13 [Aptenodytes forsteri]
 gb|KFQ93340.1| 60S ribosomal protein L13 [Nipponia nippon]
Length=211

 Score =   194 bits (493),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 114/192 (59%), Positives = 135/192 (70%), Gaps = 8/192 (4%)
 Frame = -3

Query  884  NNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQTLK  705
            N ++   HF K WQ  V TWFNQPARK RRR ARQ KA +I PRP AG +RPIV   T++
Sbjct  6    NGMILKPHFHKDWQRRVATWFNQPARKIRRRKARQAKARRIAPRPVAGPIRPIVRCPTIR  65

Query  704  YNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAKLV  525
            Y+ KVRAGRGFSLEELK AGI KK A TIGISVD RRRN S E LQANVQRLK Y++KL+
Sbjct  66   YHKKVRAGRGFSLEELKLAGINKKFARTIGISVDPRRRNKSTESLQANVQRLKEYRSKLI  125

Query  524  VFPRRARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKAYDK  357
            +FPR+    K GDS+ EEL  ATQ+ GP +PI     REKA V    +++D K+FKA+  
Sbjct  126  LFPRKPAMPKKGDSSAEELKMATQLTGPVMPIKNVFKREKARV----ISEDEKNFKAFAS  181

Query  356  LRLERTNERHIG  321
            LR+ R N R  G
Sbjct  182  LRMARANARLFG  193



>gb|ABM55445.1| ribosomal protein L13 [Xenopsylla cheopis]
Length=221

 Score =   194 bits (494),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 107/195 (55%), Positives = 140/195 (72%), Gaps = 9/195 (5%)
 Frame = -3

Query  890  KHNNVVPSGHFRKHWQNYVKTWFNQParkqrrraarqkkAVKIFPRPTAGALRPIVHGQT  711
            K NN++P+GHF K WQ +VKTWFNQPARK RRR  R KKA  IFPRP +GALRPIVH  T
Sbjct  3    KGNNMIPNGHFHKDWQRFVKTWFNQPARKIRRRQNRIKKARAIFPRPASGALRPIVHCPT  62

Query  710  LKYNMKVRAGRGFSLEELKAAGITKKLAPTIGISVDHRRRNSSLEGLQANVQRLKTYKAK  531
            ++Y+ KVRAGRGF+LEE+K AG++   A +IGI++D RRRN S+E LQ NVQRLK Y++K
Sbjct  63   VRYHTKVRAGRGFTLEEVKGAGLSAGFARSIGIALDRRRRNKSVESLQKNVQRLKEYRSK  122

Query  530  LVVFPR-RARKFKAGDSTPEELATATQVNGPYLPI----LREKASVEFVKVTDDMKSFKA  366
            L++FPR   +K + G++T +E   ATQ+ G  +PI    +R KA V    VT+D K F A
Sbjct  123  LILFPRHEKKKLRKGEATEDECKVATQLQGIVMPIKQTAVRTKARV----VTEDEKKFSA  178

Query  365  YDKLRLERTNERHIG  321
            +  LR  R ++R +G
Sbjct  179  FTALRKARADQRLVG  193



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2268595584692