BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2616

Length=720
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009622165.1|  PREDICTED: uncharacterized protein LOC104113643    112   7e-27   Nicotiana tomentosiformis
gb|AHA61363.1|  hypothetical protein Lr923_ref                          111   2e-26   Lumnitzera racemosa
ref|XP_009770423.1|  PREDICTED: uncharacterized protein LOC104221130    108   3e-25   Nicotiana sylvestris
ref|XP_007013697.1|  Uncharacterized protein TCM_038268                 105   2e-24   Theobroma cacao [chocolate]
ref|XP_006359532.1|  PREDICTED: uncharacterized protein LOC102591718    104   5e-24   
ref|XP_010105979.1|  hypothetical protein L484_007613                 95.1    1e-20   Morus notabilis
ref|XP_004242705.1|  PREDICTED: uncharacterized protein LOC101250420  93.6    7e-20   Solanum lycopersicum
gb|KJB64586.1|  hypothetical protein B456_010G056200                  87.0    1e-17   Gossypium raimondii
ref|XP_002523552.1|  conserved hypothetical protein                   86.7    2e-17   Ricinus communis
ref|XP_011018213.1|  PREDICTED: uncharacterized protein LOC105121319  85.5    4e-17   Populus euphratica
ref|XP_002308378.1|  hypothetical protein POPTR_0006s20450g           82.8    3e-16   Populus trichocarpa [western balsam poplar]
ref|XP_002325163.1|  hypothetical protein POPTR_0018s12210g           82.4    6e-16   
ref|NP_001267984.1|  stress induced protein                           82.8    6e-16   Vitis vinifera
gb|AFY26888.1|  stress induced protein                                80.9    2e-15   Morella rubra [Chinese arbutus]
gb|EYU30579.1|  hypothetical protein MIMGU_mgv1a018795mg              82.0    2e-15   Erythranthe guttata [common monkey flower]
ref|XP_011648475.1|  PREDICTED: uncharacterized protein LOC105434480  80.9    2e-15   Cucumis sativus [cucumbers]
gb|EYU34922.1|  hypothetical protein MIMGU_mgv1a015458mg              81.3    2e-15   Erythranthe guttata [common monkey flower]
gb|EYU30573.1|  hypothetical protein MIMGU_mgv1a022617mg              80.9    3e-15   Erythranthe guttata [common monkey flower]
ref|XP_011084175.1|  PREDICTED: uncharacterized protein LOC105166496  80.5    3e-15   Sesamum indicum [beniseed]
gb|KJB65882.1|  hypothetical protein B456_010G117000                  79.7    9e-15   Gossypium raimondii
ref|XP_006450344.1|  hypothetical protein CICLE_v10010338mg           79.0    9e-15   Citrus clementina [clementine]
ref|XP_004514062.1|  PREDICTED: uncharacterized protein LOC101491954  79.0    9e-15   Cicer arietinum [garbanzo]
ref|XP_007223658.1|  hypothetical protein PRUPE_ppa012789mg           77.8    3e-14   Prunus persica
ref|XP_010687820.1|  PREDICTED: uncharacterized protein LOC104901896  77.4    3e-14   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_012077505.1|  PREDICTED: uncharacterized protein LOC105638320  77.4    4e-14   Jatropha curcas
emb|CDY00331.1|  BnaA06g22320D                                        77.0    5e-14   
ref|XP_006394343.1|  hypothetical protein EUTSA_v10005490mg           76.3    1e-13   Eutrema salsugineum [saltwater cress]
ref|XP_006453702.1|  hypothetical protein CICLE_v10010491mg           75.5    1e-13   Citrus clementina [clementine]
ref|XP_006483428.1|  PREDICTED: uncharacterized protein LOC102614648  75.5    1e-13   Citrus sinensis [apfelsine]
ref|XP_009130237.1|  PREDICTED: uncharacterized protein LOC103855027  75.1    3e-13   Brassica rapa
ref|XP_011469857.1|  PREDICTED: uncharacterized protein LOC105353052  73.9    5e-13   Fragaria vesca subsp. vesca
gb|KEH38092.1|  stress induced protein                                73.9    5e-13   Medicago truncatula
emb|CDY30736.1|  BnaA02g33580D                                        74.3    5e-13   Brassica napus [oilseed rape]
ref|XP_010047188.1|  PREDICTED: uncharacterized protein LOC104436150  73.9    5e-13   
ref|XP_011078581.1|  PREDICTED: uncharacterized protein LOC105162275  73.2    1e-12   Sesamum indicum [beniseed]
ref|XP_012081227.1|  PREDICTED: uncharacterized protein LOC105641315  72.4    1e-12   Jatropha curcas
ref|XP_008336946.1|  PREDICTED: uncharacterized protein LOC103400042  72.8    2e-12   
ref|XP_010051170.1|  PREDICTED: uncharacterized protein LOC104439855  71.6    2e-12   Eucalyptus grandis [rose gum]
ref|XP_009151408.1|  PREDICTED: uncharacterized protein LOC103874722  72.0    3e-12   Brassica rapa
ref|XP_010236125.1|  PREDICTED: uncharacterized protein LOC100823892  71.6    6e-12   Brachypodium distachyon [annual false brome]
emb|CDY45749.1|  BnaC02g42330D                                        73.2    7e-12   Brassica napus [oilseed rape]
gb|KJB33800.1|  hypothetical protein B456_006G031400                  70.5    1e-11   Gossypium raimondii
ref|XP_006473947.1|  PREDICTED: uncharacterized protein LOC102618226  70.1    1e-11   Citrus sinensis [apfelsine]
ref|XP_011085867.1|  PREDICTED: uncharacterized protein LOC105167746  70.1    1e-11   Sesamum indicum [beniseed]
ref|XP_008219700.1|  PREDICTED: uncharacterized protein LOC103319885  69.7    2e-11   Prunus mume [ume]
ref|XP_002515466.1|  conserved hypothetical protein                   69.7    2e-11   Ricinus communis
ref|XP_002511430.1|  conserved hypothetical protein                   69.7    2e-11   Ricinus communis
emb|CDP10514.1|  unnamed protein product                              69.3    3e-11   Coffea canephora [robusta coffee]
gb|EPS71755.1|  hypothetical protein M569_03007                       68.9    3e-11   Genlisea aurea
ref|XP_011071822.1|  PREDICTED: uncharacterized protein LOC105157187  68.9    3e-11   Sesamum indicum [beniseed]
ref|XP_008394140.1|  PREDICTED: uncharacterized protein LOC103456238  68.6    3e-11   Malus domestica [apple tree]
gb|EYU44723.1|  hypothetical protein MIMGU_mgv11b012983mg             68.9    3e-11   Erythranthe guttata [common monkey flower]
ref|XP_008230633.1|  PREDICTED: uncharacterized protein LOC103329888  68.6    4e-11   Prunus mume [ume]
ref|XP_004508398.1|  PREDICTED: uncharacterized protein LOC101505821  68.2    5e-11   Cicer arietinum [garbanzo]
ref|XP_008443900.1|  PREDICTED: uncharacterized protein LOC103487383  68.2    5e-11   Cucumis melo [Oriental melon]
ref|XP_010524310.1|  PREDICTED: uncharacterized protein LOC104802406  68.2    7e-11   Tarenaya hassleriana [spider flower]
ref|XP_008793854.1|  PREDICTED: uncharacterized protein LOC103710047  68.2    8e-11   Phoenix dactylifera
ref|XP_012081948.1|  PREDICTED: uncharacterized protein LOC105641904  67.8    8e-11   Jatropha curcas
dbj|BAJ96348.1|  predicted protein                                    68.2    8e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010532364.1|  PREDICTED: uncharacterized protein LOC104808387  67.4    8e-11   Tarenaya hassleriana [spider flower]
gb|KHN18595.1|  hypothetical protein glysoja_007008                   67.0    1e-10   Glycine soja [wild soybean]
ref|XP_003542626.1|  PREDICTED: uncharacterized protein LOC100804202  67.0    1e-10   Glycine max [soybeans]
ref|XP_010322556.1|  PREDICTED: uncharacterized protein LOC104648037  67.4    1e-10   Solanum lycopersicum
ref|XP_006354987.1|  PREDICTED: uncharacterized protein LOC102579987  66.2    1e-10   
ref|NP_001236205.1|  uncharacterized protein LOC100500311             67.0    1e-10   Glycine max [soybeans]
gb|EYU23644.1|  hypothetical protein MIMGU_mgv1a024779mg              66.2    2e-10   Erythranthe guttata [common monkey flower]
ref|XP_009598118.1|  PREDICTED: uncharacterized protein LOC104093986  65.9    3e-10   Nicotiana tomentosiformis
ref|XP_010051169.1|  PREDICTED: uncharacterized protein LOC104439854  65.5    3e-10   Eucalyptus grandis [rose gum]
ref|XP_009760553.1|  PREDICTED: uncharacterized protein LOC104212884  66.2    3e-10   Nicotiana sylvestris
gb|ACU24578.1|  unknown                                               65.5    4e-10   Glycine max [soybeans]
ref|XP_008438207.1|  PREDICTED: uncharacterized protein LOC103483378  65.9    4e-10   Cucumis melo [Oriental melon]
ref|XP_009338419.1|  PREDICTED: uncharacterized protein LOC103930771  65.9    4e-10   Pyrus x bretschneideri [bai li]
ref|XP_003637618.1|  Potassium transporter                            69.3    4e-10   
gb|KEH24880.1|  NHL domain protein                                    65.5    5e-10   Medicago truncatula
gb|KDP31127.1|  hypothetical protein JCGZ_11503                       65.5    6e-10   Jatropha curcas
ref|XP_012080100.1|  PREDICTED: uncharacterized protein LOC105640410  65.5    6e-10   Jatropha curcas
ref|XP_002308687.1|  hypothetical protein POPTR_0006s27550g           65.5    6e-10   Populus trichocarpa [western balsam poplar]
ref|XP_002517365.1|  conserved hypothetical protein                   65.1    9e-10   Ricinus communis
ref|XP_007216842.1|  hypothetical protein PRUPE_ppa022058mg           64.3    1e-09   
ref|XP_009410283.1|  PREDICTED: uncharacterized protein LOC103992351  64.3    1e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU34707.1|  hypothetical protein MIMGU_mgv1a021008mg              64.7    1e-09   Erythranthe guttata [common monkey flower]
ref|XP_010483999.1|  PREDICTED: uncharacterized protein LOC104762419  64.3    1e-09   Camelina sativa [gold-of-pleasure]
ref|XP_002452564.1|  hypothetical protein SORBIDRAFT_04g028190        64.3    1e-09   Sorghum bicolor [broomcorn]
ref|XP_007155116.1|  hypothetical protein PHAVU_003G174800g           63.9    2e-09   Phaseolus vulgaris [French bean]
ref|XP_009761508.1|  PREDICTED: uncharacterized protein LOC104213675  63.9    2e-09   Nicotiana sylvestris
ref|XP_009599991.1|  PREDICTED: uncharacterized protein LOC104095547  63.9    2e-09   Nicotiana tomentosiformis
gb|KFK28014.1|  hypothetical protein AALP_AA8G460300                  64.3    2e-09   Arabis alpina [alpine rockcress]
ref|XP_011459812.1|  PREDICTED: uncharacterized protein LOC105350107  63.9    2e-09   Fragaria vesca subsp. vesca
gb|ABI34274.1|  IS10 transposase, putative                            67.0    2e-09   Solanum lycopersicum
ref|XP_010244781.1|  PREDICTED: uncharacterized protein LOC104588516  63.5    2e-09   Nelumbo nucifera [Indian lotus]
gb|KCW56070.1|  hypothetical protein EUGRSUZ_I01828                   63.9    2e-09   Eucalyptus grandis [rose gum]
ref|XP_010313841.1|  PREDICTED: uncharacterized protein LOC104644843  63.2    2e-09   Solanum lycopersicum
ref|XP_007036163.1|  Serine/arginine repetitive matrix protein 2,...  63.9    2e-09   
emb|CAC01808.1|  putative protein                                     67.0    3e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009355890.1|  PREDICTED: uncharacterized protein LOC103946821  63.5    3e-09   Pyrus x bretschneideri [bai li]
gb|KCW81345.1|  hypothetical protein EUGRSUZ_C02728                   62.8    3e-09   Eucalyptus grandis [rose gum]
ref|XP_003609515.1|  hypothetical protein MTR_4g116530                63.5    3e-09   Medicago truncatula
ref|NP_196993.2|  NHL domain-containing protein                       66.6    3e-09   
ref|XP_009111660.1|  PREDICTED: uncharacterized protein LOC103837083  62.8    3e-09   Brassica rapa
ref|XP_010111749.1|  hypothetical protein L484_008408                 63.5    3e-09   Morus notabilis
ref|XP_011660353.1|  PREDICTED: uncharacterized protein LOC105436380  63.5    3e-09   Cucumis sativus [cucumbers]
ref|XP_011028593.1|  PREDICTED: uncharacterized protein LOC105128567  63.9    3e-09   Populus euphratica
ref|XP_008806318.1|  PREDICTED: uncharacterized protein LOC103719038  63.5    3e-09   Phoenix dactylifera
ref|XP_006368303.1|  hypothetical protein POPTR_0001s01430g           63.2    3e-09   Populus trichocarpa [western balsam poplar]
ref|XP_009358511.1|  PREDICTED: uncharacterized protein LOC103949134  63.2    4e-09   Pyrus x bretschneideri [bai li]
emb|CDY19811.1|  BnaA09g04640D                                        62.4    4e-09   Brassica napus [oilseed rape]
emb|CDX87094.1|  BnaC09g04090D                                        62.4    4e-09   
ref|XP_003533880.1|  PREDICTED: uncharacterized protein LOC100527701  62.8    5e-09   
ref|XP_010928587.1|  PREDICTED: uncharacterized protein LOC105050319  63.2    5e-09   Elaeis guineensis
ref|XP_004232286.1|  PREDICTED: uncharacterized protein LOC101247878  62.8    5e-09   Solanum lycopersicum
gb|AFK47247.1|  unknown                                               62.4    5e-09   Medicago truncatula
ref|XP_009623300.1|  PREDICTED: uncharacterized protein LOC104114536  62.4    6e-09   Nicotiana tomentosiformis
ref|XP_009796586.1|  PREDICTED: uncharacterized protein LOC104243135  62.4    6e-09   Nicotiana sylvestris
ref|XP_004236121.1|  PREDICTED: uncharacterized protein LOC101250679  62.0    7e-09   Solanum lycopersicum
ref|XP_003546602.1|  PREDICTED: uncharacterized protein LOC100815807  62.0    8e-09   Glycine max [soybeans]
ref|XP_002871635.1|  NHL repeat-containing protein                    65.1    1e-08   
ref|XP_008453108.1|  PREDICTED: uncharacterized protein LOC103493921  62.0    1e-08   Cucumis melo [Oriental melon]
ref|XP_010678734.1|  PREDICTED: uncharacterized protein LOC104894244  62.4    1e-08   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004508851.1|  PREDICTED: uncharacterized protein LOC101489558  61.6    1e-08   Cicer arietinum [garbanzo]
ref|XP_010913558.1|  PREDICTED: uncharacterized protein LOC105039190  62.0    1e-08   Elaeis guineensis
ref|XP_006394771.1|  hypothetical protein EUTSA_v10005131mg           60.8    2e-08   Eutrema salsugineum [saltwater cress]
ref|XP_010444141.1|  PREDICTED: uncharacterized protein LOC104726886  61.6    2e-08   Camelina sativa [gold-of-pleasure]
ref|XP_003608943.1|  hypothetical protein MTR_4g106650                60.8    2e-08   Medicago truncatula
ref|XP_007138446.1|  hypothetical protein PHAVU_009G209600g           60.8    2e-08   Phaseolus vulgaris [French bean]
emb|CDP02136.1|  unnamed protein product                              61.6    2e-08   Coffea canephora [robusta coffee]
ref|XP_010550111.1|  PREDICTED: uncharacterized protein LOC104821...  61.2    2e-08   Tarenaya hassleriana [spider flower]
ref|XP_006281223.1|  hypothetical protein CARUB_v10027263mg           61.2    2e-08   Capsella rubella
ref|NP_197906.1|  uncharacterized protein                             60.5    2e-08   Arabidopsis thaliana [mouse-ear cress]
gb|ABK95323.1|  unknown                                               60.8    3e-08   Populus trichocarpa [western balsam poplar]
ref|XP_006387805.1|  hypothetical protein POPTR_0559s00200g           60.8    3e-08   
ref|XP_011657987.1|  PREDICTED: uncharacterized protein LOC105435925  60.8    3e-08   Cucumis sativus [cucumbers]
ref|XP_002322157.2|  hypothetical protein POPTR_0015s08510g           60.8    3e-08   
ref|XP_010028125.1|  PREDICTED: uncharacterized protein LOC104418462  61.2    4e-08   
ref|XP_006345039.1|  PREDICTED: uncharacterized protein LOC102590628  59.7    5e-08   Solanum tuberosum [potatoes]
ref|XP_007031415.1|  NHL domain-containing protein, putative          62.8    5e-08   
ref|XP_003523070.1|  PREDICTED: uncharacterized protein LOC100787218  60.1    5e-08   Glycine max [soybeans]
ref|XP_006289622.1|  hypothetical protein CARUB_v10003175mg           62.8    6e-08   
ref|XP_011044331.1|  PREDICTED: uncharacterized protein LOC105139552  60.1    6e-08   Populus euphratica
ref|XP_002318641.1|  hypothetical protein POPTR_0012s07970g           60.1    6e-08   Populus trichocarpa [western balsam poplar]
ref|XP_007203743.1|  hypothetical protein PRUPE_ppa018294mg           60.5    7e-08   
ref|XP_004953881.1|  PREDICTED: uncharacterized protein LOC101754778  59.7    7e-08   Setaria italica
ref|XP_009375084.1|  PREDICTED: uncharacterized protein LOC103963933  59.3    8e-08   Pyrus x bretschneideri [bai li]
ref|XP_002303463.2|  hypothetical protein POPTR_0003s10050g           59.3    9e-08   Populus trichocarpa [western balsam poplar]
ref|XP_007155404.1|  hypothetical protein PHAVU_003G198600g           58.9    1e-07   Phaseolus vulgaris [French bean]
ref|XP_009401324.1|  PREDICTED: uncharacterized protein LOC103985376  58.9    1e-07   
ref|XP_011018698.1|  PREDICTED: uncharacterized protein LOC105121669  58.9    1e-07   Populus euphratica
ref|XP_004501949.1|  PREDICTED: uncharacterized protein LOC101503959  58.5    1e-07   Cicer arietinum [garbanzo]
ref|XP_006408502.1|  hypothetical protein EUTSA_v10021620mg           58.9    2e-07   Eutrema salsugineum [saltwater cress]
ref|XP_006848825.1|  PREDICTED: uncharacterized protein LOC18438579   58.2    2e-07   Amborella trichopoda
ref|XP_009392002.1|  PREDICTED: uncharacterized protein LOC103978024  58.2    2e-07   
ref|XP_006291910.1|  hypothetical protein CARUB_v10018094mg           58.9    2e-07   
ref|XP_006282333.1|  hypothetical protein CARUB_v10028628mg           58.5    2e-07   Capsella rubella
emb|CBI15061.3|  unnamed protein product                              58.2    2e-07   Vitis vinifera
ref|XP_011623819.1|  PREDICTED: uncharacterized protein LOC18435473   58.5    2e-07   
ref|XP_002283257.1|  PREDICTED: uncharacterized protein LOC100246674  58.2    2e-07   Vitis vinifera
ref|XP_002864822.1|  hypothetical protein ARALYDRAFT_496469           60.5    2e-07   
ref|XP_010540299.1|  PREDICTED: uncharacterized protein LOC104814117  58.2    2e-07   Tarenaya hassleriana [spider flower]
gb|EYU42542.1|  hypothetical protein MIMGU_mgv1a014912mg              58.5    2e-07   Erythranthe guttata [common monkey flower]
ref|NP_001048094.1|  Os02g0743200                                     58.2    2e-07   
gb|KGN52385.1|  hypothetical protein Csa_5G630870                     57.8    3e-07   Cucumis sativus [cucumbers]
ref|XP_007140920.1|  hypothetical protein PHAVU_008G152300g           57.4    3e-07   Phaseolus vulgaris [French bean]
ref|XP_006579562.1|  PREDICTED: uncharacterized protein LOC102661934  57.8    4e-07   Glycine max [soybeans]
ref|XP_003549633.2|  PREDICTED: uncharacterized protein LOC100790161  57.8    4e-07   
ref|NP_001145500.1|  hypothetical protein                             57.8    4e-07   Zea mays [maize]
ref|XP_010107451.1|  hypothetical protein L484_002119                 57.0    6e-07   Morus notabilis
ref|XP_004489306.1|  PREDICTED: uncharacterized protein LOC101508916  57.0    6e-07   Cicer arietinum [garbanzo]
ref|XP_006578128.1|  PREDICTED: uncharacterized protein LOC102664203  56.2    8e-07   Glycine max [soybeans]
gb|KFK27791.1|  hypothetical protein AALP_AA8G429900                  55.8    1e-06   Arabis alpina [alpine rockcress]
ref|XP_009129977.1|  PREDICTED: uncharacterized protein LOC103854768  55.8    1e-06   
ref|XP_006581341.1|  PREDICTED: uncharacterized protein LOC102660700  55.8    1e-06   Glycine max [soybeans]
ref|XP_008374462.1|  PREDICTED: uncharacterized protein LOC103437744  55.8    1e-06   Malus domestica [apple tree]
emb|CDX85579.1|  BnaA02g02340D                                        58.5    1e-06   
emb|CDY36908.1|  BnaA06g16930D                                        55.8    2e-06   Brassica napus [oilseed rape]
emb|CDX91017.1|  BnaC02g05800D                                        58.5    2e-06   
ref|XP_010459398.1|  PREDICTED: uncharacterized protein LOC104740480  56.2    2e-06   Camelina sativa [gold-of-pleasure]
gb|EAY87496.1|  hypothetical protein OsI_08904                        55.8    2e-06   Oryza sativa Indica Group [Indian rice]
ref|XP_010227816.1|  PREDICTED: uncharacterized protein LOC100833226  56.2    2e-06   
emb|CDY05370.1|  BnaC02g40780D                                        55.1    2e-06   
ref|NP_001190601.1|  uncharacterized protein                          55.8    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006400002.1|  hypothetical protein EUTSA_v10012875mg           58.2    2e-06   
ref|XP_010492306.1|  PREDICTED: uncharacterized protein LOC104769725  55.8    2e-06   Camelina sativa [gold-of-pleasure]
emb|CDY05481.1|  BnaA02g32100D                                        55.1    2e-06   
ref|XP_002882183.1|  hypothetical protein ARALYDRAFT_896109           55.8    2e-06   Arabidopsis lyrata subsp. lyrata
ref|XP_010454844.1|  PREDICTED: uncharacterized protein LOC104736542  55.1    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_009149850.1|  PREDICTED: uncharacterized protein LOC103873178  55.1    3e-06   Brassica rapa
ref|XP_010421371.1|  PREDICTED: uncharacterized protein LOC104706845  54.7    3e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010493772.1|  PREDICTED: uncharacterized protein LOC104771001  54.7    3e-06   Camelina sativa [gold-of-pleasure]
gb|KFK25725.1|  hypothetical protein AALP_AA8G151600                  55.1    4e-06   Arabis alpina [alpine rockcress]
ref|XP_009405042.1|  PREDICTED: uncharacterized protein LOC103988213  54.7    4e-06   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY44983.1|  BnaCnng12130D                                        54.7    4e-06   Brassica napus [oilseed rape]
gb|EAZ24587.1|  hypothetical protein OsJ_08349                        54.7    4e-06   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009126329.1|  PREDICTED: uncharacterized protein LOC103851236  57.0    4e-06   
ref|XP_010503425.1|  PREDICTED: uncharacterized protein LOC104780615  54.3    5e-06   Camelina sativa [gold-of-pleasure]
ref|XP_011464004.1|  PREDICTED: uncharacterized protein LOC105351453  54.3    5e-06   Fragaria vesca subsp. vesca
ref|XP_010929101.1|  PREDICTED: uncharacterized protein LOC105050685  54.3    7e-06   Elaeis guineensis
ref|XP_010515113.1|  PREDICTED: uncharacterized protein LOC104791013  53.9    7e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006581931.1|  PREDICTED: uncharacterized protein LOC102662805  54.3    8e-06   Glycine max [soybeans]
emb|CDY28677.1|  BnaCnng05630D                                        54.3    9e-06   Brassica napus [oilseed rape]
ref|XP_010678733.1|  PREDICTED: uncharacterized protein LOC104894243  54.3    9e-06   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009125023.1|  PREDICTED: uncharacterized protein LOC103850070  54.3    9e-06   Brassica rapa
gb|KJB40778.1|  hypothetical protein B456_007G076900                  54.3    9e-06   Gossypium raimondii
ref|XP_009407999.1|  PREDICTED: uncharacterized protein LOC103990540  53.9    1e-05   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008781937.1|  PREDICTED: uncharacterized protein LOC103701593  53.9    1e-05   Phoenix dactylifera
gb|EPS69831.1|  hypothetical protein M569_04939                       52.0    1e-05   Genlisea aurea
ref|XP_010037576.1|  PREDICTED: uncharacterized protein LOC104426279  53.9    1e-05   Eucalyptus grandis [rose gum]
ref|XP_006476749.1|  PREDICTED: uncharacterized protein LOC102611479  53.5    1e-05   Citrus sinensis [apfelsine]
ref|XP_006439778.1|  hypothetical protein CICLE_v10022556mg           53.5    1e-05   Citrus clementina [clementine]
ref|XP_010942183.1|  PREDICTED: uncharacterized protein LOC105060257  53.1    1e-05   Elaeis guineensis
gb|KFK37608.1|  hypothetical protein AALP_AA3G005300                  53.1    2e-05   Arabis alpina [alpine rockcress]
ref|XP_010426272.1|  PREDICTED: uncharacterized protein LOC104711277  52.8    2e-05   Camelina sativa [gold-of-pleasure]
ref|XP_011015544.1|  PREDICTED: uncharacterized protein LOC105119136  52.0    3e-05   Populus euphratica
ref|XP_008393048.1|  PREDICTED: uncharacterized protein LOC103455237  52.0    3e-05   Malus domestica [apple tree]
ref|XP_010456536.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  54.3    4e-05   
ref|NP_186792.1|  uncharacterized protein                             52.4    5e-05   Arabidopsis thaliana [mouse-ear cress]
emb|CDP19326.1|  unnamed protein product                              52.0    5e-05   Coffea canephora [robusta coffee]
gb|KDO66248.1|  hypothetical protein CISIN_1g044380mg                 53.1    5e-05   Citrus sinensis [apfelsine]
ref|XP_006446457.1|  hypothetical protein CICLE_v10016328mg           53.1    6e-05   Citrus clementina [clementine]
ref|XP_010442314.1|  PREDICTED: uncharacterized protein LOC104725353  51.6    8e-05   Camelina sativa [gold-of-pleasure]
ref|NP_190385.1|  uncharacterized protein                             50.8    8e-05   Arabidopsis thaliana [mouse-ear cress]
gb|EPS65826.1|  hypothetical protein M569_08952                       51.2    8e-05   Genlisea aurea
ref|XP_010660943.1|  PREDICTED: uncharacterized protein LOC104881674  50.8    9e-05   Vitis vinifera
ref|XP_006286820.1|  hypothetical protein CARUB_v10003765mg           50.4    1e-04   Capsella rubella
gb|AFW76806.1|  hypothetical protein ZEAMMB73_771266                  50.8    1e-04   
ref|XP_002875874.1|  hypothetical protein ARALYDRAFT_485163           50.1    1e-04   
ref|XP_010482123.1|  PREDICTED: uncharacterized protein LOC104760847  50.8    2e-04   Camelina sativa [gold-of-pleasure]
emb|CAN80444.1|  hypothetical protein VITISV_043283                   51.2    2e-04   Vitis vinifera
ref|XP_008649265.1|  PREDICTED: uncharacterized protein LOC103629942  50.8    2e-04   Zea mays [maize]
gb|KJB40779.1|  hypothetical protein B456_007G076900                  50.4    3e-04   Gossypium raimondii
ref|XP_002874246.1|  hypothetical protein ARALYDRAFT_489375           48.9    4e-04   
ref|XP_007209671.1|  hypothetical protein PRUPE_ppa012215mg           49.3    5e-04   
emb|CBI34951.3|  unnamed protein product                              50.8    5e-04   Vitis vinifera
ref|XP_008239737.1|  PREDICTED: uncharacterized protein LOC103338321  49.3    7e-04   Prunus mume [ume]



>ref|XP_009622165.1| PREDICTED: uncharacterized protein LOC104113643 [Nicotiana tomentosiformis]
Length=153

 Score =   112 bits (280),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 72/113 (64%), Gaps = 8/113 (7%)
 Frame = +2

Query  191  CGCFRLLSFRSGEGNTRALIG-GESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYC  367
            CGCFR   F+S EG   +L+  GE    W   K K+++E SE+VAGP+WKN +RKMG+YC
Sbjct  30   CGCFRFPCFQSKEGEANSLLQQGEDRDSWMVTKMKELKEYSELVAGPKWKNFVRKMGKYC  89

Query  368  NPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPA  526
            N K   G   QF YD+ SYALNFD G         E  +GLFRNFSSR+A PA
Sbjct  90   NSKKSKG--QQFQYDSDSYALNFDEGD-----EAVENDDGLFRNFSSRFAAPA  135



>gb|AHA61363.1| hypothetical protein Lr923_ref, partial [Lumnitzera racemosa]
Length=156

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 90/157 (57%), Gaps = 24/157 (15%)
 Frame = +2

Query  110  SGNQESQAFMIANSPIVDEEEAG----------SPTGCGCFRLLSFRSG---EGNTRALI  250
            +  +ESQAFM A SPI++ E  G          SP+GC CF    F  G   +G      
Sbjct  8    TSTKESQAFMKAYSPILEHEHEGHNVGSYSDDVSPSGCSCF-CFKFPWGGRKDGRYDLYQ  66

Query  251  GGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGG-YKAQFIYDAQSYA  427
             GE+   WW  K KKVRE SEV+AGP+WKN++RK+G Y     +G  +K +F YD++SYA
Sbjct  67   SGENRETWWMTKLKKVREYSEVLAGPKWKNMIRKVGGY----FRGNKHKNRFHYDSESYA  122

