BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2585

Length=694
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783768.1|  PREDICTED: protein trichome birefringence-li...    218   1e-65   Nicotiana sylvestris
emb|CDP06048.1|  unnamed protein product                                209   8e-62   Coffea canephora [robusta coffee]
ref|XP_009610283.1|  PREDICTED: protein trichome birefringence-li...    207   3e-61   Nicotiana tomentosiformis
ref|XP_010314298.1|  PREDICTED: protein trichome birefringence-li...    195   1e-56   Solanum lycopersicum
gb|EYU26299.1|  hypothetical protein MIMGU_mgv1a018701mg                190   1e-55   Erythranthe guttata [common monkey flower]
ref|XP_006360069.1|  PREDICTED: uncharacterized protein LOC102593192    191   3e-55   Solanum tuberosum [potatoes]
ref|XP_006359475.1|  PREDICTED: uncharacterized protein LOC102598428    191   4e-55   Solanum tuberosum [potatoes]
ref|XP_010327259.1|  PREDICTED: protein trichome birefringence-li...    191   6e-55   
ref|XP_011098189.1|  PREDICTED: protein trichome birefringence-li...    191   2e-54   
gb|KHG24040.1|  Ribosomal S6 modification protein                       178   5e-50   Gossypium arboreum [tree cotton]
ref|XP_007021953.1|  Trichome birefringence-like 42                     178   5e-50   
ref|XP_010675282.1|  PREDICTED: protein trichome birefringence-li...    178   5e-50   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB12976.1|  hypothetical protein B456_002G048100                    174   3e-48   Gossypium raimondii
ref|XP_004295669.1|  PREDICTED: protein trichome birefringence-li...    170   5e-47   Fragaria vesca subsp. vesca
ref|XP_010093461.1|  hypothetical protein L484_017522                   166   2e-45   
ref|XP_008226367.1|  PREDICTED: protein trichome birefringence-li...    165   5e-45   Prunus mume [ume]
ref|XP_010675348.1|  PREDICTED: protein trichome birefringence-li...    163   1e-44   
emb|CBI20116.3|  unnamed protein product                                163   2e-44   Vitis vinifera
ref|XP_006477834.1|  PREDICTED: protein YLS7-like                       163   3e-44   Citrus sinensis [apfelsine]
ref|XP_007211478.1|  hypothetical protein PRUPE_ppa007592mg             162   4e-44   Prunus persica
ref|XP_010912702.1|  PREDICTED: protein trichome birefringence-li...    163   5e-44   Elaeis guineensis
ref|XP_002283640.1|  PREDICTED: protein trichome birefringence-li...    162   6e-44   Vitis vinifera
ref|XP_008351025.1|  PREDICTED: protein trichome birefringence-li...    157   3e-43   
ref|XP_008365523.1|  PREDICTED: protein trichome birefringence-li...    157   4e-43   
ref|XP_006442365.1|  hypothetical protein CICLE_v10023594mg             158   2e-42   
gb|KDO42403.1|  hypothetical protein CISIN_1g017556mg                   158   3e-42   Citrus sinensis [apfelsine]
ref|XP_009396650.1|  PREDICTED: protein trichome birefringence-li...    158   3e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007215849.1|  hypothetical protein PRUPE_ppa010297mg             154   4e-42   
ref|XP_009394133.1|  PREDICTED: protein trichome birefringence-li...    157   5e-42   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011082791.1|  PREDICTED: protein trichome birefringence-li...    156   7e-42   Sesamum indicum [beniseed]
ref|XP_008451728.1|  PREDICTED: protein trichome birefringence-li...    156   9e-42   Cucumis melo [Oriental melon]
ref|XP_007149523.1|  hypothetical protein PHAVU_005G077300g             153   1e-41   Phaseolus vulgaris [French bean]
ref|XP_010273483.1|  PREDICTED: protein trichome birefringence-li...    156   1e-41   Nelumbo nucifera [Indian lotus]
ref|XP_010060752.1|  PREDICTED: protein trichome birefringence-li...    153   2e-41   
ref|XP_009411213.1|  PREDICTED: protein trichome birefringence-li...    155   3e-41   
ref|XP_002278078.2|  PREDICTED: protein trichome birefringence-li...    155   3e-41   Vitis vinifera
ref|XP_010549391.1|  PREDICTED: protein trichome birefringence-li...    155   3e-41   Tarenaya hassleriana [spider flower]
ref|XP_004137309.1|  PREDICTED: protein trichome birefringence-li...    155   4e-41   Cucumis sativus [cucumbers]
ref|XP_010060751.1|  PREDICTED: protein trichome birefringence-li...    153   4e-41   
ref|XP_004969334.1|  PREDICTED: uncharacterized protein LOC101766252    155   6e-41   Setaria italica
ref|XP_009587076.1|  PREDICTED: protein trichome birefringence-li...    154   6e-41   Nicotiana tomentosiformis
ref|XP_009769822.1|  PREDICTED: protein trichome birefringence-li...    151   7e-41   Nicotiana sylvestris
gb|KGN51104.1|  hypothetical protein Csa_5G450150                       151   1e-40   Cucumis sativus [cucumbers]
ref|XP_009376740.1|  PREDICTED: protein trichome birefringence-li...    153   1e-40   Pyrus x bretschneideri [bai li]
emb|CDY37673.1|  BnaA04g19950D                                          147   2e-40   Brassica napus [oilseed rape]
ref|XP_002316834.2|  hypothetical protein POPTR_0011s07550g             149   2e-40   
ref|XP_007149522.1|  hypothetical protein PHAVU_005G077300g             152   2e-40   Phaseolus vulgaris [French bean]
ref|XP_010538205.1|  PREDICTED: protein trichome birefringence-li...    150   2e-40   
gb|KCW67608.1|  hypothetical protein EUGRSUZ_F01363                     152   2e-40   Eucalyptus grandis [rose gum]
ref|XP_010670414.1|  PREDICTED: protein trichome birefringence-li...    152   2e-40   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS68141.1|  hypothetical protein TRIUR3_18151                       150   3e-40   Triticum urartu
gb|EMT21950.1|  hypothetical protein F775_18320                         154   3e-40   
gb|EPS73377.1|  hypothetical protein M569_01379                         151   3e-40   Genlisea aurea
emb|CDM83556.1|  unnamed protein product                                152   4e-40   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009769816.1|  PREDICTED: protein trichome birefringence-li...    152   5e-40   Nicotiana sylvestris
ref|XP_009790315.1|  PREDICTED: protein trichome birefringence-li...    152   6e-40   Nicotiana sylvestris
ref|XP_002458239.1|  hypothetical protein SORBIDRAFT_03g029700          152   6e-40   Sorghum bicolor [broomcorn]
ref|XP_008228905.1|  PREDICTED: protein trichome birefringence-li...    151   8e-40   Prunus mume [ume]
ref|XP_007216516.1|  hypothetical protein PRUPE_ppa024241mg             150   9e-40   
ref|XP_008228904.1|  PREDICTED: protein trichome birefringence-li...    151   1e-39   Prunus mume [ume]
ref|XP_009769585.1|  PREDICTED: protein trichome birefringence-li...    151   1e-39   Nicotiana sylvestris
ref|XP_009410826.1|  PREDICTED: protein trichome birefringence-li...    151   1e-39   
ref|XP_010273288.1|  PREDICTED: protein trichome birefringence-li...    151   1e-39   Nelumbo nucifera [Indian lotus]
dbj|BAJ89025.1|  predicted protein                                      151   1e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007212437.1|  hypothetical protein PRUPE_ppa016768mg             150   1e-39   
ref|XP_011044588.1|  PREDICTED: protein trichome birefringence-li...    150   1e-39   Populus euphratica
ref|XP_002522557.1|  conserved hypothetical protein                     150   2e-39   Ricinus communis
ref|XP_011082790.1|  PREDICTED: protein trichome birefringence-li...    150   2e-39   Sesamum indicum [beniseed]
ref|XP_002317442.1|  hypothetical protein POPTR_0011s10730g             150   2e-39   
ref|XP_010272740.1|  PREDICTED: protein trichome birefringence-li...    150   2e-39   Nelumbo nucifera [Indian lotus]
ref|XP_010273484.1|  PREDICTED: protein trichome birefringence-li...    150   3e-39   Nelumbo nucifera [Indian lotus]
ref|XP_009590818.1|  PREDICTED: protein trichome birefringence-li...    150   3e-39   Nicotiana tomentosiformis
ref|XP_009590824.1|  PREDICTED: protein trichome birefringence-li...    150   3e-39   Nicotiana tomentosiformis
ref|XP_004294162.2|  PREDICTED: protein trichome birefringence-li...    150   3e-39   Fragaria vesca subsp. vesca
ref|XP_006305057.1|  hypothetical protein CARUB_v10009422mg             150   3e-39   Capsella rubella
ref|XP_007021952.1|  Lustrin A-like, putative                           150   3e-39   
ref|XP_011080615.1|  PREDICTED: protein trichome birefringence-li...    150   3e-39   Sesamum indicum [beniseed]
ref|XP_010522062.1|  PREDICTED: protein trichome birefringence-li...    149   4e-39   
gb|KJB24277.1|  hypothetical protein B456_004G138200                    149   4e-39   Gossypium raimondii
gb|KFK44758.1|  hypothetical protein AALP_AA1G299000                    150   4e-39   Arabis alpina [alpine rockcress]
ref|XP_008345148.1|  PREDICTED: protein trichome birefringence-li...    149   4e-39   
ref|XP_007211900.1|  hypothetical protein PRUPE_ppa010388mg             146   5e-39   
ref|XP_010064516.1|  PREDICTED: protein trichome birefringence-li...    149   5e-39   Eucalyptus grandis [rose gum]
ref|XP_008381177.1|  PREDICTED: protein trichome birefringence-li...    147   5e-39   
ref|XP_008228877.1|  PREDICTED: protein trichome birefringence-li...    146   6e-39   
ref|XP_010093465.1|  hypothetical protein L484_017526                   146   6e-39   
ref|XP_010522061.1|  PREDICTED: protein trichome birefringence-li...    149   6e-39   Tarenaya hassleriana [spider flower]
ref|XP_011656226.1|  PREDICTED: uncharacterized protein LOC101214809    152   7e-39   Cucumis sativus [cucumbers]
ref|XP_007216008.1|  hypothetical protein PRUPE_ppa014688mg             149   7e-39   Prunus persica
ref|XP_010540499.1|  PREDICTED: protein trichome birefringence-li...    149   7e-39   Tarenaya hassleriana [spider flower]
ref|NP_177992.1|  trichome birefringence-like 42                        149   7e-39   Arabidopsis thaliana [mouse-ear cress]
gb|AFK49604.1|  unknown                                                 149   7e-39   Lotus japonicus
ref|XP_010273481.1|  PREDICTED: protein trichome birefringence-li...    149   8e-39   Nelumbo nucifera [Indian lotus]
gb|KJB69610.1|  hypothetical protein B456_011G033800                    149   8e-39   Gossypium raimondii
gb|KJB74418.1|  hypothetical protein B456_011G293800                    148   1e-38   Gossypium raimondii
ref|XP_012091746.1|  PREDICTED: protein trichome birefringence-li...    148   1e-38   Jatropha curcas
ref|XP_006597476.1|  PREDICTED: protein YLS7-like                       148   1e-38   Glycine max [soybeans]
ref|XP_010509796.1|  PREDICTED: protein trichome birefringence-li...    148   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_004485883.1|  PREDICTED: uncharacterized protein LOC101498973    148   1e-38   Cicer arietinum [garbanzo]
ref|XP_010469399.1|  PREDICTED: protein trichome birefringence-li...    148   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010413780.1|  PREDICTED: protein trichome birefringence-li...    148   1e-38   Camelina sativa [gold-of-pleasure]
ref|NP_001043736.1|  Os01g0652100                                       149   1e-38   
ref|XP_008225213.1|  PREDICTED: protein trichome birefringence-li...    148   1e-38   Prunus mume [ume]
gb|AGV54877.1|  hypothetical protein                                    147   2e-38   Phaseolus vulgaris [French bean]
ref|XP_010499424.1|  PREDICTED: protein trichome birefringence-li...    148   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010460674.1|  PREDICTED: protein trichome birefringence-li...    148   2e-38   Camelina sativa [gold-of-pleasure]
emb|CDX79555.1|  BnaC03g18910D                                          148   2e-38   
ref|XP_010480710.1|  PREDICTED: protein trichome birefringence-li...    149   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_002305083.1|  hypothetical protein POPTR_0004s05420g             149   2e-38   
ref|XP_009132974.1|  PREDICTED: protein trichome birefringence-li...    148   2e-38   Brassica rapa
emb|CDX84658.1|  BnaA03g15720D                                          147   2e-38   
ref|XP_006646157.1|  PREDICTED: protein YLS7-like                       148   2e-38   
gb|KHN20810.1|  hypothetical protein glysoja_049140                     145   2e-38   Glycine soja [wild soybean]
ref|XP_009102887.1|  PREDICTED: protein trichome birefringence-li...    147   3e-38   Brassica rapa
gb|AFK41428.1|  unknown                                                 147   3e-38   Medicago truncatula
gb|KJB12973.1|  hypothetical protein B456_002G048100                    147   3e-38   Gossypium raimondii
emb|CDX94643.1|  BnaC07g10150D                                          147   3e-38   
emb|CBI17734.3|  unnamed protein product                                147   3e-38   Vitis vinifera
gb|KJB34893.1|  hypothetical protein B456_006G088800                    147   4e-38   Gossypium raimondii
ref|XP_011460601.1|  PREDICTED: protein trichome birefringence-li...    147   4e-38   Fragaria vesca subsp. vesca
ref|XP_008381176.1|  PREDICTED: protein trichome birefringence-li...    147   5e-38   
ref|XP_002283620.1|  PREDICTED: protein trichome birefringence-li...    145   5e-38   Vitis vinifera
gb|KHG13558.1|  Ethylene-responsive transcription factor                140   5e-38   Gossypium arboreum [tree cotton]
gb|KHN11944.1|  hypothetical protein glysoja_019917                     143   5e-38   Glycine soja [wild soybean]
ref|XP_009352799.1|  PREDICTED: protein trichome birefringence-li...    146   5e-38   Pyrus x bretschneideri [bai li]
gb|KJB12975.1|  hypothetical protein B456_002G048100                    147   5e-38   Gossypium raimondii
ref|XP_003634905.1|  PREDICTED: protein trichome birefringence-li...    146   5e-38   Vitis vinifera
ref|XP_007153710.1|  hypothetical protein PHAVU_003G058400g             146   5e-38   Phaseolus vulgaris [French bean]
gb|KEH38565.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    146   5e-38   Medicago truncatula
ref|XP_006348399.1|  PREDICTED: uncharacterized protein LOC102583199    147   6e-38   Solanum tuberosum [potatoes]
ref|XP_004305456.2|  PREDICTED: protein trichome birefringence-li...    146   6e-38   Fragaria vesca subsp. vesca
gb|KJB12974.1|  hypothetical protein B456_002G048100                    147   6e-38   Gossypium raimondii
ref|XP_002283611.1|  PREDICTED: protein trichome birefringence-li...    146   6e-38   Vitis vinifera
ref|XP_006294394.1|  hypothetical protein CARUB_v10023411mg             147   6e-38   Capsella rubella
ref|XP_012068612.1|  PREDICTED: protein trichome birefringence-li...    146   6e-38   Jatropha curcas
gb|KHG17132.1|  CAS1 domain-containing 1                                146   7e-38   Gossypium arboreum [tree cotton]
ref|NP_565779.1|  trichome birefringence-like 37 protein                146   8e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008371453.1|  PREDICTED: protein trichome birefringence-li...    146   8e-38   Malus domestica [apple tree]
ref|XP_009359364.1|  PREDICTED: protein trichome birefringence-li...    142   8e-38   Pyrus x bretschneideri [bai li]
ref|XP_010272739.1|  PREDICTED: protein trichome birefringence-li...    145   9e-38   Nelumbo nucifera [Indian lotus]
ref|XP_003593750.1|  hypothetical protein MTR_2g015720                  145   1e-37   Medicago truncatula
gb|EYU46053.1|  hypothetical protein MIMGU_mgv1a008647mg                145   1e-37   Erythranthe guttata [common monkey flower]
ref|XP_008245553.1|  PREDICTED: protein trichome birefringence-li...    145   1e-37   Prunus mume [ume]
gb|EYU38243.1|  hypothetical protein MIMGU_mgv1a012415mg                143   1e-37   Erythranthe guttata [common monkey flower]
ref|XP_002893546.1|  hypothetical protein ARALYDRAFT_473111             146   1e-37   
gb|AAF88130.1|AC021043_23  Unknown protein                              145   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007025417.1|  Trichome birefringence-like 37 isoform 1           145   1e-37   
ref|XP_003593751.1|  hypothetical protein MTR_2g015720                  145   1e-37   
ref|XP_011042150.1|  PREDICTED: protein trichome birefringence-li...    145   1e-37   Populus euphratica
ref|XP_011005473.1|  PREDICTED: protein trichome birefringence-li...    145   1e-37   Populus euphratica
ref|XP_010915618.1|  PREDICTED: protein trichome birefringence-li...    145   1e-37   Elaeis guineensis
emb|CDP06044.1|  unnamed protein product                                145   2e-37   Coffea canephora [robusta coffee]