Query  428  LNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQ  538
            LNFD+G        EE  +GL R++SSR+  P   +Q
Sbjct  123  LNFDSGV-----DSEEDDDGLMRSYSSRFVAPLSSEQ  154



>ref|XP_009770423.1| PREDICTED: uncharacterized protein LOC104221130 [Nicotiana sylvestris]
Length=154

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 72/114 (63%), Gaps = 11/114 (10%)
 Frame = +2

Query  191  CGCFRLLSFRSGEGNTRALIG--GESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRY  364
            CGCFR   F+S EG   +L+   GE    W   K K+++E SE+VAGP+WKN +RKMG+Y
Sbjct  30   CGCFRFPCFQSKEGEANSLLQQQGEDRDSWMVTKMKELKEYSELVAGPKWKNFVRKMGKY  89

Query  365  CNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPA  526
            CN K   G   QF YD+ SYA+NFD G        EE  +GL RNFS+R+A PA
Sbjct  90   CNSKKSKG--QQFQYDSDSYAMNFDEGV-------EENDDGLLRNFSTRFAAPA  134



>ref|XP_007013697.1| Uncharacterized protein TCM_038268 [Theobroma cacao]
 gb|EOY31316.1| Uncharacterized protein TCM_038268 [Theobroma cacao]
Length=152

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 87/158 (55%), Gaps = 19/158 (12%)
 Frame = +2

Query  107  MSGNQESQAFMIANSP-----IVDEEEAGSPTGCGCFRLLSF---RSGEGNTRALIG--G  256
            M+ ++E   FM  +SP     + D EE     GC  F L      R+    T +L+   G
Sbjct  1    MTNSEEKPIFMHKHSPLQGEDVDDHEEEVWDKGCDWFSLFCLKWRRNDIEETDSLVHQRG  60

Query  257  ESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNF  436
            E    WW+ K KKV+E+SE +AGP+WKN +RKM  YCN +     K +F YD+ SYALNF
Sbjct  61   EPTQTWWKSKLKKVKEVSEKLAGPKWKNFIRKMSGYCNKRR--TRKNRFQYDSYSYALNF  118

Query  437  DNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAG  550
            D+G        +++G+ L ++FS R+  P   ++ +AG
Sbjct  119  DDGA-------DKEGDDLLQDFSDRFVAPFSDERQRAG  149



>ref|XP_006359532.1| PREDICTED: uncharacterized protein LOC102591718 [Solanum tuberosum]
Length=152

 Score =   104 bits (260),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 73/126 (58%), Gaps = 7/126 (6%)
 Frame = +2

Query  164  EEEAGSPTGCGCFRLLSFRSG--EGNTRALIGG-ESAAVWWRGKAKKVRELSEVVAGPRW  334
            E E  S   C CFR   F S   EG   +L+   E+   W     K+++E SE+VAGP+W
Sbjct  18   EYEEPSSIWCACFRFPCFPSTQKEGEANSLLQERENRDSWIVKNMKELKEYSELVAGPKW  77

Query  335  KNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRY  514
            KNL+RK+G+YCNPK       QF YD+ SYALNFDNG         E  +GL RNFSSR+
Sbjct  78   KNLVRKIGKYCNPKKSSAKTTQFQYDSDSYALNFDNG----GGDVREDDDGLLRNFSSRF  133

Query  515  AVPAVG  532
            A P  G
Sbjct  134  AAPFSG  139



>ref|XP_010105979.1| hypothetical protein L484_007613 [Morus notabilis]
 gb|EXC06933.1| hypothetical protein L484_007613 [Morus notabilis]
Length=144

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 63/128 (49%), Positives = 74/128 (58%), Gaps = 12/128 (9%)
 Frame = +2

Query  155  IVDEEEAGSPTGCGCFRLLSFRSGEGNTRALIGGESAAV-----WWRGKAKKVRELSEVV  319
            I D E++GS TGCGCF  L F+    N     GG+   V     WW  K  KV+ELSEVV
Sbjct  16   IHDYEDSGSSTGCGCFWFLGFKRPRNNEN---GGDKRQVRKETTWWVKKMNKVKELSEVV  72

Query  320  AGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRN  499
            AGP+WK  +RK+G YC  K K     +F YD QSYALNFD G  AA   EEE G  L  +
Sbjct  73   AGPKWKTFIRKVGGYC--KGKKQKNTRFQYDPQSYALNFDCGVDAAEEEEEEDGPLL--D  128

Query  500  FSSRYAVP  523
             SSR+  P
Sbjct  129  ISSRFTAP  136



>ref|XP_004242705.1| PREDICTED: uncharacterized protein LOC101250420 [Solanum lycopersicum]
Length=159

 Score = 93.6 bits (231),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 72/125 (58%), Gaps = 7/125 (6%)
 Frame = +2

Query  167  EEAGSPTGCGCFRLLSFRSG--EGNTRALIGG-ESAAVWWRGKAKKVRELSEVVAGPRWK  337
             E  S   C CFR   F S   EG   +L+   E+   W     K+++E SE++AGP+WK
Sbjct  23   HEEPSSIWCACFRFPCFPSTQKEGEANSLLHERENRDSWIVKNMKELKEYSELIAGPKWK  82

Query  338  NLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYA  517
            NL+RK+G+YCNPK       QF YD+ SYALNFDNG         E  +GL RNFSSR+A
Sbjct  83   NLVRKIGKYCNPKKSSAKTTQFQYDSDSYALNFDNGG----GDGREDDDGLLRNFSSRFA  138

Query  518  VPAVG  532
             P  G
Sbjct  139  APFSG  143



>gb|KJB64586.1| hypothetical protein B456_010G056200 [Gossypium raimondii]
Length=146

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 57/149 (38%), Positives = 75/149 (50%), Gaps = 25/149 (17%)
 Frame = +2

Query  107  MSGNQESQAFMIANSPIVDEEEAGSP--TGCGCFRLLSFRS-------GEGNTRALIGGE  259
            M  +QE+  FM A      E E G     GCGCF L   +         E +T     GE
Sbjct  1    MKNSQENPIFMQA------EVEDGGVWGKGCGCFNLFCLKRRRSYNHIDESDTLLHQRGE  54

Query  260  -SAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNF  436
                 WW+ K  K+++ SE VAGP+WKN +RKMG YC+   +   K +F YD  SYALNF
Sbjct  55   QHTEEWWKCKLNKLKQFSEKVAGPKWKNFMRKMGGYCDK--RKDQKNRFQYDPCSYALNF  112

Query  437  DNGTaaaaaaeeeQGNGLFRNFSSRYAVP  523
            D G        +++ + L R FSSR+  P
Sbjct  113  DEGD-------DKEADDLLRGFSSRFTAP  134



>ref|XP_002523552.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38891.1| conserved hypothetical protein [Ricinus communis]
Length=153

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 63/161 (39%), Positives = 83/161 (52%), Gaps = 20/161 (12%)
 Frame = +2

Query  107  MSGNQESQAFM-IANSPIVDEEEAG-------SPTGCGCFRLLSFR--SGEGNTRALIGG  256
            M+  Q+ + F+    SPI++ E+ G       S +GC CF   SFR     GN    + G
Sbjct  1    MARTQQKETFVGTPYSPIMEHEQEGLDHLDDYSTSGCNCFHFFSFRWEQNHGNEHGHLLG  60

Query  257  ESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNP-KLKGGYKAQFIYDAQSYALN  433
            E    W   K KKV+E+SEVVAGPRWK  +RK+  Y    K       QF YD +SYALN
Sbjct  61   EQRETWVVKKLKKVKEVSEVVAGPRWKTFIRKISAYIKKMKRHKNNNNQFQYDPESYALN  120

Query  434  FDNGTaaaaaaeeeQGNGLFRNFSSRYAV-PAVGQQMKAGL  553
            FD           E+ + L   FSSR++V P+  QQ + GL
Sbjct  121  FDGD--------REEDDLLVPIFSSRFSVPPSADQQRQNGL  153



>ref|XP_011018213.1| PREDICTED: uncharacterized protein LOC105121319 [Populus euphratica]
Length=138

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 68/129 (53%), Gaps = 16/129 (12%)
 Frame = +2

Query  164  EEEAGSPTGCGCFRLLSFRSGEGNTRALI----GGESAAVWWRGKAKKVRELSEVVAGPR  331
            E+EA S  GC CFRL +F S   N R        G+S   W   K +KV+E SEV+AGP+
Sbjct  15   EQEAYSANGCCCFRLFNFNSRRNNEREYDVLNQNGDSRDPWLVRKLQKVKEASEVLAGPK  74

Query  332  WKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSR  511
            WK  +RK+  Y   K K     QF YDA+SYALNFD           E+ + L   FSSR
Sbjct  75   WKTFIRKISAYI--KKKKQRNNQFQYDAESYALNFD----------REEDDCLIPGFSSR  122

Query  512  YAVPAVGQQ  538
            +A  +   Q
Sbjct  123  FAAASSEDQ  131



>ref|XP_002308378.1| hypothetical protein POPTR_0006s20450g [Populus trichocarpa]
 gb|EEE91901.1| hypothetical protein POPTR_0006s20450g [Populus trichocarpa]
Length=130

 Score = 82.8 bits (203),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 56/96 (58%), Gaps = 6/96 (6%)
 Frame = +2

Query  164  EEEAGSPTGCGCFRLLSFRSGEGNTRALI----GGESAAVWWRGKAKKVRELSEVVAGPR  331
            EEEA S  GC CFRL +F     N R        G+    W   K KKV+E SE+VAGP+
Sbjct  31   EEEAYSANGCCCFRLFTFNLRRNNEREYDILNENGDHRDPWLVRKLKKVKEASEIVAGPK  90

Query  332  WKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFD  439
            WK  +RK+G Y   + +   +AQ  YDA+SYALNFD
Sbjct  91   WKTFIRKIGAYIKKRKQRNNQAQ--YDAESYALNFD  124



>ref|XP_002325163.1| hypothetical protein POPTR_0018s12210g [Populus trichocarpa]
 gb|EEF03728.1| hypothetical protein POPTR_0018s12210g [Populus trichocarpa]
Length=154

 Score = 82.4 bits (202),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 69/129 (53%), Gaps = 16/129 (12%)
 Frame = +2

Query  164  EEEAGSPTGCGCFRLLSFRSGEGNTRALI----GGESAAVWWRGKAKKVRELSEVVAGPR  331
            E+EA S  GC CF L +F S   N R        G+S+  W   K KKV+E SEV+AGP+
Sbjct  31   EQEAYSANGCCCFGLFNFNSRRNNEREYDVLNQNGDSSDPWLVRKLKKVKEASEVLAGPK  90

Query  332  WKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSR  511
            WK  +RK+  Y   K +   ++Q  YDA+SYALNFD           E+ + L   FSSR
Sbjct  91   WKTFIRKISAYIKKKKQRNNQSQ--YDAESYALNFD----------REEDDCLIPGFSSR  138

Query  512  YAVPAVGQQ  538
            +A  +   Q
Sbjct  139  FAAASSEDQ  147



>ref|NP_001267984.1| stress induced protein [Vitis vinifera]
 gb|ACN94268.1| stress induced protein [Vitis vinifera]
Length=164

 Score = 82.8 bits (203),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/92 (50%), Positives = 55/92 (60%), Gaps = 8/92 (9%)
 Frame = +2

Query  188  GCGCFRLLSFRSGEGNTRALIG------GESAAVWWRGKAKKVRELSEVVAGPRWKNLLR  349
            GCGCFRL  F SG  +     G      GE    WW  K KK +E SEV+AGP+WKN +R
Sbjct  45   GCGCFRLFGFNSGWSHDNNEDGHLFQARGERINTWWVKKLKKAKEFSEVLAGPKWKNFIR  104

Query  350  KMGRYCNPKLKGGYKAQFIYDAQSYALNFDNG  445
            K+G Y     K   K +F YDA+SYALNFD+G
Sbjct  105  KLGGYF--NNKNKKKNRFQYDAESYALNFDDG  134



>gb|AFY26888.1| stress induced protein [Morella rubra]
Length=134

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 62/103 (60%), Gaps = 9/103 (9%)
 Frame = +2

Query  155  IVDEEEAGSPTG-CGCFRLLSFR---SGEGNTRALIG--GESAAVWWRGKAKKVRELSEV  316
            + D EEA S  G CGC RLL FR   S +  +R L+   GE    WW  +  KV++++EV
Sbjct  10   MEDYEEAVSDGGGCGCLRLLGFRWSQSKDKESRYLLQQKGEYRQTWWMEQVIKVKQVTEV  69

Query  317  VAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNG  445
            +AGP+WK  +RK   Y N + +   K  F YD QSYALNFD+G
Sbjct  70   IAGPKWKTFIRKFSAYGNKRKQ---KNGFQYDPQSYALNFDSG  109



>gb|EYU30579.1| hypothetical protein MIMGU_mgv1a018795mg [Erythranthe guttata]
Length=191

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 73/134 (54%), Gaps = 14/134 (10%)
 Frame = +2

Query  149  SPIVDEEEAGSPT----GCGCFRLLSF---RSGEGNTRALIGGESAAVWWRGKAKKVREL  307
            SPI + E  G+      GC CFR   F   RS     R   GG   + W   K KK++EL
Sbjct  19   SPITERENEGAEEYAGGGCDCFRRFCFGGSRSSLLRERGTGGG---SPWLVEKLKKLKEL  75

Query  308  SEVVAGPRWKNLLRKMGRYCNPKLK---GGYKAQFIYDAQSYALNFDNG-Taaaaaaeee  475
            SE+VAGP+WKN +R++G++C+PK         AQF Y  +SYALNF  G  +      EE
Sbjct  76   SEMVAGPKWKNFVRRIGKFCSPKKHVNSTQQNAQFKYSPESYALNFSGGDNSEDHGGGEE  135

Query  476  QGNGLFRNFSSRYA  517
            +   L  +FSSR+A
Sbjct  136  EEGNLLHSFSSRFA  149



>ref|XP_011648475.1| PREDICTED: uncharacterized protein LOC105434480 [Cucumis sativus]
 gb|KGN65215.1| hypothetical protein Csa_1G265630 [Cucumis sativus]
Length=148

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/126 (40%), Positives = 64/126 (51%), Gaps = 14/126 (11%)
 Frame = +2

Query  179  SPTGCGCFRLLSFRSGE------GNTRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKN  340
            S  GCGCF+L  F S        GN      G     W   + KKVRE+SE+VAGP+WKN
Sbjct  31   SSNGCGCFQLFGFGSNRNRNYEGGNLLQQKQGREEESWMVKRLKKVREVSEMVAGPKWKN  90

Query  341  LLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAV  520
             +RKMG Y   K +   + +F YD +SYALNFD G                  FSSR+AV
Sbjct  91   FIRKMGGYLKGKKE---RNRFQYDPESYALNFDGGFDGEEDDHHPP-----IGFSSRFAV  142

Query  521  PAVGQQ  538
            P   ++
Sbjct  143  PLASRE  148



>gb|EYU34922.1| hypothetical protein MIMGU_mgv1a015458mg [Erythranthe guttata]
Length=157

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 72/134 (54%), Gaps = 13/134 (10%)
 Frame = +2

Query  149  SPIVDEEE-------AGSPTGCGCFRLLSFRSGEGNTRALIGGESAAVWWRGKAKKVREL  307
            SP++ E E       AG   GCGCFR   F     +     G    + W   K KK++EL
Sbjct  19   SPMITERENEGADEYAGG--GCGCFRRFCFGGSRNSLLRERGTGGGSPWLVEKLKKLKEL  76

Query  308  SEVVAGPRWKNLLRKMGRYCNPKLK---GGYKAQFIYDAQSYALNFDNG-Taaaaaaeee  475
            SE+VAGP+WKN +R++G++C+PK         AQF Y  +SYALNF  G +       EE
Sbjct  77   SEMVAGPKWKNFVRRIGKFCSPKKHVNSTQQNAQFQYSPESYALNFSGGDSEDHGGGGEE  136

Query  476  QGNGLFRNFSSRYA  517
            +   L  +FSSR+A
Sbjct  137  EEGNLLHSFSSRFA  150



>gb|EYU30573.1| hypothetical protein MIMGU_mgv1a022617mg [Erythranthe guttata]
Length=157

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 72/132 (55%), Gaps = 14/132 (11%)
 Frame = +2

Query  149  SPIVDEEEAGSPT----GCGCFRLLSF---RSGEGNTRALIGGESAAVWWRGKAKKVREL  307
            SPI + E  G+      GC CFR  SF   RS     R   GG   + W   K KK++EL
Sbjct  19   SPITERENEGAEEYAGGGCDCFRRFSFGGSRSSLLRERGTGGG---SPWLVEKLKKLKEL  75

Query  308  SEVVAGPRWKNLLRKMGRYCNPKLK---GGYKAQFIYDAQSYALNFDNG-Taaaaaaeee  475
            SE+VAGP+WKN +R++G++C+PK         AQF Y  +SYALNF  G  +      EE
Sbjct  76   SEMVAGPKWKNFVRRIGKFCSPKKHVNSTQQNAQFQYSPESYALNFSGGDNSEDHGGGEE  135

Query  476  QGNGLFRNFSSR  511
            +   L  +FSSR
Sbjct  136  EEGNLLHSFSSR  147



>ref|XP_011084175.1| PREDICTED: uncharacterized protein LOC105166496 [Sesamum indicum]
Length=144

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 68/128 (53%), Gaps = 16/128 (13%)
 Frame = +2

Query  152  PIVDEEEAGSPTGCGCFRLLSFRSGEGNTRALI------GGESAAVWWRGKAKKVRELSE  313
            P V +EEAG   GCGCFR   F   +  +R+ +      G      W   + KK+RELSE
Sbjct  11   PTVYDEEAG---GCGCFRRFCFGWDDVESRSYLLQERQEGVAHKEAWIVARLKKLRELSE  67

Query  314  VVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLF  493
            V+AGP+WKNL+R++G+ C  +       QF Y  +SYALNF           EE+   + 
Sbjct  68   VLAGPKWKNLIRRIGKICKLRRHNKSTLQFQYSPESYALNFAGDD-------EEEDEIIL  120

Query  494  RNFSSRYA  517
             +FS R+A
Sbjct  121  HSFSVRFA  128



>gb|KJB65882.1| hypothetical protein B456_010G117000 [Gossypium raimondii]
Length=174

 Score = 79.7 bits (195),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 68/125 (54%), Gaps = 14/125 (11%)
 Frame = +2

Query  161  DEEEAGSPTGCGCFRLL---SFRSGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGPR  331
            D E+  S  GC CFR L    FR  +G    L   E+   W + KAK++RE+SEV+AGP+
Sbjct  54   DFEDPDSSFGCRCFRGLFRWRFRL-QGQGYLLQQEEAKESWLKRKAKELREVSEVLAGPK  112

Query  332  WKNLLRKMGRY-CNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSS  508
            WKN +R+   Y  N K +   K Q  YD QSY LNFD G          + +  F +FS+
Sbjct  113  WKNFIRRFSVYGANKKRRSTMKMQ--YDIQSYELNFDEGI-------HREADAAFLDFSA  163

Query  509  RYAVP  523
            R+A P
Sbjct  164  RFAAP  168



>ref|XP_006450344.1| hypothetical protein CICLE_v10010338mg [Citrus clementina]
 gb|ESR63584.1| hypothetical protein CICLE_v10010338mg [Citrus clementina]
Length=147

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 57/141 (40%), Positives = 74/141 (52%), Gaps = 30/141 (21%)
 Frame = +2

Query  149  SPIVDE----EEAGSPTGCGCFRLLSF-RSGEGNTRALIGGESAA-----VWWRGKAKKV  298
            SP+ DE    EE G   GC CF  L   R G+G  R L+  +         W R +AKK+
Sbjct  17   SPLNDEIDLIEEYGD-GGCSCFGGLCLDRRGQG--RCLLQQQEDEEVIRETWSRERAKKI  73

Query  299  RELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQ  478
            +E SEVVA P+WKN+++++    N K +   K QF YD QSY LNFD+G           
Sbjct  74   KEFSEVVAEPKWKNIIKRLS--LNNKKRSASKIQFHYDPQSYKLNFDDGI----------  121

Query  479  GNGLFRN----FSSRYAVPAV  529
             NG F +    FS+RYA P V
Sbjct  122  -NGEFDDGHVGFSTRYAGPVV  141



>ref|XP_004514062.1| PREDICTED: uncharacterized protein LOC101491954 [Cicer arietinum]
Length=141

 Score = 79.0 bits (193),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 70/122 (57%), Gaps = 13/122 (11%)
 Frame = +2

Query  161  DEEEAGSPTGCGCFRLLSFRSGEGNTRAL-IGGESAAVWWRGKAKKVRELSEVVAGPRWK  337
            D +EA S  G GCF +L  R  +G+     +  +   +WW  K +K++E+SEV+AGP+WK
Sbjct  22   DHQEA-SGCGYGCFHVLGVRWWQGHEEGKGLLEQKEDLWWSCKLRKIKEVSEVIAGPKWK  80

Query  338  NLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYA  517
              +RK+  Y    +K   K +F YD QSYALNF +G        + + +GL  +FS R++
Sbjct  81   TFIRKISGY----VKKQQKNRFQYDEQSYALNFSSGA-------QSEDDGLPHSFSVRFS  129

Query  518  VP  523
             P
Sbjct  130  AP  131



>ref|XP_007223658.1| hypothetical protein PRUPE_ppa012789mg [Prunus persica]
 gb|EMJ24857.1| hypothetical protein PRUPE_ppa012789mg [Prunus persica]
Length=154

 Score = 77.8 bits (190),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 55/104 (53%), Gaps = 14/104 (13%)
 Frame = +2

Query  161  DEEEAGSPTGCGC-----FRLLSFRSGEGNTRALI----GGESAAVWWRGKAKKVRELSE  313
            DEEE    + CGC     FR L  RS  G  R L+    G +    W    AKKVRE SE
Sbjct  26   DEEEIAPSSSCGCLWGFYFRALRGRSNIGTQRYLLQQQGGDQVKENWLVENAKKVREFSE  85

Query  314  VVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNG  445
            V+AGP+WKN +R        +     + QF YD QSYALNFD+G
Sbjct  86   VLAGPKWKNFIRSFSTIYKKR-----RVQFQYDLQSYALNFDDG  124



>ref|XP_010687820.1| PREDICTED: uncharacterized protein LOC104901896 [Beta vulgaris 
subsp. vulgaris]
Length=145

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 54/159 (34%), Positives = 82/159 (52%), Gaps = 27/159 (17%)
 Frame = +2

Query  107  MSGNQESQAFMIAN-SPIVDEEEAGSPTGCGCFRLLSFRS--------GEGNTRALIGG-  256
            MS  QE+ + M +   P ++++      GCGCFR  SFR+             R L    
Sbjct  1    MSTPQENASLMHSQLEPELEDQ------GCGCFR--SFRAFTHKHAPNDVDRVRLLPRDR  52

Query  257  -ESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALN  433
             E    W   + KK+RE+SE+VAGP+WKN +RKMG Y +   K   +  F YD+ +Y LN
Sbjct  53   REETESWVVRQVKKLREVSELVAGPKWKNFIRKMGSYFSDNKK---RKDFQYDSFNYTLN  109

Query  434  FDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAG  550
            FD+G       + +  +G+   FSSR+A P +  + ++ 
Sbjct  110  FDDGN-----HDNDDQHGVNLGFSSRFAPPVLNDKPRSS  143



>ref|XP_012077505.1| PREDICTED: uncharacterized protein LOC105638320 [Jatropha curcas]
 gb|KDP33548.1| hypothetical protein JCGZ_07119 [Jatropha curcas]
Length=153

 Score = 77.4 bits (189),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 52/133 (39%), Positives = 73/133 (55%), Gaps = 25/133 (19%)
 Frame = +2

Query  164  EEEAG---SPTGCGCFRLLSFRSGEGNTRALIGGESAAV-----WWRGKAKKVRELSEVV  319
            EE+A    S + C CF L   R+  G+ R L+G +   +     W   KAKKV+E+SEV+
Sbjct  29   EEQAAAYFSSSCCCCFYLK--RNSNGSRRYLLGRKQEEIDNKESWVVEKAKKVKEISEVL  86

Query  320  AGPRWKNLLRKMGR-----YCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGN  484
            AGP+WKN +R+        +C+ K     K Q+ YD QSYALNFD+G        +++  
Sbjct  87   AGPKWKNFIRRCSSVHGYGFCSKKTS---KMQYQYDPQSYALNFDDGI-------DKELE  136

Query  485  GLFRNFSSRYAVP  523
              F  FS+RYA P
Sbjct  137  DSFPGFSARYATP  149



>emb|CDY00331.1| BnaA06g22320D [Brassica napus]
Length=154

 Score = 77.0 bits (188),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 53/156 (34%), Positives = 73/156 (47%), Gaps = 19/156 (12%)
 Frame = +2

Query  137  MIANSPIVDEEEAGSPTGCGCFRLLSFRSGE----GNTRALIGGESA-----AVWWRGKA  289
            ++ + P  D E    P  C CF     RS      G  R +    S        WW+  A
Sbjct  3    VVQSDPAQDPETRFVPRCCSCFPTFRSRSSAYSSWGRIRTVDDNHSVDRGDDPPWWKRAA  62

Query  290  KKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKA--QFIYDAQSYALNFDNGTaaaaa  463
             K+RE SE+VAGPRWK  +R+  R  +P+    + A  +F YD  SY+LNFD+       
Sbjct  63   LKIREWSEIVAGPRWKTFIRRFNR--DPRRGRDWDASEKFQYDPLSYSLNFDDDEEDEYV  120

Query  464  aeeeQGNGLFRNFSSRYA-VPAVGQQMKAGL*RGQI  568
                 G G FR+FS+RYA VP    +  A   R ++
Sbjct  121  -----GLGGFRSFSTRYASVPVSSGKSPAVPPRNKV  151



>ref|XP_006394343.1| hypothetical protein EUTSA_v10005490mg [Eutrema salsugineum]
 gb|ESQ31629.1| hypothetical protein EUTSA_v10005490mg [Eutrema salsugineum]
Length=165

 Score = 76.3 bits (186),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 68/146 (47%), Gaps = 21/146 (14%)
 Frame = +2

Query  137  MIANSPIVDEEEAGSPTGCGCFRLLSFRSGE-------GNTRALIGGES-----AAVWWR  280
            ++ + P  D E    P  C CF     RS         G  R +   +S        WW+
Sbjct  3    LVQSDPTQDPETRYDPRCCSCFPSFRSRSSTAVGYSSWGRIRTVDDNQSGDHGDEPRWWK  62

Query  281  GKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKA--QFIYDAQSYALNFDNGTaa  454
              A K+RE SE+VAGPRWK  +R+  R  +P+    + A  +F YD  SY+LNFD+    
Sbjct  63   RAALKIREWSEIVAGPRWKTFIRRFNR--DPRRGRDWDASEKFQYDPLSYSLNFDDDDED  120

Query  455  aaaaeeeQGNGLFRNFSSRYAVPAVG  532
                    G G FR+FS+RYA   V 
Sbjct  121  EYV-----GLGGFRSFSTRYASVPVS  141



>ref|XP_006453702.1| hypothetical protein CICLE_v10010491mg [Citrus clementina]
 gb|ESR66942.1| hypothetical protein CICLE_v10010491mg [Citrus clementina]
Length=137

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/91 (47%), Positives = 51/91 (56%), Gaps = 7/91 (8%)
 Frame = +2

Query  188  GCGCFRLLSF---RSGEGNTRALIGGES--AAVWWRGKAKKVRELSEVVAGPRWKNLLRK  352
            GC CF L SF   R G      L  G+      WW  K KKV+E+SE+ AGP+WKN +RK
Sbjct  39   GCDCFGLFSFKTRRRGNEYNNLLHEGQHRLGEPWWNEKLKKVKEVSELCAGPKWKNFIRK  98

Query  353  MGRYCNPKLKGGYKAQFIYDAQSYALNFDNG  445
             GR+ +   K      F YD QSYALNFD G
Sbjct  99   TGRFFS--FKRNKHNNFQYDPQSYALNFDGG  127



>ref|XP_006483428.1| PREDICTED: uncharacterized protein LOC102614648 [Citrus sinensis]
 gb|KDO46771.1| hypothetical protein CISIN_1g040663mg [Citrus sinensis]
Length=147

 Score = 75.5 bits (184),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 74/141 (52%), Gaps = 30/141 (21%)
 Frame = +2

Query  149  SPIVDE----EEAGSPTGCGCFRLLSF-RSGEGNTRALIGGESAA-----VWWRGKAKKV  298
            SP+ DE    EE G   GC CF  L   R G+G  R L+  +        +W R +AKK+
Sbjct  17   SPLNDEIDLIEEYGD-GGCSCFGGLCLDRRGQG--RYLLQQQEDEEVIREIWSRERAKKI  73

Query  299  RELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQ  478
            +E SEVVA P+WK++++++    N K     K QF YD QSY LNFD+G           
Sbjct  74   KEFSEVVAEPKWKSIIKRLS--LNNKKISASKMQFHYDPQSYKLNFDDGI----------  121

Query  479  GNGLFRN----FSSRYAVPAV  529
             NG F +    FS+RYA P V
Sbjct  122  -NGEFDDGHVGFSARYAGPVV  141



>ref|XP_009130237.1| PREDICTED: uncharacterized protein LOC103855027 [Brassica rapa]
Length=161

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 65/144 (45%), Gaps = 20/144 (14%)
 Frame = +2

Query  137  MIANSPIVDEEEAGSPTGCGCFRLLSFRSGE-------GNTRAL----IGGESAAVWWRG  283
            ++ + P  D E    P  C CF     RS         G  R        G     WW+ 
Sbjct  3    VVHSDPAHDPETRYDPRCCSCFPSFRSRSSTALGYSSWGRIRTADDNNTHGPDEPRWWKR  62

Query  284  KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKA--QFIYDAQSYALNFDNGTaaa  457
             A KVRE SE+ AGPRWK  +R+  R  +P+    + A  +F YD  SYALNFD+     
Sbjct  63   AALKVREWSEIAAGPRWKTFIRRFNR--DPRRGRDWDAGEKFQYDPLSYALNFDDDDEDE  120

Query  458  aaaeeeQGNGLFRNFSSRYAVPAV  529
                   G G FR+FS+RYA   V
Sbjct  121  YV-----GLGGFRSFSTRYAAVPV  139



>ref|XP_011469857.1| PREDICTED: uncharacterized protein LOC105353052 [Fragaria vesca 
subsp. vesca]
Length=146

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 75/146 (51%), Gaps = 25/146 (17%)
 Frame = +2

Query  158  VDEEEAGSPTGC-GCFRLLSF----RSGEGNTRALIGGESAAV----WWRGKAKKVRELS  310
            +D  E  +P  C GCF +  F     S E   + L+GG +++     WWR +  K RE +
Sbjct  1    MDAYEEEAPACCHGCFGVFKFPWKQSSSENEGKLLLGGCNSSTKEVTWWRKELNKAREST  60

Query  311  EVVAGPRWKNLLRKMGRYC----NPKL----KGGYKAQFIYDAQSYALNFDNGTaaaaaa  466
             V  GP+WKNL+RK+G YC      K+    K   K +F YD  SY LNFDNG+      
Sbjct  61   VVYGGPKWKNLVRKIGAYCRGCRKQKVRLWKKQKPKNRFQYDMDSYNLNFDNGS------  114

Query  467  eeeQGNGLFRNFSSRYAVPA--VGQQ  538
            +   G     +F++R+A P+  + QQ
Sbjct  115  DGRDGENPVADFAARFAAPSSVISQQ  140



>gb|KEH38092.1| stress induced protein [Medicago truncatula]
Length=141

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 66/122 (54%), Gaps = 12/122 (10%)
 Frame = +2

Query  161  DEEEAGSPTGCGCFRLLSFRSGEGNTRAL-IGGESAAVWWRGKAKKVRELSEVVAGPRWK  337
            ++ +  S  G GCFR    + G GN     +  +    WW  K +K++E+SEV+AGP+WK
Sbjct  21   NDHQEDSGCGYGCFRACGLKWGLGNDEGKGLLEQREDSWWVCKLRKMKEVSEVIAGPKWK  80

Query  338  NLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYA  517
              +RK+  Y   + KG    +F YD  SYALNF +G        + + + L  +FS+R++
Sbjct  81   TFIRKISMYGKKQQKG----KFQYDEHSYALNFSSGA-------QSEDDDLPHSFSARFS  129

Query  518  VP  523
             P
Sbjct  130  AP  131



>emb|CDY30736.1| BnaA02g33580D [Brassica napus]
Length=161

 Score = 74.3 bits (181),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 65/144 (45%), Gaps = 20/144 (14%)
 Frame = +2

Query  137  MIANSPIVDEEEAGSPTGCGCFRLLSFRSGE-------GNTRALIG----GESAAVWWRG  283
            ++ + P  D E    P  C CF     RS         G  R        G     WW+ 
Sbjct  3    VVHSDPAHDPETRYDPRCCSCFPSFRSRSSTALGYSSWGRIRTADDNNNHGPDEPRWWKR  62

Query  284  KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKA--QFIYDAQSYALNFDNGTaaa  457
             A KVRE SE+ AGPRWK  +R+  R  +P+    + A  +F YD  SYALNFD+     
Sbjct  63   AALKVREWSEIAAGPRWKTFIRRFNR--DPRRGRDWDAGEKFQYDPLSYALNFDDDDEDE  120

Query  458  aaaeeeQGNGLFRNFSSRYAVPAV  529
                   G G FR+FS+RYA   V
Sbjct  121  YV-----GLGGFRSFSTRYAAVPV  139



>ref|XP_010047188.1| PREDICTED: uncharacterized protein LOC104436150 [Eucalyptus grandis]
 gb|KCW79012.1| hypothetical protein EUGRSUZ_C00435 [Eucalyptus grandis]
Length=154

 Score = 73.9 bits (180),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 53/90 (59%), Gaps = 4/90 (4%)
 Frame = +2

Query  179  SPTGCGCFRLLSFRSGEGN----TRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLL  346
            SP+GC CF L  +R G G      R   G +    W   + KKVRE +E+VAGP+WKN +
Sbjct  29   SPSGCSCFCLKWWRGGGGAHPYMQRQHGGNDGGESWTVSRFKKVREFTELVAGPKWKNFI  88

Query  347  RKMGRYCNPKLKGGYKAQFIYDAQSYALNF  436
            RK+G Y     K   + +F YDA+SYALNF
Sbjct  89   RKVGGYWRSDRKRNPQGKFGYDAESYALNF  118



>ref|XP_011078581.1| PREDICTED: uncharacterized protein LOC105162275 [Sesamum indicum]
Length=148

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 55/151 (36%), Positives = 75/151 (50%), Gaps = 20/151 (13%)
 Frame = +2

Query  125  SQAFMIANSPIVDEEEAGSPTGCGCFRLLSF---RSGEGNTRALIG----GESAAVWWRG  283
            S AF+    P  D ++       GCFR   F     GE +   L G    G     W   
Sbjct  10   SSAFIPTPEPHKDADDY---VAGGCFRRFCFGWDDGGESHNYLLQGRGERGGHKEAWVAA  66

Query  284  KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaa  463
            + KK++E SE+VAGP+WKN +RK+GR    K +   +  F Y  QSYALNF      A  
Sbjct  67   QLKKLKEFSELVAGPKWKNFIRKIGRIFKHKKQ---RMDFQYSPQSYALNF------AED  117

Query  464  aeeeQGNGLFRNFSSRYAVPAVG-QQMKAGL  553
             ++E+   L  +FSSR+A  ++  QQ K GL
Sbjct  118  QDQEEDGNLLHSFSSRFAPHSINDQQRKDGL  148



>ref|XP_012081227.1| PREDICTED: uncharacterized protein LOC105641315 [Jatropha curcas]
Length=126

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 40/94 (43%), Positives = 50/94 (53%), Gaps = 24/94 (26%)
 Frame = +2

Query  173  AGSPTGCGCFRLLSFRSGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRK  352
            A S +GC CFR+  FR                     K KKV+E+SEVVAGP+WK  +RK
Sbjct  24   ASSSSGCNCFRVFCFR---------------------KFKKVKEVSEVVAGPKWKTFIRK  62

Query  353  MGRYCNPK---LKGGYKAQFIYDAQSYALNFDNG  445
            +  Y N +         +QF YD QSYALNFD+G
Sbjct  63   ISLYFNKQKNNHHHNNNSQFQYDPQSYALNFDDG  96



>ref|XP_008336946.1| PREDICTED: uncharacterized protein LOC103400042 [Malus domestica]
Length=165

 Score = 72.8 bits (177),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/131 (33%), Positives = 59/131 (45%), Gaps = 19/131 (15%)
 Frame = +2

Query  194  GCFRLL--SFRSGEGNTRAL------IGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLR  349
            GCFR    ++R  + N          IG      WWR K  + +E +EV+ GP+WKN +R
Sbjct  26   GCFRFFGXAYRKSDDNVYEHLVLQEGIGRNKETTWWRKKLNEAKEYTEVLGGPKWKNFIR  85

Query  350  KMGRYC----NPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYA  517
            K+G YC    N   +      F YD  SYALNFD G          +G      F++R+A
Sbjct  86   KIGGYCERQKNRLCRKEKNTAFPYDIHSYALNFDEGV-------GREGADAVLGFTARFA  138

Query  518  VPAVGQQMKAG  550
             P   +    G
Sbjct  139  APXSNEHGSMG  149



>ref|XP_010051170.1| PREDICTED: uncharacterized protein LOC104439855 [Eucalyptus grandis]
 gb|KCW81346.1| hypothetical protein EUGRSUZ_C02729 [Eucalyptus grandis]
Length=126

 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 61/108 (56%), Gaps = 11/108 (10%)
 Frame = +2

Query  143  ANSPIVDEEEAGSPTGCGCFRLLSF----RSGEGNTRALIGG--ESAAVWWRGKAKKVRE  304
            ++  + D E+A +P+ CGCF  L F    +  E   R L     E+   W+    KKV+ 
Sbjct  12   SDEDMEDFEDANTPSSCGCFDKLCFGWRGKRDESVDRLLAHQPEEARETWFVQNLKKVQH  71

Query  305  LSEVVAGPRWKNLLRKMGRYCNPKLKGGYKA-QFIYDAQSYALNFDNG  445
            +SEV+AGP+WKN +R+ G    P+  G  +  QF YD +SYALNFD G
Sbjct  72   VSEVLAGPKWKNFIRRSG----PRGVGKKRRNQFHYDQRSYALNFDGG  115



>ref|XP_009151408.1| PREDICTED: uncharacterized protein LOC103874722 [Brassica rapa]
Length=155

 Score = 72.0 bits (175),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/138 (36%), Positives = 67/138 (49%), Gaps = 17/138 (12%)
 Frame = +2

Query  137  MIANSPIVDEEEAGSPTGCGCFRLLSFRSGE----GNTRALIGGESA-----AVWWRGKA  289
            ++ + P  D E    P  C CF     RS      G  R++    S        WW+  A
Sbjct  3    VVQSDPAQDPETRYVPRCCSCFPTFRSRSSAYSSWGRIRSVDDNHSVDRGDDPPWWKRAA  62

Query  290  KKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKA--QFIYDAQSYALNFDNGTaaaaa  463
             K+RE SE+VAGPRWK  +R+  R  +P+    + A  +F YD  SY+LNFD+       
Sbjct  63   LKIREWSEIVAGPRWKTFIRRFNR--DPRRGRDWDASEKFQYDPLSYSLNFDDDDEDDEY  120

Query  464  aeeeQGNGLFRNFSSRYA  517
                 G G FR+FS+RYA
Sbjct  121  V----GLGGFRSFSTRYA  134



>ref|XP_010236125.1| PREDICTED: uncharacterized protein LOC100823892 [Brachypodium 
distachyon]
Length=185

 Score = 71.6 bits (174),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 55/105 (52%), Gaps = 10/105 (10%)
 Frame = +2

Query  257  ESAAVWWRGKAK---KVRELSEVVAGPRWKNLLRKMGR---YCNPKLKGGYKAQFIYDAQ  418
            E    WWRG A    KVRE SE+ AGPRWK  +R+ GR          GG K    YDA 
Sbjct  64   EEGPRWWRGAADAVLKVREWSELAAGPRWKTFIRRFGRGGAAGQRNFGGGRK--LNYDAL  121

Query  419  SYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
            SYALNFD G  A        G+  +R+FSSR+A P  G   K+ +
Sbjct  122  SYALNFDEGHGATPEPGG--GDYQYRDFSSRFAAPPTGSSAKSSM  164



>emb|CDY45749.1| BnaC02g42330D [Brassica napus]
Length=332

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 52/144 (36%), Positives = 66/144 (46%), Gaps = 21/144 (15%)
 Frame = +2

Query  137  MIANSPIVDEEEAGSPTGCGCFRLLSFRSGE-------GNTRALIG----GESAAVWWRG  283
            ++ + P  D E    P  C CF     RS         G  R        G     WW+ 
Sbjct  3    VVHSDPAHDPETRYDPRCCSCFPSFRSRSSPALGYSSWGRIRTADDNNNHGPDEPRWWKR  62

Query  284  KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKA--QFIYDAQSYALNFDNGTaaa  457
             A KVRE SE+ AGPRWK  +R+  R  +P+    + A  +F YD  SYALNFD+     
Sbjct  63   AALKVREWSEIAAGPRWKTFIRRFNR--DPRRGRDWDAGEKFQYDPLSYALNFDDDDEDE  120

Query  458  aaaeeeQGNGLFRNFSSRYA-VPA  526
                   G G FR+FS+RYA VP 
Sbjct  121  YV-----GLGGFRSFSTRYASVPV  139



>gb|KJB33800.1| hypothetical protein B456_006G031400 [Gossypium raimondii]
 gb|KJB33801.1| hypothetical protein B456_006G031400 [Gossypium raimondii]
Length=160

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/147 (38%), Positives = 69/147 (47%), Gaps = 17/147 (12%)
 Frame = +2

Query  131  AFMIANSPIVDEEEAGSPT------GCGCFRLLSFRSGEGNTRAL---IGG---ESAAVW  274
            A  I   P + EEE  S +       C CF   S R       A    IG    +S   +
Sbjct  4    AAHIDIEPAIPEEETTSNSLIRNTRCCFCFPCFSSRRTPAVGVAFWQRIGSSHVQSDTGF  63

Query  275  WRGKA---KKVRELSEVVAGPRWKNLLRKMGRYCNP--KLKGGYKAQFIYDAQSYALNFD  439
            W       KKVRE SE+VAGPRWK  +R+  R  +    + GG   QF YD  SYALNFD
Sbjct  64   WSSSVRAFKKVREWSEIVAGPRWKTFIRRFNRSKSGGGIVSGGRHGQFHYDPLSYALNFD  123

Query  440  NGTaaaaaaeeeQGNGLFRNFSSRYAV  520
             G       E++   G FR FS+RYA+
Sbjct  124  EGPGQNGNLEDDNDFGAFRAFSTRYAL  150



>ref|XP_006473947.1| PREDICTED: uncharacterized protein LOC102618226 [Citrus sinensis]
Length=137

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 48/87 (55%), Gaps = 7/87 (8%)
 Frame = +2

Query  188  GCGCFRLLSF---RSGEGNTRALIGGES--AAVWWRGKAKKVRELSEVVAGPRWKNLLRK  352
            GC CF L SF   R G      L  G+      WW  K KKV+E+SE+ AGP+WKN +RK
Sbjct  39   GCDCFGLFSFKTRRRGNEYNNLLHEGQHRLGEPWWNEKLKKVKEVSELCAGPKWKNFIRK  98

Query  353  MGRYCNPKLKGGYKAQFIYDAQSYALN  433
             GR+ +   K      F YD QSYALN
Sbjct  99   TGRFFS--FKRNKHNNFQYDPQSYALN  123



>ref|XP_011085867.1| PREDICTED: uncharacterized protein LOC105167746 [Sesamum indicum]
Length=156

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 70/139 (50%), Gaps = 21/139 (15%)
 Frame = +2

Query  155  IVDEEEAGSPTGCGCFRLLSFRSGE-----GNTRALIGGESAAVWWRG--KAKKVRELSE  313
            +  E E  S   C  FR   F+S +      + R      S ++W +G    KKVRE SE
Sbjct  24   VFHETEYVSRGCCSFFRFPCFKSEKWERISASEREQEVSSSGSLWGKGIHAVKKVREWSE  83

Query  314  VVAGPRWKNLLRKMGRY-CNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGL  490
            +VAGP+WK  +R+  +    PK       +F YD  SYALNFD  +       + +   +
Sbjct  84   LVAGPKWKTFIRRFKKTPARPK-----PGKFQYDPSSYALNFDESS-------QFEDERI  131

Query  491  FRNFSSRY-AVPAVGQQMK  544
            FR+FSSRY A+PA   Q+K
Sbjct  132  FRDFSSRYAAIPAQNGQLK  150



>ref|XP_008219700.1| PREDICTED: uncharacterized protein LOC103319885 [Prunus mume]
Length=147

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/100 (43%), Positives = 52/100 (52%), Gaps = 13/100 (13%)
 Frame = +2

Query  161  DEEEAGSPTGCGCFRLLSFRSGEGNTRALI-----GGESAAVWWRGKAKKVRELSEVVAG  325
            DEEE    + CGC   L  RS  G  R L+     G +    W    AKKVRE SEV+AG
Sbjct  26   DEEEIAPSSSCGC---LWGRSNIGTQRYLLHQQQEGDQIKENWLVENAKKVREFSEVLAG  82

Query  326  PRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNG  445
            P+WKN +          +    + QF YD QSYALNFD+G
Sbjct  83   PKWKNFICSFS-----TIYKKRRVQFQYDPQSYALNFDDG  117



>ref|XP_002515466.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46915.1| conserved hypothetical protein [Ricinus communis]
Length=158

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 72/120 (60%), Gaps = 14/120 (12%)
 Frame = +2

Query  119  QESQAFMIANSPIVDEEEAGSP-----TGCGCFR--LLSFRSGEGNTRALIGG--ESAAV  271
            + S + ++A    VD+++   P       C CF   ++  R+ +G+ R L+    ++ + 
Sbjct  13   ETSSSSLLAEIHYVDDQDHEEPAMTSLVCCSCFNGSVIWKRNDKGSKRLLLPKQEDTKSC  72

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRY--CNPKLKGGYKAQFIYDAQSYALNFDNG  445
             +RG+AKK++E+SEV+AGP+WKN +R+ G +   N K +   + +  YD QSYALNFD+G
Sbjct  73   CFRGRAKKLKEISEVLAGPKWKNFIRRFGGHGWINNKKR---RMRCQYDPQSYALNFDDG  129



>ref|XP_002511430.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF52032.1| conserved hypothetical protein [Ricinus communis]
Length=174

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 51/89 (57%), Gaps = 1/89 (1%)
 Frame = +2

Query  290  KKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaae  469
            KK+RE SE+VAGP+WK  +R+  R       G +  +F YD  SYALNFD G       E
Sbjct  75   KKIREWSEIVAGPKWKTFIRRFNRCNRGSGNGRHNGKFQYDPLSYALNFDEGQNGHFHDE  134

Query  470  eeQGNGLFRNFSSRYA-VPAVGQQMKAGL  553
            E    G FR+FSSRYA V A G+ +   +
Sbjct  135  ENDDYGGFRDFSSRYASVSASGKPLSMDV  163



>emb|CDP10514.1| unnamed protein product [Coffea canephora]
Length=157

 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 57/93 (61%), Gaps = 9/93 (10%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTa  451
            W+  K K ++E SEVVAGP+WKNL+RK+G+Y  PK       Q +Y   SYALNFD+G  
Sbjct  71   WFVDKLKNMKEYSEVVAGPKWKNLVRKIGKYVKPKKST---TQSMYTPNSYALNFDDGE-  126

Query  452  aaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAG  550
                 EEE+ + LF +FSSR++ P    Q +  
Sbjct  127  -----EEEEEDDLFVSFSSRFSAPLSSNQQRTS  154



>gb|EPS71755.1| hypothetical protein M569_03007 [Genlisea aurea]
Length=145

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 53/92 (58%), Gaps = 5/92 (5%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTa  451
            W   KAK +RE SEVVAGP++KNL+R+MGR   P+ +   +AQF Y   SYALNF     
Sbjct  57   WIVEKAKSLREYSEVVAGPKFKNLMRRMGRILKPRKQRSPEAQFQYSPGSYALNFSG---  113

Query  452  aaaaaeeeQGNGLFRNFSSRYA-VPAVGQQMK  544
                  EE+G  L  NFS R+A  PA     +
Sbjct  114  -EGDDWEEEGGALMHNFSYRFAGAPAPADHQR  144



>ref|XP_011071822.1| PREDICTED: uncharacterized protein LOC105157187 [Sesamum indicum]
Length=163

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 54/91 (59%), Gaps = 7/91 (8%)
 Frame = +2

Query  254  GESAAVWWRG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYA  427
            G S ++W RG    KK+RE SE+VAGPRWK  +R+  R       G     F YD  SYA
Sbjct  63   GSSNSLWARGVGALKKIREWSEIVAGPRWKTFIRRFNR----NRSGSRHVNFQYDPLSYA  118

Query  428  LNFDNGTaaaaaaeeeQGNGLF-RNFSSRYA  517
            +NFD G    +  +EE+ +G + RNFSSRYA
Sbjct  119  MNFDEGPGQNSHFDEEEEDGYYSRNFSSRYA  149



>ref|XP_008394140.1| PREDICTED: uncharacterized protein LOC103456238 [Malus domestica]
Length=145

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 43/105 (41%), Positives = 56/105 (53%), Gaps = 11/105 (10%)
 Frame = +2

Query  149  SPI-VDEEEAGSPTGCGCFRLLSFRSGEGNTRALI----GGESAAVWWRGKAKKVRELSE  313
            SP+ V++EE      CGC   L  R   G  R L+    G ++   W   K KK RE+SE
Sbjct  16   SPLEVNDEEIDPSFSCGCLWALCGRRI-GARRYLLQQQEGEQAKESWLVEKVKKAREISE  74

Query  314  VVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGT  448
            V+AGP+WKN +R        +     + QF YD QSYALNFD+G 
Sbjct  75   VLAGPKWKNFIRSFSTIYKKR-----RVQFQYDPQSYALNFDDGN  114



>gb|EYU44723.1| hypothetical protein MIMGU_mgv11b012983mg [Erythranthe guttata]
Length=154

 Score = 68.9 bits (167),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 51/154 (33%), Positives = 72/154 (47%), Gaps = 17/154 (11%)
 Frame = +2

Query  113  GNQESQAFMIANSPIVDEEEAGSPTGCGC--FRLLSFRSGEGNTRALIGGESAA----VW  274
              Q +  F   +    DE  A    GC C  F +  F+S      +  G E        W
Sbjct  2    AQQSTADFTSKDEDSGDESAAFFNRGCCCCFFSIPCFKSDNWERISTSGREQQDGIDRSW  61

Query  275  WR---GKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNG  445
            W       KKVRE SE+VAGP+WK  +R+  +       G    +F YD  SY+LNFD+G
Sbjct  62   WDKGVDALKKVREWSELVAGPKWKTFIRRFNKTSGKSKPG----KFQYDPLSYSLNFDDG  117

Query  446  TaaaaaaeeeQGNGLFRNFSSRY-AVPAVGQQMK  544
                    + + + ++R+FSSRY A+PA   Q+K
Sbjct  118  ---RGQNGQYEDDAVYRDFSSRYAAIPAHSGQLK  148



>ref|XP_008230633.1| PREDICTED: uncharacterized protein LOC103329888 [Prunus mume]
Length=160

 Score = 68.6 bits (166),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 67/138 (49%), Gaps = 14/138 (10%)
 Frame = +2

Query  140  IANSPIVDEEEAGSPTGCGCFRLLSFRSGEGNT-----RALIGGESAAVWWRGKAKKVRE  304
            +A S  V+E  +   +GC C  +  F S   +      R    G+    WW    KK+RE
Sbjct  18   LAESDDVEELMSAKTSGC-CLWMPCFGSEPSSMDGSWERIRNSGDHGDPWWNRGWKKIRE  76

Query  305  LSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGN  484
             SEVVAGP+WK  +R+     N        ++F YD  SY+LNFD G      +     +
Sbjct  77   WSEVVAGPKWKTFIRRF----NKSTANKRSSKFHYDPMSYSLNFDEGP---GQSGNLDDD  129

Query  485  GLFRNFSSRYA-VPAVGQ  535
             L+R+FS RYA +PA  +
Sbjct  130  YLYRDFSCRYASIPASAK  147



>ref|XP_004508398.1| PREDICTED: uncharacterized protein LOC101505821 [Cicer arietinum]
Length=139

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 45/120 (38%), Positives = 60/120 (50%), Gaps = 18/120 (15%)
 Frame = +2

Query  188  GCGCFRLLSF-----RSGEGN---TRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNL  343
            GCGCFR+ +      R  EG         G      W   K KK++E SEV+AGP+WK  
Sbjct  29   GCGCFRVFTSKWWQRRHEEGKHLLEEKDEGNRGEDTWVMEKLKKMKETSEVIAGPKWKTF  88

Query  344  LRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVP  523
            +RK+  Y     K   K +F YDA SYALNF++G  +           L  +FSSR++ P
Sbjct  89   IRKISWYG----KKNQKNRFQYDAHSYALNFNSGAQSEDEEY------LPPSFSSRFSAP  138



>ref|XP_008443900.1| PREDICTED: uncharacterized protein LOC103487383 [Cucumis melo]
Length=149

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 66/126 (52%), Gaps = 14/126 (11%)
 Frame = +2

Query  179  SPTGCGCFRLLSF-----RSGEG-NTRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKN  340
            S  GCGCF+L  F     R+ EG N      G     W   K KKV+E+SE+VAGP+WKN
Sbjct  32   SSNGCGCFQLFGFGSNRNRNYEGANLLQQKQGREEESWMVKKLKKVKEVSEMVAGPKWKN  91

Query  341  LLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAV  520
             +RKMG Y   K +   + +F YD +SYALNFD G                  FSSR+AV
Sbjct  92   FIRKMGGYLKGKKQ---RNRFQYDPESYALNFDGGFDGEEDDHHPP-----IGFSSRFAV  143

Query  521  PAVGQQ  538
            P   ++
Sbjct  144  PLASRE  149



>ref|XP_010524310.1| PREDICTED: uncharacterized protein LOC104802406 [Tarenaya hassleriana]
Length=169

 Score = 68.2 bits (165),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 51/152 (34%), Positives = 74/152 (49%), Gaps = 23/152 (15%)
 Frame = +2

Query  119  QESQAFMIANSPIVDE--EEAGSPTGCGCFRLLSFRSGEGNT---------RALIGGESA  265
            ++SQAF I  +   D+  E   +  GC CF L    S + +          R +   E+ 
Sbjct  2    RQSQAFKIPENDATDDMHEAMFAKRGC-CFMLPCLGSSQPSAAGSVWWQRIRTVDKCEAE  60

Query  266  AVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQ-----FIYDAQSYAL  430
              WW  + +K RE SE+VAGPRWK  +R+ GR+      GG  A+     F YD  SY+L
Sbjct  61   ERWWYRRWRKTREWSELVAGPRWKTFIRRFGRHRGSCGGGGISARQDHGTFQYDPFSYSL  120

Query  431  NFDNGTaaaaaaeeeQGNGL-FRNFSSRYAVP  523
            NFD+G            +G  +R+FS+R+  P
Sbjct  121  NFDDGGQNGHF-----DDGFPYRDFSARFTGP  147



>ref|XP_008793854.1| PREDICTED: uncharacterized protein LOC103710047 [Phoenix dactylifera]
Length=172

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 55/107 (51%), Gaps = 13/107 (12%)
 Frame = +2

Query  254  GESAAVWWR---GKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGY----KAQFIYD  412
            G+    WWR       KVRE SE+VAGPRWK  +R+  R  NP+  GG      ++F YD
Sbjct  57   GDERGGWWRRGRSAVMKVREWSELVAGPRWKTFIRRFKR--NPRHGGGVVRMGSSRFQYD  114

Query  413  AQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
              SY LNFD G   +       G   FR+FS+R+AVP       A L
Sbjct  115  PLSYTLNFDEGHGGSPEG----GYTGFRDFSARFAVPPAPATSSANL  157



>ref|XP_012081948.1| PREDICTED: uncharacterized protein LOC105641904 [Jatropha curcas]
 gb|KDP45384.1| hypothetical protein JCGZ_09633 [Jatropha curcas]
Length=155

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 63/131 (48%), Gaps = 22/131 (17%)
 Frame = +2

Query  152  PIVDEEEAGSPTGCGCF-RLLSFRSGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGP  328
            P + EE + S  G   + R+ S  S    T           WW+   KK++E SE+VAGP
Sbjct  21   PFLSEEPSRSSVGSVFWERINSIESSHTATNK------EEPWWKRGWKKMKEWSEIVAGP  74

Query  329  RWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLF-----  493
            +WK L+RK+GR            +F YD  SYALNFD G          + NG F     
Sbjct  75   KWKTLIRKIGRKRQSNSGKQGTGKFHYDPLSYALNFDEGP---------RENGHFDEDLM  125

Query  494  -RNFSSRYAVP  523
             R FSSRY++P
Sbjct  126  GREFSSRYSLP  136



>dbj|BAJ96348.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=177

 Score = 68.2 bits (165),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 53/98 (54%), Gaps = 6/98 (6%)
 Frame = +2

Query  272  WWRGKAK---KVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFI-YDAQSYALNFD  439
            WW+G      KVRE SE+ AGPRWK  +R+ GR   P+    +  + + YDA SYALNFD
Sbjct  66   WWQGAVDAMLKVREWSELAAGPRWKTFIRRFGRGPGPRPHHAFGGRKLNYDALSYALNFD  125

Query  440  NGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
             G  A     +  G   +R+FSSR+A P    +    L
Sbjct  126  EGHGATPDPGDHAGG--YRDFSSRFAAPPSSAKSSMDL  161



>ref|XP_010532364.1| PREDICTED: uncharacterized protein LOC104808387 [Tarenaya hassleriana]
Length=144

 Score = 67.4 bits (163),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 55/101 (54%), Gaps = 9/101 (9%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYK-----AQFIYDAQSYALNF  436
            WW     K+RE SE+VAGPRWK  +R+  R  N    GG +      QF YDA SYALNF
Sbjct  33   WWTRAILKLREWSEIVAGPRWKTFIRRFNR-SNHLHGGGDRDRHGNGQFQYDALSYALNF  91

Query  437  DNGTaaaaaaeeeQGN--GLFRNFSSRY-AVPAVGQQMKAG  550
            D G         ++    G FR+FS+RY AVP   ++  AG
Sbjct  92   DEGPVVEDGGVADEDRAYGGFRSFSTRYAAVPPSNKKTIAG  132



>gb|KHN18595.1| hypothetical protein glysoja_007008 [Glycine soja]
Length=140

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 68/125 (54%), Gaps = 21/125 (17%)
 Frame = +2

Query  173  AGSPTGCGCFRLLSFR--------SGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGP  328
            AGS +GCGCFR  S +         G+G       GES   W   K +K +E+SEV+AGP
Sbjct  22   AGS-SGCGCFRCFSLKKWWQGYEEEGKGLLDQKGEGES---WVVNKLRKAKEVSEVIAGP  77

Query  329  RWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSS  508
            +WK  +RK+  Y   K+K   + +F YD  SYALNF++         + +  G+  +FSS
Sbjct  78   KWKTFIRKISGY-GKKVK-YQRNRFQYDEHSYALNFNS-------EAQSEDEGMPHSFSS  128

Query  509  RYAVP  523
            R+A P
Sbjct  129  RFAAP  133



>ref|XP_003542626.1| PREDICTED: uncharacterized protein LOC100804202 [Glycine max]
 gb|KHN22109.1| hypothetical protein glysoja_033423 [Glycine soja]
Length=141

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 63/118 (53%), Gaps = 12/118 (10%)
 Frame = +2

Query  179  SPTGCGCFRLLSFRSG---EGNTRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLR  349
            S  GCGCF L  +  G   EG    +        W   K +K +E+SEV+AGP+WK  +R
Sbjct  26   SGCGCGCFGLKKWWQGHEEEGKGLLVDQKGEGESWVVEKLRKAKEVSEVIAGPKWKTFIR  85

Query  350  KMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVP  523
            K+  Y   K+K   + +F YD  SYALNF++G        + +  G+  +FSSR+A P
Sbjct  86   KISGY-GKKVK-QQRNRFQYDEHSYALNFNSGA-------QSEDEGMPHSFSSRFAAP  134