ref|NP_564318.1|  protein trichome birefringence-like 38                145   2e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009359360.1|  PREDICTED: protein trichome birefringence-li...    142   2e-37   
emb|CDY17220.1|  BnaA05g09680D                                          145   2e-37   Brassica napus [oilseed rape]
ref|XP_002887755.1|  hypothetical protein ARALYDRAFT_316771             145   2e-37   Arabidopsis lyrata subsp. lyrata
ref|XP_006477896.1|  PREDICTED: protein YLS7-like                       145   2e-37   
ref|XP_002516811.1|  conserved hypothetical protein                     145   2e-37   
gb|KJB68384.1|  hypothetical protein B456_010G242200                    145   2e-37   Gossypium raimondii
ref|XP_006415616.1|  hypothetical protein EUTSA_v10007896mg             145   2e-37   Eutrema salsugineum [saltwater cress]
gb|KHN21700.1|  hypothetical protein glysoja_050079                     142   2e-37   Glycine soja [wild soybean]
gb|KHN13696.1|  hypothetical protein glysoja_034006                     145   2e-37   Glycine soja [wild soybean]
ref|XP_006591157.1|  PREDICTED: protein YLS7-like                       145   2e-37   Glycine max [soybeans]
ref|XP_004500006.1|  PREDICTED: uncharacterized protein LOC101510811    145   2e-37   Cicer arietinum [garbanzo]
ref|XP_006438892.1|  hypothetical protein CICLE_v10033510mg             145   2e-37   Citrus clementina [clementine]
gb|KHG20284.1|  Enolase                                                 145   2e-37   Gossypium arboreum [tree cotton]
ref|XP_003551303.1|  PREDICTED: protein YLS7-like                       142   2e-37   
ref|XP_008245550.1|  PREDICTED: protein trichome birefringence-li...    144   3e-37   Prunus mume [ume]
ref|XP_006346586.1|  PREDICTED: uncharacterized protein LOC102604720    144   3e-37   Solanum tuberosum [potatoes]
ref|XP_006364115.1|  PREDICTED: uncharacterized protein LOC102591526    140   3e-37   
gb|AFK45250.1|  unknown                                                 144   3e-37   Lotus japonicus
ref|XP_009590179.1|  PREDICTED: protein trichome birefringence-li...    144   3e-37   Nicotiana tomentosiformis
ref|XP_009804652.1|  PREDICTED: protein trichome birefringence-li...    142   3e-37   Nicotiana sylvestris
ref|XP_004251923.1|  PREDICTED: protein trichome birefringence-li...    144   3e-37   
ref|XP_002304779.2|  hypothetical protein POPTR_0003s20070g             144   3e-37   
ref|XP_009143809.1|  PREDICTED: protein trichome birefringence-li...    144   3e-37   Brassica rapa
ref|XP_008383643.1|  PREDICTED: protein trichome birefringence-li...    144   4e-37   
ref|XP_007148060.1|  hypothetical protein PHAVU_006G177100g             144   4e-37   Phaseolus vulgaris [French bean]
ref|XP_009348409.1|  PREDICTED: protein trichome birefringence-li...    144   4e-37   Pyrus x bretschneideri [bai li]
ref|XP_010670501.1|  PREDICTED: protein trichome birefringence-li...    144   4e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009626454.1|  PREDICTED: protein trichome birefringence-li...    144   4e-37   Nicotiana tomentosiformis
ref|XP_009334009.1|  PREDICTED: protein trichome birefringence-li...    144   4e-37   Pyrus x bretschneideri [bai li]
ref|XP_006467669.1|  PREDICTED: protein YLS7-like                       144   4e-37   
ref|XP_006442366.1|  hypothetical protein CICLE_v10024135mg             144   4e-37   Citrus clementina [clementine]
ref|XP_012068510.1|  PREDICTED: protein trichome birefringence-li...    144   4e-37   Jatropha curcas
ref|XP_006449479.1|  hypothetical protein CICLE_v10015687mg             144   4e-37   Citrus clementina [clementine]
ref|XP_006410551.1|  hypothetical protein EUTSA_v10016785mg             144   6e-37   Eutrema salsugineum [saltwater cress]
ref|XP_009365268.1|  PREDICTED: protein trichome birefringence-li...    144   6e-37   Pyrus x bretschneideri [bai li]
ref|XP_010052993.1|  PREDICTED: protein trichome birefringence-li...    144   6e-37   Eucalyptus grandis [rose gum]
ref|XP_007022285.1|  Trichome birefringence-like 38                     144   6e-37   
ref|XP_009143811.1|  PREDICTED: protein trichome birefringence-li...    144   6e-37   Brassica rapa
gb|KDO83226.1|  hypothetical protein CISIN_1g017346mg                   144   7e-37   Citrus sinensis [apfelsine]
ref|XP_006482975.1|  PREDICTED: protein YLS7-like                       144   7e-37   Citrus sinensis [apfelsine]
gb|KHF98470.1|  Transmembrane protein                                   142   7e-37   Gossypium arboreum [tree cotton]
emb|CDY17219.1|  BnaA05g09690D                                          144   7e-37   Brassica napus [oilseed rape]
ref|XP_006852470.2|  PREDICTED: protein trichome birefringence-li...    144   7e-37   Amborella trichopoda
gb|KHN08449.1|  hypothetical protein glysoja_014214                     143   7e-37   Glycine soja [wild soybean]
ref|XP_009104567.1|  PREDICTED: protein trichome birefringence-li...    143   8e-37   Brassica rapa
ref|XP_003569466.1|  PREDICTED: protein trichome birefringence-li...    144   9e-37   Brachypodium distachyon [annual false brome]
ref|XP_004488994.1|  PREDICTED: uncharacterized protein LOC101512890    143   9e-37   Cicer arietinum [garbanzo]
ref|XP_003542986.1|  PREDICTED: protein YLS7-like isoform X1            143   9e-37   Glycine max [soybeans]
ref|XP_004229288.2|  PREDICTED: protein trichome birefringence-li...    143   1e-36   Solanum lycopersicum
ref|XP_006594557.1|  PREDICTED: protein YLS7-like isoform X2            143   1e-36   Glycine max [soybeans]
ref|XP_009141359.1|  PREDICTED: protein trichome birefringence-li...    143   1e-36   Brassica rapa
gb|KHN19645.1|  hypothetical protein glysoja_042542                     141   1e-36   Glycine soja [wild soybean]
ref|XP_003545134.1|  PREDICTED: protein YLS7-like                       143   1e-36   Glycine max [soybeans]
gb|KJB12978.1|  hypothetical protein B456_002G048200                    143   1e-36   Gossypium raimondii
ref|XP_010093464.1|  hypothetical protein L484_017525                   141   1e-36   
gb|KJB12977.1|  hypothetical protein B456_002G048200                    143   1e-36   Gossypium raimondii
ref|XP_003537664.1|  PREDICTED: protein YLS7-like                       143   1e-36   Glycine max [soybeans]
ref|XP_010064517.1|  PREDICTED: protein trichome birefringence-li...    145   1e-36   
gb|ACU19344.1|  unknown                                                 143   1e-36   Glycine max [soybeans]
ref|XP_002282459.1|  PREDICTED: protein trichome birefringence-li...    142   1e-36   Vitis vinifera
ref|XP_003634906.1|  PREDICTED: protein trichome birefringence-li...    143   1e-36   Vitis vinifera
gb|KDO77820.1|  hypothetical protein CISIN_1g017263mg                   143   1e-36   Citrus sinensis [apfelsine]
ref|XP_004229160.1|  PREDICTED: protein trichome birefringence-li...    142   1e-36   Solanum lycopersicum
gb|KDO77822.1|  hypothetical protein CISIN_1g017263mg                   143   1e-36   Citrus sinensis [apfelsine]
ref|XP_010272737.1|  PREDICTED: protein trichome birefringence-li...    142   2e-36   Nelumbo nucifera [Indian lotus]
ref|XP_007021950.1|  Trichome birefringence-like 41                     142   2e-36   Theobroma cacao [chocolate]
ref|XP_009359359.1|  PREDICTED: protein trichome birefringence-li...    142   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_007215869.1|  hypothetical protein PRUPE_ppa010517mg             139   2e-36   
gb|KCW67609.1|  hypothetical protein EUGRSUZ_F01364                     144   2e-36   Eucalyptus grandis [rose gum]
gb|ERN13934.1|  hypothetical protein AMTR_s00021p00122990               143   2e-36   Amborella trichopoda
emb|CDY30832.1|  BnaC05g22080D                                          142   2e-36   Brassica napus [oilseed rape]
ref|XP_006358930.1|  PREDICTED: uncharacterized protein LOC102599643    139   2e-36   
ref|XP_009370960.1|  PREDICTED: protein trichome birefringence-li...    142   2e-36   Pyrus x bretschneideri [bai li]
ref|XP_006367983.1|  PREDICTED: uncharacterized protein LOC102605300    139   2e-36   
ref|XP_009354247.1|  PREDICTED: protein trichome birefringence-li...    142   3e-36   Pyrus x bretschneideri [bai li]
ref|XP_003543193.1|  PREDICTED: protein YLS7-like                       141   3e-36   Glycine max [soybeans]
gb|KHN32337.1|  hypothetical protein glysoja_032520                     142   3e-36   Glycine soja [wild soybean]
ref|XP_010547339.1|  PREDICTED: protein trichome birefringence-li...    139   3e-36   
ref|XP_003518885.1|  PREDICTED: protein YLS7-like                       142   3e-36   Glycine max [soybeans]
ref|XP_009804651.1|  PREDICTED: protein trichome birefringence-li...    141   3e-36   Nicotiana sylvestris
ref|XP_008365735.1|  PREDICTED: LOW QUALITY PROTEIN: protein tric...    138   3e-36   
ref|XP_008783903.1|  PREDICTED: protein trichome birefringence-li...    142   3e-36   Phoenix dactylifera
gb|KHN19485.1|  hypothetical protein glysoja_026100                     142   3e-36   Glycine soja [wild soybean]
ref|XP_003540507.2|  PREDICTED: protein YLS7-like                       142   3e-36   Glycine max [soybeans]
ref|XP_006602443.1|  PREDICTED: protein YLS7-like                       142   3e-36   
ref|XP_003552076.2|  PREDICTED: protein YLS7-like                       142   3e-36   
ref|XP_010472706.1|  PREDICTED: protein trichome birefringence-li...    141   3e-36   Camelina sativa [gold-of-pleasure]
ref|XP_002513104.1|  conserved hypothetical protein                     141   3e-36   
gb|KDO54062.1|  hypothetical protein CISIN_1g036968mg                   141   4e-36   Citrus sinensis [apfelsine]
ref|XP_004248190.1|  PREDICTED: protein trichome birefringence-li...    141   4e-36   Solanum lycopersicum
gb|AHN91976.1|  TBL1                                                    141   4e-36   Citrus sinensis [apfelsine]
ref|XP_004295667.1|  PREDICTED: protein trichome birefringence-li...    141   4e-36   Fragaria vesca subsp. vesca
ref|XP_003529365.1|  PREDICTED: protein YLS7-like                       141   5e-36   Glycine max [soybeans]
ref|XP_003551901.1|  PREDICTED: protein YLS7-like                       141   5e-36   Glycine max [soybeans]
gb|KCW69906.1|  hypothetical protein EUGRSUZ_F03235                     141   5e-36   Eucalyptus grandis [rose gum]
ref|XP_006843604.1|  PREDICTED: protein PMR5                            141   6e-36   Amborella trichopoda
ref|XP_003608140.1|  hypothetical protein MTR_4g088030                  137   6e-36   
ref|XP_010106402.1|  hypothetical protein L484_008607                   141   6e-36   Morus notabilis
ref|XP_008451727.1|  PREDICTED: protein trichome birefringence-li...    140   6e-36   Cucumis melo [Oriental melon]
ref|XP_010547338.1|  PREDICTED: protein trichome birefringence-li...    139   6e-36   
ref|XP_009409696.1|  PREDICTED: protein trichome birefringence-li...    140   6e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010915622.1|  PREDICTED: protein trichome birefringence-li...    140   7e-36   Elaeis guineensis
ref|XP_010068952.1|  PREDICTED: protein trichome birefringence-li...    141   7e-36   Eucalyptus grandis [rose gum]
ref|XP_003599941.1|  hypothetical protein MTR_3g049330                  140   7e-36   Medicago truncatula
ref|XP_008353744.1|  PREDICTED: protein trichome birefringence-li...    137   7e-36   
ref|XP_009365267.1|  PREDICTED: protein trichome birefringence-li...    141   7e-36   Pyrus x bretschneideri [bai li]
ref|XP_010057074.1|  PREDICTED: protein trichome birefringence-li...    141   7e-36   Eucalyptus grandis [rose gum]
ref|XP_010417475.1|  PREDICTED: protein trichome birefringence-li...    140   7e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010915620.1|  PREDICTED: protein trichome birefringence-li...    140   8e-36   
ref|XP_008342760.1|  PREDICTED: protein trichome birefringence-li...    137   8e-36   
emb|CDX79269.1|  BnaC06g20340D                                          140   8e-36   
ref|XP_008245551.1|  PREDICTED: protein trichome birefringence-li...    140   8e-36   Prunus mume [ume]
emb|CDY64767.1|  BnaCnng44810D                                          141   8e-36   Brassica napus [oilseed rape]
ref|XP_010062787.1|  PREDICTED: protein trichome birefringence-li...    141   9e-36   Eucalyptus grandis [rose gum]
ref|XP_009123178.1|  PREDICTED: protein trichome birefringence-li...    140   9e-36   Brassica rapa
ref|XP_004244290.1|  PREDICTED: protein trichome birefringence-li...    141   9e-36   Solanum lycopersicum
ref|XP_007033643.1|  Trichome birefringence-like 43, putative           140   1e-35   
ref|XP_010531925.1|  PREDICTED: protein trichome birefringence-li...    140   1e-35   Tarenaya hassleriana [spider flower]
ref|XP_006480514.1|  PREDICTED: protein YLS7-like                       140   1e-35   Citrus sinensis [apfelsine]
ref|XP_008342763.1|  PREDICTED: protein trichome birefringence-li...    139   1e-35   
emb|CDX97608.1|  BnaA05g24710D                                          140   1e-35   
ref|XP_004505135.1|  PREDICTED: uncharacterized protein LOC101503421    140   1e-35   Cicer arietinum [garbanzo]
ref|XP_011045911.1|  PREDICTED: protein trichome birefringence-li...    140   1e-35   Populus euphratica
ref|XP_003608110.1|  hypothetical protein MTR_4g087730                  140   1e-35   Medicago truncatula
ref|XP_008345147.1|  PREDICTED: protein trichome birefringence-li...    139   1e-35   
ref|XP_004489870.1|  PREDICTED: uncharacterized protein LOC101510652    140   1e-35   Cicer arietinum [garbanzo]
ref|XP_008783904.1|  PREDICTED: protein trichome birefringence-li...    140   1e-35   
gb|ACU18958.1|  unknown                                                 140   1e-35   
ref|XP_010273482.1|  PREDICTED: protein trichome birefringence-li...    140   2e-35   
ref|XP_008783902.1|  PREDICTED: protein trichome birefringence-li...    140   2e-35   
ref|XP_006301170.1|  hypothetical protein CARUB_v10021567mg             140   2e-35   
gb|KDO42385.1|  hypothetical protein CISIN_1g025538mg                   137   2e-35   
ref|XP_010052537.1|  PREDICTED: protein trichome birefringence-li...    139   2e-35   
gb|KDO77819.1|  hypothetical protein CISIN_1g017263mg                   140   2e-35   
ref|XP_006367779.1|  PREDICTED: uncharacterized protein LOC102593572    136   2e-35   
emb|CDX97611.1|  BnaA05g24680D                                          139   2e-35   
ref|XP_008342762.1|  PREDICTED: protein trichome birefringence-li...    139   2e-35   
emb|CBI22044.3|  unnamed protein product                                143   3e-35   
ref|XP_009370964.1|  PREDICTED: protein trichome birefringence-li...    138   3e-35   
dbj|BAD73018.1|  unknown protein                                        139   3e-35   
ref|XP_011042148.1|  PREDICTED: protein trichome birefringence-li...    139   3e-35   
ref|NP_001042402.1|  Os01g0217000                                       139   4e-35   
ref|XP_009146318.1|  PREDICTED: protein trichome birefringence-li...    138   4e-35   
ref|XP_010547337.1|  PREDICTED: protein trichome birefringence-li...    139   4e-35   
emb|CDX98504.1|  BnaC05g38710D                                          138   5e-35   
ref|XP_010675285.1|  PREDICTED: protein trichome birefringence-li...    139   5e-35   
emb|CDX98498.1|  BnaC05g38770D                                          138   5e-35   
ref|XP_007214202.1|  hypothetical protein PRUPE_ppa022459mg             137   5e-35   
ref|XP_004149051.1|  PREDICTED: protein trichome birefringence-li...    139   5e-35   
gb|KDP41046.1|  hypothetical protein JCGZ_03578                         132   5e-35   
gb|KJB67475.1|  hypothetical protein B456_010G192400                    138   6e-35   
ref|XP_011464795.1|  PREDICTED: protein trichome birefringence-li...    138   6e-35   
ref|XP_008443074.1|  PREDICTED: protein trichome birefringence-li...    139   7e-35   
gb|AES90337.2|  trichome birefringence-like protein                     138   7e-35   
ref|XP_009370963.1|  PREDICTED: protein trichome birefringence-li...    138   7e-35   
ref|XP_006492255.1|  PREDICTED: protein YLS7-like                       138   7e-35   
ref|XP_009354272.1|  PREDICTED: protein trichome birefringence-li...    138   7e-35   
ref|XP_009359366.1|  PREDICTED: protein trichome birefringence-li...    138   7e-35   
emb|CDP06047.1|  unnamed protein product                                132   7e-35   