>ref|XP_010322556.1| PREDICTED: uncharacterized protein LOC104648037 [Solanum lycopersicum]
Length=156

 Score = 67.4 bits (163),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 57/161 (35%), Positives = 77/161 (48%), Gaps = 22/161 (14%)
 Frame = +2

Query  107  MSGNQESQAFMIANSPIVDEEEAGSPTGCGCFRLLSFRSGEGNTRALI----------GG  256
            M+G++   A+    +P +D  E        CF   SFRS    T+ +             
Sbjct  1    MAGSEFPHAY--PQTPSIDTSETLFQRRSRCFCFPSFRSPNQLTKYVKFDWWHRLRSGAV  58

Query  257  ESAAVWWRG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYAL  430
            +  +VW +G    KK+RE SE+VAGPRWK  +R+  R       G   A+F YD  SY+L
Sbjct  59   KEGSVWAKGINALKKLREWSEIVAGPRWKTFIRRFHR----NKSGNRNAKFQYDPLSYSL  114

Query  431  NFDNGTaaaaaaeeeQGNGLFRNFSSRYA-VPAVGQQMKAG  550
            NFD G       EEE    + RNFS+RYA +PA     K G
Sbjct  115  NFDEGRGNNGEEEEEL---VLRNFSTRYASIPASSNLGKDG  152



>ref|XP_006354987.1| PREDICTED: uncharacterized protein LOC102579987 [Solanum tuberosum]
Length=103

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 46/81 (57%), Gaps = 3/81 (4%)
 Frame = +2

Query  170  EAGSPTGCGCFRLLSFRSG--EGNTRALIGG-ESAAVWWRGKAKKVRELSEVVAGPRWKN  340
            E  S   CGCF    F S   EG   +L+   E+   W     K+++E SE+VAGP+WKN
Sbjct  23   EEPSSIWCGCFSFPCFASTQKEGQANSLLQERENRDSWIVKNMKELKEYSELVAGPKWKN  82

Query  341  LLRKMGRYCNPKLKGGYKAQF  403
            L+RK+G+YCNPK       QF
Sbjct  83   LVRKIGKYCNPKKSSAKTTQF  103



>ref|NP_001236205.1| uncharacterized protein LOC100500311 [Glycine max]
 gb|ACU15349.1| unknown [Glycine max]
Length=140

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 48/125 (38%), Positives = 68/125 (54%), Gaps = 21/125 (17%)
 Frame = +2

Query  173  AGSPTGCGCFRLLSFR--------SGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGP  328
            AGS +GCGCFR  S +         G+G       GES   W   K +K +E+SEV+AGP
Sbjct  22   AGS-SGCGCFRCFSLKKWWQGYEEEGKGLLDQKGEGES---WVVNKLRKAKEVSEVIAGP  77

Query  329  RWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSS  508
            +WK  +RK+  Y   K+K   + +F YD  SYALNF++         + +  G+  +FSS
Sbjct  78   KWKTFIRKISGY-GKKVK-YQRNRFQYDEHSYALNFNS-------EAQREDEGMPHSFSS  128

Query  509  RYAVP  523
            R+A P
Sbjct  129  RFAAP  133



>gb|EYU23644.1| hypothetical protein MIMGU_mgv1a024779mg [Erythranthe guttata]
Length=109

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/61 (51%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLK---GGYKAQFIYDAQSYALNFDN  442
            W   K KK++ELSE+VAGP+WKN +R++G++C+PK         AQF Y  +SYALNF  
Sbjct  28   WLVEKLKKLKELSEMVAGPKWKNFVRRIGKFCSPKKHVNSTQQNAQFQYSPESYALNFSG  87

Query  443  G  445
            G
Sbjct  88   G  88



>ref|XP_009598118.1| PREDICTED: uncharacterized protein LOC104093986 [Nicotiana tomentosiformis]
Length=140

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 64/121 (53%), Gaps = 16/121 (13%)
 Frame = +2

Query  197  CFRLLSFRSGEGNTRALIGGESAAVWWRG--KAKKVRELSEVVAGPRWKNLLRKMGRYCN  370
            CF   SF    G+T  L    + +VW +G    KK+RE SE+VAGPRWK  +R+  R   
Sbjct  24   CFCFPSF----GSTNQL---STRSVWAKGINALKKLREWSEMVAGPRWKTFIRRFNR---  73

Query  371  PKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAG  550
                G   A+F YD  SY+LNFD G       +EE+   + RNFS+RYA  ++    K  
Sbjct  74   -NKSGRINAKFQYDPLSYSLNFDEGP---GNNKEEEEEYVLRNFSTRYASASISAPAKVS  129

Query  551  L  553
            +
Sbjct  130  M  130



>ref|XP_010051169.1| PREDICTED: uncharacterized protein LOC104439854 [Eucalyptus grandis]
Length=133

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 40/110 (36%), Positives = 59/110 (54%), Gaps = 11/110 (10%)
 Frame = +2

Query  137  MIANSPIVDEEEAGSPTGCGCFRLLSF----RSGEGNTRALIGG--ESAAVWWRGKAKKV  298
            + +N  + D ++A   + C CF  L F    +  E   R L     E+   W+    KKV
Sbjct  17   LKSNEDMDDFDDANVASSCRCFDKLCFGWRGKRDESVDRLLAHQPEEARETWFVQNLKKV  76

Query  299  RELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKA-QFIYDAQSYALNFDNG  445
            + +SEV+AGP+WKN +R+ G    P+  G  +  QF YD +SYALNFD+ 
Sbjct  77   QHVSEVLAGPKWKNFIRRSG----PRGVGKKRRNQFHYDQRSYALNFDDA  122



>ref|XP_009760553.1| PREDICTED: uncharacterized protein LOC104212884 [Nicotiana sylvestris]
Length=159

 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/98 (42%), Positives = 56/98 (57%), Gaps = 10/98 (10%)
 Frame = +2

Query  266  AVWWRG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFD  439
            +VW +G    KK+RE SE+VAGPRWK  +R+  R      K G  A+F YD  SY+LNFD
Sbjct  60   SVWAKGINALKKLREWSEIVAGPRWKTFIRRFNRN-----KSGRNAKFQYDPLSYSLNFD  114

Query  440  NGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
             G       +EE+   + RNFS+RYA  ++    K  +
Sbjct  115  EGP---GNNKEEEEEYVLRNFSTRYASASISPPGKVSM  149



>gb|ACU24578.1| unknown [Glycine max]
Length=141

 Score = 65.5 bits (158),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 62/118 (53%), Gaps = 12/118 (10%)
 Frame = +2

Query  179  SPTGCGCFRLLSFRSG---EGNTRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLR  349
            S  GCGCF L  +  G   EG    +        W   K +K +E+SEV+AGP+WK  +R
Sbjct  26   SGCGCGCFGLKKWWQGHEEEGKGLLVDQKGEGESWVVEKLRKAKEVSEVIAGPKWKTFIR  85

Query  350  KMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVP  523
            K+  Y   K+K   + +F YD  SYA NF++G        + +  G+  +FSSR+A P
Sbjct  86   KISGY-GKKVK-QQRNRFQYDEHSYAFNFNSGA-------QSEDEGMPHSFSSRFAAP  134



>ref|XP_008438207.1| PREDICTED: uncharacterized protein LOC103483378 [Cucumis melo]
Length=167

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 52/94 (55%), Gaps = 11/94 (12%)
 Frame = +2

Query  272  WWRGKA---KKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFD-  439
            WW G+    KK+RE SE+VAGPRWK  +R+  R     +K G   +F YD  SYALNFD 
Sbjct  65   WWTGRIRSLKKLREWSEIVAGPRWKTFIRRFNRNRPATVKLG---KFQYDPISYALNFDE  121

Query  440  ---NGTaaaaaaeeeQGNGLFRNFSSRY-AVPAV  529
               NG        E  G G F+NFS R+ AVP  
Sbjct  122  GHNNGDVDFEGNHEYTGGGGFQNFSDRFAAVPPA  155



>ref|XP_009338419.1| PREDICTED: uncharacterized protein LOC103930771 [Pyrus x bretschneideri]
Length=166

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 43/132 (33%), Positives = 58/132 (44%), Gaps = 20/132 (15%)
 Frame = +2

Query  194  GCFRLLSF---RSGEGNTRALI------GGESAAVWWRGKAKKVRELSEVVAGPRWKNLL  346
            GCFR       + G+ N    +      G      WWR K  + +E +EVV GP+WKN +
Sbjct  26   GCFRFFGSAYRKQGDDNVYEHLVQQEGRGRNKETTWWRKKLNEAKESTEVVGGPKWKNFI  85

Query  347  RKMGRYC----NPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRY  514
            RK+G Y     N   +    A F YD  SYALNFD G          +G      F++R+
Sbjct  86   RKIGGYWERQKNRLCRKEKNAAFPYDIHSYALNFDEGV-------GREGADAVLGFTARF  138

Query  515  AVPAVGQQMKAG  550
            A P   +    G
Sbjct  139  AAPFSNEHGSVG  150



>ref|XP_003637618.1| Potassium transporter [Medicago truncatula]
Length=835

 Score = 69.3 bits (168),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 47/132 (36%), Positives = 60/132 (45%), Gaps = 15/132 (11%)
 Frame = +2

Query  164  EEEAGSPTGCGCFRLLSFRSGEGN----TRALIGGESAA---VWWRGKAKKVRELSEVVA  322
            +E A    GC CF +  F S   +     R  I          WW     KVRELSE+VA
Sbjct  20   QETAFRKRGCICFPIPCFSSETSSPSWWERIQIQSPEKNHHHQWWFRGWMKVRELSEIVA  79

Query  323  GPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNF  502
            GP+WK  +R+ G+  N  +K G      YD  SYALNFD+G           G      F
Sbjct  80   GPKWKTFIRRFGKNRNSYVKQG---TLNYDPSSYALNFDDGATREDGNFYGYG-----GF  131

Query  503  SSRYAVPAVGQQ  538
            S+RYA   V ++
Sbjct  132  SARYAAVPVTEK  143



>gb|KEH24880.1| NHL domain protein [Medicago truncatula]
Length=156

 Score = 65.5 bits (158),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 51/138 (37%), Positives = 65/138 (47%), Gaps = 17/138 (12%)
 Frame = +2

Query  164  EEEAGSPTGCGCFRLLSFRSGEGNT----RALIGG---ESAAVWWRGKAKKVRELSEVVA  322
            +E A    GC CF +  F S   +     R  I          WW     KVRELSE+VA
Sbjct  20   QETAFRKRGCICFPIPCFSSETSSPSWWERIQIQSPEKNHHHQWWFRGWMKVRELSEIVA  79

Query  323  GPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGL-FRN  499
            GP+WK  +R+ G+  N  +K G      YD  SYALNFD+G      A  E GN   +  
Sbjct  80   GPKWKTFIRRFGKNRNSYVKQG---TLNYDPSSYALNFDDG------ATREDGNFYGYGG  130

Query  500  FSSRYAVPAVGQQMKAGL  553
            FS+RYA   V ++    L
Sbjct  131  FSARYAAVPVTEKSSMDL  148



>gb|KDP31127.1| hypothetical protein JCGZ_11503 [Jatropha curcas]
Length=159

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +2

Query  290  KKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaae  469
            KK+RE SE+VAGPRWK  +R+  R  +   + G   +F YD  SYALNFD G       +
Sbjct  64   KKIREWSEIVAGPRWKTFIRRFNRRGSGNSRHG---KFQYDPLSYALNFDEGPGQNGNLD  120

Query  470  eeQGNGLFRNFSSRYA  517
            E+   G FR+FSSRYA
Sbjct  121  EDDDYGGFRDFSSRYA  136



>ref|XP_012080100.1| PREDICTED: uncharacterized protein LOC105640410 [Jatropha curcas]
Length=166

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 47/76 (62%), Gaps = 3/76 (4%)
 Frame = +2

Query  290  KKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaae  469
            KK+RE SE+VAGPRWK  +R+  R  +   + G   +F YD  SYALNFD G       +
Sbjct  71   KKIREWSEIVAGPRWKTFIRRFNRRGSGNSRHG---KFQYDPLSYALNFDEGPGQNGNLD  127

Query  470  eeQGNGLFRNFSSRYA  517
            E+   G FR+FSSRYA
Sbjct  128  EDDDYGGFRDFSSRYA  143



>ref|XP_002308687.1| hypothetical protein POPTR_0006s27550g [Populus trichocarpa]
 gb|EEE92210.1| hypothetical protein POPTR_0006s27550g [Populus trichocarpa]
Length=152

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 56/101 (55%), Gaps = 18/101 (18%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTa  451
            W   K K+V+E+SE++AGP+WKN +R   R+ N   K   + Q  YD QSYALNFD G  
Sbjct  63   WLVEKVKRVKEISEILAGPKWKNFIR---RFSNNNKKRS-RMQCQYDPQSYALNFDEG--  116

Query  452  aaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL*RGQICH  574
                    + +  + +FS+RYA P V       + +G++ H
Sbjct  117  -----FGREVDSEYPDFSARYAAPVV-------ISKGELAH  145



>ref|XP_002517365.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44907.1| conserved hypothetical protein [Ricinus communis]
Length=168

 Score = 65.1 bits (157),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 53/94 (56%), Gaps = 19/94 (20%)
 Frame = +2

Query  263  AAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGY-KAQFIYDAQSYALNFD  439
            A  WW    K++RE SE+VAGP+WK L+RK+ +    + + GY  A+F YD  SYALNFD
Sbjct  69   ADAWWVRGWKRMREWSEIVAGPKWKTLIRKISKR---RKQNGYGNAKFRYDPLSYALNFD  125

Query  440  NGTaaaaaaeeeQGNGLF------RNFSSRYAVP  523
             G            NG F      R FSSRY++P
Sbjct  126  EGPGQ---------NGHFDEDLVGRGFSSRYSLP  150



>ref|XP_007216842.1| hypothetical protein PRUPE_ppa022058mg, partial [Prunus persica]
 gb|EMJ18041.1| hypothetical protein PRUPE_ppa022058mg, partial [Prunus persica]
Length=135

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/130 (34%), Positives = 63/130 (48%), Gaps = 14/130 (11%)
 Frame = +2

Query  164  EEEAGSPTGCGCFRLLSFRSGEGNT-----RALIGGESAAVWWRGKAKKVRELSEVVAGP  328
            E  + + +GC C  +  F S + +      R    G+    WW    KK+RE SEVVAGP
Sbjct  1    ELMSANTSGC-CLWMPCFGSEQSSIDRSWERIRNSGDHGDPWWNRGWKKIREWSEVVAGP  59

Query  329  RWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSS  508
            +WK  +R+     N        ++F YD  SY+LNFD G      +     + L R+FS 
Sbjct  60   KWKTFIRRF----NKSTANKRSSKFHYDPMSYSLNFDEGP---GQSGNLDDDYLHRDFSC  112

Query  509  RYA-VPAVGQ  535
            RYA +PA  +
Sbjct  113  RYASIPASAK  122



>ref|XP_009410283.1| PREDICTED: uncharacterized protein LOC103992351 [Musa acuminata 
subsp. malaccensis]
Length=145

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 60/133 (45%), Gaps = 10/133 (8%)
 Frame = +2

Query  137  MIANSPIVDEEEAGSP--TGCGCFRLLSFRSGEGNTRALIGGESAAVWWRGKA-----KK  295
            + AN    D+  AGS     C CF   S            GG+    WW G        K
Sbjct  3    VDANIDPFDDPSAGSDRRQYCCCFPFSSPWERIQAPAPAEGGDERRRWWSGAGLRALMMK  62

Query  296  VRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeee  475
             RE SE+VAGPRWK  LR+ GR  N     G  A+F YD  SYALNFD G    +     
Sbjct  63   GREWSELVAGPRWKTFLRRFGRNPNRGRAAGGLARFQYDPLSYALNFDEGQGGDSPEG--  120

Query  476  QGNGLFRNFSSRY  514
             G    R+FS+R+
Sbjct  121  -GYDDHRDFSARF  132



>gb|EYU34707.1| hypothetical protein MIMGU_mgv1a021008mg [Erythranthe guttata]
Length=164

 Score = 64.7 bits (156),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 51/86 (59%), Gaps = 8/86 (9%)
 Frame = +2

Query  290  KKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaae  469
            KKVRE SE+VAGP+WK  +R+  +      +G    +F YD  SYALNFD+G        
Sbjct  77   KKVREWSEIVAGPKWKTFIRRFNKTAARPKQG----KFQYDPMSYALNFDDGP---GQNG  129

Query  470  eeQGNGLFRNFSSRY-AVPAVGQQMK  544
            + + + +FR FSSRY A+P    Q+K
Sbjct  130  QIEDDRIFRAFSSRYAAIPVQNGQLK  155



>ref|XP_010483999.1| PREDICTED: uncharacterized protein LOC104762419 [Camelina sativa]
Length=165

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/114 (37%), Positives = 59/114 (52%), Gaps = 10/114 (9%)
 Frame = +2

Query  215  FRSGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYK  394
             R+ + NT    GG+    WW   + K+RELSE+ AGPRWK  +R+  R  +P+    + 
Sbjct  40   IRTVDDNTHTHSGGDEPR-WWIRASLKIRELSEIAAGPRWKTFIRRFNR--DPRRGRDWD  96

Query  395  A--QFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYA-VPAVGQQMKA  547
            A  +F YD  SY+LNFD             G G  R+FS+R+A VP    +  A
Sbjct  97   ASEKFQYDPLSYSLNFDGDDDEDEYV----GLGGMRSFSTRFASVPVYSGKAPA  146



>ref|XP_002452564.1| hypothetical protein SORBIDRAFT_04g028190 [Sorghum bicolor]
 gb|EES05540.1| hypothetical protein SORBIDRAFT_04g028190 [Sorghum bicolor]
Length=164

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 59/128 (46%), Gaps = 16/128 (13%)
 Frame = +2

Query  191  CGCFRLLSFRSGEGNTRALIGGESAAVWWRGKAK---KVRELSEVVAGPRWKNLLRKMGR  361
            C CF   +  S    +   +GG     WW+       KVRE SE+VAGPRWK  +R+ GR
Sbjct  23   CCCFPWPASSS----SHQRVGGAEEETWWQRAVDAVLKVREWSELVAGPRWKTFIRRFGR  78

Query  362  Y---CNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGL-FRNFSSRYAVPAV  529
                  P    G   +  YDA SYALNFD G          +G+   +R+FS+R+  P  
Sbjct  79   SGPPTRPHHHFGGGRKLNYDALSYALNFDEG-----HGASPEGDYTGYRDFSARFVAPPA  133

Query  530  GQQMKAGL  553
              +    L
Sbjct  134  SAKSSMDL  141



>ref|XP_007155116.1| hypothetical protein PHAVU_003G174800g [Phaseolus vulgaris]
 gb|ESW27110.1| hypothetical protein PHAVU_003G174800g [Phaseolus vulgaris]
Length=143

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/130 (33%), Positives = 66/130 (51%), Gaps = 15/130 (12%)
 Frame = +2

Query  164  EEEAGSPTGCGCFRLLSF----RSGEGNTRALIGGE--SAAVWWRGKAKKVRELSEVVAG  325
            +E + S  GCGCFR        R  +   + L+  +      W   K +K +E SEV+AG
Sbjct  20   DEGSNSGCGCGCFRGFDLKKWWRESDEEDKGLLDEQRGERESWVVEKLRKAKEASEVIAG  79

Query  326  PRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFS  505
            P+WK  +RK+  Y   K+K   + +F YD QSY LNF++G        + +   +  +FS
Sbjct  80   PKWKTFIRKISGY-GKKMK-QQRNRFQYDEQSYNLNFNSGA-------QSEDEAMPYSFS  130

Query  506  SRYAVPAVGQ  535
            +R+A P   Q
Sbjct  131  ARFAAPGRRQ  140



>ref|XP_009761508.1| PREDICTED: uncharacterized protein LOC104213675 [Nicotiana sylvestris]
Length=153

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 61/127 (48%), Gaps = 15/127 (12%)
 Frame = +2

Query  188  GCGCFRLLSFRSGEGNTRALIGGES--AAVWWR---GKAKKVRELSEVVAGPRWKNLLRK  352
            GC CF L S R G      +   +      WW       KKVRE SE+VAGP+WK  +R+
Sbjct  29   GC-CFWLPSLRCGRSVWERISTSDQKEEPRWWDKGVNAVKKVREWSELVAGPKWKTFIRR  87

Query  353  MGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVG  532
              +            +F YD  SY+LNFD+G       ++ + + LFR+FSSR+A   V 
Sbjct  88   FNK------NRSKTNKFNYDPLSYSLNFDDGP---GVNDQSEDDRLFRDFSSRFASIPVS  138

Query  533  QQMKAGL  553
             +    L
Sbjct  139  AKSSMDL  145



>ref|XP_009599991.1| PREDICTED: uncharacterized protein LOC104095547 [Nicotiana tomentosiformis]
Length=153

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 61/127 (48%), Gaps = 15/127 (12%)
 Frame = +2

Query  188  GCGCFRLLSFRSGEGNTRALIGGES--AAVWWR---GKAKKVRELSEVVAGPRWKNLLRK  352
            GC CF L S R G      +   +      WW       KKVRE SE+VAGP+WK  +R+
Sbjct  29   GC-CFWLPSLRCGRSVWERISTNDQKEEPRWWDKGINAVKKVREWSELVAGPKWKTFIRR  87

Query  353  MGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVG  532
              +            +F YD  SY+LNFD+G       ++ + + LFR+FSSR+A   V 
Sbjct  88   FNK------NRSKTNKFNYDPLSYSLNFDDGP---GVNDQSEDDRLFRDFSSRFASIPVS  138

Query  533  QQMKAGL  553
             +    L
Sbjct  139  AKSSMDL  145



>gb|KFK28014.1| hypothetical protein AALP_AA8G460300 [Arabis alpina]
Length=165

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 67/151 (44%), Gaps = 20/151 (13%)
 Frame = +2

Query  137  MIANSPIVDEEEAGSPTGCGCFRLLSFRSGE-------GNTRALIGGESAAV----WWRG  283
            ++ + P  D E    P  C CF     RS         G  R +            WW  
Sbjct  3    VVQSDPNPDPETRYDPRCCSCFPSFRSRSSTAVGFSSWGRIRTVDDDNHHNDDESRWWIR  62

Query  284  KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKA--QFIYDAQSYALNFDNGTaaa  457
             A K+RE SE+VAGPRWK  +R+  R  +P+    + A  +F YD  SY+LNFD+     
Sbjct  63   AAFKIREWSEIVAGPRWKTFIRRFNR--DPRRGRDWDASEKFQYDPLSYSLNFDDDDEED  120

Query  458  aaaeeeQGNGLFRNFSSRYA-VPAVGQQMKA  547
                   G G  R+FS+RYA VP    +  A
Sbjct  121  EYV----GVGGLRSFSTRYASVPISTSKAPA  147



>ref|XP_011459812.1| PREDICTED: uncharacterized protein LOC105350107 [Fragaria vesca 
subsp. vesca]
Length=149

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 45/103 (44%), Positives = 54/103 (52%), Gaps = 14/103 (14%)
 Frame = +2

Query  167  EEAGSPTGCGCFRLLSFRS---GEGNT----RALIG-GESA-AVWWRGKAKKVRELSEVV  319
            EE    + CGCF  L  R    G  N     R L+  GE A   W     KKVRELSEV+
Sbjct  18   EELVQTSSCGCFWGLYSRVVPCGRNNNGIRGRYLLQQGEVARESWLVQNVKKVRELSEVL  77

Query  320  AGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGT  448
            AGP+WKN +R +G     +     + Q  YD QSYALNFD+G 
Sbjct  78   AGPKWKNFIRSIGSIYKKR-----RVQAQYDPQSYALNFDDGV  115



>gb|ABI34274.1| IS10 transposase, putative [Solanum lycopersicum]
Length=648

 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 54/153 (35%), Positives = 75/153 (49%), Gaps = 22/153 (14%)
 Frame = +2

Query  107  MSGNQESQAFMIANSPIVDEEEAGSPTGCGCFRLLSFRSGEGNTRALI----------GG  256
            M+G++   A+    +P +D  E        CF   SFRS    T+ +             
Sbjct  1    MAGSEFPHAY--PQTPSIDTSETLFQRRSRCFCFPSFRSPNQLTKYVKFDWWHRLRSGAV  58

Query  257  ESAAVWWRG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYAL  430
            +  +VW +G    KK+RE SE+VAGPRWK  +R+  R       G   A+F YD  SY+L
Sbjct  59   KEGSVWAKGINALKKLREWSEIVAGPRWKTFIRRFHR----NKSGNRNAKFQYDPLSYSL  114

Query  431  NFDNGTaaaaaaeeeQGNGLFRNFSSRYA-VPA  526
            NFD G        EE+   + RNFS+RYA +PA
Sbjct  115  NFDEGR---GNNGEEEEELVLRNFSTRYASIPA  144



>ref|XP_010244781.1| PREDICTED: uncharacterized protein LOC104588516 [Nelumbo nucifera]
Length=151

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 56/101 (55%), Gaps = 12/101 (12%)
 Frame = +2

Query  158  VDEEEAGSPTGCGCFRLLSF--RSGEGNTRALIG----GESAAVWWRGKAKKVRELSEVV  319
            V++ E     GC CFRL     RS +  +  L+     GE+   WW    K V+E++E++
Sbjct  23   VEDYEYFGSGGCACFRLCFRWRRSNKAESSYLLQRQQQGENTESWWMKTVKAVKEMTELL  82

Query  320  AGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDN  442
            AGP+WKN +R   R+   + +   +  F YD+ SYALNF+N
Sbjct  83   AGPKWKNFIR---RFSGHRKR---RTMFQYDSYSYALNFEN  117



>gb|KCW56070.1| hypothetical protein EUGRSUZ_I01828 [Eucalyptus grandis]
Length=173

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 52/100 (52%), Gaps = 19/100 (19%)
 Frame = +2

Query  248  IGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYA  427
            +G      WW     +VRE SE+VAGPRWK  +R+       K + G  +QF YD  SYA
Sbjct  69   VGDMPDDPWWARGWHRVREWSELVAGPRWKTFIRRFN-----KDRFGRNSQFRYDPLSYA  123

Query  428  LNFDNGTaaaaaaeeeQGNGLF------RNFSSRYA-VPA  526
            LNFD G         + G  LF      R+FSSRYA +PA
Sbjct  124  LNFDEGP-------GQNGRPLFGEDVVRRDFSSRYASIPA  156



>ref|XP_010313841.1| PREDICTED: uncharacterized protein LOC104644843 [Solanum lycopersicum]
Length=134

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 62/132 (47%), Gaps = 35/132 (27%)
 Frame = +2

Query  185  TGCGCFRLLSFRSGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGPR----W----KN  340
            TGCG    L+F              S   W +G     R L +    P     W    KN
Sbjct  29   TGCGLCSCLNF--------------SCFNWGKGHEVHSRSLLQDHEKPEHRESWLVILKN  74

Query  341  LLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAV  520
            LLRKM    N K     + QF YDAQSYALNFD+G         E+ +GLF NFSSR+AV
Sbjct  75   LLRKMNS--NSK---KSRPQFQYDAQSYALNFDDGA-------REEEDGLFSNFSSRFAV  122

Query  521  PAVGQ-QMKAGL  553
            P + Q Q K GL
Sbjct  123  PVIAQKQSKIGL  134



>ref|XP_007036163.1| Serine/arginine repetitive matrix protein 2, putative [Theobroma 
cacao]
 gb|EOY20664.1| Serine/arginine repetitive matrix protein 2, putative [Theobroma 
cacao]
Length=174

 Score = 63.9 bits (154),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 62/137 (45%), Gaps = 15/137 (11%)
 Frame = +2

Query  152  PIVDEEEAGS----PTGCGCFRLLSFRSGEG-------NTRALIGGESAAVWWRG--KAK  292
            PI +E  + S       C CF   S R             R      S ++W R     +
Sbjct  10   PIFEETTSNSLLRNTRCCFCFPCFSSRRTPTVGLAFWERIRTAQVQSSTSLWARSVRAFR  69

Query  293  KVRELSEVVAGPRWKNLLRKMGRYC--NPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaa  466
            KVRE SE+VAGPRWK  +R+  R    +  +  G   QF YD  SYALNFD G       
Sbjct  70   KVREWSEIVAGPRWKTFIRRFNRSKSGSGSVGDGRHGQFHYDPLSYALNFDEGPGQNGNF  129

Query  467  eeeQGNGLFRNFSSRYA  517
             ++   G FR FS+RYA
Sbjct  130  VDDIDYGGFRAFSTRYA  146



>emb|CAC01808.1| putative protein [Arabidopsis thaliana]
Length=733

 Score = 67.0 bits (162),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 36/100 (36%), Positives = 53/100 (53%), Gaps = 10/100 (10%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRY--CNPKLKGGYK----AQFIYDAQSYALN  433
            WW     K+RE SE+VAGP+WK  +R+ GR   CN  + GG        F YD+ SY+LN
Sbjct  625  WWVSGWMKMREWSEIVAGPKWKTFIRRFGRNHCCNGGIDGGCNRPEHVSFRYDSWSYSLN  684

Query  434  FDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
            FD+G          +    +R++S R+A P++    K  +
Sbjct  685  FDDG----KQTGHFEDEFPYRDYSMRFAAPSLPVSTKCSI  720



>ref|XP_009355890.1| PREDICTED: uncharacterized protein LOC103946821 [Pyrus x bretschneideri]
Length=149

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 51/99 (52%), Gaps = 10/99 (10%)
 Frame = +2

Query  164  EEEAGSPTGCGCFRLLSFRSGEGNTRALI----GGESAAVWWRGKAKKVRELSEVVAGPR  331
            +EE      CGC  +L  R   G  R L+    G ++   W   K KK RE+SEV+AGP+
Sbjct  26   DEEIDPSFSCGCSWVLCGRRI-GARRYLLQQQQGEQAKEGWLVEKVKKAREISEVLAGPK  84

Query  332  WKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGT  448
            WKN  R        +     + QF YD QSYALNFD+G 
Sbjct  85   WKNFTRSFSTIYKKR-----RVQFQYDPQSYALNFDDGN  118



>gb|KCW81345.1| hypothetical protein EUGRSUZ_C02728 [Eucalyptus grandis]
Length=111

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 55/102 (54%), Gaps = 11/102 (11%)
 Frame = +2

Query  161  DEEEAGSPTGCGCFRLLSF----RSGEGNTRALIGG--ESAAVWWRGKAKKVRELSEVVA  322
            D ++A   + C CF  L F    +  E   R L     E+   W+    KKV+ +SEV+A
Sbjct  3    DFDDANVASSCRCFDKLCFGWRGKRDESVDRLLAHQPEEARETWFVQNLKKVQHVSEVLA  62

Query  323  GPRWKNLLRKMGRYCNPKLKGGYKA-QFIYDAQSYALNFDNG  445
            GP+WKN +R+ G    P+  G  +  QF YD +SYALNFD+ 
Sbjct  63   GPKWKNFIRRSG----PRGVGKKRRNQFHYDQRSYALNFDDA  100



>ref|XP_003609515.1| hypothetical protein MTR_4g116530 [Medicago truncatula]
 gb|AES91712.1| stress induced protein [Medicago truncatula]
Length=149

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 65/128 (51%), Gaps = 18/128 (14%)
 Frame = +2

Query  164  EEEAGSPTGCGCFRLLS---FRSGEGNTRALIGGESA-----AVWWRGKAKKVRELSEVV  319
            EE  G   GCG  R+ +   ++  +   + L+  +S        W   K KK++E SEV+
Sbjct  22   EETNGYGCGCGWSRIFTSKWWQRHDEEGKHLLNEKSEGNRGEETWMMDKLKKMKETSEVI  81

Query  320  AGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRN  499
            AGP+WK  LRK+  Y     K   K +F YDA SYALNF++G  +           L  +
Sbjct  82   AGPKWKTFLRKISGYG----KKQQKHRFQYDAHSYALNFNSGAQSEDEEY------LPPS  131

Query  500  FSSRYAVP  523
            FS+R++ P
Sbjct  132  FSTRFSNP  139



>ref|NP_196993.2| NHL domain-containing protein [Arabidopsis thaliana]
 gb|AED92086.1| NHL domain-containing protein [Arabidopsis thaliana]
Length=754

 Score = 66.6 bits (161),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 36/100 (36%), Positives = 53/100 (53%), Gaps = 10/100 (10%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRY--CNPKLKGGYK----AQFIYDAQSYALN  433
            WW     K+RE SE+VAGP+WK  +R+ GR   CN  + GG        F YD+ SY+LN
Sbjct  646  WWVSGWMKMREWSEIVAGPKWKTFIRRFGRNHCCNGGIDGGCNRPEHVSFRYDSWSYSLN  705

Query  434  FDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
            FD+G          +    +R++S R+A P++    K  +
Sbjct  706  FDDG----KQTGHFEDEFPYRDYSMRFAAPSLPVSTKCSI  741



>ref|XP_009111660.1| PREDICTED: uncharacterized protein LOC103837083 [Brassica rapa]
Length=123

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 48/88 (55%), Gaps = 6/88 (7%)
 Frame = +2

Query  191  CGCFRLLSF---RSGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGR  361
            CGC  L +F   R G+G     +  E    WW  K K  +E+SE +AGP+WKN +R    
Sbjct  20   CGCRYLCNFWWRRRGDGGWSGNLQEEKGESWWTRKLKGPKEISEKIAGPKWKNFIRS---  76

Query  362  YCNPKLKGGYKAQFIYDAQSYALNFDNG  445
            + N + K      F YD ++Y+LNFD+G
Sbjct  77   FSNGRKKMKRDVDFTYDLKNYSLNFDDG  104



>ref|XP_010111749.1| hypothetical protein L484_008408 [Morus notabilis]
 gb|EXC31611.1| hypothetical protein L484_008408 [Morus notabilis]
Length=166

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/152 (36%), Positives = 75/152 (49%), Gaps = 21/152 (14%)
 Frame = +2

Query  104  NMSGNQESQAFMIANSPIVDEEEAGSPTGCGCFRLLSFRSGEGNT--RALIGGESAAVWW  277
            NM+ N + Q  M+A        + G      CF         G+   + +   E+   WW
Sbjct  17   NMNLNDDVQEMMLA--------KRGCCLWIPCFGRPDRSPAAGSIWWQRMRPAENDDPWW  68

Query  278  RGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKG-GYK--AQFIYDAQSYALNFDNGT  448
                KKVRE SE+VAGP+WK  +R+  R      +G GYK   +F YD  SY+LNFD G 
Sbjct  69   SRGWKKVREWSEIVAGPKWKTFIRRFNR----NHRGFGYKEGGKFRYDELSYSLNFDEGP  124

Query  449  aaaaaaeeeQGNGLFRNFSSRYA-VPAVGQQM  541
              + A +    N + R+FSSRYA VPA  + +
Sbjct  125  GQSGADDV---NFVRRDFSSRYASVPASAKPL  153



>ref|XP_011660353.1| PREDICTED: uncharacterized protein LOC105436380 [Cucumis sativus]
 gb|KGN64297.1| hypothetical protein Csa_1G045950 [Cucumis sativus]
Length=166

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 50/88 (57%), Gaps = 8/88 (9%)
 Frame = +2

Query  272  WWRG---KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDN  442
            WW G     KK+RE SE+VAGPRWK  +R+  R     +K G   +F YD  SYALNFD 
Sbjct  66   WWTGGIRSLKKLREWSEIVAGPRWKTFIRRFNRNRPATVKLG---KFQYDPISYALNFDE  122

Query  443  GTaaaaaaeeeQGN--GLFRNFSSRYAV  520
            G       + ++ N  G F+NFS R+A 
Sbjct  123  GHNGDVDFDGDEYNTGGGFQNFSDRFAA  150



>ref|XP_011028593.1| PREDICTED: uncharacterized protein LOC105128567 [Populus euphratica]
Length=190

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 42/95 (44%), Positives = 56/95 (59%), Gaps = 5/95 (5%)
 Frame = +2

Query  272  WWRG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYK-AQFIYDAQSYALNFDN  442
            W++G    KK+RE SE+VAGP+WK  +R++ R  +     G +   F YD  SY+LNFD 
Sbjct  82   WFKGIRALKKIREWSEIVAGPKWKTFIRRLNRNKSSGSGNGRRHGNFQYDPLSYSLNFDE  141

Query  443  GTaaaaaaeeeQGN-GLFRNFSSRYA-VPAVGQQM  541
            G        +E  + G FR+FSSRYA V A GQ M
Sbjct  142  GPGGQKGNFDEMDDYGGFRDFSSRYASVSASGQPM  176



>ref|XP_008806318.1| PREDICTED: uncharacterized protein LOC103719038 [Phoenix dactylifera]
Length=170

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/99 (39%), Positives = 52/99 (53%), Gaps = 10/99 (10%)
 Frame = +2

Query  272  WWRGKAK---KVRELSEVVAGPRWKNLLRKMGRYCNPKLKGG--YKAQFIYDAQSYALNF  436
            WW    K   KV+E SE++AGPRWK  +R++GRY      GG   +++F YD  SYALNF
Sbjct  61   WWTTGWKALTKVKEWSEILAGPRWKTFIRRVGRYARRGGSGGGMPRSRFGYDPLSYALNF  120

Query  437  DNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
            D+G        E   + + R FS RY  P    +    L
Sbjct  121  DDGM-----DSETDEDVVHRGFSVRYVAPPSSTKSSMDL  154



>ref|XP_006368303.1| hypothetical protein POPTR_0001s01430g [Populus trichocarpa]
 gb|ERP64872.1| hypothetical protein POPTR_0001s01430g [Populus trichocarpa]
Length=159

 Score = 63.2 bits (152),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 51/90 (57%), Gaps = 9/90 (10%)
 Frame = +2

Query  260  SAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYK-AQFIYDAQSYALNF  436
            S   WW     ++R+ SE++AGPRWK  LR+     N K  GG +  +F YD  SYALNF
Sbjct  62   SPESWWFRGWMRIRDCSELLAGPRWKTFLRRF----NKKPGGGTQYGRFQYDPSSYALNF  117

Query  437  DNGTaaaaaaeeeQGNGLFRNFSSRYAVPA  526
            D G+        E  + + RNFSSRY++P 
Sbjct  118  DQGS----RRRPEDDDLMDRNFSSRYSLPP  143



>ref|XP_009358511.1| PREDICTED: uncharacterized protein LOC103949134 [Pyrus x bretschneideri]
Length=165

 Score = 63.2 bits (152),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 58/131 (44%), Gaps = 19/131 (15%)
 Frame = +2

Query  194  GCFRLL--SFRSGEGNTRALI------GGESAAVWWRGKAKKVRELSEVVAGPRWKNLLR  349
            GCFR    ++R  + N    +      G      WWR K  + +E +EV+ GP+WKN +R
Sbjct  26   GCFRFFGSAYRKYDDNVYEHLVRQEGRGRNKETTWWRKKLNEAKEYTEVLGGPKWKNFIR  85

Query  350  KMGRYC----NPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYA  517
             +G Y     N   +    A F YD  SYALNFD G          +G      F++R+A
Sbjct  86   NIGGYWERQKNRLCRKEKNAGFPYDIHSYALNFDEGV-------GREGADAVLGFTARFA  138

Query  518  VPAVGQQMKAG  550
             P   +    G
Sbjct  139  APFSNEHGSMG  149



>emb|CDY19811.1| BnaA09g04640D [Brassica napus]
Length=123

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 48/88 (55%), Gaps = 6/88 (7%)
 Frame = +2

Query  191  CGCFRLLSF---RSGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGR  361
            CGC  L +F   R G+G     +  E    WW  K K  +E+SE +AGP+WKN +R    
Sbjct  20   CGCRYLCNFWWRRRGDGGWSGNLQEEKGENWWTRKLKGPKEISEKIAGPKWKNFIRS---  76

Query  362  YCNPKLKGGYKAQFIYDAQSYALNFDNG  445
            + N + K      F YD ++Y+LNFD+G
Sbjct  77   FSNGRKKMKRDVDFTYDLKNYSLNFDDG  104



>emb|CDX87094.1| BnaC09g04090D [Brassica napus]
Length=123

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 48/88 (55%), Gaps = 6/88 (7%)
 Frame = +2

Query  191  CGCFRLLSF---RSGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGR  361
            CGC  L +F   R G+G     +  E    WW  K K  +E+SE +AGP+WKN +R    
Sbjct  20   CGCRYLCNFWWRRRGDGGWSGNLREEKGESWWSRKLKGPKEISEKIAGPKWKNFIRS---  76

Query  362  YCNPKLKGGYKAQFIYDAQSYALNFDNG  445
            + N + K      F YD ++Y+LNFD+G
Sbjct  77   FSNGRKKMKRDVDFTYDLKNYSLNFDDG  104



>ref|XP_003533880.1| PREDICTED: uncharacterized protein LOC100527701 [Glycine max]
 gb|KHN22757.1| hypothetical protein glysoja_049384 [Glycine soja]
Length=144

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 68/126 (54%), Gaps = 20/126 (16%)
 Frame = +2

Query  170  EAGSPTGCG--CFRLLSF----RSGEGNTRALI--GGESAAVWWRGKAKKVRELSEVVAG  325
            E   P+GCG  CFR   +    R G    + L+   G+S   +   K +K++E SEV+AG
Sbjct  21   EHQEPSGCGYGCFRGFGWSWCSRRGSEEGKGLVEQKGDSRLSY---KLRKIKEFSEVIAG  77

Query  326  PRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFS  505
            P+WK  +RK+  Y   + +   K +F YD  SYALNF++G        + + + +  +FS
Sbjct  78   PKWKTFIRKISGYGRKQQQ--QKNRFQYDEHSYALNFNSGA-------QSEDDDMPPSFS  128

Query  506  SRYAVP  523
            +R++ P
Sbjct  129  ARFSAP  134



>ref|XP_010928587.1| PREDICTED: uncharacterized protein LOC105050319 [Elaeis guineensis]
Length=171

 Score = 63.2 bits (152),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 51/92 (55%), Gaps = 15/92 (16%)
 Frame = +2

Query  272  WW---RGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGY----KAQFIYDAQSYAL  430
            WW   R    KVRE SE+VAGPRWK  +R+  R  NP+  GG      A+F YD  SY L
Sbjct  61   WWSRGRRAVMKVREWSELVAGPRWKTFIRRFNR--NPRHGGGVVRMGSARFQYDPLSYTL  118

Query  431  NFDNGTaaaaaaeeeQGNGL-FRNFSSRYAVP  523
            NFD G          +G+   +R+FS+R+A P
Sbjct  119  NFDEG-----HGGSPEGDYTGYRDFSTRFAAP  145



>ref|XP_004232286.1| PREDICTED: uncharacterized protein LOC101247878 [Solanum lycopersicum]
Length=149

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 44/127 (35%), Positives = 60/127 (47%), Gaps = 15/127 (12%)
 Frame = +2

Query  188  GCGCFRLLSFRSGEGN-TRALIGGESAAVWWRGK----AKKVRELSEVVAGPRWKNLLRK  352
            GC CF   SF  G G   R     +     W  K      KVRE SE+VAGP+WK  +R+
Sbjct  25   GC-CFWFPSFTCGRGVWERVSTSDQKEETHWWDKGLNVVMKVREWSELVAGPKWKTFIRR  83

Query  353  MGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVG  532
              +            +F YD  SY+LNFD+G       ++ + + LFR+FSSR+A   V 
Sbjct  84   FNK------NRSKTNKFNYDPMSYSLNFDDGP---GVNDQSEDDRLFRDFSSRFASIPVS  134

Query  533  QQMKAGL  553
             +    L
Sbjct  135  AKSSMDL  141



>gb|AFK47247.1| unknown [Medicago truncatula]
 gb|KEH35056.1| NHL domain protein [Medicago truncatula]
Length=143

 Score = 62.4 bits (150),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 48/83 (58%), Gaps = 11/83 (13%)
 Frame = +2

Query  293  KVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKA--QFIYDAQSYALNFDNGTaaaaaa  466
            K+RE SE+VAGPRWK  +R+  R       GG++   ++ YD  SYALNFD G       
Sbjct  51   KIREWSEIVAGPRWKTFIRRFNR----NKSGGFRHAGKYQYDPLSYALNFDEGQNGEFEN  106

Query  467  eeeQGNGLFRNFSSRY--AVPAV  529
            +   G   FRNFS+RY  AVP +
Sbjct  107  DSPDG---FRNFSARYVAAVPTL  126



>ref|XP_009623300.1| PREDICTED: uncharacterized protein LOC104114536 [Nicotiana tomentosiformis]
Length=151

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 54/93 (58%), Gaps = 11/93 (12%)
 Frame = +2

Query  257  ESAAVWWRG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYAL  430
            E  +VW +G     K+RE SE+ AGPRWK  +R+  R      K G + +F YD  SYAL
Sbjct  51   EEGSVWAKGINAVLKLREWSELAAGPRWKTFIRRFNRS-----KSGKQGKFQYDPLSYAL  105

Query  431  NFDNGTaaaaaaeeeQGNGLFRNFSSRYA-VPA  526
            NFD G +     E+E G    RNFS+RYA +PA
Sbjct  106  NFDEGHSGNNGEEDEYG---LRNFSTRYASIPA  135



>ref|XP_009796586.1| PREDICTED: uncharacterized protein LOC104243135 [Nicotiana sylvestris]
Length=151

 Score = 62.4 bits (150),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 54/93 (58%), Gaps = 11/93 (12%)
 Frame = +2

Query  257  ESAAVWWRG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYAL  430
            E  +VW +G     K+RE SE+ AGPRWK  +R+  R      K G + +F YD  SYAL
Sbjct  51   EEGSVWAKGINAVLKLREWSELAAGPRWKTFIRRFNRS-----KSGKQGKFQYDPLSYAL  105

Query  431  NFDNGTaaaaaaeeeQGNGLFRNFSSRYA-VPA  526
            NFD G +     E+E G    RNFS+RYA +PA
Sbjct  106  NFDEGHSGNNGEEDEYG---LRNFSTRYASIPA  135



>ref|XP_004236121.1| PREDICTED: uncharacterized protein LOC101250679 [Solanum lycopersicum]
Length=141

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 53/90 (59%), Gaps = 13/90 (14%)
 Frame = +2

Query  266  AVWWRG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFD  439
            +VW +G     K+RE SE+VAGPRWK  +R+  R      K G + +F YD  SYALNFD
Sbjct  46   SVWAKGINALMKLREWSEIVAGPRWKTFIRRFNRN-----KNGTQGKFHYDPLSYALNFD  100

Query  440  NGTaaaaaaeeeQGNGLFRNFSSRYA-VPA  526
             GT      E     GL R+FS+RYA +PA
Sbjct  101  EGTINGEEDEY----GL-RDFSTRYASIPA  125



>ref|XP_003546602.1| PREDICTED: uncharacterized protein LOC100815807 [Glycine max]
 gb|KHN24263.1| hypothetical protein glysoja_048496 [Glycine soja]
Length=140

 Score = 62.0 bits (149),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 41/122 (34%), Positives = 64/122 (52%), Gaps = 15/122 (12%)
 Frame = +2

Query  170  EAGSPTGCG--CFRL--LSFRSGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGPRWK  337
            E   P+GCG  CF+   LS+       + L+  +    W   K +K++E SEV+AGP+WK
Sbjct  21   EHQEPSGCGYGCFQGFGLSWCRSHEEGKGLVE-QKGNSWLSCKLRKIKEFSEVIAGPKWK  79

Query  338  NLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYA  517
              +RK+  Y     K   K +F YD  SYALNF++G        + + +    +FS+R++
Sbjct  80   TFIRKISGYGR---KQQQKNRFQYDEHSYALNFNSGD-------KSEDDDTPPSFSARFS  129

Query  518  VP  523
             P
Sbjct  130  AP  131



>ref|XP_002871635.1| NHL repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47894.1| NHL repeat-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=704

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 49/159 (31%), Positives = 73/159 (46%), Gaps = 22/159 (14%)
 Frame = +2

Query  128  QAFMIANSPIVDE--EEAGSPTGCGCFRLLSFRSGEGN----------TRALIGGESAAV  271
            Q+F I+     DE  E   +  GC CF L    S + +           R +   E    
Sbjct  538  QSFPISEMDATDEMHEAMFAKRGC-CFILPCLGSSQPSGPNGSVWWQRIRTVDKLEPDER  596

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGR-YCNPKLKGG----YKAQFIYDAQSYALNF  436
            WW     K+RE SE+VAGP+WK  +R+ GR +C   + GG        F YD+ SY+LNF
Sbjct  597  WWVSGWMKMREWSELVAGPKWKTFIRRFGRNHCCGGVDGGCNRPEHVSFRYDSWSYSLNF  656

Query  437  DNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
            D+G          +    +R++S R+A P++    K  +
Sbjct  657  DDG----KQTGHFEDEFPYRDYSMRFAAPSLPVSTKCSI  691



>ref|XP_008453108.1| PREDICTED: uncharacterized protein LOC103493921 [Cucumis melo]
Length=173

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/157 (35%), Positives = 75/157 (48%), Gaps = 39/157 (25%)
 Frame = +2

Query  149  SPIVDEEEAGS--PTG-CGCFRLLSFRSGEGNTRALIGG------------ESAAVWWRG  283
            SP  + +++ S  PT  CGCFRL  F    G+ R    G             S   WW  
Sbjct  11   SPCCEADKSNSLLPTARCGCFRLSCF----GSRRVATVGPSWWERIRASQVHSEGRWWAR  66

Query  284  KAK---KVRELSEVVAGPRWKNLLRKMGR----------YCNPKLKGGYKAQFIYDAQSY  424
              K   K+RE SE+VAGPRWK  +R+  R               ++ G   +F YD  SY
Sbjct  67   GVKVILKLREWSEIVAGPRWKTFIRRFNRNRSGGCGGGGGGGSGVRAG---KFQYDPLSY  123

Query  425  ALNFDNGTaaaaaaeeeQG--NGLFRNFSSRYA-VPA  526
            A+NFD G+      +++    NG +RNFS+RYA +PA
Sbjct  124  AMNFDEGSRQIGELDDDMDDFNG-YRNFSARYASIPA  159



>ref|XP_010678734.1| PREDICTED: uncharacterized protein LOC104894244 [Beta vulgaris 
subsp. vulgaris]
Length=199

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 47/85 (55%), Gaps = 8/85 (9%)
 Frame = +2

Query  272  WWRGKAK---KVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDN  442
            WW G  K   K+RE SE++AGP+WK  +R+  R       G    +F YD  SYALNFD+
Sbjct  99   WWAGPLKGLKKIREWSEIIAGPKWKTFIRRFNRGTG--KNGAASGKFQYDPLSYALNFDD  156

Query  443  GTaaaaaaeeeQGNGLFRNFSSRYA  517
            G          + +G F +FSSR+A
Sbjct  157  GP---GQNGNFEEDGYFPDFSSRFA  178



>ref|XP_004508851.1| PREDICTED: uncharacterized protein LOC101489558 [Cicer arietinum]
Length=151

 Score = 61.6 bits (148),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/89 (45%), Positives = 52/89 (58%), Gaps = 11/89 (12%)
 Frame = +2

Query  272  WW-RG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDN  442
            WW RG    KK+RE SE+VAGPRWK ++R+   + + K    Y+    YD  SYALNFD 
Sbjct  56   WWSRGIRALKKLREWSEIVAGPRWKTVIRRFNSHRSSKRNAKYQ----YDPLSYALNFDE  111

Query  443  GTaaaaaaeeeQGNGLFRNFSSRYAVPAV  529
            G       ++   +G FRNFS+RYA   V
Sbjct  112  GP---GQNDDGHDDG-FRNFSTRYAAVNV  136



>ref|XP_010913558.1| PREDICTED: uncharacterized protein LOC105039190 [Elaeis guineensis]
Length=179

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/99 (40%), Positives = 52/99 (53%), Gaps = 11/99 (11%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGY-----KAQFIYDAQSYALNF  436
            WW     KVRE SE+ AGPRWK  +R+  R  NP+  GG       ++F YD  SYALNF
Sbjct  66   WWWRAVMKVREWSELAAGPRWKTFIRRFNR--NPRHGGGSVVRMGSSRFQYDPLSYALNF  123

Query  437  DNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
            D G    +   +  G G   +FS+R+AVP    +    L
Sbjct  124  DEG-HGGSPDGDYTGYG---DFSTRFAVPPAPAKSSVDL  158



>ref|XP_006394771.1| hypothetical protein EUTSA_v10005131mg [Eutrema salsugineum]
 gb|ESQ32057.1| hypothetical protein EUTSA_v10005131mg [Eutrema salsugineum]
Length=125

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 52/99 (53%), Gaps = 7/99 (7%)
 Frame = +2

Query  161  DEEEAGSPTGCGCFRLLSF----RSGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGP  328
            D EE  +  GCG FR  S     R G+      +  E    W   K K+++E+SE +AGP
Sbjct  13   DYEETTAFCGCGYFRKFSVIRWRRGGDSVWSGNLQEERGENWGSRKLKELKEISEKIAGP  72

Query  329  RWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNG  445
            +WKN +R    + N K K      F YD ++Y+LNFD+G
Sbjct  73   KWKNFIRS---FSNGKKKMKRDVDFNYDLKNYSLNFDDG  108



>ref|XP_010444141.1| PREDICTED: uncharacterized protein LOC104726886 [Camelina sativa]
Length=169

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 56/107 (52%), Gaps = 10/107 (9%)
 Frame = +2

Query  215  FRSGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYK  394
             R+ + NT +  GG+    WW   + K+RE SE+ AGPRWK  +R+  R  +P+    + 
Sbjct  43   IRTVDDNTHSHSGGDEPR-WWIRASLKIREWSEIAAGPRWKTFIRRFNR--DPRRGRDWD  99

Query  395  AQ--FIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYA-VPA  526
            A   F YD  SY+LNFD             G G  R+FS+R+A VP 
Sbjct  100  ASETFQYDPLSYSLNFDGDDDEDEYV----GLGGMRSFSTRFASVPV  142



>ref|XP_003608943.1| hypothetical protein MTR_4g106650 [Medicago truncatula]
 gb|AES91140.1| hypothetical protein MTR_4g106650 [Medicago truncatula]
 gb|AFK45595.1| unknown [Medicago truncatula]
 gb|AFK49083.1| unknown [Medicago truncatula]
Length=149

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 44/89 (49%), Positives = 53/89 (60%), Gaps = 14/89 (16%)
 Frame = +2

Query  260  SAAVWW-RG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYAL  430
            +A  WW RG    KK+R  SE+VAGPRWKN +RK   + N + K   K Q  YD  SYAL
Sbjct  53   TADRWWSRGLKALKKLRNWSEIVAGPRWKNFIRK---FNNHRSKRMTKCQ--YDPLSYAL  107

Query  431  NFDNGTaaaaaaeeeQGNGLFRNFSSRYA  517
            NFD G       E+   +G FRNFS+RYA
Sbjct  108  NFDEG-----QNEDSHDDG-FRNFSTRYA  130



>ref|XP_007138446.1| hypothetical protein PHAVU_009G209600g [Phaseolus vulgaris]
 gb|ESW10440.1| hypothetical protein PHAVU_009G209600g [Phaseolus vulgaris]
Length=140

 Score = 60.8 bits (146),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 16/118 (14%)
 Frame = +2

Query  182  PTGC--GCFRL--LSFRSGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLR  349
            PTGC  GCFR   LS+  G       +  +    W   K + ++E +EV+AGP+WK  +R
Sbjct  25   PTGCRYGCFRGFGLSWCGGREQVNGSVE-QRGDSWVICKLRNMKEFTEVIAGPKWKTFIR  83

Query  350  KMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVP  523
            K+  Y   + K     +F YD  SYALNF++G        + + + +  +FS+R++VP
Sbjct  84   KISGYGRKQQKN----RFQYDEHSYALNFNSGA-------QSEDDDMPPSFSARFSVP  130



>emb|CDP02136.1| unnamed protein product [Coffea canephora]
Length=185

 Score = 61.6 bits (148),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 64/123 (52%), Gaps = 18/123 (15%)
 Frame = +2

Query  188  GCGCFRLLSFRSGEGNT-----RALIGGESAAVW---WRGKA----KKVRELSEVVAGPR  331
            GC CF L  F SG+ +T      A    E  + W   W  K+    KK+R  SE+VAGP+
Sbjct  37   GC-CFWLPCFGSGQSDTVWERISATPEKEETSRWRWDWWDKSLNALKKIRGWSELVAGPK  95

Query  332  WKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSR  511
            WK  +R+  +     LKGG   +F YD  SYALNFD G   +        +  FR+FSSR
Sbjct  96   WKTFIRRFNK--TRGLKGG--GKFQYDPVSYALNFDEGP-GSNGPLFGDDDRFFRDFSSR  150

Query  512  YAV  520
            +A+
Sbjct  151  FAL  153



>ref|XP_010550111.1| PREDICTED: uncharacterized protein LOC104821066 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010550112.1| PREDICTED: uncharacterized protein LOC104821066 isoform X2 [Tarenaya 
hassleriana]
Length=174

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 50/151 (33%), Positives = 75/151 (50%), Gaps = 20/151 (13%)
 Frame = +2

Query  119  QESQAFMIANSPIVDEEEAGSPTGCGCFRLL-----SFRSGEGNT-----RALIGGESAA  268
            ++ QAF IA +   D+      T  GC  +L     S  S  G+      R     E+  
Sbjct  2    RQPQAFPIAENDAADDMHEAMLTKRGCCFILPCLGSSQPSDAGSVWWQRIRTADKREADE  61

Query  269  VWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQ-----FIYDAQSYALN  433
             WW    +K+RE SE+VAGP+WK  +R++GR+      GG  A+     + YD  SY+LN
Sbjct  62   RWWIRGWRKLREWSELVAGPKWKTFIRRLGRH-RSCCGGGISARPDHGTYRYDPLSYSLN  120

Query  434  FDNGTaaaaaaeeeQGNGL-FRNFSSRYAVP  523
            FD+G A          +G+ +R+FS+R+  P
Sbjct  121  FDDGGAGPNGHF---DDGVPYRDFSARFTGP  148



>ref|XP_006281223.1| hypothetical protein CARUB_v10027263mg [Capsella rubella]
 gb|EOA14121.1| hypothetical protein CARUB_v10027263mg [Capsella rubella]
Length=165

 Score = 61.2 bits (147),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 52/95 (55%), Gaps = 10/95 (11%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKA--QFIYDAQSYALNFDNG  445
            WW   + KVRE SE+VAGPRWK  +R+  R  +P+    + A  +F YD  SY+LNFD+ 
Sbjct  60   WWIRASLKVREWSEIVAGPRWKTFIRRFNR--DPRRGRDWDAGEKFQYDPLSYSLNFDDD  117

Query  446  TaaaaaaeeeQGNGLFRNFSSRYA-VPAVGQQMKA  547
                       G G  R+FS+R+A VP    +  A
Sbjct  118  DEDEYV-----GLGGLRSFSTRFASVPVYSGKAPA  147



>ref|NP_197906.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAC42146.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50684.1| unknown protein [Arabidopsis thaliana]
 gb|AED93416.1| uncharacterized protein AT5G25240 [Arabidopsis thaliana]
Length=131

 Score = 60.5 bits (145),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 55/104 (53%), Gaps = 12/104 (12%)
 Frame = +2

Query  161  DEEEAGSPTGCGCFRLLSF---RSGEGNTRA------LIGGESAAVWWRGKAKKVRELSE  313
            D EE  +  GCG FR  SF   R G+  +R+       +  E    W   K K ++E+SE
Sbjct  12   DYEETAAFCGCGYFRSFSFTRWRRGDDESRSRGGWSGCLQEERRGNWGSEKLKGLKEISE  71

Query  314  VVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNG  445
             +AGP+WKN +R    + + + K      F YD ++Y+LNFD+G
Sbjct  72   KIAGPKWKNFIRS---FSSGRKKMRRDVDFTYDLKNYSLNFDDG  112



>gb|ABK95323.1| unknown [Populus trichocarpa]
Length=172

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 55/95 (58%), Gaps = 5/95 (5%)
 Frame = +2

Query  272  WWRG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYK-AQFIYDAQSYALNFDN  442
            W++G    KK+RE SE+VAGP+WK  +R+  R  +     G +   F YD  SY+LNFD 
Sbjct  64   WFKGIRALKKIREWSEIVAGPKWKTFIRRFNRTKSSGSGSGRRHGNFQYDPLSYSLNFDE  123