ref|XP_004134666.1|  PREDICTED: protein trichome birefringence-li...    138   9e-35   
gb|KDO58611.1|  hypothetical protein CISIN_1g018353mg                   137   9e-35   
ref|XP_009590835.1|  PREDICTED: protein trichome birefringence-li...    137   1e-34   
ref|XP_010429700.1|  PREDICTED: protein trichome birefringence-li...    137   1e-34   
ref|XP_008783971.1|  PREDICTED: protein trichome birefringence-li...    136   1e-34   
ref|XP_006448024.1|  hypothetical protein CICLE_v10015743mg             137   1e-34   
ref|XP_006348326.1|  PREDICTED: uncharacterized protein LOC102586487    137   1e-34   
ref|XP_004137221.1|  PREDICTED: protein trichome birefringence-li...    137   1e-34   
ref|XP_004968629.1|  PREDICTED: uncharacterized protein LOC101778813    138   1e-34   
ref|XP_004232960.1|  PREDICTED: protein trichome birefringence-li...    138   1e-34   
ref|XP_006477835.1|  PREDICTED: protein YLS7-like                       137   2e-34   
gb|AAP22494.1|  hypothetical protein At2g30900                          137   2e-34   
ref|XP_009354245.1|  PREDICTED: protein trichome birefringence-li...    137   2e-34   
ref|XP_009599976.1|  PREDICTED: protein trichome birefringence-li...    137   2e-34   
ref|XP_009599983.1|  PREDICTED: protein trichome birefringence-li...    137   2e-34   
gb|AAC20724.1|  hypothetical protein                                    137   2e-34   
gb|KJB45823.1|  hypothetical protein B456_007G331200                    137   2e-34   
ref|NP_180647.2|  protein TRICHOME BIREFRINGENCE-LIKE 43                137   2e-34   
ref|XP_010675287.1|  PREDICTED: protein trichome birefringence-li...    137   2e-34   
ref|XP_002304780.1|  hypothetical protein POPTR_0003s20060g             136   2e-34   
ref|XP_011096427.1|  PREDICTED: protein trichome birefringence-li...    137   2e-34   
ref|XP_007021951.1|  Trichome birefringence-like 37                     136   2e-34   
ref|NP_001144145.1|  uncharacterized protein LOC100276997 precursor     137   2e-34   
emb|CAN82331.1|  hypothetical protein VITISV_007322                     137   2e-34   
ref|XP_011016305.1|  PREDICTED: protein trichome birefringence-li...    134   2e-34   
ref|XP_006389962.1|  hypothetical protein EUTSA_v10019641mg             137   3e-34   
ref|XP_006387085.1|  hypothetical protein POPTR_1908s00200g             136   3e-34   
gb|KHG02694.1|  putative C7orf58                                        136   3e-34   
emb|CBI21958.3|  unnamed protein product                                134   3e-34   
gb|KDO63324.1|  hypothetical protein CISIN_1g017063mg                   136   3e-34   
ref|XP_006469036.1|  PREDICTED: protein YLS7-like                       136   3e-34   
ref|XP_006446762.1|  hypothetical protein CICLE_v10015634mg             136   3e-34   
ref|XP_004234094.1|  PREDICTED: protein trichome birefringence-li...    136   3e-34   
ref|XP_006365454.1|  PREDICTED: uncharacterized protein LOC102604606    137   4e-34   
ref|XP_009781572.1|  PREDICTED: protein trichome birefringence-li...    136   4e-34   
gb|KDO77821.1|  hypothetical protein CISIN_1g017263mg                   136   4e-34   
ref|XP_008439751.1|  PREDICTED: protein trichome birefringence-li...    136   4e-34   
ref|XP_004491381.1|  PREDICTED: uncharacterized protein LOC101498345    135   5e-34   
gb|EYU28072.1|  hypothetical protein MIMGU_mgv1a008400mg                136   5e-34   
ref|XP_003552077.1|  PREDICTED: protein YLS7-like                       135   5e-34   
ref|XP_010070349.1|  PREDICTED: protein trichome birefringence-li...    135   7e-34   
ref|XP_009790075.1|  PREDICTED: protein trichome birefringence-li...    135   7e-34   
ref|XP_010686317.1|  PREDICTED: protein trichome birefringence-li...    135   7e-34   
ref|XP_007213066.1|  hypothetical protein PRUPE_ppa020515mg             135   7e-34   
gb|KCW89619.1|  hypothetical protein EUGRSUZ_A01902                     135   7e-34   
ref|XP_009626448.1|  PREDICTED: protein trichome birefringence-li...    135   7e-34   
ref|XP_010272758.1|  PREDICTED: protein trichome birefringence-li...    135   8e-34   
emb|CDX75793.1|  BnaC03g38760D                                          135   8e-34   
emb|CDX82462.1|  BnaA03g33590D                                          133   9e-34   
gb|KJB45822.1|  hypothetical protein B456_007G331100                    135   9e-34   
ref|XP_004303168.1|  PREDICTED: protein trichome birefringence-li...    135   9e-34   
ref|XP_002317443.1|  hypothetical protein POPTR_0011s10740g             135   1e-33   
gb|KHN36929.1|  hypothetical protein glysoja_001660                     134   1e-33   
ref|XP_002879285.1|  hypothetical protein ARALYDRAFT_344851             132   1e-33   
tpg|DAA58322.1|  TPA: putative DUF231 domain containing family pr...    135   1e-33   
ref|XP_009769000.1|  PREDICTED: protein trichome birefringence-li...    135   1e-33   
ref|XP_009340027.1|  PREDICTED: protein trichome birefringence-li...    135   1e-33   
ref|XP_008381178.1|  PREDICTED: protein trichome birefringence-li...    135   1e-33   
ref|NP_001241315.1|  uncharacterized protein LOC100793795 precursor     134   1e-33   
ref|XP_002285609.1|  PREDICTED: protein trichome birefringence-li...    134   1e-33   
ref|XP_008678490.1|  PREDICTED: protein trichome birefringence-li...    131   1e-33   
ref|XP_007149521.1|  hypothetical protein PHAVU_005G077200g             134   1e-33   
ref|XP_006362437.1|  PREDICTED: uncharacterized protein LOC102599991    134   2e-33   
gb|ERN13935.1|  hypothetical protein AMTR_s00021p00123200               129   2e-33   
ref|XP_006368594.1|  hypothetical protein POPTR_0001s06130g             134   2e-33   
ref|XP_009769584.1|  PREDICTED: protein trichome birefringence-li...    135   2e-33   
ref|XP_007050058.1|  Trichome birefringence-like 39                     134   2e-33   
ref|XP_008675272.1|  PREDICTED: LOW QUALITY PROTEIN: protein tric...    135   2e-33   
emb|CDX84181.1|  BnaC04g09430D                                          134   2e-33   
ref|XP_006442367.1|  hypothetical protein CICLE_v10020789mg             134   2e-33   
gb|KFK31236.1|  hypothetical protein AALP_AA6G086200                    134   2e-33   
ref|XP_003565497.2|  PREDICTED: protein trichome birefringence-li...    135   2e-33   
ref|XP_010557124.1|  PREDICTED: protein trichome birefringence-li...    134   3e-33   
ref|XP_012070198.1|  PREDICTED: protein trichome birefringence-li...    134   3e-33   
ref|XP_010465402.1|  PREDICTED: protein trichome birefringence-li...    134   3e-33   
ref|XP_006492301.1|  PREDICTED: protein YLS7-like                       133   3e-33   
ref|XP_004243406.1|  PREDICTED: protein trichome birefringence-li...    134   3e-33   
ref|XP_004244289.1|  PREDICTED: protein trichome birefringence-li...    134   3e-33   
ref|XP_002279857.1|  PREDICTED: protein trichome birefringence-li...    134   3e-33   
gb|KDO58612.1|  hypothetical protein CISIN_1g018724mg                   133   3e-33   
gb|EYU43352.1|  hypothetical protein MIMGU_mgv1a017695mg                133   3e-33   
ref|XP_011002532.1|  PREDICTED: protein trichome birefringence-li...    133   4e-33   
ref|XP_006410237.1|  hypothetical protein EUTSA_v10016834mg             133   4e-33   
gb|AAC63848.1|  hypothetical protein                                    129   4e-33   
ref|XP_009365265.1|  PREDICTED: protein trichome birefringence-li...    133   4e-33   
ref|XP_009357163.1|  PREDICTED: protein trichome birefringence-li...    133   4e-33   
ref|XP_009787170.1|  PREDICTED: protein trichome birefringence-li...    133   4e-33   
ref|XP_009116583.1|  PREDICTED: protein trichome birefringence-li...    133   5e-33   
ref|XP_003540508.1|  PREDICTED: protein YLS7-like                       133   5e-33   
ref|XP_009593637.1|  PREDICTED: protein trichome birefringence-li...    133   5e-33   
ref|XP_009135400.1|  PREDICTED: protein trichome birefringence-li...    133   5e-33   
ref|XP_003598798.1|  hypothetical protein MTR_3g021060                  133   5e-33   
emb|CDY19065.1|  BnaA04g18050D                                          130   5e-33   
ref|XP_007149000.1|  hypothetical protein PHAVU_005G032100g             133   5e-33   
ref|XP_010915619.1|  PREDICTED: protein trichome birefringence-li...    133   6e-33   
emb|CDY20089.1|  BnaA01g29130D                                          132   6e-33   
gb|KJB71443.1|  hypothetical protein B456_011G124000                    133   6e-33   
ref|XP_004305820.2|  PREDICTED: protein trichome birefringence-li...    132   6e-33   
ref|XP_010502205.1|  PREDICTED: protein trichome birefringence-li...    132   7e-33   
ref|XP_010035884.1|  PREDICTED: protein trichome birefringence-li...    132   7e-33   
ref|XP_012068518.1|  PREDICTED: protein trichome birefringence-li...    132   8e-33   
ref|XP_006294476.1|  hypothetical protein CARUB_v10023492mg             132   8e-33   
ref|XP_008226366.1|  PREDICTED: protein trichome birefringence-li...    132   8e-33   
ref|NP_180669.2|  protein TRICHOME BIREFRINGENCE-LIKE 40                129   9e-33   
ref|XP_004497100.1|  PREDICTED: uncharacterized protein LOC101501368    132   9e-33   
gb|KHN19484.1|  hypothetical protein glysoja_026099                     130   9e-33   
ref|XP_002862622.1|  hypothetical protein ARALYDRAFT_333274             132   9e-33   
ref|XP_006852462.1|  PREDICTED: protein trichome birefringence-li...    132   9e-33   
ref|XP_008672661.1|  PREDICTED: putative DUF231 domain containing...    133   9e-33   
ref|XP_002325581.2|  hypothetical protein POPTR_0019s11990g             132   9e-33   
ref|XP_010510274.1|  PREDICTED: protein trichome birefringence-li...    132   1e-32   
emb|CAJ40777.1|  alpha galactosidase precursor                          132   1e-32   
ref|XP_008342494.1|  PREDICTED: protein trichome birefringence-li...    132   1e-32   
emb|CDP06045.1|  unnamed protein product                                132   1e-32   
ref|XP_011086013.1|  PREDICTED: protein trichome birefringence-li...    132   1e-32   
ref|NP_001145271.1|  putative DUF231 domain containing family pro...    132   1e-32   
ref|XP_006296433.1|  hypothetical protein CARUB_v10025613mg             132   1e-32   
ref|XP_010920821.1|  PREDICTED: protein PMR5                            132   1e-32   
ref|XP_007142244.1|  hypothetical protein PHAVU_008G264500g             132   1e-32   
ref|XP_002881157.1|  hypothetical protein ARALYDRAFT_482040             132   1e-32   
ref|XP_008672660.1|  PREDICTED: putative DUF231 domain containing...    132   1e-32   
ref|XP_007133303.1|  hypothetical protein PHAVU_011G168300g             131   1e-32   
ref|XP_008381569.1|  PREDICTED: protein trichome birefringence-li...    132   1e-32   
ref|XP_011044589.1|  PREDICTED: protein trichome birefringence-li...    131   2e-32   
ref|XP_011042149.1|  PREDICTED: protein trichome birefringence-li...    131   2e-32   
ref|XP_007146400.1|  hypothetical protein PHAVU_006G037200g             132   2e-32   
ref|XP_009409697.1|  PREDICTED: protein trichome birefringence-li...    131   2e-32   
ref|XP_010099368.1|  hypothetical protein L484_004794                   132   2e-32   
ref|XP_010535032.1|  PREDICTED: protein trichome birefringence-li...    131   2e-32   
ref|XP_008351941.1|  PREDICTED: protein trichome birefringence-li...    132   2e-32   
ref|XP_010999583.1|  PREDICTED: protein trichome birefringence-li...    131   2e-32   
ref|XP_003599590.1|  hypothetical protein MTR_3g035830                  131   2e-32   
ref|XP_002306016.2|  hypothetical protein POPTR_0004s14320g             129   2e-32   
ref|XP_006576076.1|  PREDICTED: protein YLS7-like                       128   3e-32   
ref|XP_002882897.1|  hypothetical protein ARALYDRAFT_478900             131   3e-32   
ref|XP_011024935.1|  PREDICTED: protein PMR5-like                       131   3e-32   
ref|XP_006407039.1|  hypothetical protein EUTSA_v10021040mg             130   3e-32   
gb|KDO66930.1|  hypothetical protein CISIN_1g016108mg                   130   3e-32   
ref|XP_007217300.1|  hypothetical protein PRUPE_ppa018693mg             130   3e-32   
ref|XP_006448025.1|  hypothetical protein CICLE_v10018196mg             130   3e-32   
emb|CDO96761.1|  unnamed protein product                                130   4e-32   
ref|XP_010925980.1|  PREDICTED: protein trichome birefringence-li...    130   4e-32   
ref|XP_010487295.1|  PREDICTED: protein trichome birefringence-li...    130   4e-32   
ref|XP_008783972.1|  PREDICTED: protein trichome birefringence-li...    130   5e-32   
emb|CDY32336.1|  BnaC01g36550D                                          130   5e-32   
ref|NP_188103.2|  protein trichome birefringence-like 41                128   5e-32   
ref|XP_010320713.1|  PREDICTED: protein trichome birefringence-li...    130   6e-32   
ref|XP_009339560.1|  PREDICTED: protein trichome birefringence-li...    130   6e-32   
ref|XP_010418747.1|  PREDICTED: protein trichome birefringence-li...    124   6e-32   
emb|CBI30668.3|  unnamed protein product                                130   6e-32   
ref|XP_008228902.1|  PREDICTED: protein trichome birefringence-li...    130   6e-32   
gb|KEH38564.1|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    130   7e-32   
ref|XP_002274664.1|  PREDICTED: protein trichome birefringence-li...    130   7e-32   
gb|AAM65091.1|  unknown                                                 130   8e-32   
dbj|BAD44658.1|  unnamed protein product                                130   8e-32   
ref|NP_001077985.1|  protein TRICHOME BIREFRINGENCE-LIKE 40             130   8e-32   
gb|AAO42294.1|  unknown protein                                         129   8e-32   
gb|KJB83952.1|  hypothetical protein B456_013G175200                    129   8e-32   
gb|KDO66926.1|  hypothetical protein CISIN_1g016108mg                   130   9e-32   
ref|XP_008792962.1|  PREDICTED: protein PMR5                            130   9e-32   
ref|XP_009132768.1|  PREDICTED: protein trichome birefringence-li...    130   9e-32   
gb|EMT17911.1|  hypothetical protein F775_21346                         128   9e-32   
ref|XP_006425092.1|  hypothetical protein CICLE_v10028623mg             130   9e-32   
ref|XP_006488549.1|  PREDICTED: protein YLS7-like                       130   9e-32   
gb|AES69051.2|  Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family pr...    130   9e-32   
ref|XP_006376352.1|  hypothetical protein POPTR_0013s12290g             129   1e-31   
ref|XP_007211411.1|  hypothetical protein PRUPE_ppa007013mg             130   1e-31   
ref|XP_003598800.1|  GRAS family transcription factor                   130   1e-31   
ref|XP_004488993.1|  PREDICTED: uncharacterized protein LOC101512583    129   1e-31   
ref|XP_012079047.1|  PREDICTED: protein trichome birefringence-li...    129   1e-31   
ref|XP_002525125.1|  conserved hypothetical protein                     129   1e-31   
ref|XP_006348847.1|  PREDICTED: uncharacterized protein LOC102593679    129   1e-31   
ref|XP_010469762.1|  PREDICTED: protein trichome birefringence-li...    129   1e-31   
ref|XP_008244484.1|  PREDICTED: protein trichome birefringence-li...    129   1e-31   
emb|CDY23962.1|  BnaC03g17290D                                          129   1e-31   
emb|CBI15933.3|  unnamed protein product                                128   1e-31   
ref|XP_009143638.1|  PREDICTED: protein trichome birefringence-li...    129   1e-31   
ref|XP_009409698.1|  PREDICTED: protein trichome birefringence-li...    129   2e-31   
ref|XP_009141436.1|  PREDICTED: protein trichome birefringence-li...    130   2e-31   
ref|XP_003613275.1|  hypothetical protein MTR_5g034810                  129   2e-31   
ref|XP_011010610.1|  PREDICTED: protein trichome birefringence-li...    129   2e-31   
ref|XP_007207333.1|  hypothetical protein PRUPE_ppa006874mg             129   2e-31   
ref|XP_010513188.1|  PREDICTED: protein trichome birefringence-li...    129   2e-31   
ref|XP_007048774.1|  Trichome birefringence-like 43 isoform 2           127   2e-31   
gb|KFK38836.1|  hypothetical protein AALP_AA3G166600                    129   2e-31   
ref|XP_010253781.1|  PREDICTED: protein PMR5-like                       129   2e-31   
gb|AFK42120.1|  unknown                                                 129   2e-31   
ref|XP_011657557.1|  PREDICTED: protein trichome birefringence-li...    129   2e-31   



>ref|XP_009783768.1| PREDICTED: protein trichome birefringence-like 42 [Nicotiana 
sylvestris]
Length=359

 Score =   218 bits (556),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 109/121 (90%), Gaps = 0/121 (0%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANW+DSNIDP  TKVFFQGISAVHYHG +WNEP VQDCR QTKPIEGS++PG+RYPGEAV
Sbjct  238  ANWIDSNIDPAMTKVFFQGISAVHYHGKDWNEPMVQDCRGQTKPIEGSNYPGDRYPGEAV  297

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVVDCSHWCVAGVPDSWNQILYSILI  334
            VK VL NMT SVYLLDI LLTQLRKDGHPS YA G +DCSHWCVAGVPD+WN++LY+IL+
Sbjct  298  VKNVLSNMTKSVYLLDITLLTQLRKDGHPSRYANGEIDCSHWCVAGVPDTWNELLYTILL  357

Query  333  Q  331
            Q
Sbjct  358  Q  358



>emb|CDP06048.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   209 bits (531),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSNIDP KTKVFFQGISAVH HG+EWNEPAVQDCR QTK IEG+ +PG+ YPGEAV
Sbjct  240  AKWVDSNIDPGKTKVFFQGISAVHNHGSEWNEPAVQDCRGQTKAIEGADYPGQHYPGEAV  299

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVVDCSHWCVAGVPDSWNQILYSILI  334
            VK VLGNMT  VYLLDI LLTQLRKDGHPS YA G +DCSHWC+AGVPD+WN++LY++L+
Sbjct  300  VKDVLGNMTKPVYLLDITLLTQLRKDGHPSNYANGALDCSHWCLAGVPDTWNELLYAMLL  359

Query  333  QN  328
            ++
Sbjct  360  ES  361



>ref|XP_009610283.1| PREDICTED: protein trichome birefringence-like 42 [Nicotiana 
tomentosiformis]
Length=359

 Score =   207 bits (528),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 95/121 (79%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVDSNIDP  TKVFFQGISAVHYHG +W+EP VQDCR QTKPIEGS++PG+RY GEAV
Sbjct  238  ANWVDSNIDPAVTKVFFQGISAVHYHGKDWDEPMVQDCRGQTKPIEGSNYPGDRYLGEAV  297

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVVDCSHWCVAGVPDSWNQILYSILI  334
            VK VL NMT  VYLLDI LLTQLRKDGHPS YA G  DCSHWCVAGV D+WN++LY+IL+
Sbjct  298  VKNVLSNMTKPVYLLDITLLTQLRKDGHPSRYANGETDCSHWCVAGVTDAWNELLYTILL  357

Query  333  Q  331
            Q
Sbjct  358  Q  358



>ref|XP_010314298.1| PREDICTED: protein trichome birefringence-like 42 [Solanum lycopersicum]
Length=346

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 103/123 (84%), Gaps = 1/123 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVDSNIDP  TKVFFQGISAVHY G +W+EP V+DC  QTKPIEGS++PGERY GEAV
Sbjct  224  ANWVDSNIDPAVTKVFFQGISAVHYFGKDWDEPMVKDCSGQTKPIEGSTYPGERYAGEAV  283

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYSIL  337
            VK VL NMT  V LLDI LLTQLRKDGHPS  A G  +DCSHWCVAGVPD+WN++LY++L
Sbjct  284  VKSVLSNMTMPVNLLDITLLTQLRKDGHPSRIASGASMDCSHWCVAGVPDAWNELLYTML  343

Query  336  IQN  328
            +Q 
Sbjct  344  LQK  346



>gb|EYU26299.1| hypothetical protein MIMGU_mgv1a018701mg, partial [Erythranthe 
guttata]
Length=262

 Score =   190 bits (482),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 103/122 (84%), Gaps = 0/122 (0%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVDSNIDP KT+VFFQGIS VHY G++WNEP+V+DCR QTKPI GS +PG +  G+ V
Sbjct  141  ANWVDSNIDPAKTRVFFQGISTVHYKGSDWNEPSVKDCRGQTKPINGSDYPGIKPQGDPV  200

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVVDCSHWCVAGVPDSWNQILYSILI  334
            V+ VL NM    +LLDI+L+TQLRKDGHPS YAG  +DCSHWCVAGVPD+WNQ+LY++L+
Sbjct  201  VRSVLSNMKKPAFLLDISLMTQLRKDGHPSIYAGKGLDCSHWCVAGVPDTWNQLLYTLLL  260

Query  333  QN  328
            ++
Sbjct  261  KS  262



>ref|XP_006360069.1| PREDICTED: uncharacterized protein LOC102593192 [Solanum tuberosum]
Length=352

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 102/123 (83%), Gaps = 1/123 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A W+DSNI+P  TKVFFQGISAVH  G +WNEP V+DC  QTKPIEGS++PGERY GEAV
Sbjct  230  AKWIDSNINPAVTKVFFQGISAVHARGKDWNEPQVKDCSGQTKPIEGSTYPGERYRGEAV  289

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA-GGVVDCSHWCVAGVPDSWNQILYSIL  337
            VK VL NMT  V LLDI LLTQLRKDGHPS  A GG+ DCSHWCVAGVPD+WN++LY+IL
Sbjct  290  VKSVLSNMTKPVNLLDITLLTQLRKDGHPSRIASGGLNDCSHWCVAGVPDAWNELLYTIL  349

Query  336  IQN  328
            +Q 
Sbjct  350  LQK  352



>ref|XP_006359475.1| PREDICTED: uncharacterized protein LOC102598428 [Solanum tuberosum]
Length=346

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/123 (73%), Positives = 102/123 (83%), Gaps = 1/123 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVDSNIDP  TKVFFQGISAVHY+G +W+EP V+DC  QTKPI GS++PGERY GEAV
Sbjct  224  ANWVDSNIDPVVTKVFFQGISAVHYYGKDWDEPMVKDCSGQTKPIGGSTYPGERYAGEAV  283

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYSIL  337
            VK VL NMT  V LLDI LLTQLRKDGHPS  A G  +DCSHWCVAGVPD+WN++LY+ L
Sbjct  284  VKSVLSNMTMPVNLLDITLLTQLRKDGHPSRIASGASMDCSHWCVAGVPDAWNELLYTTL  343

Query  336  IQN  328
            +Q 
Sbjct  344  LQK  346



>ref|XP_010327259.1| PREDICTED: protein trichome birefringence-like 42 [Solanum lycopersicum]
Length=352

 Score =   191 bits (484),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A W+DSN+DP  T+VFFQGISAVH  G +W+EP V+DC  QTKPIEGSS+PGERYPGEAV
Sbjct  230  AKWIDSNVDPAVTEVFFQGISAVHARGKDWDEPQVKDCSGQTKPIEGSSYPGERYPGEAV  289

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV-DCSHWCVAGVPDSWNQILYSIL  337
            VK VL NMT  V LLDI LLTQLRKDGHPS  A G + DCSHWCVAGVPD+WN++LY++L
Sbjct  290  VKSVLSNMTMPVNLLDITLLTQLRKDGHPSRVASGALNDCSHWCVAGVPDTWNELLYTML  349

Query  336  IQ  331
            +Q
Sbjct  350  LQ  351



>ref|XP_011098189.1| PREDICTED: protein trichome birefringence-like 42 [Sesamum indicum]
Length=388

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 104/122 (85%), Gaps = 0/122 (0%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVDSN+DP +T+VFFQGISA HY G EWNEP VQ+C  QT+P+EGS++PG + PG+AV
Sbjct  267  ANWVDSNVDPVRTRVFFQGISASHYRGTEWNEPNVQNCSGQTRPVEGSTYPGNKPPGDAV  326

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVVDCSHWCVAGVPDSWNQILYSILI  334
            VKGVL +M     LLDIALLTQLRKDGHPSTY+   +DCSHWC+AGVPD+WNQ+LY++L+
Sbjct  327  VKGVLSSMKRPAVLLDIALLTQLRKDGHPSTYSDVRLDCSHWCLAGVPDTWNQLLYAVLV  386

Query  333  QN  328
            ++
Sbjct  387  ES  388



>gb|KHG24040.1| Ribosomal S6 modification protein [Gossypium arboreum]
Length=371

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 102/125 (82%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVD+NIDP+KT+VFFQG++AVH++  EW EP+ + C  QT+P++GS++PG   PGEA+
Sbjct  247  ANWVDTNIDPSKTRVFFQGVAAVHFNAKEWGEPSDKGCIKQTEPLKGSTYPGPPVPGEAI  306

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            +K VL  MT   YLLDI LLTQLRKDGHPS YAG    ++DCSHWC+AGVPD+WNQ+LY+
Sbjct  307  LKTVLSKMTKPAYLLDITLLTQLRKDGHPSIYAGAGPKLIDCSHWCLAGVPDTWNQLLYA  366

Query  342  ILIQN  328
             L+Q+
Sbjct  367  ALVQS  371



>ref|XP_007021953.1| Trichome birefringence-like 42 [Theobroma cacao]
 gb|EOY13478.1| Trichome birefringence-like 42 [Theobroma cacao]
Length=370

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 97/124 (78%), Gaps = 3/124 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVD NIDP+KT VFFQG++AVH    EWN+P  +DC  QT+P++GS++PG   PGEA+
Sbjct  246  ANWVDKNIDPSKTSVFFQGVAAVHLDAKEWNDPNHKDCTEQTEPVKGSTYPGPGVPGEAI  305

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            +K VL NM    YLLDI LLTQLRKDGHPS YAGG     DCSHWC+AGVPD+WNQ+LY+
Sbjct  306  LKSVLSNMAKPAYLLDITLLTQLRKDGHPSIYAGGGPRFTDCSHWCLAGVPDTWNQLLYA  365

Query  342  ILIQ  331
             L+Q
Sbjct  366  ALLQ  369



>ref|XP_010675282.1| PREDICTED: protein trichome birefringence-like 42 [Beta vulgaris 
subsp. vulgaris]
Length=365

 Score =   178 bits (452),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 101/125 (81%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVD++IDP KT+VFFQG+SAVH +G+EW EP  + CR QT+P+ GS + G R PGEA+
Sbjct  241  ANWVDAHIDPKKTQVFFQGVSAVHMNGSEWKEPRARFCRQQTQPVAGSRYGGGRQPGEAI  300

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            VK VL +M   V+LLDI LLTQLRKDGHPS YAGG   ++DCSHWC+ GVPD+WNQ+LYS
Sbjct  301  VKNVLRHMKKPVHLLDITLLTQLRKDGHPSIYAGGGSKLLDCSHWCLPGVPDTWNQLLYS  360

Query  342  ILIQN  328
            IL ++
Sbjct  361  ILFRH  365



>gb|KJB12976.1| hypothetical protein B456_002G048100 [Gossypium raimondii]
Length=371

 Score =   174 bits (440),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 100/125 (80%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVD+NIDP+KT+V FQG++AVH++  EW EP+ + C  QT+P++GS++PG   PGEA+
Sbjct  247  ANWVDTNIDPSKTRVLFQGVAAVHFNAKEWGEPSDKGCIKQTEPLKGSTYPGPPVPGEAI  306

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            +K VL  MT   YLLDI LLTQLRKDGHPS YA     ++DCSHWC+AGVPD+WNQ+LY+
Sbjct  307  LKTVLSKMTKPAYLLDITLLTQLRKDGHPSIYARAGPKLIDCSHWCLAGVPDTWNQLLYA  366

Query  342  ILIQN  328
             L+Q+
Sbjct  367  ALVQS  371



>ref|XP_004295669.1| PREDICTED: protein trichome birefringence-like 42 [Fragaria vesca 
subsp. vesca]
 ref|XP_011460825.1| PREDICTED: protein trichome birefringence-like 42 [Fragaria vesca 
subsp. vesca]
Length=369

 Score =   170 bits (431),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 93/122 (76%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSNID +KTKVFFQG++AVH  G EW EP  + CR Q +P+ G+S+PG  +PGEA+
Sbjct  246  AKWVDSNIDFSKTKVFFQGVAAVHIDGKEWKEPKARTCRGQAQPLMGTSYPGPSHPGEAI  305

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG---GVVDCSHWCVAGVPDSWNQILYS  343
            VK VL  M   +YLLDI LLTQLRKDGHPS YAG     VDCSHWC+ G PD+WN++LY+
Sbjct  306  VKSVLSTMAKPIYLLDITLLTQLRKDGHPSIYAGMGSKFVDCSHWCLPGAPDAWNELLYA  365

Query  342  IL  337
            +L
Sbjct  366  VL  367



>ref|XP_010093461.1| hypothetical protein L484_017522 [Morus notabilis]
 gb|EXB54085.1| hypothetical protein L484_017522 [Morus notabilis]
Length=381