Query  443  GTaaaaaaeeeQGN-GLFRNFSSRYA-VPAVGQQM  541
            G        +E  + G FR+FSSRYA V A GQ +
Sbjct  124  GPGGQKGDFDELDDYGGFRDFSSRYASVSASGQPV  158



>ref|XP_006387805.1| hypothetical protein POPTR_0559s00200g, partial [Populus trichocarpa]
 gb|ERP46719.1| hypothetical protein POPTR_0559s00200g, partial [Populus trichocarpa]
Length=165

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 55/95 (58%), Gaps = 5/95 (5%)
 Frame = +2

Query  272  WWRG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYK-AQFIYDAQSYALNFDN  442
            W++G    KK+RE SE+VAGP+WK  +R+  R  +     G +   F YD  SY+LNFD 
Sbjct  57   WFKGIRALKKIREWSEIVAGPKWKTFIRRFNRTKSSGSGSGRRHGNFQYDPLSYSLNFDE  116

Query  443  GTaaaaaaeeeQGN-GLFRNFSSRYA-VPAVGQQM  541
            G        +E  + G FR+FSSRYA V A GQ +
Sbjct  117  GPGGQKGDFDELDDYGGFRDFSSRYASVSASGQPV  151



>ref|XP_011657987.1| PREDICTED: uncharacterized protein LOC105435925 [Cucumis sativus]
 gb|KGN63596.1| hypothetical protein Csa_1G005570 [Cucumis sativus]
Length=175

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 74/160 (46%), Gaps = 42/160 (26%)
 Frame = +2

Query  149  SPIVDEEEAGS--PTG-CGCFRLLSFRSGEGNTRALIGGES------------AAVWWRG  283
            SP  D +++ S  PT  CGCFRL  F    G+ R    G S               WW  
Sbjct  10   SPCCDADKSNSLLPTARCGCFRLSCF----GSRRVATVGPSWWERIRASQVHNEGRWWTR  65

Query  284  KAK---KVRELSEVVAGPRWKNLLRKMGR-------------YCNPKLKGGYKAQFIYDA  415
              +   K+RE SE+VAGPRWK  +R+  R                  ++ G   +F YD 
Sbjct  66   GVRVLLKLREWSEIVAGPRWKTFIRRFNRNRSGGCGGCGSGGGGGSGVRAG---KFQYDP  122

Query  416  QSYALNFDNGTaa--aaaaeeeQGNGLFRNFSSRYA-VPA  526
             SYA+NFD G+        + +  NG +RNFS+RYA +PA
Sbjct  123  LSYAMNFDEGSRQIGELDDDIDDFNG-YRNFSARYASIPA  161



>ref|XP_002322157.2| hypothetical protein POPTR_0015s08510g, partial [Populus trichocarpa]
 gb|EEF06284.2| hypothetical protein POPTR_0015s08510g, partial [Populus trichocarpa]
Length=169

 Score = 60.8 bits (146),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 55/95 (58%), Gaps = 5/95 (5%)
 Frame = +2

Query  272  WWRG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYK-AQFIYDAQSYALNFDN  442
            W++G    KK+RE SE+VAGP+WK  +R+  R  +     G +   F YD  SY+LNFD 
Sbjct  61   WFKGIRALKKIREWSEIVAGPKWKTFIRRFNRTKSSGSGSGRRHGNFQYDPLSYSLNFDE  120

Query  443  GTaaaaaaeeeQGN-GLFRNFSSRYA-VPAVGQQM  541
            G        +E  + G FR+FSSRYA V A GQ +
Sbjct  121  GPGGQKGDFDELDDYGGFRDFSSRYASVSASGQPV  155



>ref|XP_010028125.1| PREDICTED: uncharacterized protein LOC104418462 [Eucalyptus grandis]
Length=196

 Score = 61.2 bits (147),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 53/145 (37%), Positives = 65/145 (45%), Gaps = 29/145 (20%)
 Frame = +2

Query  146  NSPIVDEEEAGSPTGCGCFRLLSFRSGEGNTRALIGGES-----------------AAVW  274
            + P    E   SP+ C CF +  FR+      A   G+S                   VW
Sbjct  34   DEPDSMPEYPSSPSTC-CFCIPRFRARTPPPAA--PGQSYWERVGSGGRRGGDGGDGGVW  90

Query  275  WRG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNG-  445
             RG    KK+RE SE+ AGPRWK  +R+  R      K   + +F YD   YALNFD G 
Sbjct  91   SRGLRALKKLREWSEIAAGPRWKTFIRRFNR------KAHRQGRFNYDPLDYALNFDEGQ  144

Query  446  TaaaaaaeeeQGNGLFRNFSSRYAV  520
               A     E G G FRNFS+RYA 
Sbjct  145  GEDADEEGGEGGGGGFRNFSARYAA  169



>ref|XP_006345039.1| PREDICTED: uncharacterized protein LOC102590628 [Solanum tuberosum]
Length=150

 Score = 59.7 bits (143),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 52/90 (58%), Gaps = 13/90 (14%)
 Frame = +2

Query  266  AVWWRG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFD  439
            +VW +G     K+RE SE+VAGPRWK  +R+  R      K G + +F YD  SYALNFD
Sbjct  55   SVWAKGINALMKLREWSEIVAGPRWKTFIRRFNRN-----KNGAQGKFQYDPLSYALNFD  109

Query  440  NGTaaaaaaeeeQGNGLFRNFSSRYA-VPA  526
             G       E     GL R+FS+RYA +PA
Sbjct  110  EGNNNGEEDEY----GL-RDFSTRYASIPA  134



>ref|XP_007031415.1| NHL domain-containing protein, putative [Theobroma cacao]
 gb|EOY02341.1| NHL domain-containing protein, putative [Theobroma cacao]
Length=810

 Score = 62.8 bits (151),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 53/99 (54%), Gaps = 7/99 (7%)
 Frame = +2

Query  221  SGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQ  400
            + + N+ A         WW    KKVRE SE+VAGP+WK  +R+  +  N    GG K  
Sbjct  699  TDDTNSAASTNTSHYVPWWTRGWKKVREWSELVAGPKWKTFIRRFNK--NKTGNGGMK--  754

Query  401  FIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYA  517
            F YD  SY+LNFD G       +E+  N   RNFSSRYA
Sbjct  755  FHYDPLSYSLNFDEGPGQNGHFDEDFMN---RNFSSRYA  790



>ref|XP_003523070.1| PREDICTED: uncharacterized protein LOC100787218 [Glycine max]
Length=178

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 49/98 (50%), Gaps = 13/98 (13%)
 Frame = +2

Query  248  IGGESAAVWWRGKAK---KVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYK---AQFIY  409
            + G     WW G  +   KVRE SE+ AGPRWK  +R+  R       GG +    ++ Y
Sbjct  70   VTGSPGGRWWSGGVRAFMKVREWSELAAGPRWKTFIRRFSR----SRSGGSRHAAGKYQY  125

Query  410  DAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVP  523
            D  SYALNFD G         + G    RNFS+RYA P
Sbjct  126  DPLSYALNFDEG---HNGDFGDDGYDGLRNFSTRYAAP  160



>ref|XP_006289622.1| hypothetical protein CARUB_v10003175mg [Capsella rubella]
 gb|EOA22520.1| hypothetical protein CARUB_v10003175mg [Capsella rubella]
Length=726

 Score = 62.8 bits (151),  Expect = 6e-08, Method: Composition-based stats.
 Identities = 34/99 (34%), Positives = 51/99 (52%), Gaps = 9/99 (9%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGR-YCNPKLKGGYK----AQFIYDAQSYALNF  436
            WW     K+RE SE+VAGP+WK  +R+ GR +C   L  G        F YD+ SY+LNF
Sbjct  619  WWVSGWMKMREWSELVAGPKWKTFIRRFGRNHCCGGLDSGCNRPAPVSFRYDSWSYSLNF  678

Query  437  DNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
            D+G          +    +R++S R+  P++    K  +
Sbjct  679  DDG----KQTGHFEDEFPYRDYSMRFTAPSLPVSTKCSI  713



>ref|XP_011044331.1| PREDICTED: uncharacterized protein LOC105139552 [Populus euphratica]
Length=172

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = +2

Query  290  KKVRELSEVVAGPRWKNLLRKMGRYCN-PKLKGGYKAQFIYDAQSYALNFDNGT--aaaa  460
            KK+RE SEVVAGP+WK  +R+  R  N     G +  +F YD  SY+LNFD G       
Sbjct  72   KKIREWSEVVAGPKWKTFIRRFNRNKNGSSGNGRHHGKFQYDPFSYSLNFDEGPGGQNGN  131

Query  461  aaeeeQGNGLFRNFSSRYA-VPAVGQQM  541
              + +  NG FR+FSSRYA V A G+ +
Sbjct  132  FDDLDDYNG-FRDFSSRYASVSASGRPV  158



>ref|XP_002318641.1| hypothetical protein POPTR_0012s07970g [Populus trichocarpa]
 gb|EEE96861.1| hypothetical protein POPTR_0012s07970g [Populus trichocarpa]
Length=172

 Score = 60.1 bits (144),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 40/88 (45%), Positives = 52/88 (59%), Gaps = 5/88 (6%)
 Frame = +2

Query  290  KKVRELSEVVAGPRWKNLLRKMGRYCNP-KLKGGYKAQFIYDAQSYALNFDNGT--aaaa  460
            KK+RE SEVVAGP+WK  +R+  R  N     G +  +F YD  SY+LNFD G       
Sbjct  72   KKIREWSEVVAGPKWKTFIRRFNRNKNSGSGNGRHHGKFQYDPFSYSLNFDEGPGGQNGN  131

Query  461  aaeeeQGNGLFRNFSSRYA-VPAVGQQM  541
              + +  NG FR+FSSRYA V A G+ +
Sbjct  132  LDDLDDYNG-FRDFSSRYASVSASGRPV  158



>ref|XP_007203743.1| hypothetical protein PRUPE_ppa018294mg [Prunus persica]
 gb|EMJ04942.1| hypothetical protein PRUPE_ppa018294mg [Prunus persica]
Length=204

 Score = 60.5 bits (145),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 53/190 (28%), Positives = 76/190 (40%), Gaps = 53/190 (28%)
 Frame = +2

Query  107  MSGNQESQAFMIAN--SPIVDEEE--------------------AGSPTGCG-CFRLLSF  217
            M+ N E +  +I N  SPI + E                     +  P G G CF L  F
Sbjct  1    MASNNEHKPTLIMNHTSPIYEYERYEGEDLDDYHQDQDASSSSSSSPPCGVGDCFGLFGF  60

Query  218  RS--------GEGNTRALIGGE-----SAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMG  358
             S         +   + L+  E         WWR K  K +E ++V+ G +WK  +RK+ 
Sbjct  61   TSCTWRQNHDNDYERKYLLQQEGGWHKETTWWWRKKLTKAKESTQVLDGSKWKTFIRKIA  120

Query  359  RYC-------NPKLKGGYK---AQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSS  508
             YC       N +L    K    +F YD  SYALNFD G          +GN    +F++
Sbjct  121  GYCKTMKQKQNNRLSKKQKQKNTRFQYDFHSYALNFDGGV-------AREGNDAALDFAA  173

Query  509  RYAVPAVGQQ  538
            R+A P   + 
Sbjct  174  RFAAPLSNEH  183



>ref|XP_004953881.1| PREDICTED: uncharacterized protein LOC101754778 [Setaria italica]
Length=174

 Score = 59.7 bits (143),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 52/102 (51%), Gaps = 15/102 (15%)
 Frame = +2

Query  272  WWRGKAK---KVRELSEVVAGPRWKNLLRKMGRYCNPKLK----GGYKAQFIYDAQSYAL  430
            WW+  A    KVRE SE+VAGPRWK  +R+ GR   P       GG K    YDA SYAL
Sbjct  58   WWQRAADAVLKVREWSELVAGPRWKTFIRRFGRSGPPTRPHHHFGGRK--LNYDALSYAL  115

Query  431  NFDNGTaaaaaaeeeQGNGL-FRNFSSRYAVPAVGQQMKAGL  553
            NFD G          +G+   +R+FS+R+  P    +    L
Sbjct  116  NFDEG-----HGASPEGDYTGYRDFSARFVGPPASAKSSMDL  152



>ref|XP_009375084.1| PREDICTED: uncharacterized protein LOC103963933 [Pyrus x bretschneideri]
Length=159

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 60/128 (47%), Gaps = 14/128 (11%)
 Frame = +2

Query  185  TGCGCFRLLSFRSGEGNT-----RALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLR  349
            +GC CF +  F     +      R    GE    W     KK+RE SE++AGP+WK  +R
Sbjct  33   SGC-CFWIPCFGPEPSSPDRSWERIRSAGEYEDPWLYRGWKKIREWSELLAGPKWKTFIR  91

Query  350  KMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAV  529
            +  +  NP+  G    +F YD  SY+LNFD G            + L+R+FS RYA   V
Sbjct  92   RFNKN-NPRRSG----KFQYDPTSYSLNFDEGPGQNGNLI---DDYLYRDFSCRYASIPV  143

Query  530  GQQMKAGL  553
              +    L
Sbjct  144  SAKSSMDL  151



>ref|XP_002303463.2| hypothetical protein POPTR_0003s10050g [Populus trichocarpa]
 gb|EEE78442.2| hypothetical protein POPTR_0003s10050g [Populus trichocarpa]
Length=158

 Score = 59.3 bits (142),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 47/86 (55%), Gaps = 11/86 (13%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGG--YKAQFIYDAQSYALNFDNG  445
            WW     K+R+ SE+VAGP+WK  LR+     N K  GG     +F YD  SYALNFD G
Sbjct  67   WWFQGWMKIRDWSELVAGPKWKTFLRRF----NKKPGGGNPQHGKFQYDPSSYALNFDEG  122

Query  446  TaaaaaaeeeQGNGLFRNFSSRYAVP  523
                     E  + L R FSSRY++P
Sbjct  123  A-----KLYEDDDLLGRGFSSRYSLP  143



>ref|XP_007155404.1| hypothetical protein PHAVU_003G198600g [Phaseolus vulgaris]
 gb|ESW27398.1| hypothetical protein PHAVU_003G198600g [Phaseolus vulgaris]
Length=158

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 42/77 (55%), Gaps = 9/77 (12%)
 Frame = +2

Query  290  KKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaae  469
            KK+R+ S++VAGPRWK  LRK  R    K    Y+    YD  SYALNFD G        
Sbjct  72   KKLRDWSKIVAGPRWKTFLRKFNRNRTSKRMPKYQ----YDPMSYALNFDEG-----RNG  122

Query  470  eeQGNGLFRNFSSRYAV  520
            +   +   RNFS+RYA 
Sbjct  123  DSNDDAALRNFSTRYAA  139



>ref|XP_009401324.1| PREDICTED: uncharacterized protein LOC103985376 [Musa acuminata 
subsp. malaccensis]
Length=155

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 51/92 (55%), Gaps = 13/92 (14%)
 Frame = +2

Query  272  WWR---GKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGY----KAQFIYDAQSYAL  430
            WWR   G   KVRE SE+VAGPRWK  +R+  R  +    GG      A+F YD  SYAL
Sbjct  65   WWRRVVGAVMKVREWSELVAGPRWKTFIRRFNRNRHSGGGGGSWRMGSAKFQYDPLSYAL  124

Query  431  NFDNGTaaaaaaeeeQGNGL-FRNFSSRYAVP  523
            NFD G          +G+   +R+FS+R+A P
Sbjct  125  NFDEG-----HGGSPEGDYAGYRDFSARFAAP  151



>ref|XP_011018698.1| PREDICTED: uncharacterized protein LOC105121669 [Populus euphratica]
Length=159

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 50/90 (56%), Gaps = 9/90 (10%)
 Frame = +2

Query  260  SAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYK-AQFIYDAQSYALNF  436
            S   WW     ++R+ SE++AGP+WK  LR+     N K  GG    +F YD  SYALNF
Sbjct  62   SPESWWFRGWMRIRDWSELLAGPKWKTFLRRF----NKKPGGGTPYGRFQYDPSSYALNF  117

Query  437  DNGTaaaaaaeeeQGNGLFRNFSSRYAVPA  526
            D G+        E  + + R+FSSRY++P 
Sbjct  118  DQGS----RRRPEDDDLMERSFSSRYSLPP  143



>ref|XP_004501949.1| PREDICTED: uncharacterized protein LOC101503959 [Cicer arietinum]
Length=157

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 53/104 (51%), Gaps = 7/104 (7%)
 Frame = +2

Query  248  IGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYK--AQFIYDAQS  421
            I G +   W      +VRE SE+ AGPRWK  +R+  R       GG++   ++ YD  S
Sbjct  51   ITGTAGDHWCSRGFMRVREWSEIAAGPRWKTFIRRFNR----NRSGGFRHAGKYQYDPLS  106

Query  422  YALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
            Y+LNFD G       E++  +G FRNFS+RY      + +   L
Sbjct  107  YSLNFDEGPGQNGDFEDDSPDG-FRNFSARYVAATPLKSVSTDL  149



>ref|XP_006408502.1| hypothetical protein EUTSA_v10021620mg [Eutrema salsugineum]
 gb|ESQ49955.1| hypothetical protein EUTSA_v10021620mg [Eutrema salsugineum]
Length=180

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/113 (31%), Positives = 51/113 (45%), Gaps = 18/113 (16%)
 Frame = +2

Query  257  ESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGR--------------YCNPKLKGGYK  394
            E    WW    +K+RE SE+VAGPRWK  +R++GR               C         
Sbjct  59   EPDERWWICGWRKMREWSELVAGPRWKTFIRRVGRNHCCGGGRAGNSGGGCGAIPNRSDH  118

Query  395  AQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
             +F YD  SY+LNFD+G               +R++S R+A P++    K  +
Sbjct  119  RKFRYDPLSYSLNFDDGK----QTGHFDDEFPYRDYSMRFAAPSLPVSTKCSI  167



>ref|XP_006848825.1| PREDICTED: uncharacterized protein LOC18438579 [Amborella trichopoda]
 gb|ERN10406.1| hypothetical protein AMTR_s00026p00165550 [Amborella trichopoda]
Length=132

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 59/122 (48%), Gaps = 18/122 (15%)
 Frame = +2

Query  161  DEEEAGSPTGCGCFRLLSF---RSGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGPR  331
            DE+  G  TG  CF+   F    +G    + L    S   WW+    K RE SE++AGP+
Sbjct  21   DEDFQG--TGFCCFQWNCFGKRDTGVQEKQLLRNQGSKEEWWKKGWDKGREWSEILAGPK  78

Query  332  WKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSR  511
            WK  +R++      + K   K Q+ YD QSYALNFD          ++  +G    F SR
Sbjct  79   WKTFIRRL------RFKKQGKPQYKYDPQSYALNFDGD-------RDDNSDGFLVGFPSR  125

Query  512  YA  517
            +A
Sbjct  126  FA  127



>ref|XP_009392002.1| PREDICTED: uncharacterized protein LOC103978024 [Musa acuminata 
subsp. malaccensis]
Length=137

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 59/119 (50%), Gaps = 19/119 (16%)
 Frame = +2

Query  188  GCGCFRLL--SFRSGEGNTRALIGGESAA--VWWRGKAK---KVRELSEVVAGPRWKNLL  346
            GC CFR+     R+ +   R   GG       WWR   K   KVRE +E+VAGPRWK  +
Sbjct  6    GCCCFRMPWPGTRARKAVERREYGGGPVTGRWWWRRGMKVVMKVREWTEIVAGPRWKTFV  65

Query  347  RKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVP  523
            R+  R       GG    F YD  SYALNFD G        +  G+ + R FS+RYA P
Sbjct  66   RRFRRR---PRHGG----FGYDPLSYALNFDEGL-----GSDSDGDSVRRGFSARYATP  112



>ref|XP_006291910.1| hypothetical protein CARUB_v10018094mg, partial [Capsella rubella]
 gb|EOA24808.1| hypothetical protein CARUB_v10018094mg, partial [Capsella rubella]
Length=182

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 68/152 (45%), Gaps = 17/152 (11%)
 Frame = +2

Query  113  GNQESQAFMIANSPIVDEEEAGSPTGCGCFRLLSFRSGEGNT----RALIGGESAAVWWR  280
            G ++ +     + P+V E   GS     C  L  FR+    +    R          WW 
Sbjct  36   GKRDLEPETTTSDPLVGESSCGS-----C--LPGFRANAAKSSWWQRIHSNHHHEPRWWV  88

Query  281  GKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaa  460
                K+RE SEVVAGPRWK  +R+  R           A+F YD  SY L+F++      
Sbjct  89   RAFLKIREWSEVVAGPRWKTFIRRFNRDRRQGRDWDDAAKFRYDPLSYNLSFED-----E  143

Query  461  aaeeeQGNGLFRNFSSRYA-VPAVGQQMKAGL  553
              ++E G G  R+FS RYA VP V  +  A +
Sbjct  144  YKDDEAGFGGLRSFSMRYASVPVVSSKAPAVI  175



>ref|XP_006282333.1| hypothetical protein CARUB_v10028628mg [Capsella rubella]
 gb|EOA15231.1| hypothetical protein CARUB_v10028628mg [Capsella rubella]
Length=172

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 50/109 (46%), Gaps = 14/109 (13%)
 Frame = +2

Query  257  ESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKL----------KGGYKAQFI  406
            E    WW    +K+RE SE+VAGPRWK  +R+ GR                +     +F 
Sbjct  55   EPDQRWWIRGWRKMREWSELVAGPRWKTFIRRFGRNHCCGCGGGGGGGNSNRSSDHCKFR  114

Query  407  YDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
            YD  SY+LNFD+G               +R++S R+A P++    K  +
Sbjct  115  YDPLSYSLNFDDG----KLTGHFDDEFPYRDYSMRFAAPSLPVSTKCSI  159



>emb|CBI15061.3| unnamed protein product [Vitis vinifera]
Length=156

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 71/145 (49%), Gaps = 19/145 (13%)
 Frame = +2

Query  113  GNQESQAFMIANSPIVDEEEAGSPTGCGCFRLLSFRSGEGNTRALI------GGESAAVW  274
             ++E +A   A SP+       S   C CF +  F S   +T  L         ++   W
Sbjct  2    AHKEVEAQAEAESPMDATTGLFSSRSC-CFCIPCFGSSRSSTVGLAWWEKMRTAQNEDTW  60

Query  275  WRGKA----KKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDN  442
            W G++    KKVRE SE+ AGPRWK  +R   R+   +  G    +F YD  SY+LNFD 
Sbjct  61   W-GRSLRSFKKVREWSELAAGPRWKTFIR---RFNKTRSGGARHGKFQYDPLSYSLNFDE  116

Query  443  GTaaaaaaeeeQGNGLFRNFSSRYA  517
            G     ++++++G      F++RYA
Sbjct  117  GAGHNGSSDDDRGY----EFTARYA  137



>ref|XP_011623819.1| PREDICTED: uncharacterized protein LOC18435473 [Amborella trichopoda]
 gb|ERN07257.1| hypothetical protein AMTR_s00019p00197370 [Amborella trichopoda]
Length=178

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 47/143 (33%), Positives = 64/143 (45%), Gaps = 32/143 (22%)
 Frame = +2

Query  158  VDEEEAG----SPTGCGCFRLLSFRSGEGNTRALIGGE-----SAAV--------WWR--  280
            +D EE      S  GC  +    FRS + ++  +  GE      AA         WW   
Sbjct  27   IDAEEVSELLFSKRGCSIW-FCCFRSEDSSSSPVFKGECWERMKAAASEPENENKWWMKG  85

Query  281  -GKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaa  457
                KKVRE SE+VAGPRWK  +R+  R        G   +F YD  SYALNFD G +  
Sbjct  86   WNALKKVREWSELVAGPRWKTFIRRFNRSGK-----GRAGKFQYDPLSYALNFDEGHSQE  140

Query  458  aaaeeeQGNGLFRNFSSRYAVPA  526
                    +  + +FS+R+  P+
Sbjct  141  L------DHQNYSDFSTRFVAPS  157



>ref|XP_002283257.1| PREDICTED: uncharacterized protein LOC100246674 [Vitis vinifera]
Length=163

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 74/148 (50%), Gaps = 20/148 (14%)
 Frame = +2

Query  104  NMSGNQESQAFMIANSPIVDEEEAGSPTGCGCFRLLSFRSGEGNTRALI------GGESA  265
            NM+ ++E +A   A SP+       S   C CF +  F S   +T  L         ++ 
Sbjct  7    NMA-HKEVEAQAEAESPMDATTGLFSSRSC-CFCIPCFGSSRSSTVGLAWWEKMRTAQNE  64

Query  266  AVWWRGKA----KKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALN  433
              WW G++    KKVRE SE+ AGPRWK  +R   R+   +  G    +F YD  SY+LN
Sbjct  65   DTWW-GRSLRSFKKVREWSELAAGPRWKTFIR---RFNKTRSGGARHGKFQYDPLSYSLN  120

Query  434  FDNGTaaaaaaeeeQGNGLFRNFSSRYA  517
            FD G     ++++++G      F++RYA
Sbjct  121  FDEGAGHNGSSDDDRG----YEFTARYA  144



>ref|XP_002864822.1| hypothetical protein ARALYDRAFT_496469 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41081.1| hypothetical protein ARALYDRAFT_496469 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/127 (36%), Positives = 62/127 (49%), Gaps = 24/127 (19%)
 Frame = +2

Query  191  CGCFRLLSFRS------GEGNTRALIGGESA------AVWWRGKAKKVRELSEVVAGPRW  334
            C CF   SFRS      G G  R +     +        WW   + K+RE SE+VAGPRW
Sbjct  218  CCCFP--SFRSRSSTAVGWGRIRTVDDSNHSGDHGDEPRWWIRASLKIREWSEIVAGPRW  275

Query  335  KNLLRKMGRYCNPKLKGGYKA--QFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSS  508
            K  +R+  R  +P+    + A  +F YD  SY+LNFD+            G G  R+FS+
Sbjct  276  KTFIRRFNR--DPRRGRDWDASEKFQYDPLSYSLNFDDDDEDEYV-----GLGGLRSFST  328

Query  509  RYA-VPA  526
            R+A VP 
Sbjct  329  RFASVPV  335



>ref|XP_010540299.1| PREDICTED: uncharacterized protein LOC104814117 [Tarenaya hassleriana]
Length=163

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 56/105 (53%), Gaps = 13/105 (12%)
 Frame = +2

Query  161  DEEEAGSPTGCGC------FRLLSFRSGEGNTRALIGGESAA----VWWRGKAKKVRELS  310
            + ++A + T CGC      F ++ +R G    R    G+S       W + K K+++E+S
Sbjct  33   ENDDANTATFCGCGGYLRNFCVIRWRRG-TEVRGGWNGDSQQERGESWAKEKLKELKEMS  91

Query  311  EVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNG  445
            E +AGP+WKN +R+     N K        F YD +SY+LNFD+G
Sbjct  92   EKIAGPKWKNFIRRFS--TNNKRSSKRNLDFTYDLRSYSLNFDDG  134



>gb|EYU42542.1| hypothetical protein MIMGU_mgv1a014912mg [Erythranthe guttata]
Length=174

 Score = 58.5 bits (140),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 49/91 (54%), Gaps = 11/91 (12%)
 Frame = +2

Query  266  AVWWRG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFD  439
             +W RG     K+RE SE+VAGPRWK  +R+  R       G   A F YD  SYA+NFD
Sbjct  74   TLWSRGVDALMKIREWSEIVAGPRWKTFIRRFNR----NRSGSRAANFQYDPLSYAMNFD  129

Query  440  NGTaaaaaaeeeQ--GNGLF---RNFSSRYA  517
             G       + ++   +G +   RNFSSRYA
Sbjct  130  EGPGQGQNGQLDEEGEDGYYYGSRNFSSRYA  160



>ref|NP_001048094.1| Os02g0743200 [Oryza sativa Japonica Group]
 dbj|BAD15743.1| NHL repeat-containing protein-like [Oryza sativa Japonica Group]
 dbj|BAD16104.1| NHL repeat-containing protein-like [Oryza sativa Japonica Group]
 dbj|BAF10008.1| Os02g0743200 [Oryza sativa Japonica Group]
 dbj|BAG98365.1| unnamed protein product [Oryza sativa Japonica Group]
Length=171

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/131 (34%), Positives = 60/131 (46%), Gaps = 19/131 (15%)
 Frame = +2

Query  191  CGCFRLLSFRSGEGNTRALIGGESAAVWWRGKAK---KVRELSEVVAGPRWKNLLRKMGR  361
            C CF   S      ++   +GG     WW+       KVRE SE+VAGPRWK  +R+ GR
Sbjct  29   CCCFPWPS----SASSHQRVGGAEEESWWQRAVDAVLKVREWSELVAGPRWKTFIRRFGR  84

Query  362  YCNPKLKG------GYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGL-FRNFSSRYAV  520
                   G       Y  +  YDA SYALNFD G          +G+   +R+FS+R+A 
Sbjct  85   GGGGGGGGGGPRPHNYGRKLNYDALSYALNFDEG-----HGASPEGDYTGYRDFSARFAA  139

Query  521  PAVGQQMKAGL  553
            P    +    L
Sbjct  140  PPASAKSSMDL  150



>gb|KGN52385.1| hypothetical protein Csa_5G630870 [Cucumis sativus]
Length=152

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 43/147 (29%), Positives = 70/147 (48%), Gaps = 25/147 (17%)
 Frame = +2

Query  140  IANSPIVDEEEAG------------SPTGCGCFRLLSFRSGEGNT--RALIGGESAAVWW  277
            +A+SP +  +E G            +  GC C  +   RS    +    +   ++   WW
Sbjct  3    LAHSPDLSSDENGFLHNDDLHDAVFATRGC-CLWIPCLRSNSSQSWWERIRAADNDDEWW  61

Query  278  RGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaa  457
                K+ RE SE+VAGP+WK  +R+  +  N       ++ F YD  SY+LNFD G    
Sbjct  62   LKGWKRFREWSEIVAGPKWKTFIRQFHKNRN------RQSTFRYDPLSYSLNFDEGP---  112

Query  458  aaaeeeQGNGLFRNFSSRY-AVPAVGQ  535
            A  +    + + R+FS+R+ A+PA  +
Sbjct  113  AHDDPFTDDFVRRDFSTRFAAIPASAK  139



>ref|XP_007140920.1| hypothetical protein PHAVU_008G152300g [Phaseolus vulgaris]
 gb|ESW12914.1| hypothetical protein PHAVU_008G152300g [Phaseolus vulgaris]
Length=141