 Score =   166 bits (421),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 99/130 (76%), Gaps = 4/130 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPG-ERYPGEA  517
            A WV+SNIDP+KT VF+QG+SAVH +G EWN+P  ++C  QT+P+ GS +PG   +PGE 
Sbjct  252  AKWVNSNIDPSKTIVFYQGVSAVHQNGTEWNDPKAKNCNGQTQPVMGSKYPGTTSHPGEE  311

Query  516  VVKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG---GVVDCSHWCVAGVPDSWNQILY  346
            +VK VL ++ +  YLLDI LLTQLRKDGHPS YA      VDCSHWC+ GVPD+WN+ILY
Sbjct  312  IVKSVLSSLRDQAYLLDITLLTQLRKDGHPSIYATKDRAFVDCSHWCLPGVPDTWNEILY  371

Query  345  SILIQN*FLL  316
            ++L+ +  LL
Sbjct  372  AVLLNSNILL  381



>ref|XP_008226367.1| PREDICTED: protein trichome birefringence-like 42 [Prunus mume]
Length=362

 Score =   165 bits (418),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 94/123 (76%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSNID +KTKVFFQG++AVH  G EW +P  + C  QT+P+ G ++PG  +PGEA+
Sbjct  240  AKWVDSNIDFSKTKVFFQGVAAVHLDGKEWKDPKAKGCLGQTQPVLGPTYPGPSHPGEAI  299

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG---GVVDCSHWCVAGVPDSWNQILYS  343
            VK VL ++ N VYLLDI LLTQLRKDGHPS YAG     VDCSHWC+ G PD+WN++LY+
Sbjct  300  VKSVLSSIENPVYLLDITLLTQLRKDGHPSIYAGQGPKFVDCSHWCLPGAPDAWNELLYA  359

Query  342  ILI  334
             L+
Sbjct  360  ALL  362



>ref|XP_010675348.1| PREDICTED: protein trichome birefringence-like 42 [Beta vulgaris 
subsp. vulgaris]
Length=329

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 93/124 (75%), Gaps = 3/124 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVD+NI+P KT+VFFQG SA H +G+EW EP  + CRH+ +P++   + G R+P E +
Sbjct  205  ANWVDANINPKKTQVFFQGASAAHLNGSEWGEPTARFCRHEVEPVKDPIYAGGRHPSELI  264

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            VK VL  M   V LLDI LLTQLRKDGHPS YA G   ++DCSHWC+ GVPD+WNQ+L+S
Sbjct  265  VKNVLNQMEKDVNLLDITLLTQLRKDGHPSIYASGDQKLLDCSHWCLPGVPDAWNQLLFS  324

Query  342  ILIQ  331
            IL +
Sbjct  325  ILFE  328



>emb|CBI20116.3| unnamed protein product [Vitis vinifera]
Length=329

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 92/123 (75%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD NIDP+KT+VFFQG+SAVH  G +W+EP  + C  QT P+ GS++PG   P E V
Sbjct  205  AKWVDENIDPSKTRVFFQGVSAVHVIGADWDEPGAKQCIGQTTPVNGSAYPGGSLPAEDV  264

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG---GVVDCSHWCVAGVPDSWNQILYS  343
            ++ ++  M    +L+DI LLTQLRKDGHPS YAG    +VDCSHWC+AGVPDSWN++LY+
Sbjct  265  LRSIISRMKKPAFLMDITLLTQLRKDGHPSVYAGQGKALVDCSHWCLAGVPDSWNELLYA  324

Query  342  ILI  334
             L+
Sbjct  325  ALL  327



>ref|XP_006477834.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=369

 Score =   163 bits (412),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 92/123 (75%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSNID +KTKVFFQG++AVH  G EW +P  + C  QT+P++G  +PG  +PGEAV
Sbjct  247  AKWVDSNIDFSKTKVFFQGVAAVHVDGREWGDPTAKGCDGQTEPMKGPKYPGPAHPGEAV  306

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG---GVVDCSHWCVAGVPDSWNQILYS  343
            VK V+ +M    YLLDI +LTQLRKDGHPS Y G      DCSHWC+AGVPD+WNQ+LY+
Sbjct  307  VKSVISSMAKPAYLLDITVLTQLRKDGHPSVYTGRGSTFDDCSHWCLAGVPDAWNQLLYT  366

Query  342  ILI  334
             LI
Sbjct  367  ALI  369



>ref|XP_007211478.1| hypothetical protein PRUPE_ppa007592mg [Prunus persica]
 gb|EMJ12677.1| hypothetical protein PRUPE_ppa007592mg [Prunus persica]
Length=362

 Score =   162 bits (411),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 92/123 (75%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSNID +KTKVFFQG++AVH  G EW +P    C  QT+P+ G ++PG  +PGEA+
Sbjct  240  AKWVDSNIDFSKTKVFFQGVAAVHLDGKEWKDPKANGCIGQTQPVLGPTYPGPSHPGEAI  299

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG---GVVDCSHWCVAGVPDSWNQILYS  343
            VK VL  + N VYLLDI LLTQLRKDGHPS YAG     VDCSHWC+ G PD+WN++LY+
Sbjct  300  VKSVLSIIENPVYLLDITLLTQLRKDGHPSIYAGQGPKFVDCSHWCLPGAPDTWNELLYA  359

Query  342  ILI  334
             L+
Sbjct  360  ALL  362



>ref|XP_010912702.1| PREDICTED: protein trichome birefringence-like 38 [Elaeis guineensis]
Length=375

 Score =   163 bits (412),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 92/122 (75%), Gaps = 2/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD NI+P  TKVFFQGIS  HY G++W EP  +DC  QT+P+ GS++PG   P + +
Sbjct  254  AKWVDYNINPAATKVFFQGISPTHYQGSDWGEPNAKDCSKQTQPVSGSTYPGAPVPAQGI  313

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG--VVDCSHWCVAGVPDSWNQILYSI  340
            VK VLG ++  VYLLDI LL+QLRKD HPS Y+G    +DCSHWC+AG+PD+WNQILY+ 
Sbjct  314  VKNVLGTISKPVYLLDITLLSQLRKDAHPSAYSGDHQGMDCSHWCLAGLPDTWNQILYAA  373

Query  339  LI  334
            L+
Sbjct  374  LL  375



>ref|XP_002283640.1| PREDICTED: protein trichome birefringence-like 42 [Vitis vinifera]
Length=369

 Score =   162 bits (411),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 92/123 (75%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD NIDP+KT+VFFQG+SAVH  G +W+EP  + C  QT P+ GS++PG   P E V
Sbjct  245  AKWVDENIDPSKTRVFFQGVSAVHVIGADWDEPGAKQCIGQTTPVNGSAYPGGSLPAEDV  304

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG---GVVDCSHWCVAGVPDSWNQILYS  343
            ++ ++  M    +L+DI LLTQLRKDGHPS YAG    +VDCSHWC+AGVPDSWN++LY+
Sbjct  305  LRSIISRMKKPAFLMDITLLTQLRKDGHPSVYAGQGKALVDCSHWCLAGVPDSWNELLYA  364

Query  342  ILI  334
             L+
Sbjct  365  ALL  367



>ref|XP_008351025.1| PREDICTED: protein trichome birefringence-like 42 [Malus domestica]
Length=244

 Score =   157 bits (398),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 88/122 (72%), Gaps = 3/122 (2%)
 Frame = -2

Query  690  NWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAVV  511
             WVDS+ID + TKVFFQG++AVH  G EW +P    C  QT+PI G ++PG  +PGEA+V
Sbjct  123  KWVDSSIDISNTKVFFQGVAAVHTDGKEWKDPKAGSCLRQTQPILGPTYPGPSHPGEAIV  182

Query  510  KGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG---GVVDCSHWCVAGVPDSWNQILYSI  340
            K VL  M   VYLLDI LLTQLRKDGHPS YAG      DCSHWC+ G PD+WN++LY+ 
Sbjct  183  KSVLSGMEKPVYLLDITLLTQLRKDGHPSIYAGEGPKYNDCSHWCLPGAPDTWNELLYAA  242

Query  339  LI  334
            L+
Sbjct  243  LL  244



>ref|XP_008365523.1| PREDICTED: protein trichome birefringence-like 42 [Malus domestica]
Length=232

 Score =   157 bits (396),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 88/123 (72%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              WVDS+ID + TKVFFQG++AVH  G EW +P    C  QT+PI G ++PG  +PGEA+
Sbjct  110  GKWVDSSIDISXTKVFFQGVAAVHTDGKEWKDPKAGSCLRQTQPILGPTYPGPSHPGEAI  169

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG---GVVDCSHWCVAGVPDSWNQILYS  343
            VK VL  M   VYLLDI LLTQLRKDGHPS YAG      DCSHWC+ G PD+WN++LY+
Sbjct  170  VKSVLSGMEKPVYLLDITLLTQLRKDGHPSIYAGEGPKYNDCSHWCLPGAPDTWNELLYA  229

Query  342  ILI  334
             L+
Sbjct  230  ALL  232



>ref|XP_006442365.1| hypothetical protein CICLE_v10023594mg, partial [Citrus clementina]
 gb|ESR55605.1| hypothetical protein CICLE_v10023594mg, partial [Citrus clementina]
Length=331

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 90/123 (73%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WV SNID +KTKVFFQG++AVH  G EW +P  + C  QT+P++G  +PG  + GEAV
Sbjct  209  AKWVGSNIDFSKTKVFFQGVAAVHVDGREWGDPTAKGCDGQTEPMKGPKYPGPAHLGEAV  268

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG---GVVDCSHWCVAGVPDSWNQILYS  343
            VK V+ +M    YLLDI LLTQLR+DGHPS Y G      DCSHWC+AGVPD+WNQ+LY+
Sbjct  269  VKSVISSMAKPAYLLDITLLTQLRRDGHPSVYTGRGSAFDDCSHWCLAGVPDTWNQLLYT  328

Query  342  ILI  334
             LI
Sbjct  329  ALI  331



>gb|KDO42403.1| hypothetical protein CISIN_1g017556mg [Citrus sinensis]
Length=369

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 90/123 (73%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WV SNID +KTKVFFQG++AVH  G EW +P  + C  QT+P++G  +PG  + GEAV
Sbjct  247  AKWVGSNIDFSKTKVFFQGVAAVHVDGREWGDPTAKGCDGQTEPMKGPKYPGPAHLGEAV  306

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG---GVVDCSHWCVAGVPDSWNQILYS  343
            VK V+ +M    YLLDI LLTQLR+DGHPS Y G      DCSHWC+AGVPD+WNQ+LY+
Sbjct  307  VKSVISSMAKPAYLLDITLLTQLRRDGHPSVYTGRGSAFDDCSHWCLAGVPDTWNQLLYT  366

Query  342  ILI  334
             LI
Sbjct  367  ALI  369



>ref|XP_009396650.1| PREDICTED: protein trichome birefringence-like 37 [Musa acuminata 
subsp. malaccensis]
Length=373

 Score =   158 bits (399),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 91/121 (75%), Gaps = 2/121 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSN++P  TKVFFQGIS  HY G +W +P+ ++C  Q +P++GS++PG   P + +
Sbjct  252  AKWVDSNVNPATTKVFFQGISPTHYLGVDWGDPSAKNCYRQIQPVKGSTYPGGPVPAQGI  311

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG--GVVDCSHWCVAGVPDSWNQILYSI  340
            VK VL  MT  VYLLDI LL+QLRKD HPS Y+G    +DCSHWCV+G+PD+WNQILY+ 
Sbjct  312  VKSVLSTMTKPVYLLDITLLSQLRKDAHPSAYSGDHAGMDCSHWCVSGLPDTWNQILYAA  371

Query  339  L  337
            L
Sbjct  372  L  372



>ref|XP_007215849.1| hypothetical protein PRUPE_ppa010297mg [Prunus persica]
 gb|EMJ17048.1| hypothetical protein PRUPE_ppa010297mg [Prunus persica]
Length=255

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 94/125 (75%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A+WV+SN+DPNKTKVFFQG+S  H +  EW++P   +C  Q+KP+ G  +PG+ +P E V
Sbjct  131  ASWVNSNVDPNKTKVFFQGVSPDHSNATEWSDPKAINCNAQSKPLPGPDYPGKAHPAEEV  190

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            V+ VL +M+ +V+LLD+  L+QLRKDGHPS Y  G    +DCSHWC+AGVPD+WN +LY+
Sbjct  191  VEKVLRSMSKTVHLLDVTTLSQLRKDGHPSVYGLGGHRGMDCSHWCLAGVPDTWNVLLYA  250

Query  342  ILIQN  328
             L QN
Sbjct  251  ALTQN  255



>ref|XP_009394133.1| PREDICTED: protein trichome birefringence-like 38 [Musa acuminata 
subsp. malaccensis]
Length=373

 Score =   157 bits (397),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 88/122 (72%), Gaps = 2/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSNID   TKVFFQGIS  HY G +W E    +C  QT+P+ GS++PG   P + +
Sbjct  252  AKWVDSNIDSAATKVFFQGISPTHYQGADWGEQNTNNCNKQTQPVAGSTYPGGPLPAQGI  311

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG--GVVDCSHWCVAGVPDSWNQILYSI  340
            V  VLG M+  VYLLDI LL+QLRKD HPS Y+G    +DCSHWC+AG+PD+WNQILY+ 
Sbjct  312  VNSVLGAMSKPVYLLDITLLSQLRKDAHPSAYSGDHSGMDCSHWCLAGLPDTWNQILYAA  371

Query  339  LI  334
            L+
Sbjct  372  LV  373



>ref|XP_011082791.1| PREDICTED: protein trichome birefringence-like 43 [Sesamum indicum]
Length=357

 Score =   156 bits (395),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 89/125 (71%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            + WVDSN++P KTKVFFQGIS  HY+G EWN      C  +T+PI G  +PG   P  AV
Sbjct  228  SKWVDSNVNPAKTKVFFQGISPTHYNGTEWNASRTGSCNGETQPISGGVYPGGTLPAVAV  287

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV---DCSHWCVAGVPDSWNQILYS  343
            VKGVL NMT  V LLD+  L++LRKDGHPS Y  G     DCSHWC+AGVPD+WNQ+LY+
Sbjct  288  VKGVLSNMTTGVRLLDVTTLSELRKDGHPSVYGIGGQRGNDCSHWCLAGVPDTWNQLLYA  347

Query  342  ILIQN  328
            IL+ +
Sbjct  348  ILVTD  352



>ref|XP_008451728.1| PREDICTED: protein trichome birefringence-like 42 [Cucumis melo]
Length=367

 Score =   156 bits (395),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 93/127 (73%), Gaps = 5/127 (4%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              W+DSNI+P+KT VFFQG+SAVH  GN+W E + ++C+ + +PI+GS +PG    GEA+
Sbjct  241  GKWLDSNINPSKTIVFFQGVSAVHIDGNDWGEISTKNCQGEKQPIKGSKYPGPSLEGEAI  300

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG-----VVDCSHWCVAGVPDSWNQIL  349
            VK VL ++   VYLLD+ LLTQLRKDGHPS Y        ++DCSHWC+ GVPD+WN IL
Sbjct  301  VKSVLNDIVTPVYLLDVTLLTQLRKDGHPSNYTTSNSSTPLLDCSHWCLPGVPDTWNLIL  360

Query  348  YSILIQN  328
            ++ L QN
Sbjct  361  FTTLFQN  367



>ref|XP_007149523.1| hypothetical protein PHAVU_005G077300g [Phaseolus vulgaris]
 gb|ESW21517.1| hypothetical protein PHAVU_005G077300g [Phaseolus vulgaris]
Length=256

 Score =   153 bits (387),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+N+DP K KVFFQGIS  HY+G+ WNEP+ + C  Q  P+ GS++PG   P  AV
Sbjct  135  AKWVDTNVDPTKVKVFFQGISPSHYNGSLWNEPSAKSCIRQKTPVPGSTYPGGLPPAVAV  194

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA-GGV--VDCSHWCVAGVPDSWNQILYS  343
            +KGVLG +   V LLDI  L+ LRKDGHPS Y  GG   +DCSHWC+AGVPD+WN+ILY+
Sbjct  195  LKGVLGTIKKPVTLLDITTLSLLRKDGHPSIYGLGGAAGMDCSHWCLAGVPDTWNEILYN  254

Query  342  IL  337
            ++
Sbjct  255  LI  256



>ref|XP_010273483.1| PREDICTED: protein trichome birefringence-like 38 [Nelumbo nucifera]
Length=365

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVDSNIDP  TKVFFQGIS  HY G EWN+P +  C  QT+P+ GS++PG      AV
Sbjct  243  ANWVDSNIDPASTKVFFQGISPTHYDGREWNQPKMS-CNAQTQPVSGSTYPGGSPAPAAV  301

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA-GGV--VDCSHWCVAGVPDSWNQILYS  343
            VK VLG M+  V LLDI  L+QLRKDGHPS Y  GG   +DCSHWC+AGVPD+WN++LY+
Sbjct  302  VKNVLGKMSKPVNLLDITTLSQLRKDGHPSAYGPGGAKGMDCSHWCLAGVPDTWNELLYA  361

Query  342  ILI  334
             L+
Sbjct  362  SLV  364



>ref|XP_010060752.1| PREDICTED: protein trichome birefringence-like 41 isoform X2 
[Eucalyptus grandis]
 ref|XP_010060753.1| PREDICTED: protein trichome birefringence-like 41 isoform X2 
[Eucalyptus grandis]
 ref|XP_010060754.1| PREDICTED: protein trichome birefringence-like 41 isoform X2 
[Eucalyptus grandis]
 ref|XP_010060755.1| PREDICTED: protein trichome birefringence-like 41 isoform X2 
[Eucalyptus grandis]
Length=257

 Score =   153 bits (386),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 91/123 (74%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+NIDP K+KVFFQGIS  HY+G +WNEP+ + C  Q +P+ GS++PG   P  AV
Sbjct  135  AGWVDANIDPAKSKVFFQGISPSHYNGTQWNEPSAKSCVGQKQPMPGSTYPGGPPPAVAV  194

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            +KGVL  +   V LLDI  L+ LRKDGHPS Y  G    +DCSHWC+AGVPD+WN+ILY+
Sbjct  195  LKGVLSKIKKPVVLLDITNLSLLRKDGHPSMYGLGGRTAMDCSHWCLAGVPDTWNEILYN  254

Query  342  ILI  334
            +++
Sbjct  255  LIL  257



>ref|XP_009411213.1| PREDICTED: protein trichome birefringence-like 38 [Musa acuminata 
subsp. malaccensis]
Length=356

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 89/122 (73%), Gaps = 2/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+NI+P  TKVFFQGIS  HY G EW +   ++C  QT+P+ GS++PG   P + V
Sbjct  235  AKWVDANINPAATKVFFQGISPTHYKGAEWGDKNAKNCYRQTQPVNGSTYPGGPVPAQGV  294

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG--VVDCSHWCVAGVPDSWNQILYSI  340
            V  VLG M+  VYLLDI LL+QLR D HPS Y+G    +DCSHWC+AGVPD+WNQILY+ 
Sbjct  295  VTSVLGAMSKPVYLLDITLLSQLRIDAHPSAYSGDHPGMDCSHWCLAGVPDTWNQILYAA  354

Query  339  LI  334
            L+
Sbjct  355  LL  356



>ref|XP_002278078.2| PREDICTED: protein trichome birefringence-like 43 [Vitis vinifera]
Length=353

 Score =   155 bits (391),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 93/126 (74%), Gaps = 4/126 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEP-AVQDCRHQTKPIEGSSFPGERYPGEA  517
            ANWVDS +DP KTKVFFQG+S  H +G+ W E     +C+ Q +PI G++FPG ++P EA
Sbjct  228  ANWVDSQVDPTKTKVFFQGVSPDHMNGSTWGESNPSSNCKGQMQPIFGTTFPGGQHPAEA  287

Query  516  VVKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILY  346
            VV+ VL  MT  VYLL +  L+QLRKDGHPS Y  G    +DCSHWC+AGVPD+WN++LY
Sbjct  288  VVEKVLQTMTKPVYLLRVTTLSQLRKDGHPSVYGHGGHRDMDCSHWCLAGVPDTWNELLY  347

Query  345  SILIQN  328
            + LIQN
Sbjct  348  AALIQN  353



>ref|XP_010549391.1| PREDICTED: protein trichome birefringence-like 37 [Tarenaya hassleriana]
Length=387

 Score =   155 bits (393),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 89/120 (74%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+D +KT+VFFQGIS  HY G EWNEP  + C  QT+P+ GS++PG   P  AV
Sbjct  267  AKWVDLNVDSSKTRVFFQGISPTHYQGREWNEPK-KTCIGQTEPLSGSTYPGGPPPATAV  325

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            +  VL +M  SVYLLDI +L+QLRKD HPSTY G G  DCSHWC+ G+PD+WNQ+LYS L
Sbjct  326  LAKVLSSMRTSVYLLDITMLSQLRKDAHPSTYVGDGGTDCSHWCLPGLPDTWNQLLYSAL  385



>ref|XP_004137309.1| PREDICTED: protein trichome birefringence-like 42 [Cucumis sativus]
 gb|KGN53586.1| hypothetical protein Csa_4G083600 [Cucumis sativus]
Length=371

 Score =   155 bits (391),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 92/127 (72%), Gaps = 5/127 (4%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              W+DSNI+P+ T VFFQG+SAVH  GN+W E + ++C+ + +PI+GS +PG    GEA+
Sbjct  245  GKWLDSNINPSNTIVFFQGVSAVHIDGNDWGEASTKNCQGEKQPIKGSRYPGPSLEGEAI  304

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG-----VVDCSHWCVAGVPDSWNQIL  349
             K VL ++   VYLLD+ LLTQLRKDGHPS Y        ++DCSHWC+AGVPD+WN IL
Sbjct  305  AKNVLSDIVTPVYLLDVTLLTQLRKDGHPSNYTTSNNSTPLLDCSHWCLAGVPDTWNLIL  364

Query  348  YSILIQN  328
            ++ L QN
Sbjct  365  FATLFQN  371



>ref|XP_010060751.1| PREDICTED: protein trichome birefringence-like 41 isoform X1 
[Eucalyptus grandis]
Length=282

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 91/123 (74%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+NIDP K+KVFFQGIS  HY+G +WNEP+ + C  Q +P+ GS++PG   P  AV
Sbjct  160  AGWVDANIDPAKSKVFFQGISPSHYNGTQWNEPSAKSCVGQKQPMPGSTYPGGPPPAVAV  219

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            +KGVL  +   V LLDI  L+ LRKDGHPS Y  G    +DCSHWC+AGVPD+WN+ILY+
Sbjct  220  LKGVLSKIKKPVVLLDITNLSLLRKDGHPSMYGLGGRTAMDCSHWCLAGVPDTWNEILYN  279

Query  342  ILI  334
            +++
Sbjct  280  LIL  282



>ref|XP_004969334.1| PREDICTED: uncharacterized protein LOC101766252 [Setaria italica]
Length=392

 Score =   155 bits (391),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 91/122 (75%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSN+D +KTKV+FQGIS  HY+G EW E   ++C  QT+PI GS++P    P +A 
Sbjct  271  ARWVDSNVDTSKTKVYFQGISPTHYNGAEWGE-GSRNCAQQTQPIAGSAYPAGPVPAQAA  329

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            V+  L  M+  VYLLD+ LL+QLR+DGHPS Y+GG    DCSHWC+AGVPD+WNQILY+ 
Sbjct  330  VRAALSGMSKPVYLLDVTLLSQLRRDGHPSAYSGGHPGNDCSHWCLAGVPDTWNQILYAS  389

Query  339  LI  334
            L+
Sbjct  390  LL  391



>ref|XP_009587076.1| PREDICTED: protein trichome birefringence-like 41 [Nicotiana 
tomentosiformis]
Length=367

 Score =   154 bits (390),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 92/123 (75%), Gaps = 1/123 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+++D  KTKVFFQG++A+HYHG+EW EP V++C ++T P++GS++P        +
Sbjct  239  AKWVDTDVDTKKTKVFFQGVAAMHYHGSEWGEPKVKNCFNETTPVKGSTYPSGLPIPVNI  298

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            VK VL  M+  VYLLDI  LTQLRKDGHPS Y G    DC+HWC+ GVPD+WNQILY+ L
Sbjct  299  VKQVLRKMSKPVYLLDITKLTQLRKDGHPSIYNGLHGFDCTHWCIGGVPDTWNQILYASL  358

Query  336  IQN  328
            + N
Sbjct  359  LPN  361



>ref|XP_009769822.1| PREDICTED: protein trichome birefringence-like 41 isoform X2 
[Nicotiana sylvestris]
Length=257

 Score =   151 bits (382),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 90/121 (74%), Gaps = 1/121 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+++D  KTKV+FQG++A+HYHG+EW EP V++C ++T P++GS++P        +
Sbjct  129  AKWVDTDVDTKKTKVYFQGVAAMHYHGSEWGEPKVKNCFNETTPVKGSTYPSGLAIPVNI  188

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            VK VL  M+  VYLLDI  LTQLRKDGHPS Y G    DC+HWC+ GVPD+WNQILY+ L
Sbjct  189  VKQVLRKMSKPVYLLDITKLTQLRKDGHPSIYNGLHGFDCTHWCIGGVPDTWNQILYASL  248

Query  336  I  334
             
Sbjct  249  F  249



>gb|KGN51104.1| hypothetical protein Csa_5G450150 [Cucumis sativus]
Length=278

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 90/121 (74%), Gaps = 1/121 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVDS +D NKTKVFFQGIS  HY+GNEWNEP V++C  +T PI GS++PG        
Sbjct  149  ANWVDSQVDTNKTKVFFQGISPSHYNGNEWNEPGVRNCFKETSPINGSTYPGGLPAASLT  208

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYSIL  337
            ++ VL  ++  + +L+I  L+QLRKD HPS+Y G   +DC+HWC+AG+PD+WNQ+LY+ L
Sbjct  209  LEKVLSEVSKPIQVLNITTLSQLRKDAHPSSYNGFRGMDCTHWCIAGLPDTWNQLLYATL  268

Query  336  I  334
            I
Sbjct  269  I  269



>ref|XP_009376740.1| PREDICTED: protein trichome birefringence-like 42 [Pyrus x bretschneideri]
Length=343

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/120 (59%), Positives = 86/120 (72%), Gaps = 3/120 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              WVDS+ID + TKVFFQG++AVH  G EW +P    C  QT+PI G ++PG  +PGEA+
Sbjct  221  GKWVDSSIDISITKVFFQGVAAVHTDGKEWKDPEAGSCLRQTQPILGPTYPGPSHPGEAI  280

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG---GVVDCSHWCVAGVPDSWNQILYS  343
            VK VL  M   VYLLDI LLTQLRKDGHPS YAG      DCSHWC+ G PD+WN++LY+
Sbjct  281  VKSVLSGMEKPVYLLDITLLTQLRKDGHPSIYAGEGPKYNDCSHWCLPGAPDTWNELLYA  340



>emb|CDY37673.1| BnaA04g19950D [Brassica napus]
Length=135

 Score =   147 bits (370),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N++ ++T+VFFQGIS  HY G EWNEP   +C  Q +P+ GS++PG   P  ++
Sbjct  15   AQWVDQNVNISQTRVFFQGISPTHYVGKEWNEPR-DNCNGQMQPLSGSTYPGGSLPAASI  73

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTY-AGGVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   VYLLDI  L+QLRKD HPSTY A G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  74   VSRVLSSMKTPVYLLDITTLSQLRKDAHPSTYGAAGGSDCSHWCLPGLPDTWNQLLYAAL  133



>ref|XP_002316834.2| hypothetical protein POPTR_0011s07550g [Populus trichocarpa]
 gb|EEE97446.2| hypothetical protein POPTR_0011s07550g [Populus trichocarpa]
Length=224

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 85/122 (70%), Gaps = 2/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              WVD NIDP+KTKVFFQGIS  HY G +WN+P  + C  +  P+ GS++P    P  AV
Sbjct  104  GRWVDQNIDPSKTKVFFQGISPTHYQGKDWNQPK-KSCSGEAVPLSGSTYPAGSPPAAAV  162

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   VYLLDI  L+QLRKD HPSTY+ G   DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  163  VNKVLSSMKKPVYLLDITTLSQLRKDAHPSTYSDGSGTDCSHWCLPGLPDTWNQLLYAAL  222

Query  336  IQ  331
            I 
Sbjct  223  IM  224



>ref|XP_007149522.1| hypothetical protein PHAVU_005G077300g [Phaseolus vulgaris]
 gb|ESW21516.1| hypothetical protein PHAVU_005G077300g [Phaseolus vulgaris]
Length=350

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+N+DP K KVFFQGIS  HY+G+ WNEP+ + C  Q  P+ GS++PG   P  AV
Sbjct  229  AKWVDTNVDPTKVKVFFQGISPSHYNGSLWNEPSAKSCIRQKTPVPGSTYPGGLPPAVAV  288

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA-GGV--VDCSHWCVAGVPDSWNQILYS  343
            +KGVLG +   V LLDI  L+ LRKDGHPS Y  GG   +DCSHWC+AGVPD+WN+ILY+
Sbjct  289  LKGVLGTIKKPVTLLDITTLSLLRKDGHPSIYGLGGAAGMDCSHWCLAGVPDTWNEILYN  348

Query  342  IL  337
            ++
Sbjct  349  LI  350



>ref|XP_010538205.1| PREDICTED: protein trichome birefringence-like 38 [Tarenaya hassleriana]
Length=250

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 85/120 (71%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+D   T+VFFQGIS  HY G EWNEP  + C  Q +P+ GS++PG   P  AV
Sbjct  130  AQWVDLNVDTAVTRVFFQGISPTHYEGREWNEPR-KSCNGQMEPLSGSTYPGGEPPAAAV  188

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V+ VL +M   VYLLDI  L+QLRKD HPSTY G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  189  VEKVLSSMRTPVYLLDITTLSQLRKDAHPSTYGGDGGTDCSHWCLPGLPDTWNQLLYAAL  248



>gb|KCW67608.1| hypothetical protein EUGRSUZ_F01363 [Eucalyptus grandis]
Length=341

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 91/123 (74%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+NIDP K+KVFFQGIS  HY+G +WNEP+ + C  Q +P+ GS++PG   P  AV
Sbjct  219  AGWVDANIDPAKSKVFFQGISPSHYNGTQWNEPSAKSCVGQKQPMPGSTYPGGPPPAVAV  278

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            +KGVL  +   V LLDI  L+ LRKDGHPS Y  G    +DCSHWC+AGVPD+WN+ILY+
Sbjct  279  LKGVLSKIKKPVVLLDITNLSLLRKDGHPSMYGLGGRTAMDCSHWCLAGVPDTWNEILYN  338

Query  342  ILI  334
            +++
Sbjct  339  LIL  341



>ref|XP_010670414.1| PREDICTED: protein trichome birefringence-like 38 [Beta vulgaris 
subsp. vulgaris]
Length=357

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 90/121 (74%), Gaps = 1/121 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+ IDPNKT+V FQGI+  HY+G EWN+ +   C  +T PI+GS++PG   P   V
Sbjct  236  AKWVDAEIDPNKTRVLFQGINPTHYNGKEWNDTSAIGCSKETMPIKGSTYPGGETPALGV  295

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTY-AGGVVDCSHWCVAGVPDSWNQILYSIL  337
            VK VL  ++  VYLLDI  L+QLRKDGHP++Y A   +DC+HWCVAG+PD+WNQ+LY+ L
Sbjct  296  VKQVLSTISKPVYLLDITTLSQLRKDGHPASYNAFQGMDCNHWCVAGLPDTWNQLLYTTL  355

Query  336  I  334
            I
Sbjct  356  I  356



>gb|EMS68141.1| hypothetical protein TRIUR3_18151 [Triticum urartu]
Length=276

 Score =   150 bits (379),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSN+D +KTKV+FQGIS  H++G +W E +   C HQT+PI GS++PG   P +  
Sbjct  155  ARWVDSNVDTSKTKVYFQGISPTHFNGAQWGESS-SSCAHQTQPIAGSTYPGGPLPAQGA  213

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            V+  L  M+  V+LLDI LL+QLR+D HPS Y+GG    DCSHWC+AG+PD+WNQILY+ 
Sbjct  214  VRNALNGMSKPVFLLDITLLSQLRRDAHPSAYSGGHPGNDCSHWCLAGLPDTWNQILYAS  273

Query  339  LI  334
            L+
Sbjct  274  LL  275



>gb|EMT21950.1| hypothetical protein F775_18320 [Aegilops tauschii]
Length=422

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSN+D +KTKV+FQGIS  H++G +W E +   C HQTKPI G ++PG   P +  
Sbjct  301  ARWVDSNVDTSKTKVYFQGISPTHFNGAQWGE-SSSSCAHQTKPIAGPTYPGGPLPAQGA  359