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 46/122 (38%), Positives = 64/122 (52%), Gaps = 17/122 (14%)
 Frame = +2

Query  179  SPTGCGCFRLLSFRSGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMG  358
            S  GC CF +  F  G+ N++  +  E    WW     K+RE S+VVA  +WK   R+  
Sbjct  21   SKRGC-CFNICCF--GD-NSKTRLSPEKKVQWWVKGWTKIREWSKVVARSKWKTFNRRF-  75

Query  359  RYCNPKLKGGYKAQ--FIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYA-VPAV  529
               N     GY+ Q  F YDA+SYA NFD+GT      + ++  G   +FSSRYA VP+ 
Sbjct  76   ---NKNRSIGYRKQGSFHYDARSYAQNFDDGT----REKRQEHYGC--DFSSRYASVPSS  126

Query  530  GQ  535
             +
Sbjct  127  AK  128



>ref|XP_006579562.1| PREDICTED: uncharacterized protein LOC102661934 [Glycine max]
Length=164

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 45/86 (52%), Gaps = 9/86 (10%)
 Frame = +2

Query  272  WW-RG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDN  442
            WW RG    KK+RE SE+VAGP+WK  +R+  R    K    Y+    YD  SYALNFD 
Sbjct  65   WWSRGLRALKKLREWSEIVAGPKWKTFIRRFNRNRPNKRIPTYQ----YDPFSYALNFDE  120

Query  443  GTaaaaaaeeeQGNGLFRNFSSRYAV  520
            G            +   RNFS+RYA 
Sbjct  121  GP--NGDFNHHHDDAALRNFSTRYAA  144



>ref|XP_003549633.2| PREDICTED: uncharacterized protein LOC100790161 [Glycine max]
Length=173

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 42/105 (40%), Positives = 52/105 (50%), Gaps = 14/105 (13%)
 Frame = +2

Query  215  FRSGEGNTRALIGGESAAVWW-RG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKG  385
             RS   +T A  G      WW RG    KK+RE SE+VAGP+WK  +R+  R    K   
Sbjct  46   VRSHSHSTPASTGDR----WWSRGLRALKKLREWSEIVAGPKWKTFIRRFNRNRPNKRIP  101

Query  386  GYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAV  520
             Y+    YD  SYALNFD G         +  +   RNFS+RYA 
Sbjct  102  TYQ----YDPFSYALNFDEGP---NGDFNDDDDAALRNFSTRYAA  139



>ref|NP_001145500.1| hypothetical protein [Zea mays]
 gb|ACG30333.1| hypothetical protein [Zea mays]
 gb|ACG48038.1| hypothetical protein [Zea mays]
 gb|AFW73376.1| hypothetical protein ZEAMMB73_030441 [Zea mays]
Length=179

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 50/101 (50%), Gaps = 10/101 (10%)
 Frame = +2

Query  269  VWWRGKAK---KVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYK---AQFIYDAQSYAL  430
             WW+       KVRE SE+VAGPRWK  +R+ GR   P     +     +  YDA SYAL
Sbjct  60   TWWQRAVDAVLKVREWSELVAGPRWKTFIRRFGRSGPPARPHHHHFGGRKLNYDALSYAL  119

Query  431  NFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
            NFD G  A+   +       +R+FS+R+  P    +    L
Sbjct  120  NFDEGHGASPEGDYTG----YRDFSARFVGPPASAKSSMDL  156



>ref|XP_010107451.1| hypothetical protein L484_002119 [Morus notabilis]
 gb|EXC16035.1| hypothetical protein L484_002119 [Morus notabilis]
Length=167

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 50/86 (58%), Gaps = 7/86 (8%)
 Frame = +2

Query  272  WW-RG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDN  442
            WW RG    KK+RE SE+VAGP+WK  +R+  R    +  G    +F YD  SY+LNFD 
Sbjct  63   WWNRGIRAFKKLREWSEIVAGPKWKTFIRRFNRN---RSGGNRHGKFQYDPLSYSLNFDE  119

Query  443  GTaaaaaaeeeQGNGLFRNFSSRYAV  520
            G      +EE+   G FR+FS+RY  
Sbjct  120  GLVHNGNSEEDDYAG-FRDFSTRYGT  144



>ref|XP_004489306.1| PREDICTED: uncharacterized protein LOC101508916 [Cicer arietinum]
Length=151

 Score = 57.0 bits (136),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 48/91 (53%), Gaps = 9/91 (10%)
 Frame = +2

Query  257  ESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNF  436
            E+ A WW     KVRE SEV+AGP+WK  +R+  +  N  +K G      YD  SYALNF
Sbjct  53   ENKAKWWFRGWMKVREWSEVIAGPKWKTFIRRFNKNRNVYVKQG---SLNYDPLSYALNF  109

Query  437  DNGTaaaaaaeeeQGNGLFRNFSSRYA-VPA  526
            D+G           G      FS+R+A VPA
Sbjct  110  DDGNVGDDGISYGYG-----GFSARFASVPA  135



>ref|XP_006578128.1| PREDICTED: uncharacterized protein LOC102664203 [Glycine max]
 gb|KHN29598.1| hypothetical protein glysoja_016220 [Glycine soja]
Length=127

 Score = 56.2 bits (134),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 62/124 (50%), Gaps = 15/124 (12%)
 Frame = +2

Query  161  DEEEAGSPTGCGCFRLLSFRSGEGNTRALIGGESAAV---WWRGKAKKV-RELSEVVAGP  328
            D ++      CGCFR+   R      +     E+  V   W + K K+V + LSE++  P
Sbjct  12   DHQDMAITHYCGCFRVFYARYESCREQQ----ETLKVHRNWLQKKLKRVVKALSEILVWP  67

Query  329  RWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSS  508
            +    L+++    +       K QF YD +SYALNFD+G+        E+ +G+F  FS+
Sbjct  68   KKSFSLQRLSTCISEVKDKKRKMQFQYDPKSYALNFDDGS-------IEEDDGVFLGFSA  120

Query  509  RYAV  520
            RYA+
Sbjct  121  RYAL  124



>gb|KFK27791.1| hypothetical protein AALP_AA8G429900 [Arabis alpina]
Length=129

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 48/103 (47%), Gaps = 11/103 (11%)
 Frame = +2

Query  161  DEEEAGSPTGCGCFRLLSFRSGEGNTRAL--------IGGESAAVWWRGKAKKVRELSEV  316
            D EE  +  GCG FR  S                   +  E    W   K K ++E+SE 
Sbjct  12   DYEETTAFCGCGYFRNCSVNRWRRGGGGDGGGSWSGNLQEERGENWGSRKLKGLKEISEK  71

Query  317  VAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNG  445
            +AGP+WKN +R    + N K K      F YD Q+Y+LNFD+G
Sbjct  72   IAGPKWKNFIRS---FSNGKKKMKRDVDFSYDLQNYSLNFDDG  111



>ref|XP_009129977.1| PREDICTED: uncharacterized protein LOC103854768 [Brassica rapa]
Length=125

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 53/105 (50%), Gaps = 12/105 (11%)
 Frame = +2

Query  155  IVDEEEAGSPTGCGC-----FRLLSFRS---GEGNTRALIGGESAAVWWRGKAKKVRELS  310
            ++ +E   + T CGC     F +  +R    G+      +  E +  WW  K K ++E+S
Sbjct  8    LLSDEYNETATLCGCGYLRRFHVFRWRRVGGGDSGWSGNLQEERSESWWSRKLKVLKEIS  67

Query  311  EVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNG  445
            E +AGP+WKN +R   +    K K      F YD ++Y+LNFD G
Sbjct  68   EKIAGPKWKNFIRSFSK----KKKVKRDVDFTYDLENYSLNFDEG  108



>ref|XP_006581341.1| PREDICTED: uncharacterized protein LOC102660700 [Glycine max]
 gb|KHN07050.1| hypothetical protein glysoja_023233 [Glycine soja]
Length=138

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 66/131 (50%), Gaps = 23/131 (18%)
 Frame = +2

Query  173  AGSPT-------GCGCFRLLSFRSGEGNTRALIGGESAAV------WWRGKAKK-VRELS  310
            AG+P+          CFR+L   + +G  R    GE          W R K ++ ++ LS
Sbjct  2    AGTPSRLEEIIASLNCFRVLY--APQGPHRYESRGEEQETLEIRRKWLRKKLERAMKVLS  59

Query  311  EVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGL  490
            E++  P+    LR++    +   +   K QF YD +SYALNFD+G+        E+ +G+
Sbjct  60   EILVWPKKSFSLRRLRTCISEAKEMKRKMQFQYDPKSYALNFDDGS-------IEEDDGV  112

Query  491  FRNFSSRYAVP  523
            F +FS+RYA P
Sbjct  113  FLDFSARYACP  123



>ref|XP_008374462.1| PREDICTED: uncharacterized protein LOC103437744 [Malus domestica]
Length=141

 Score = 55.8 bits (133),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/88 (42%), Positives = 45/88 (51%), Gaps = 9/88 (10%)
 Frame = +2

Query  293  KVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGY--KAQFIYDAQSYALNFDNGTaaaaaa  466
            K+RE SE+VAGPRWK  +R+  R  +     G     +F YD  SYALNFD G       
Sbjct  48   KLREWSEIVAGPRWKTFIRRFNRSRSIGRGAGASNHGKFQYDPLSYALNFDEGPVDEDDE  107

Query  467  eeeQGNGLFRNFSSRYAVPAVGQQMKAG  550
                    FRNFS RYA  +  Q  K+G
Sbjct  108  VVG-----FRNFSVRYA--SFPQPAKSG  128



>emb|CDX85579.1| BnaA02g02340D [Brassica napus]
Length=1432

 Score = 58.5 bits (140),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 32/102 (31%), Positives = 53/102 (52%), Gaps = 12/102 (12%)
 Frame = +2

Query  272   WWRGKAKKVRELSEVVAGPRWKNLLRKMGR-YCNPKLKGGY-------KAQFIYDAQSYA  427
             WW     K+RE SE++AGP+WK  +R++GR +C   +  G           F YD+ SY+
Sbjct  1320  WWMSGWSKMREWSEILAGPKWKTFIRRVGRSHCCGGVGDGGGGGNRTDHVDFRYDSWSYS  1379

Query  428   LNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
             LNFD+G          +    +R++S R+  P++    K+ +
Sbjct  1380  LNFDDG----KQTGHFEDEFPYRDYSMRFTSPSLPVSTKSSI  1417



>emb|CDY36908.1| BnaA06g16930D [Brassica napus]
Length=149

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 51/119 (43%), Gaps = 3/119 (3%)
 Frame = +2

Query  176  GSPTGCGCFRLLSFRSGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKM  355
            G+   C C  + S       T           WW     K+RE SE+VAGPRWK  +R+ 
Sbjct  19   GNSPCCSCLAVGSSWWQRKTTDLHSNHHHEPRWWIRAILKIREWSEIVAGPRWKTFIRQF  78

Query  356  GRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYA-VPAV  529
             R           A+  YD  SY LNF +        E   G G +R+FS RYA VP V
Sbjct  79   NRDQRRGRAWDNSARHKYDTSSYKLNFKDEGEDEEDDEA--GFGGYRSFSMRYASVPVV  135



>emb|CDX91017.1| BnaC02g05800D [Brassica napus]
Length=1526

 Score = 58.5 bits (140),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 31/94 (33%), Positives = 51/94 (54%), Gaps = 12/94 (13%)
 Frame = +2

Query  272   WWRGKAKKVRELSEVVAGPRWKNLLRKMGR-YCNPKLKGGY-------KAQFIYDAQSYA  427
             WW     K+RE SE++AGP+WK  +R++GR +C   +  G        +  F YD+ SY+
Sbjct  1414  WWMSGWSKMREWSEILAGPKWKTFIRRVGRSHCCGGVGDGGGGGNRTDQVDFRYDSWSYS  1473

Query  428   LNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAV  529
             LNFD+G          +    +R++S R+  P++
Sbjct  1474  LNFDDG----KQTGHFEDEFPYRDYSMRFTSPSL  1503



>ref|XP_010459398.1| PREDICTED: uncharacterized protein LOC104740480 [Camelina sativa]
Length=173

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/150 (31%), Positives = 64/150 (43%), Gaps = 28/150 (19%)
 Frame = +2

Query  137  MIANSPIVDEEEAGSPTGCGCFRLLSFRS-----------------GEGNTRALIGGESA  265
            +  + P  D +       C CF   SFRS                  + NT     G   
Sbjct  3    VTQSDPTRDPDTRYDRLCCSCF--PSFRSRSSNAVGYSSWGRIRTVDDNNTHTHSNGGDE  60

Query  266  AVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKA--QFIYDAQSYALNFD  439
              WW   + K+RE SE+ AGPRWK  +R+  R  +P+    + A  +F YD  SY+LNFD
Sbjct  61   PRWWIRASLKIREWSELAAGPRWKTFIRRFNR--DPRRGRDWDASEKFQYDPLSYSLNFD  118

Query  440  NGTaaaaaaeeeQGNGLFRNFSSRYA-VPA  526
                         G G  R+FS+R+A VP 
Sbjct  119  EDDDEDEYV----GLGGMRSFSTRFASVPV  144



>gb|EAY87496.1| hypothetical protein OsI_08904 [Oryza sativa Indica Group]
Length=155

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 59/128 (46%), Gaps = 16/128 (13%)
 Frame = +2

Query  191  CGCFRLLSFRSGEGNTRALIGGESAAVWWRGKAK---KVRELSEVVAGPRWKNLLRKMGR  361
            C CF   S      ++   +GG     WW+       KVRE SE+VAGPRWK  +R+ GR
Sbjct  16   CCCFPWPS----SASSHQRVGGAEEESWWQRAVDAVLKVREWSELVAGPRWKTFIRRFGR  71

Query  362  YCNPKLKG---GYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGL-FRNFSSRYAVPAV  529
                        Y  +  YDA SYALNFD G          +G+   +R+FS+R+A P  
Sbjct  72   GGGGGGGPRPHNYGRKLNYDALSYALNFDEG-----HGASPEGDYTGYRDFSARFAAPPA  126

Query  530  GQQMKAGL  553
              +    L
Sbjct  127  SAKSSMDL  134



>ref|XP_010227816.1| PREDICTED: uncharacterized protein LOC100833226 [Brachypodium 
distachyon]
Length=197

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 49/90 (54%), Gaps = 10/90 (11%)
 Frame = +2

Query  272  WWRGKAK---KVRELSEVVAGPRWKNLLRKMGRYCNPKLK---GGYKAQFIYDAQSYALN  433
            WWR       KVRE SE+VAGPRWK  +R+  R   P      GG   +  YDA +YALN
Sbjct  78   WWRRGVDAFMKVREWSELVAGPRWKTFIRRFRR--GPTRHGSGGGVGRKLNYDALNYALN  135

Query  434  FDNGTaaaaaaeeeQGNGLFRNFSSRYAVP  523
            FD G  A+     +     +R+FS+R+A P
Sbjct  136  FDEGHPASPEPGGDFAG--YRDFSTRFAAP  163



>emb|CDY05370.1| BnaC02g40780D [Brassica napus]
Length=125

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 53/105 (50%), Gaps = 12/105 (11%)
 Frame = +2

Query  155  IVDEEEAGSPTGCGC-----FRLLSFRS---GEGNTRALIGGESAAVWWRGKAKKVRELS  310
            ++ ++   + T CGC     F +  +R    G+      +  E +  WW  K K ++E+S
Sbjct  8    LLSDDYEKTATFCGCGYLRRFHVFRWRRVGGGDSGWSGNLQEERSESWWSRKLKVLKEIS  67

Query  311  EVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNG  445
            E +AGP+WKN +R      + K K      F YD ++Y+LNFD G
Sbjct  68   EKIAGPKWKNFIRSF----SKKKKVKRDVDFTYDLENYSLNFDEG  108



>ref|NP_001190601.1| uncharacterized protein [Arabidopsis thaliana]
 dbj|BAB10856.1| unnamed protein product [Arabidopsis thaliana]
 dbj|BAC42376.1| unknown protein [Arabidopsis thaliana]
 gb|AED97666.1| uncharacterized protein AT5G62865 [Arabidopsis thaliana]
Length=167

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/95 (39%), Positives = 52/95 (55%), Gaps = 9/95 (9%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKA--QFIYDAQSYALNFDNG  445
            WW   + K+RE SE+VAGPRWK  +R+  R  +P+    + A  +F YD  SY+LNFD+ 
Sbjct  61   WWIRASLKIREWSEIVAGPRWKTFIRRFNR--DPRRGRDWDASEKFQYDPLSYSLNFDDD  118

Query  446  TaaaaaaeeeQGNGLFRNFSSRYA-VPAVGQQMKA  547
                       G G  R+FS+R+A VP    +  A
Sbjct  119  DEEDEYV----GLGGLRSFSTRFASVPVYSGKAPA  149



>ref|XP_006400002.1| hypothetical protein EUTSA_v10012875mg [Eutrema salsugineum]
 gb|ESQ41455.1| hypothetical protein EUTSA_v10012875mg [Eutrema salsugineum]
Length=676

 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 55/112 (49%), Gaps = 10/112 (9%)
 Frame = +2

Query  236  TRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGR---YC---NPKLKGGYKA  397
             R +   E    WW     K+RE SE++AGP+WK  +R++GR   +C   +       + 
Sbjct  556  IRTVDKLEPDERWWISGWNKMREWSEIMAGPKWKTFIRRVGRNNHFCGCGDVGCNRPDQV  615

Query  398  QFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
             F YD+ SY+LNFD+G          +    +R++S R+  P++    K  L
Sbjct  616  DFRYDSWSYSLNFDDG----KQTGRFEDEFPYRDYSMRFTAPSLPVSTKCSL  663



>ref|XP_010492306.1| PREDICTED: uncharacterized protein LOC104769725 [Camelina sativa]
Length=179

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 53/116 (46%), Gaps = 15/116 (13%)
 Frame = +2

Query  239  RALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGY---------  391
            R +   E    WW     K+RE SE++AGP+WK  +R+ GR       GG          
Sbjct  55   RTVDKLEPDERWWVSGWMKMREWSELLAGPKWKTFIRRFGRSHCCGGGGGGGVDGGGCNR  114

Query  392  --KAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
                 F YD+ SY+LNFD+G          +    +R++S+R+  P++    K  +
Sbjct  115  PEHVSFSYDSWSYSLNFDDG----KQTGHFEDEFPYRDYSTRFTSPSLPVSTKCSI  166



>emb|CDY05481.1| BnaA02g32100D [Brassica napus]
Length=125

 Score = 55.1 bits (131),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 51/101 (50%), Gaps = 10/101 (10%)
 Frame = +2

Query  161  DEEEAGSPTGCGCFRLLSF----RSGEGNT--RALIGGESAAVWWRGKAKKVRELSEVVA  322
            D E+  +  GCG  R        R G G++     +  E +  WW  K K ++E+SE +A
Sbjct  12   DYEKTATFCGCGYLRRFHVFRWRRVGGGDSGWSGNLQEERSESWWSRKLKVLKEISEKIA  71

Query  323  GPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNG  445
            GP+WKN +R      + K K      F YD ++Y+LNFD G
Sbjct  72   GPKWKNFIRSF----SKKKKVKRDVDFTYDLENYSLNFDEG  108



>ref|XP_002882183.1| hypothetical protein ARALYDRAFT_896109 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58442.1| hypothetical protein ARALYDRAFT_896109 [Arabidopsis lyrata subsp. 
lyrata]
Length=177

 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 67/173 (39%), Gaps = 39/173 (23%)
 Frame = +2

Query  137  MIANSPIVDEEEAGSPT--------GCGCFRLLSFRSGEGNTR----------ALIGGES  262
            M   SP + E +A            GC CF +    S + +TR           +   E 
Sbjct  1    MSHQSPPISEVDATDDMHEALFAKRGC-CFLMPCLASSQPSTRGGSVWWQRITTVDKLEP  59

Query  263  AAVWWRGKAKKVRELSEVVAGPRWKNLLRKM----------------GRYCNPKLKGGYK  394
               WW    +++RE SE+VAGPRWK  +R+                    C        +
Sbjct  60   DERWWIRGWRRMREWSELVAGPRWKTFIRRFGRNHCCGGGGGRVGNSSGGCGAMTNRSDQ  119

Query  395  AQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
             +F YD  SY+LNFD+G               +R++S R+A P++    K  +
Sbjct  120  GKFRYDPLSYSLNFDDG----KQTGHFDDEFPYRDYSMRFAAPSLPVSTKCSI  168



>ref|XP_010454844.1| PREDICTED: uncharacterized protein LOC104736542 [Camelina sativa]
Length=144

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 3/58 (5%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNG  445
            W  GK K ++E+SE +AGP+WKN +R    + N + K      F YD ++Y+LNFD+G
Sbjct  69   WESGKLKGLKEISEKIAGPKWKNFIRS---FSNSRKKMRRDVDFTYDLKNYSLNFDDG  123



>ref|XP_009149850.1| PREDICTED: uncharacterized protein LOC103873178 [Brassica rapa]
Length=149

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 50/119 (42%), Gaps = 3/119 (3%)
 Frame = +2

Query  176  GSPTGCGCFRLLSFRSGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKM  355
            G+   C C  + S       T           WW     K+RE SE+VAGPRWK  +R  
Sbjct  19   GNSPCCSCLAVGSSWWQRKTTDLHSNHHHEPRWWIRAILKIREWSEIVAGPRWKTFIRNF  78

Query  356  GRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYA-VPAV  529
             R           A+  YD  SY LNF +        E   G G +R+FS RYA VP V
Sbjct  79   NRDQRRGRAWDNSARHKYDTSSYKLNFKDEGEDEEDDEA--GFGGYRSFSMRYASVPVV  135



>ref|XP_010421371.1| PREDICTED: uncharacterized protein LOC104706845 [Camelina sativa]
Length=144

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 53/115 (46%), Gaps = 23/115 (20%)
 Frame = +2

Query  161  DEEEAGSPTGCGCFRLLSF-----RSGEGNTRA---------------LIGGESAAVWWR  280
            D +E  +  GCG FR L       R G  +  A                +  E    W  
Sbjct  12   DYDEPAAFCGCGYFRKLCVVRWRRRKGGDDEEARLEHRSRSSGWSGGGSLQEERGGRWES  71

Query  281  GKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNG  445
            GK K ++E+SE +AGP+WKN +R    + N + K      F YD ++Y+LNFD+G
Sbjct  72   GKLKGLKEISEKIAGPKWKNFIRS---FSNSRKKMRRDVDFTYDLKNYSLNFDDG  123



>ref|XP_010493772.1| PREDICTED: uncharacterized protein LOC104771001 [Camelina sativa]
Length=144

 Score = 54.7 bits (130),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 37/58 (64%), Gaps = 3/58 (5%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNG  445
            W  GK K ++E+SE +AGP+WKN +R    + N + K      F YD ++Y+LNFD+G
Sbjct  69   WGSGKLKGLKEISEKIAGPKWKNFIRS---FSNSRKKMRRDVDFTYDLKNYSLNFDDG  123



>gb|KFK25725.1| hypothetical protein AALP_AA8G151600 [Arabis alpina]
Length=164

 Score = 55.1 bits (131),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 52/113 (46%), Gaps = 12/113 (11%)
 Frame = +2

Query  239  RALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGR-YC-------NPKLKGGYK  394
            R +   E    WW     K+R  SE+VAGP+WK  +R+ GR +C          +     
Sbjct  43   RTVDKLEPDDRWWISGWNKMRGWSELVAGPKWKTYIRRFGRSHCCGGGGGGEGGVNRADT  102

Query  395  AQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
              F YD+ SY+LNFD+G          +    +R++S R+  P++    K  +
Sbjct  103  VSFRYDSWSYSLNFDDG----KQTGHFEDEFPYRDYSMRFTAPSLPVSTKCSI  151



>ref|XP_009405042.1| PREDICTED: uncharacterized protein LOC103988213 [Musa acuminata 
subsp. malaccensis]
Length=143

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 50/99 (51%), Gaps = 14/99 (14%)
 Frame = +2

Query  248  IGGESAAVWWR----GKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYK---AQFI  406
            +GG     WW         +VRE SE+VA PRW   +R   R+   +  GG++   A+F 
Sbjct  48   VGGRHEGRWWSRVFGAALTRVREWSELVARPRWNAFIRHFRRH---RHGGGWRVASARFQ  104

Query  407  YDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVP  523
            YD  SYALNFD G       E       +R+FS+R+A P
Sbjct  105  YDPLSYALNFDEGHGECPEEEYMG----YRDFSTRFASP  139



>emb|CDY44983.1| BnaCnng12130D [Brassica napus]
Length=149

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 44/87 (51%), Gaps = 3/87 (3%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTa  451
            WW     K+RE SE+VAGPRWK  +R+  R           A+  YD  SY LNF +   
Sbjct  51   WWIRAILKIREWSEIVAGPRWKTFIRQFNRDQRRGRAWDNSARHKYDTSSYKLNFKDEGE  110

Query  452  aaaaaeeeQGNGLFRNFSSRYA-VPAV  529
                 E   G G +R+FS RYA VP V
Sbjct  111  DEEDDEA--GFGGYRSFSMRYASVPVV  135



>gb|EAZ24587.1| hypothetical protein OsJ_08349 [Oryza sativa Japonica Group]
Length=158

 Score = 54.7 bits (130),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 61/132 (46%), Gaps = 21/132 (16%)
 Frame = +2

Query  191  CGCFRLLSFRSGEGNTRALIGGESAAVWWRGKAK---KVRELSEVVAGPRWKNLLRKMGR  361
            C CF   S      ++   +GG     WW+       KVRE SE+VAGPRWK  +R+ GR
Sbjct  16   CCCFPWPS----SASSHQRVGGAEEESWWQRAVDAVLKVREWSELVAGPRWKTFIRRFGR  71

Query  362  YCN-------PKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGL-FRNFSSRYA  517
                      P+    Y  +  YDA SYALNFD G          +G+   +R+FS+R+A
Sbjct  72   GGGCGGCCGWPRPH-NYGRKLNYDALSYALNFDEG-----HGASPEGDYTGYRDFSARFA  125

Query  518  VPAVGQQMKAGL  553
             P    +    L
Sbjct  126  APPASAKSSMDL  137



>ref|XP_009126329.1| PREDICTED: uncharacterized protein LOC103851236 [Brassica rapa]
Length=678

 Score = 57.0 bits (136),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 54/113 (48%), Gaps = 12/113 (11%)
 Frame = +2

Query  239  RALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGR-YC-------NPKLKGGYK  394
            R +   E    WW     K+RE SE++AGP+WK  +R++GR +C                
Sbjct  555  RTVDKLEPDERWWMSGWSKMREWSEILAGPKWKTFIRRVGRSHCCGGVGDGGGGGNRTDH  614

Query  395  AQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
              F YD+ SY+LNFD+G          +    +R++S R+  P++    K+ +
Sbjct  615  VDFRYDSWSYSLNFDDG----KQTGHFEDEFPYRDYSMRFTSPSLPVSTKSSI  663



>ref|XP_010503425.1| PREDICTED: uncharacterized protein LOC104780615 [Camelina sativa]
Length=147

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 49/94 (52%), Gaps = 8/94 (9%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTa  451
            WW     K+RE SE+VAGPRWK  +RK  R    + +G   A F YD  SY L+F++   
Sbjct  53   WWVRAFLKIREWSEIVAGPRWKTFIRKFNR---DRPRG--TANFRYDPLSYTLSFED--E  105

Query  452  aaaaaeeeQGNGLFRNFSSRYA-VPAVGQQMKAG  550
                 + E G G  R+FS RYA VP    +   G
Sbjct  106  YKDDDDNEAGFGGVRSFSMRYASVPVDSSKATDG  139



>ref|XP_011464004.1| PREDICTED: uncharacterized protein LOC105351453 [Fragaria vesca 
subsp. vesca]
Length=139

 Score = 54.3 bits (129),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 45/78 (58%), Gaps = 7/78 (9%)
 Frame = +2

Query  293  KVRELSEVVAGPRWKNLLRKMGR---YCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaa  463
            KVRE SE+VAGP+WK  +R+  R          GG   +F YD  SYALNFD G      
Sbjct  47   KVREWSEIVAGPKWKTFIRRFNRSKSGGGSSSGGGRHRKFQYDPLSYALNFDEGP----V  102

Query  464  aeeeQGNGLFRNFSSRYA  517
             EE   +G FR+FS+R+A
Sbjct  103  GEEVDESGGFRDFSTRFA  120



>ref|XP_010929101.1| PREDICTED: uncharacterized protein LOC105050685 [Elaeis guineensis]
Length=165

 Score = 54.3 bits (129),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 44/131 (34%), Positives = 63/131 (48%), Gaps = 16/131 (12%)
 Frame = +2

Query  188  GCGCFRLLSFRSGEGNTRALIGGESAAV----WWRG---KAKKVRELSEVVAGPRWKNLL  346
            GC CF +     G  +   +   E+A +    WW        KVRE SE++AGPRWK  +
Sbjct  26   GCCCFWVP--WPGTKSWERIAPAEAAPIKRRCWWTAGWRTLMKVREWSEMLAGPRWKTFI  83

Query  347  RKMGRYCNPKLKGG--YKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAV  520
            R++ RY      GG   +++F YD  SY+LNFD+G        E   +   R FS+RY  
Sbjct  84   RRVRRYARRGGSGGGLPRSRFGYDPLSYSLNFDDGM-----DSETDDDVAHRGFSARYVA  138

Query  521  PAVGQQMKAGL  553
            P +  +    L
Sbjct  139  PPLSTKSSMDL  149



>ref|XP_010515113.1| PREDICTED: uncharacterized protein LOC104791013 [Camelina sativa]
Length=151

 Score = 53.9 bits (128),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 45/86 (52%), Gaps = 3/86 (3%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTa  451
            WW     K+RE SE+VAGPRWK  +R+  R           A+F YD  SY L+F++   
Sbjct  53   WWVRAFLKIREWSEIVAGPRWKTFIRRFNRDRRQGRDWDDGAKFRYDPLSYTLSFED--E  110

Query  452  aaaaaeeeQGNGLFRNFSSRYA-VPA  526
                  +E G G  R+FS RYA VP 
Sbjct  111  YKDDDNDETGFGGVRSFSMRYASVPV  136



>ref|XP_006581931.1| PREDICTED: uncharacterized protein LOC102662805 [Glycine max]
Length=179