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG--VVDCSHWCVAGVPDSWNQILYSI  340
            V+  LG M+  V+LLDI LL+QLR+D HPS Y+GG    DCSHWC+AG+PD+WNQILY+ 
Sbjct  360  VRNALGGMSKPVFLLDITLLSQLRRDAHPSAYSGGHPSNDCSHWCLAGLPDTWNQILYAS  419

Query  339  LI  334
            L+
Sbjct  420  LL  421



>gb|EPS73377.1| hypothetical protein M569_01379, partial [Genlisea aurea]
Length=320

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSN+DP+KTKVFFQGIS  HY+G+ WNEP    C  +T P+EGS++PG   P   V
Sbjct  201  AKWVDSNVDPSKTKVFFQGISPSHYNGSLWNEPRAWSCIRETVPVEGSTYPGGLPPALFV  260

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVVDCSHWCVAGVPDSWNQILYSILI  334
            +K VL  +   V LLDI  L+ LRKDGHPS Y    +DCSHWC+ GVPD+WNQILY++++
Sbjct  261  LKKVLRTIKKPVQLLDITNLSLLRKDGHPSIYGLPAMDCSHWCLPGVPDTWNQILYNLIL  320



>emb|CDM83556.1| unnamed protein product [Triticum aestivum]
Length=388

 Score =   152 bits (385),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSN+D +KTKV+FQGIS  H++G +W E +   C HQT+PI G ++PG   P +  
Sbjct  267  ARWVDSNVDTSKTKVYFQGISPTHFNGAQWGE-SSSSCAHQTQPIAGPTYPGGPLPAQGA  325

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG--VVDCSHWCVAGVPDSWNQILYSI  340
            V+  LG M+  V+LLDI LL+QLR+D HPS Y+GG    DCSHWC+AG+PD+WNQILY+ 
Sbjct  326  VRNALGGMSKPVFLLDITLLSQLRRDAHPSAYSGGHPSNDCSHWCLAGLPDTWNQILYAS  385

Query  339  LI  334
            L+
Sbjct  386  LL  387



>ref|XP_009769816.1| PREDICTED: protein trichome birefringence-like 41 isoform X1 
[Nicotiana sylvestris]
Length=363

 Score =   152 bits (383),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 90/121 (74%), Gaps = 1/121 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+++D  KTKV+FQG++A+HYHG+EW EP V++C ++T P++GS++P        +
Sbjct  235  AKWVDTDVDTKKTKVYFQGVAAMHYHGSEWGEPKVKNCFNETTPVKGSTYPSGLAIPVNI  294

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            VK VL  M+  VYLLDI  LTQLRKDGHPS Y G    DC+HWC+ GVPD+WNQILY+ L
Sbjct  295  VKQVLRKMSKPVYLLDITKLTQLRKDGHPSIYNGLHGFDCTHWCIGGVPDTWNQILYASL  354

Query  336  I  334
             
Sbjct  355  F  355



>ref|XP_009790315.1| PREDICTED: protein trichome birefringence-like 41 [Nicotiana 
sylvestris]
Length=377

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 88/125 (70%), Gaps = 5/125 (4%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWN-EPAVQDCRHQTKPIEGSSFPGERYPGEA  517
            + WV+SNIDP KTKVFFQGIS  HY+G EWN   A  +C  +T+PI GS +PG       
Sbjct  245  SRWVESNIDPTKTKVFFQGISPTHYNGQEWNGSKASSNCNGETQPISGSMYPGGPMAAAT  304

Query  516  VVKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA----GGVVDCSHWCVAGVPDSWNQIL  349
            VVK VL NM+  V LLDI LL+QLRKDGHPS Y     G   DCSHWC+AGVPD+WNQI 
Sbjct  305  VVKEVLSNMSKPVTLLDITLLSQLRKDGHPSIYGINAKGKGNDCSHWCLAGVPDTWNQIF  364

Query  348  YSILI  334
            Y++L+
Sbjct  365  YALLV  369



>ref|XP_002458239.1| hypothetical protein SORBIDRAFT_03g029700 [Sorghum bicolor]
 gb|EES03359.1| hypothetical protein SORBIDRAFT_03g029700 [Sorghum bicolor]
Length=398

 Score =   152 bits (384),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSN+D ++TKV+FQGIS  HY+G +W E   + C  QT+P+ GS++P    P +  
Sbjct  277  ARWVDSNVDTSRTKVYFQGISPTHYNGADWGE-GSRSCAQQTQPVAGSAYPAGPVPAQGA  335

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            V+  LG M+  VYLLD+ LL+QLR+DGHPS Y+GG    DCSHWC+AGVPD+WNQILY+ 
Sbjct  336  VRAALGGMSKPVYLLDVTLLSQLRRDGHPSAYSGGHPGNDCSHWCLAGVPDTWNQILYAS  395

Query  339  LI  334
            L+
Sbjct  396  LL  397



>ref|XP_008228905.1| PREDICTED: protein trichome birefringence-like 43 [Prunus mume]
Length=358

 Score =   151 bits (381),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 91/125 (73%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSN+D NKTKVFFQG+S  H +G EW +P   +C  Q++P+ G ++PGE +P E V
Sbjct  234  ATWVDSNVDSNKTKVFFQGVSPDHSNGREWGDPQANNCSAQSEPLPGPNYPGEAHPAEKV  293

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            V+ VL  M+  V+LL++  L+QLRKDGHPS Y  G    +DC+HWC+AGVPD+WN +LY+
Sbjct  294  VEKVLRTMSKPVHLLNVTTLSQLRKDGHPSVYGLGGHRGLDCTHWCLAGVPDTWNVLLYA  353

Query  342  ILIQN  328
             L QN
Sbjct  354  ALTQN  358



>ref|XP_007216516.1| hypothetical protein PRUPE_ppa024241mg, partial [Prunus persica]
 gb|EMJ17715.1| hypothetical protein PRUPE_ppa024241mg, partial [Prunus persica]
Length=330

 Score =   150 bits (379),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 90/125 (72%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSN+D NKTKVFFQG+S  H +G EW +P   +C  Q+ P+ G ++PGE +P E V
Sbjct  206  ATWVDSNVDSNKTKVFFQGVSPDHSNGREWGDPQANNCSAQSDPLPGPNYPGEAHPAEKV  265

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            V+ VL  M+  V+LL++  L+QLRKDGHPS Y  G    +DC+HWC+AGVPD+WN +LY+
Sbjct  266  VEKVLRTMSKPVHLLNVTTLSQLRKDGHPSVYGLGGHRGLDCTHWCLAGVPDTWNVLLYA  325

Query  342  ILIQN  328
             L QN
Sbjct  326  ALTQN  330



>ref|XP_008228904.1| PREDICTED: protein trichome birefringence-like 43 [Prunus mume]
Length=359

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 92/125 (74%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A+WV+SN+DPNKT VFFQG+S  H +  EW++P   +C  Q+KP+ G  +PG+ +P E V
Sbjct  235  ASWVNSNVDPNKTMVFFQGVSPDHSNATEWSDPKAINCNAQSKPLPGPDYPGKAHPAEEV  294

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            V+ VL +M+  V+LLD+  L+QLRKDGHPS Y  G    +DCSHWC+AGVPD+WN +LY+
Sbjct  295  VEKVLRSMSKPVHLLDVTTLSQLRKDGHPSVYGLGGHRGMDCSHWCLAGVPDTWNVLLYA  354

Query  342  ILIQN  328
             L QN
Sbjct  355  ALTQN  359



>ref|XP_009769585.1| PREDICTED: protein trichome birefringence-like 38 [Nicotiana 
sylvestris]
Length=353

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 90/121 (74%), Gaps = 1/121 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WV++++D NKTKVFFQG S  HYHG++WNEP V +C ++T P+ GS++P        +
Sbjct  233  AKWVETDVDTNKTKVFFQGASPAHYHGSDWNEPNVNNCLNETSPVNGSTYPSGLPVAVEI  292

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTY-AGGVVDCSHWCVAGVPDSWNQILYSIL  337
            VK VL N++  V+LLDI  L+QLRKDGHPS Y A   +DC+HWC+AGVPD+WNQI Y+ L
Sbjct  293  VKQVLSNISKPVFLLDITKLSQLRKDGHPSKYNAFKGMDCTHWCLAGVPDTWNQIFYASL  352

Query  336  I  334
            I
Sbjct  353  I  353



>ref|XP_009410826.1| PREDICTED: protein trichome birefringence-like 38 [Musa acuminata 
subsp. malaccensis]
Length=373

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 89/122 (73%), Gaps = 2/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+NI+P  TKVFFQGIS  H  G EW +   ++C  QT+P+ GS++PG   P + V
Sbjct  252  AKWVDANINPAATKVFFQGISPTHSKGPEWGDKNAKNCYGQTQPVNGSTYPGGPVPAQGV  311

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG--VVDCSHWCVAGVPDSWNQILYSI  340
            V  VLG M+  VYLLDI LL+QLR+D HPS Y+G    +DCSHWC+AG+PD+WNQILY+ 
Sbjct  312  VTSVLGAMSKPVYLLDITLLSQLRRDAHPSAYSGDHPGMDCSHWCLAGLPDTWNQILYAK  371

Query  339  LI  334
            L+
Sbjct  372  LL  373



>ref|XP_010273288.1| PREDICTED: protein trichome birefringence-like 38 [Nelumbo nucifera]
Length=367

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 93/122 (76%), Gaps = 1/122 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDS+++P++TKVFFQGIS  HY+G EWNEP  ++C  QT+P++GS++PG       V
Sbjct  246  ARWVDSDVEPSRTKVFFQGISPSHYNGMEWNEPGERNCAKQTQPMKGSTYPGGWPRAMNV  305

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYSIL  337
            V  VL ++T  VYLL++  L+QLRKD HPS+Y G   +DC+HWC+AG+PD+WNQ+LY+ L
Sbjct  306  VSKVLSSITKPVYLLNVTTLSQLRKDAHPSSYNGFKGMDCTHWCIAGLPDTWNQLLYAAL  365

Query  336  IQ  331
            I 
Sbjct  366  IH  367



>dbj|BAJ89025.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=384

 Score =   151 bits (381),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 89/122 (73%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSN+D +KTKV+FQGIS  HY+G +W E +   C HQT+PI G ++PG   P +  
Sbjct  263  ARWVDSNVDTSKTKVYFQGISPTHYNGAQWGE-SSSSCAHQTQPIAGPAYPGGPLPAQGA  321

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            V+  LG M+  V+LLDI LL+QLR+D HPS Y+GG    DCSHWC+AG+PD+WN ILY+ 
Sbjct  322  VRSALGGMSKPVFLLDITLLSQLRRDAHPSAYSGGHPGNDCSHWCLAGLPDTWNHILYAS  381

Query  339  LI  334
            L+
Sbjct  382  LL  383



>ref|XP_007212437.1| hypothetical protein PRUPE_ppa016768mg, partial [Prunus persica]
 gb|EMJ13636.1| hypothetical protein PRUPE_ppa016768mg, partial [Prunus persica]
Length=329

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 86/123 (70%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            + WVDSN+D N TKVFFQGIS  HY+G EW++P    C  QT+P+ G ++P    P   V
Sbjct  204  SKWVDSNVDANNTKVFFQGISPSHYNGKEWDDPNSATCSGQTQPVTGRTYPAGSPPAATV  263

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV---DCSHWCVAGVPDSWNQILYS  343
            V  VL  M++SV LLDI LL+QLRKDGHPS Y  G     DCSHWC+AGVPD+WNQ+ Y+
Sbjct  264  VNDVLTAMSSSVTLLDITLLSQLRKDGHPSMYGNGGRTGNDCSHWCLAGVPDTWNQLFYA  323

Query  342  ILI  334
             L+
Sbjct  324  TLV  326



>ref|XP_011044588.1| PREDICTED: protein trichome birefringence-like 41 [Populus euphratica]
Length=370

 Score =   150 bits (380),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 90/123 (73%), Gaps = 4/123 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            +NWVD+NI+PN T+VFFQGIS  H +G+EWNE    +C  QT+PI GSS+PG   P  AV
Sbjct  242  SNWVDTNINPNVTEVFFQGISPTHCNGDEWNETK-SNCNGQTQPINGSSYPGRSPPAAAV  300

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV---DCSHWCVAGVPDSWNQILYS  343
            V+ VL NM  SV LLD+  L+QLRKDGHPS Y        DCSHWC+AGVPD+WN++LY+
Sbjct  301  VRDVLRNMKVSVTLLDVTTLSQLRKDGHPSIYGSDGKEGNDCSHWCLAGVPDTWNELLYA  360

Query  342  ILI  334
             LI
Sbjct  361  TLI  363



>ref|XP_002522557.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF39857.1| conserved hypothetical protein [Ricinus communis]
Length=370

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 85/121 (70%), Gaps = 2/121 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+DP KTKVFFQGIS  HY G EWN+P  + C  + +P+ GS++PG   P  AV
Sbjct  250  AKWVDQNVDPAKTKVFFQGISPTHYEGREWNQPK-KSCNGEAEPLSGSTYPGGAPPAVAV  308

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYSIL  337
            V  VL  +   VYLLDI  L+QLRKD HPSTY  G   DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  309  VNKVLSTIKKPVYLLDITTLSQLRKDAHPSTYGDGSGTDCSHWCLPGLPDTWNQLLYAAL  368

Query  336  I  334
            +
Sbjct  369  V  369



>ref|XP_011082790.1| PREDICTED: protein trichome birefringence-like 41 [Sesamum indicum]
Length=351

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+N+DP  TKVFFQGIS  HY+G+ WNEP  + C  Q +P+ GS++PG   P  AV
Sbjct  228  AKWVDTNVDPTNTKVFFQGISPSHYNGSTWNEPRAKSCVGQREPVAGSTYPGGLPPALAV  287

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVVDCSHWCVAGVPDSWNQILYSILI  334
            +K VL  M   V LLDI  L+ LRKDGHPS Y  G +DCSHWC+ GVPD+WN ILY+ L+
Sbjct  288  LKKVLSRMKKHVELLDITNLSLLRKDGHPSVYGLGGMDCSHWCLPGVPDTWNLILYNRLV  347



>ref|XP_002317442.1| hypothetical protein POPTR_0011s10730g [Populus trichocarpa]
 gb|EEE98054.1| hypothetical protein POPTR_0011s10730g [Populus trichocarpa]
Length=366

 Score =   150 bits (380),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 90/123 (73%), Gaps = 4/123 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            + WVD+NI+PN T+VFFQGIS  HY+G+EWNE    +C  QT+PI GSS+PG   P  AV
Sbjct  244  SRWVDTNINPNVTEVFFQGISPTHYNGDEWNETK-SNCNGQTQPINGSSYPGGSPPAAAV  302

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV---DCSHWCVAGVPDSWNQILYS  343
            V+ VL NM  SV LLD+  L+QLRKDGHPS Y        DCSHWC+AGVPD+WN++LY+
Sbjct  303  VRDVLRNMKVSVTLLDVTALSQLRKDGHPSIYGSDGKEGNDCSHWCLAGVPDTWNELLYA  362

Query  342  ILI  334
             LI
Sbjct  363  TLI  365



>ref|XP_010272740.1| PREDICTED: protein trichome birefringence-like 38 [Nelumbo nucifera]
Length=369

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 89/123 (72%), Gaps = 4/123 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            + WVDSNIDP   KVFFQGIS  HY+G+EWN+P + +C  QT+P+ GS++PG   P  AV
Sbjct  241  SKWVDSNIDPAIRKVFFQGISPTHYNGSEWNQPKM-NCNGQTQPLNGSAYPGGSPPAVAV  299

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTY---AGGVVDCSHWCVAGVPDSWNQILYS  343
            VK VL  M+N V LLDI  L+QLRKDGHPS Y        DCSHWC+AGVPD+WN +LY+
Sbjct  300  VKNVLSKMSNPVDLLDITTLSQLRKDGHPSIYGLDGKKGTDCSHWCLAGVPDTWNHLLYA  359

Query  342  ILI  334
             LI
Sbjct  360  SLI  362



>ref|XP_010273484.1| PREDICTED: protein trichome birefringence-like 41 [Nelumbo nucifera]
Length=361

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/124 (56%), Positives = 89/124 (72%), Gaps = 3/124 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+DP K+ VFFQGIS  HY+G+ WNEP+V+ C  QT+P+ GS++PG   P   V
Sbjct  238  AGWVDDNVDPTKSLVFFQGISPSHYNGSGWNEPSVKSCHGQTQPVNGSTYPGGSPPALDV  297