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 32/77 (42%), Positives = 42/77 (55%), Gaps = 4/77 (5%)
 Frame = +2

Query  293  KVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaee  472
            KVRE SE+ AGPRWK  +R+  R  +   +     ++ YD  SY+LNFD G       + 
Sbjct  89   KVREWSELAAGPRWKTFIRRFSRSRSGWARHA-AGKYQYDPLSYSLNFDEGHNGYFDGDG  147

Query  473  eQGNGLFRNFSSRYAVP  523
              G    RNFS+RYA P
Sbjct  148  YDG---LRNFSARYAAP  161



>emb|CDY28677.1| BnaCnng05630D [Brassica napus]
Length=183

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 52/111 (47%), Gaps = 16/111 (14%)
 Frame = +2

Query  257  ESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGR-YCNPKLKG-----------GYKAQ  400
            E    WW    +K R+ SE+VAGPRWK  +R+ GR +C     G             + +
Sbjct  64   EPGERWWIRGWRKTRQWSELVAGPRWKTFIRRFGRNHCCGGCAGNSDCVAISPNRSEQGK  123

Query  401  FIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
            F YD  SY+LNFD+G          +    ++ +S R+A P++    K  +
Sbjct  124  FRYDPLSYSLNFDDG----KQTGHFEDEFPYQYYSKRFAAPSLPVSTKCPM  170



>ref|XP_010678733.1| PREDICTED: uncharacterized protein LOC104894243 [Beta vulgaris 
subsp. vulgaris]
Length=188

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 56/115 (49%), Gaps = 20/115 (17%)
 Frame = +2

Query  230  GNTRALIGGESAAVWWRGKA---------------KKVRELSEVVAGPRWKNLLRKMGRY  364
            G+T + +  ++ + W R +                KK+RE SE+VAGP+WK  +R+  R 
Sbjct  50   GSTTSSLSDQTPSFWTRFRTADTHNRWWARPFKAFKKIREWSEIVAGPKWKTFIRQFNRR  109

Query  365  CNPKLKGGYKA----QFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYA  517
             +      +      +F YD  SYALNFD G        +E  NG F +FSSR+A
Sbjct  110  RHNHRHHHHHHNSNGKFQYDPLSYALNFDEG-PGQNGHFDEDYNGHFPDFSSRFA  163



>ref|XP_009125023.1| PREDICTED: uncharacterized protein LOC103850070 [Brassica rapa]
Length=183

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/111 (31%), Positives = 52/111 (47%), Gaps = 16/111 (14%)
 Frame = +2

Query  257  ESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGR-YCNPKLKG-----------GYKAQ  400
            E    WW    +K R+ SE+VAGPRWK  +R+ GR +C     G             + +
Sbjct  64   EPGERWWIRGWRKTRQWSELVAGPRWKTFIRRFGRNHCCGGCAGNSDCVAISPNRSEQGK  123

Query  401  FIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
            F YD  SY+LNFD+G          +    ++ +S R+A P++    K  +
Sbjct  124  FRYDPLSYSLNFDDG----KQTGHFEDEFPYQYYSKRFAAPSLPVSTKCPM  170



>gb|KJB40778.1| hypothetical protein B456_007G076900 [Gossypium raimondii]
Length=193

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 58/120 (48%), Gaps = 19/120 (16%)
 Frame = +2

Query  179  SPTGCGCFRLLSFRSGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMG  358
            S  G   ++ L+  + + ++ + +       WW    ++ RE SE+VAGP+WK  +R   
Sbjct  68   SAVGPIWWQHLAVYNNDIDSESSMPSSDNEAWWTRGWRRFREWSELVAGPKWKTFVR---  124

Query  359  RYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLF------RNFSSRYAV  520
            R+ N +   G   +F YD  SYALNFD G           GNG +      RNFS RYA 
Sbjct  125  RFKNNRTGNG-GGKFHYDPLSYALNFDEGPG---------GNGNYDDDYFKRNFSYRYAT  174



>ref|XP_009407999.1| PREDICTED: uncharacterized protein LOC103990540 [Musa acuminata 
subsp. malaccensis]
Length=166

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 61/138 (44%), Gaps = 19/138 (14%)
 Frame = +2

Query  146  NSPIVDEEEAGSPTGCGCF----------RLLSFRSGEGNTRALIGGESAAVWWRG--KA  289
            N+ +   +E  S  GC CF          R++        T  +    S   W RG    
Sbjct  12   NAAMATADEMFSKRGCCCFFVPWPNKAWERIMP--PASERTDGVCPAASRRWWCRGWKAI  69

Query  290  KKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaae  469
             KVRE SE+VAGPRWK  +R+  R       G    +F YD  SYA NFD G        
Sbjct  70   LKVREWSELVAGPRWKTFIRRFRRRPRNGGGGKPGGRFGYDPMSYARNFDEGQ-----GS  124

Query  470  eeQGNGLFRNFSSRYAVP  523
            +  G+ + R FS+RYA P
Sbjct  125  DSDGDTVRRGFSARYATP  142



>ref|XP_008781937.1| PREDICTED: uncharacterized protein LOC103701593 [Phoenix dactylifera]
Length=169

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 37/64 (58%), Gaps = 8/64 (13%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGG-----YKAQFIYDAQSYALNF  436
            WWR    KVRE SE+ AGPRWK  +R+  R  N +  GG       ++F YD  SYALNF
Sbjct  66   WWRA-VMKVREWSELAAGPRWKTFIRRFNR--NARHGGGGVVRMGPSRFQYDPLSYALNF  122

Query  437  DNGT  448
            D G 
Sbjct  123  DEGP  126



>gb|EPS69831.1| hypothetical protein M569_04939, partial [Genlisea aurea]
Length=68

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 25/52 (48%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +2

Query  290  KKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNG  445
            KKVRE SE+VAGP+WK  +R+     +         +F YD  SYALNFD+G
Sbjct  13   KKVREWSELVAGPKWKTFIRRFNHIASGGRAKPPPPRFQYDPLSYALNFDDG  64



>ref|XP_010037576.1| PREDICTED: uncharacterized protein LOC104426279 [Eucalyptus grandis]
 gb|KCW49304.1| hypothetical protein EUGRSUZ_K02860 [Eucalyptus grandis]
Length=189

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 42/80 (53%), Gaps = 7/80 (9%)
 Frame = +2

Query  293  KVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQ------FIYDAQSYALNFDNGTaa  454
            K+RE SEVVAGPRWK  +R+  R  +    GG   Q      F YD  SYALNFD G   
Sbjct  87   KLREWSEVVAGPRWKTFIRRFSRSRSIGAAGGAHDQYRHGGRFNYDPMSYALNFDEGPGH  146

Query  455  aaaaeeeQGN-GLFRNFSSR  511
                 +++     +RNFS R
Sbjct  147  DPHHLDDEDYFRRYRNFSVR  166



>ref|XP_006476749.1| PREDICTED: uncharacterized protein LOC102611479 [Citrus sinensis]
Length=171

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 49/90 (54%), Gaps = 7/90 (8%)
 Frame = +2

Query  257  ESAAVWWRGKA---KKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYA  427
            +S   WW       ++VRE SE+VAGP+WK  +R+  R  +      +  +F YD  SY+
Sbjct  61   QSHDRWWAPAVAAFQRVREWSEIVAGPKWKTFIRRFNRNRSGN-SHSHHGKFQYDPLSYS  119

Query  428  LNFDNGTaaaaaaeeeQGNGLFRNFSSRYA  517
            LNF+  +       +++  G  R+FSSRYA
Sbjct  120  LNFEEDS---NFDNDDEFTGFRRDFSSRYA  146



>ref|XP_006439778.1| hypothetical protein CICLE_v10022556mg [Citrus clementina]
 gb|ESR53018.1| hypothetical protein CICLE_v10022556mg [Citrus clementina]
 gb|KDO69722.1| hypothetical protein CISIN_1g030787mg [Citrus sinensis]
Length=171

 Score = 53.5 bits (127),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 49/90 (54%), Gaps = 7/90 (8%)
 Frame = +2

Query  257  ESAAVWWRGKA---KKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYA  427
            +S   WW       ++VRE SE+VAGP+WK  +R+  R  +      +  +F YD  SY+
Sbjct  61   QSHDRWWAPAVAAFQRVREWSEIVAGPKWKTFIRRFNRNRSGN-SHNHHGKFQYDPLSYS  119

Query  428  LNFDNGTaaaaaaeeeQGNGLFRNFSSRYA  517
            LNF+  +       +++  G  R+FSSRYA
Sbjct  120  LNFEEDS---NFDNDDEFTGFRRDFSSRYA  146



>ref|XP_010942183.1| PREDICTED: uncharacterized protein LOC105060257 [Elaeis guineensis]
Length=150

 Score = 53.1 bits (126),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 46/87 (53%), Gaps = 13/87 (15%)
 Frame = +2

Query  272  WWRGKAK---KVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDN  442
            WW    K   K+RE SE +AGPRWK  +R++GR+     + G  ++F YD  SYALNFD+
Sbjct  54   WWTTGLKALMKLREWSEKLAGPRWKTFIRRVGRHTR---RPG--SRFGYDPLSYALNFDD  108

Query  443  GTaaaaaaeeeQGNGLFRNFSSRYAVP  523
            G          +     R F + YA P
Sbjct  109  GMDNETEDAVAR-----RGFPALYAAP  130



>gb|KFK37608.1| hypothetical protein AALP_AA3G005300 [Arabis alpina]
Length=175

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/122 (28%), Positives = 53/122 (43%), Gaps = 21/122 (17%)
 Frame = +2

Query  239  RALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGR---YCNPKLKG--------  385
            R +   E    WW    +K+RE SE+VAGP+W+  +R+ GR   +C     G        
Sbjct  53   RTVDKLEPDERWWIRGWRKMREWSELVAGPKWETFIRRFGRNHCFCGGGGGGGGNSGGGC  112

Query  386  ------GYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKA  547
                      +F YD  SY+LNFD+G               +R++S R+  P++    K 
Sbjct  113  GGIPNRSEHGKFRYDPLSYSLNFDDG----KQTGHFDDEFPYRDYSMRFTAPSLPVSTKC  168

Query  548  GL  553
             +
Sbjct  169  SI  170



>ref|XP_010426272.1| PREDICTED: uncharacterized protein LOC104711277 [Camelina sativa]
Length=152

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 44/86 (51%), Gaps = 3/86 (3%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTa  451
            WW     K+RE SE+VAGPRWK  +R+  R      K    A F YD  SY L+F     
Sbjct  53   WWVRAFLKIREWSEIVAGPRWKTFMRRFNRDRPRGRKWDDTANFRYDPLSYTLSF--EDE  110

Query  452  aaaaaeeeQGNGLFRNFSSRYA-VPA  526
                 ++E G G  R+FS RYA VP 
Sbjct  111  YKDDDDDEAGFGGVRSFSMRYASVPV  136



>ref|XP_011015544.1| PREDICTED: uncharacterized protein LOC105119136, partial [Populus 
euphratica]
Length=138

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 34/60 (57%), Gaps = 6/60 (10%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQ--FIYDAQSYALNFDNG  445
            WW     K+R+ SE+VAGP+WK  LR+     N K  GG      F YD  SYALNFD G
Sbjct  67   WWFQGWMKIRDWSELVAGPKWKTFLRRF----NKKPGGGNPQHGNFQYDPSSYALNFDEG  122



>ref|XP_008393048.1| PREDICTED: uncharacterized protein LOC103455237 [Malus domestica]
Length=142

 Score = 52.0 bits (123),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 49/98 (50%), Gaps = 13/98 (13%)
 Frame = +2

Query  272  WWRGKAK---KVRELSEVVAGPRWKNLLRKMG---RYCNPKLKGGYKAQFIYDAQSYALN  433
            WW    K   K+RE SE+VAGP+WK  +R+             GG   +F YD  SYALN
Sbjct  38   WWSRGIKALYKLREWSEIVAGPKWKTFIRRFNRSRSGGGSSGGGGRHGKFQYDPLSYALN  97

Query  434  FDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKA  547
            FD G             G FR+FS+R+A  ++ Q  K+
Sbjct  98   FDEGPVDEDDEA-----GGFRDFSARFA--SIPQPAKS  128



>ref|XP_010456536.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104737993 
[Camelina sativa]
Length=716

 Score = 54.3 bits (129),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/115 (30%), Positives = 53/115 (46%), Gaps = 13/115 (11%)
 Frame = +2

Query  236  TRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGY--------  391
             R +   E    WW     K+RE SE++AGP+WK  +R+ GR       GG         
Sbjct  593  IRTVDKLEPDERWWVSGWMKMREWSELLAGPKWKTFIRRFGRNHCCGGGGGVDGAGCNRP  652

Query  392  -KAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
                F YD+ SY+LNFD+G          +    +R++S+R+  P++    K  +
Sbjct  653  EHVSFRYDSWSYSLNFDDG----KQTGHFEDEFPYRDYSTRFTAPSLPVSTKCSI  703



>ref|NP_186792.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF24613.1|AC010870_6 hypothetical protein [Arabidopsis thaliana]
 dbj|BAC43514.1| unknown protein [Arabidopsis thaliana]
 gb|AAO63970.1| unknown protein [Arabidopsis thaliana]
 gb|AEE73665.1| uncharacterized protein AT3G01430 [Arabidopsis thaliana]
Length=180

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/163 (27%), Positives = 66/163 (40%), Gaps = 40/163 (25%)
 Frame = +2

Query  188  GCGCFRLLSFRSGEGNTR----------ALIGGESAAVWWRGKAKKVRELSEVVAGPRWK  337
            GC CF +    S + +TR           +   E    WW    +++RE SE+VAGPRWK
Sbjct  26   GC-CFLMPCLASSQPSTRGGSVWWQRITTVDKLEPDERWWIRGWRRMREWSELVAGPRWK  84

Query  338  NLLRKMGRYCNPKL-------------------KGGYKAQFIYDAQSYALNFDNGTaaaa  460
              +R+ GR                         +   + +F YD  SY+LNFD+G     
Sbjct  85   TYIRRFGRSNCCGGGGGRVGNSSGGCGGGAMPNRSSDQGKFRYDQLSYSLNFDDGN----  140

Query  461  aaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL*RGQICHFGSDI  589
                      +R++S R+A P++    K  +       F SDI
Sbjct  141  QTGHFDDEFPYRDYSMRFAAPSLPVSTKCSI------DFDSDI  177



>emb|CDP19326.1| unnamed protein product [Coffea canephora]
Length=172

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 47/88 (53%), Gaps = 3/88 (3%)
 Frame = +2

Query  266  AVWWRGKA--KKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFD  439
            + W RG +  KK+RE SE+ AGPRWK  +R+  R    +    +   + YD  SY+LNFD
Sbjct  65   SFWARGISALKKIREWSEIAAGPRWKTFIRRFSRTGRRRNNNNFGCNYQYDPLSYSLNFD  124

Query  440  NGTaaaaaaeeeQGNGL-FRNFSSRYAV  520
             GT       + + +    RNFS RYA 
Sbjct  125  EGTGQNGDYGDGEEDYYGLRNFSVRYAT  152



>gb|KDO66248.1| hypothetical protein CISIN_1g044380mg [Citrus sinensis]
Length=259

 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 62/141 (44%), Gaps = 36/141 (26%)
 Frame = +2

Query  188  GCGCFRLLSFRSGEGNTRALIGGE-----------SAAVWWRGKAKKVRELSEVVAGPRW  334
            GC CF +  F S  G + + +  E           + A WW    K++RE SE+ AGP+W
Sbjct  117  GC-CFWIPCFGSKPGQSPSSVWWERIRAVDYNYKANDAPWWTRGWKRLREWSEITAGPKW  175

Query  335  KNLLRKMGR------YCNPKLKGG--------YKAQFIYDAQSYALNFDNGTaaaaaaee  472
            K  +R   +       C   ++GG         + +F YD  SY+LNFD G A       
Sbjct  176  KTFIRTFRKNHQRFVIC---VRGGCAGGAQHRQQPKFYYDPLSYSLNFDEGAATDEDLAS  232

Query  473  eQGNGLFRNFSSRYAVPAVGQ  535
                   R+FSSR+A    G+
Sbjct  233  -------RDFSSRFASVVFGK  246



>ref|XP_006446457.1| hypothetical protein CICLE_v10016328mg [Citrus clementina]
 gb|ESR59697.1| hypothetical protein CICLE_v10016328mg [Citrus clementina]
Length=259

 Score = 53.1 bits (126),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 62/142 (44%), Gaps = 36/142 (25%)
 Frame = +2

Query  188  GCGCFRLLSFRSGEGNTRALIGGE-----------SAAVWWRGKAKKVRELSEVVAGPRW  334
            GC CF +  F S  G + + +  E           + A WW    K++RE SE+ AGP+W
Sbjct  117  GC-CFWIPCFGSKPGPSPSSVWWERIRAVDYNYKANDAPWWTRGWKRLREWSEITAGPKW  175

Query  335  KNLLRKMGR------YCNPKLKGG--------YKAQFIYDAQSYALNFDNGTaaaaaaee  472
            K  +R   +       C   ++GG         + +F YD  SY+LNFD G A       
Sbjct  176  KTFIRTFRKNHQRFVIC---VRGGCAGGAQHRQQPKFYYDPLSYSLNFDEGAATDEDLAS  232

Query  473  eQGNGLFRNFSSRYAVPAVGQQ  538
                   R+FSSR+A    G+ 
Sbjct  233  -------RDFSSRFASVVFGKD  247



>ref|XP_010442314.1| PREDICTED: uncharacterized protein LOC104725353 [Camelina sativa]
Length=176

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/107 (30%), Positives = 49/107 (46%), Gaps = 17/107 (16%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKM------------GRYCNPKLKGGY-KAQFIYD  412
            WW    +K+RE SE+VAGPRWK  +R+                   +  G +   +F YD
Sbjct  61   WWIRGWRKMREWSELVAGPRWKTFIRRFGRNRCCGGGGGGNIGGGGECAGNHNHGKFRYD  120

Query  413  AQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
              SY+LNFD+G               +R++S R+A P++    K  +
Sbjct  121  PLSYSLNFDDGK----QTGHFDDEFPYRDYSMRFAAPSLPVSTKCSI  163



>ref|NP_190385.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB41137.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAT41834.1| At3g48020 [Arabidopsis thaliana]
 dbj|BAD43879.1| unknown protein [Arabidopsis thaliana]
 gb|AEE78357.1| uncharacterized protein AT3G48020 [Arabidopsis thaliana]
Length=135

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 45/95 (47%), Gaps = 4/95 (4%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTa  451
            WW     K+RE SE+VAGPRWK  +R+  R            +F YD  SY L+F++   
Sbjct  38   WWVRAFLKIREWSEIVAGPRWKTFIRRFNRDPRRGQDWDDSDKFRYDPVSYTLSFEDEDK  97

Query  452  aaaaaeeeQGNGLFRNFSSRYA-VPAVGQQMKAGL  553
                     G G  R+FS RYA VP    +  A +
Sbjct  98   DDDDEA---GVGGVRSFSMRYASVPVASGKSPAVI  129



>gb|EPS65826.1| hypothetical protein M569_08952, partial [Genlisea aurea]
Length=153

 Score = 51.2 bits (121),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 57/128 (45%), Gaps = 15/128 (12%)
 Frame = +2

Query  197  CFRLLSFRSGEGNTRALIGGESAAVWWRGKA------------KKVRELSEVVAGPRWKN  340
            CF    F   E ++     G  A  WW   +             K+RE SE++AGPRWK 
Sbjct  29   CFYFPCFDRSEADSSRGGDGTGAPSWWTKMSGSALWTRGVDALMKIREWSEILAGPRWKT  88

Query  341  LLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAV  520
             +R+  R       G + A + YD  SYA+NFD G   +    +E      RNFSSRYA 
Sbjct  89   FIRRFNRNRGGGGNGKH-ANYQYDPLSYAMNFDEGNGISDLEADEAYYS--RNFSSRYAK  145

Query  521  PAVGQQMK  544
             ++    K
Sbjct  146  GSIDLPYK  153



>ref|XP_010660943.1| PREDICTED: uncharacterized protein LOC104881674 [Vitis vinifera]
Length=154

 Score = 50.8 bits (120),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 53/98 (54%), Gaps = 10/98 (10%)
 Frame = +2

Query  272  WW-RG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDN  442
            WW RG    K++RE +E+ AGPRWK  +R+ G+       GG   +F YD  SYA+NFD 
Sbjct  55   WWSRGLNALKQIREWTEIHAGPRWKTFIRQFGKSR--GGGGGRHGKFNYDPLSYAMNFDE  112

Query  443  GTaaaaaaeeeQGNGLFRNFSSRYAV--PAVGQQMKAG  550
            G       +E+ G   + +FS RYA   P+V   M  G
Sbjct  113  GPRQYGHLDEDHG---YPDFSYRYASLPPSVKSSMDLG  147



>ref|XP_006286820.1| hypothetical protein CARUB_v10003765mg [Capsella rubella]
 gb|EOA19718.1| hypothetical protein CARUB_v10003765mg [Capsella rubella]
Length=142

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/108 (31%), Positives = 48/108 (44%), Gaps = 19/108 (18%)
 Frame = +2

Query  161  DEEEAGSPTGCGCFRLLSF----------------RSGEGNTRALIGGESAAVWWRGKAK  292
            D EE  +  GCG FR L                  R   G+  +L        W   K K
Sbjct  13   DHEETAAFCGCGYFRKLCVVRWRRRRGGGDDDEEARLHHGHRGSLQEERGVVNWGIEKLK  72

Query  293  KVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNF  436
             ++E+SE +AGP+WKN +R    + + + K      F YD ++Y+LNF
Sbjct  73   GLKEISEKIAGPKWKNFIRS---FSHSRKKMRRDVDFTYDLKNYSLNF  117



>gb|AFW76806.1| hypothetical protein ZEAMMB73_771266 [Zea mays]
Length=188

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 46/87 (53%), Gaps = 2/87 (2%)
 Frame = +2

Query  293  KVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaee  472
            KVRE SE++AGPRWK  +R+  R  +     G   +  YD  SYALNFD G  AA   + 
Sbjct  80   KVREWSELMAGPRWKTFIRRFRRGSSRHGANG-GGKLNYDPLSYALNFDEGHGAANPEDG  138

Query  473  eQGNGLFRNFSSRYAVPAVGQQMKAGL  553
            +   G  R+ S+R+  P  G    + +
Sbjct  139  DY-QGYDRDISTRFVAPLPGSAKSSSM  164



>ref|XP_002875874.1| hypothetical protein ARALYDRAFT_485163 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52133.1| hypothetical protein ARALYDRAFT_485163 [Arabidopsis lyrata subsp. 
lyrata]
Length=136

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/93 (37%), Positives = 43/93 (46%), Gaps = 4/93 (4%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTa  451
            WW     K+RE SE+VAGPRWK  +R+  R            +F YD  SY L+F++   
Sbjct  39   WWVRAFLKIREWSEIVAGPRWKTFIRRFNRDPRRGRDWDDSDKFRYDPASYTLSFEDEDK  98

Query  452  aaaaaeeeQGNGLFRNFSSRYA-VPAVGQQMKA  547
                     G G  R+FS RYA VP       A
Sbjct  99   DDDDEA---GFGGARSFSMRYASVPVASGTTPA  128



>ref|XP_010482123.1| PREDICTED: uncharacterized protein LOC104760847 [Camelina sativa]
Length=177

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/108 (30%), Positives = 49/108 (45%), Gaps = 18/108 (17%)
 Frame = +2

Query  272  WWRGKAKKVRELSEVVAGPRWKNLLRKMGR--------------YCNPKLKGGYKAQFIY  409
            WW    +K+RE SE+VAGPR K  +R+ GR                       +  +F Y
Sbjct  61   WWIRGWRKMREWSELVAGPRLKTFIRRFGRNRCCGVGGGGNSGGGGGCAGNHNHHGKFGY  120

Query  410  DAQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAVPAVGQQMKAGL  553
            D  SY+LNFD+G        +      +R++S R+A P++    K  +
Sbjct  121  DPLSYSLNFDDGK----QTGQFDDEFPYRDYSMRFAAPSLPVSTKYSI  164



>emb|CAN80444.1| hypothetical protein VITISV_043283 [Vitis vinifera]
Length=221

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 53/98 (54%), Gaps = 10/98 (10%)
 Frame = +2

Query  272  WW-RG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDN  442
            WW RG    K++RE +E+ AGPRWK  +R+ G+       GG   +F YD  SYA+NFD 
Sbjct  55   WWSRGLNALKQIREWTEIHAGPRWKTFIRQFGKSR--GGGGGRHGKFNYDPLSYAMNFDE  112

Query  443  GTaaaaaaeeeQGNGLFRNFSSRYAV--PAVGQQMKAG  550
            G       +E+ G   + +FS RYA   P+V   M  G
Sbjct  113  GPRQYGHLDEDHG---YPDFSYRYASLPPSVKSSMDLG  147



>ref|XP_008649265.1| PREDICTED: uncharacterized protein LOC103629942 [Zea mays]
Length=223

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/87 (38%), Positives = 46/87 (53%), Gaps = 2/87 (2%)
 Frame = +2

Query  293  KVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNFDNGTaaaaaaee  472
            KVRE SE++AGPRWK  +R+  R  +     G   +  YD  SYALNFD G  AA   + 
Sbjct  115  KVREWSELMAGPRWKTFIRRFRRGSSRHGANG-GGKLNYDPLSYALNFDEGHGAANPEDG  173

Query  473  eQGNGLFRNFSSRYAVPAVGQQMKAGL  553
            +   G  R+ S+R+  P  G    + +
Sbjct  174  DY-QGYDRDISTRFVAPLPGSAKSSSM  199



>gb|KJB40779.1| hypothetical protein B456_007G076900 [Gossypium raimondii]
Length=211

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 47/90 (52%), Gaps = 4/90 (4%)
 Frame = +2

Query  176  GSPTGCGCFRLLSFRSGEGNTRALIGGESAAVWWRGKAKKVRELSEVVAGPRWKNLLRKM  355
             S  G   ++ L+  + + ++ + +       WW    ++ RE SE+VAGP+WK  +R  
Sbjct  67   NSAVGPIWWQHLAVYNNDIDSESSMPSSDNEAWWTRGWRRFREWSELVAGPKWKTFVR--  124

Query  356  GRYCNPKLKGGYKAQFIYDAQSYALNFDNG  445
             R+ N +   G   +F YD  SYALNFD G
Sbjct  125  -RFKNNRTGNG-GGKFHYDPLSYALNFDEG  152



>ref|XP_002874246.1| hypothetical protein ARALYDRAFT_489375 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50505.1| hypothetical protein ARALYDRAFT_489375, partial [Arabidopsis 
lyrata subsp. lyrata]
Length=128

 Score = 48.9 bits (115),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 46/101 (46%), Gaps = 12/101 (12%)
 Frame = +2

Query  161  DEEEAGSPTGCGCFRLLSF---------RSGEGNTRALIGGESAAVWWRGKAKKVRELSE  313
            D EE  +  GCG FR L               G     +  E    W   K K ++E+SE
Sbjct  12   DYEETATFCGCGFFRKLCVVRWRRRDDESRSRGGWSGCLQEERGGKWGSEKLKGLKEISE  71

Query  314  VVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYDAQSYALNF  436
             +AGP+WKN +R    + + + K      F YD ++Y+LNF
Sbjct  72   KIAGPKWKNFIRS---FSSGRKKMKRDVDFTYDLKNYSLNF  109



>ref|XP_007209671.1| hypothetical protein PRUPE_ppa012215mg [Prunus persica]
 gb|EMJ10870.1| hypothetical protein PRUPE_ppa012215mg [Prunus persica]
Length=179

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 48/94 (51%), Gaps = 13/94 (14%)
 Frame = +2

Query  272  WWRGKAK---KVRELSEVVAGPRWKNLLRKMGR----YCNPKLKGGYKAQFIYDAQSYAL  430
            WW    K   K+RE SE+VAGPRWK  +R+  R           G +  +F YD  SYAL
Sbjct  76   WWSRGFKAFYKLREWSEIVAGPRWKTFIRRFNRNRSGGGGSSGAGRHHGKFQYDPLSYAL  135

Query  431  NFDNGTaaaaaaeeeQGNGLFRNFSSRYA-VPAV  529
            NFD G             G FR+FS+R+A +P V
Sbjct  136  NFDEGKEDEDDEV-----GGFRDFSTRFASLPPV  164



>emb|CBI34951.3| unnamed protein product [Vitis vinifera]
Length=811

 Score = 50.8 bits (120),  Expect = 5e-04, Method: Composition-based stats.
 Identities = 42/108 (39%), Positives = 58/108 (54%), Gaps = 12/108 (11%)
 Frame = +2

Query  248  IGG--ESAAVWW-RG--KAKKVRELSEVVAGPRWKNLLRKMGRYCNPKLKGGYKAQFIYD  412
            +GG  E    WW RG    K++RE +E+ AGPRWK  +R+ G+  +    GG   +F YD
Sbjct  655  VGGPAEKKDGWWSRGLNALKQIREWTEIHAGPRWKTFIRQFGK--SRGGGGGRHGKFNYD  712

Query  413  AQSYALNFDNGTaaaaaaeeeQGNGLFRNFSSRYAV--PAVGQQMKAG  550
              SYA+NFD G       +E+ G   + +FS RYA   P+V   M  G
Sbjct  713  PLSYAMNFDEGPRQYGHLDEDHG---YPDFSYRYASLPPSVKSSMDLG  757



>ref|XP_008239737.1| PREDICTED: uncharacterized protein LOC103338321 [Prunus mume]
Length=192

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 39/94 (41%), Positives = 51/94 (54%), Gaps = 13/94 (14%)
 Frame = +2

Query  272  WWRGKAK---KVRELSEVVAGPRWKNLLRKMGR----YCNPKLKGGYKAQFIYDAQSYAL  430
            WW    K   K+RE SE+VAGPRWK  +R+  R           G +  +F YD  SYAL
Sbjct  89   WWSRGLKAFYKLREWSEIVAGPRWKTFIRRFNRNRSGGGGSSGAGRHHGKFQYDPLSYAL  148

Query  431  NFDNGTaaaaaaeeeQGNGLFRNFSSRYA-VPAV  529
            NFD G       +E+   G FR+FS+R+A +P V
Sbjct  149  NFDEGK-----EDEDDEGGGFRDFSTRFASLPPV  177



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1323106870870