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            +K VL  M   VYLLD+  L+ LRKDGHPS Y       +DCSHWC+AGVPD+WNQ+LY+
Sbjct  298  LKSVLRKMVKPVYLLDVTGLSLLRKDGHPSIYGFSGREGMDCSHWCLAGVPDTWNQLLYN  357

Query  342  ILIQ  331
             LI+
Sbjct  358  ALIR  361



>ref|XP_009590818.1| PREDICTED: protein trichome birefringence-like 41 isoform X1 
[Nicotiana tomentosiformis]
Length=378

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 89/126 (71%), Gaps = 6/126 (5%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWN-EPAVQDCRHQTKPIEGSSFPGERYPGEA  517
            + WV+SNIDP+KT+VFFQGIS  HY+G EWN   A  +C  +T+PI GS +PG       
Sbjct  245  SKWVESNIDPSKTRVFFQGISPTHYNGQEWNGSKANSNCNGETQPISGSIYPGGHMAAAT  304

Query  516  VVKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA-----GGVVDCSHWCVAGVPDSWNQI  352
            VVK VL NM+  V LLDI LL+QLRKDGHPS Y      G   DCSHWC+AGVPD+WNQ+
Sbjct  305  VVKEVLSNMSKPVTLLDITLLSQLRKDGHPSIYGINGTKGKGNDCSHWCLAGVPDTWNQL  364

Query  351  LYSILI  334
             Y++L+
Sbjct  365  FYTLLV  370



>ref|XP_009590824.1| PREDICTED: protein trichome birefringence-like 41 isoform X2 
[Nicotiana tomentosiformis]
Length=377

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 89/126 (71%), Gaps = 6/126 (5%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWN-EPAVQDCRHQTKPIEGSSFPGERYPGEA  517
            + WV+SNIDP+KT+VFFQGIS  HY+G EWN   A  +C  +T+PI GS +PG       
Sbjct  244  SKWVESNIDPSKTRVFFQGISPTHYNGQEWNGSKANSNCNGETQPISGSIYPGGHMAAAT  303

Query  516  VVKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA-----GGVVDCSHWCVAGVPDSWNQI  352
            VVK VL NM+  V LLDI LL+QLRKDGHPS Y      G   DCSHWC+AGVPD+WNQ+
Sbjct  304  VVKEVLSNMSKPVTLLDITLLSQLRKDGHPSIYGINGTKGKGNDCSHWCLAGVPDTWNQL  363

Query  351  LYSILI  334
             Y++L+
Sbjct  364  FYTLLV  369



>ref|XP_004294162.2| PREDICTED: protein trichome birefringence-like 41 [Fragaria vesca 
subsp. vesca]
Length=380

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 89/123 (72%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            + WVDSN+D   T+VFFQGIS  HY+G EWNE     C  QT+PI GS++PG   P + V
Sbjct  252  SKWVDSNVDAKTTQVFFQGISPSHYNGKEWNETDSATCSGQTRPISGSTYPGGSPPAKTV  311

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA-GGVV--DCSHWCVAGVPDSWNQILYS  343
            V  VL  M++ V LLDI LL+QLRKDGHPS Y  GG +  DCSHWC++GVPD+WN++LY+
Sbjct  312  VNQVLAKMSSPVTLLDITLLSQLRKDGHPSLYGFGGKMGNDCSHWCLSGVPDTWNELLYA  371

Query  342  ILI  334
             L+
Sbjct  372  TLV  374



>ref|XP_006305057.1| hypothetical protein CARUB_v10009422mg [Capsella rubella]
 gb|EOA37955.1| hypothetical protein CARUB_v10009422mg [Capsella rubella]
Length=384

 Score =   150 bits (379),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 85/120 (71%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+D  KT+VFFQGIS  HY G EWNEP  + C  Q +P+ GSS+P  + P   V
Sbjct  264  ARWVDQNVDTTKTRVFFQGISPTHYEGREWNEPR-KSCSGQMQPLGGSSYPSGQPPSAGV  322

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VLG+M   V+LLDI  L+QLRKD HPS+Y G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  323  VSKVLGSMRKPVFLLDITTLSQLRKDAHPSSYGGDGGTDCSHWCLPGLPDTWNQLLYAAL  382



>ref|XP_007021952.1| Lustrin A-like, putative [Theobroma cacao]
 gb|EOY13477.1| Lustrin A-like, putative [Theobroma cacao]
Length=363

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 90/120 (75%), Gaps = 1/120 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            + WVDSN+DP+ T+VFFQGIS +HY G  WN P    C+ +T+P+ G+++PG   P   +
Sbjct  234  SRWVDSNVDPHTTQVFFQGISPIHYDGKGWNGPITATCQGETEPLNGTTYPGGLPPAVDI  293

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYSIL  337
            VK VLG+M+  V L+DI +L+ LRKDGHPS Y+G    DCSHWC+AGVPDSWN+ILY+IL
Sbjct  294  VKEVLGSMSKPVTLIDITMLSLLRKDGHPSLYSGNEGNDCSHWCLAGVPDSWNEILYAIL  353



>ref|XP_011080615.1| PREDICTED: protein trichome birefringence-like 38 [Sesamum indicum]
Length=366

 Score =   150 bits (378),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 94/125 (75%), Gaps = 4/125 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWV+S ++P+KTKVFFQGIS  HY+G EWNEP  +DC  +T P++GS++PG       V
Sbjct  240  ANWVNSEVNPSKTKVFFQGISPSHYNGTEWNEPGAKDCSRETAPLDGSTYPGGEPLAAEV  299

Query  513  VKGVL-GNMTNS--VYLLDIALLTQLRKDGHPSTY-AGGVVDCSHWCVAGVPDSWNQILY  346
            VK VL  N++ S  V+LLDI  L+QLRKDGHPS Y A   +DC+HWC+AGVPD+WNQ+LY
Sbjct  300  VKQVLRSNISPSKPVHLLDITTLSQLRKDGHPSKYNAFAGMDCTHWCLAGVPDTWNQLLY  359

Query  345  SILIQ  331
              L+Q
Sbjct  360  VELLQ  364



>ref|XP_010522062.1| PREDICTED: protein trichome birefringence-like 43 isoform X2 
[Tarenaya hassleriana]
Length=335

 Score =   149 bits (376),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 89/123 (72%), Gaps = 4/123 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEG-SSFPGERYPGEA  517
            A WVD N+DP++T+VFFQG+S  H + N+W+EP  + CR +T P+ G SS+P   +P E 
Sbjct  211  AKWVDENVDPSRTQVFFQGVSPDHANSNDWSEPGYKGCRGETTPLMGSSSYPAGSHPAEM  270

Query  516  VVKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILY  346
            V + V+G M N V LLD+  L+QLRKDGHPS +  G   V DCSHWC+AGVPD+WNQ+LY
Sbjct  271  VAEKVIGEMKNKVKLLDVTFLSQLRKDGHPSVFGLGGHRVADCSHWCLAGVPDTWNQLLY  330

Query  345  SIL  337
            + L
Sbjct  331  AEL  333



>gb|KJB24277.1| hypothetical protein B456_004G138200 [Gossypium raimondii]
Length=359

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 92/125 (74%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+N++ +KT VFFQG+S  H + ++W EP  ++C  Q +PI+G  +PG ++P E V
Sbjct  235  AKWVDANVNTSKTTVFFQGVSPDHINSSDWGEPKAKNCEGQKEPIKGGDYPGGQHPAEKV  294

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            V+ VL  M+  VYLL++  L+QLRKDGHPS Y  G    +DCSHWC+AGVPD+WNQ+LY+
Sbjct  295  VEKVLKTMSTPVYLLNVTTLSQLRKDGHPSVYGHGGHRDMDCSHWCLAGVPDTWNQLLYA  354

Query  342  ILIQN  328
             LIQ+
Sbjct  355  ALIQS  359



>gb|KFK44758.1| hypothetical protein AALP_AA1G299000 [Arabis alpina]
Length=380

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+D  KT+VFFQGIS  HY G EWNEP  + C  Q +P+ GSS+P  + P   +
Sbjct  260  ARWVDQNVDTTKTRVFFQGISPTHYEGREWNEPR-KTCNGQLQPLSGSSYPSGQPPAATI  318

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   VYLLDI  L+QLRKD HPSTY G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  319  VSKVLKSMKKPVYLLDITTLSQLRKDAHPSTYGGDGGTDCSHWCLPGLPDTWNQLLYAAL  378



>ref|XP_008345148.1| PREDICTED: protein trichome birefringence-like 38 [Malus domestica]
Length=364

 Score =   149 bits (377),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 87/123 (71%), Gaps = 4/123 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            + WVDSN+D NKTKVFF GIS  HY GNEW++P    C  QT+P+ GS +PG   P   V
Sbjct  240  SKWVDSNVDANKTKVFFXGISPTHYDGNEWDDPK-STCNGQTQPVSGSIYPGGPPPATTV  298

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV---DCSHWCVAGVPDSWNQILYS  343
            VK VL  M+  + LLDI LL+QLRKDGHPS Y        DCSHWC+AGVPDSWN++LY+
Sbjct  299  VKDVLTTMSTPITLLDITLLSQLRKDGHPSVYGLDGKHGNDCSHWCLAGVPDSWNELLYA  358

Query  342  ILI  334
            IL+
Sbjct  359  ILV  361



>ref|XP_007211900.1| hypothetical protein PRUPE_ppa010388mg [Prunus persica]
 gb|EMJ13099.1| hypothetical protein PRUPE_ppa010388mg [Prunus persica]
Length=251

 Score =   146 bits (369),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 88/123 (72%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSNIDP KTKVFFQGIS  HY+G++W+EP  + C  Q +P+ GS++PG   P  +V
Sbjct  129  AGWVDSNIDPAKTKVFFQGISPSHYNGSQWDEPKARSCVGQKEPLLGSTYPGGLPPALSV  188

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            +K  L  +T  V LLD+  L+ LRKDGHPS Y  G    +DCSHWC+ GVPD+WN+ILY+
Sbjct  189  LKNALSKITKPVTLLDVTNLSLLRKDGHPSIYGLGGTTAMDCSHWCLCGVPDTWNEILYN  248

Query  342  ILI  334
             ++
Sbjct  249  FIL  251



>ref|XP_010064516.1| PREDICTED: protein trichome birefringence-like 41 [Eucalyptus 
grandis]
Length=365

 Score =   149 bits (376),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 88/129 (68%), Gaps = 8/129 (6%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            + WV SNIDP  TKVFFQGIS  HY G EW EP    C  QT+PI+GS +P    P   V
Sbjct  236  SKWVQSNIDPTTTKVFFQGISPTHYKGEEWKEPK-STCSGQTEPIKGSVYPSGLPPAVTV  294

Query  513  VKGVLGNMTNS---VYLLDIALLTQLRKDGHPSTYAG----GVVDCSHWCVAGVPDSWNQ  355
            VK VL NM+ +   V LLDI  L+QLRKDGHPS Y G    G +DCSHWC+AGVPD+WN+
Sbjct  295  VKEVLANMSTTAVAVTLLDITTLSQLRKDGHPSKYDGIHGKGKIDCSHWCLAGVPDTWNE  354

Query  354  ILYSILIQN  328
            IL +ILI N
Sbjct  355  ILNAILIAN  363



>ref|XP_008381177.1| PREDICTED: protein trichome birefringence-like 43 isoform X2 
[Malus domestica]
Length=282

 Score =   147 bits (371),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 91/125 (73%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+N++  KT+VFFQG+S  H +G+EW E A + C  QT+P+    +P   +P E V
Sbjct  146  ARWVDTNLESTKTRVFFQGVSPDHNNGSEWGEAASKHCEGQTQPMARDEYPAGSHPAEVV  205

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            V+ VL +M+N V+LL++  L+QLRKDGHPS Y  G    +DCSHWC+AGVPD+WNQ+LY+
Sbjct  206  VERVLRSMSNXVHLLNVTTLSQLRKDGHPSVYGHGGHRDMDCSHWCLAGVPDTWNQLLYA  265

Query  342  ILIQN  328
             LIQ+
Sbjct  266  SLIQS  270



>ref|XP_008228877.1| PREDICTED: protein trichome birefringence-like 43 [Prunus mume]
Length=256

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 87/125 (70%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A W+DSN+DP KT+VFFQG+S  H +G +W E   + C  Q +P+ G  +P   +P E V
Sbjct  129  ARWIDSNLDPKKTRVFFQGVSPDHNNGGDWGERTAKHCEGQMRPVVGHQYPAGSHPAELV  188

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            V+ VL +M+   YLL++  L+QLRKDGHPS Y  G    +DCSHWC+AGVPD+WNQ+LY+
Sbjct  189  VERVLHSMSKPAYLLNVTTLSQLRKDGHPSVYGHGGHRDMDCSHWCLAGVPDTWNQLLYA  248

Query  342  ILIQN  328
             LIQ 
Sbjct  249  ALIQR  253



>ref|XP_010093465.1| hypothetical protein L484_017526 [Morus notabilis]
 gb|EXB54089.1| hypothetical protein L484_017526 [Morus notabilis]
Length=252

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 87/123 (71%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+NIDP KT VFFQGIS  HY+G  WNEP+ + C+ +  P+ GS++PG   P   V
Sbjct  130  AAWVDTNIDPAKTMVFFQGISPSHYNGTLWNEPSAKSCKEEKLPLAGSTYPGGLPPALFV  189

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            +K VL  +T  V LLDI  L+ LRKDGHPS Y  G    +DCSHWC+ GVPD+WN+ILY+
Sbjct  190  LKDVLNKITKPVKLLDITNLSLLRKDGHPSIYGFGGLTAMDCSHWCLPGVPDTWNEILYN  249

Query  342  ILI  334
            +++
Sbjct  250  LIL  252



>ref|XP_010522061.1| PREDICTED: protein trichome birefringence-like 43 isoform X1 
[Tarenaya hassleriana]
Length=348

 Score =   149 bits (375),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 89/123 (72%), Gaps = 4/123 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEG-SSFPGERYPGEA  517
            A WVD N+DP++T+VFFQG+S  H + N+W+EP  + CR +T P+ G SS+P   +P E 
Sbjct  224  AKWVDENVDPSRTQVFFQGVSPDHANSNDWSEPGYKGCRGETTPLMGSSSYPAGSHPAEM  283

Query  516  VVKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILY  346
            V + V+G M N V LLD+  L+QLRKDGHPS +  G   V DCSHWC+AGVPD+WNQ+LY
Sbjct  284  VAEKVIGEMKNKVKLLDVTFLSQLRKDGHPSVFGLGGHRVADCSHWCLAGVPDTWNQLLY  343

Query  345  SIL  337
            + L
Sbjct  344  AEL  346



>ref|XP_011656226.1| PREDICTED: uncharacterized protein LOC101214809 [Cucumis sativus]
Length=711

 Score =   152 bits (385),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 91/123 (74%), Gaps = 1/123 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVDS +D NKTKVFFQGIS  HY+GNEWNEP V++C  +T PI GS++PG        
Sbjct  582  ANWVDSQVDTNKTKVFFQGISPSHYNGNEWNEPGVRNCFKETSPINGSTYPGGLPAASLT  641

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYSIL  337
            ++ VL  ++  + +L+I  L+QLRKD HPS+Y G   +DC+HWC+AG+PD+WNQ+LY+ L
Sbjct  642  LEKVLSEVSKPIQVLNITTLSQLRKDAHPSSYNGFRGMDCTHWCIAGLPDTWNQLLYATL  701

Query  336  IQN  328
            I +
Sbjct  702  ISS  704



>ref|XP_007216008.1| hypothetical protein PRUPE_ppa014688mg [Prunus persica]
 gb|EMJ17207.1| hypothetical protein PRUPE_ppa014688mg [Prunus persica]
Length=354

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 88/125 (70%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A W+D+N+DP KT+VFFQG+S  H +G +W EP  + C  Q +P+ G  +P   +P E V
Sbjct  227  ARWIDTNLDPKKTRVFFQGVSPDHNNGGDWGEPTAKHCEGQMRPVVGHQYPAGSHPAELV  286

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            V+ VL +M+   YLL++  L+QLRKDGHPS Y  G    +DCSHWC+AGVPD+WNQ+LY+
Sbjct  287  VERVLHSMSKPAYLLNVTTLSQLRKDGHPSVYGHGGHRDMDCSHWCLAGVPDTWNQLLYA  346

Query  342  ILIQN  328
             LIQ 
Sbjct  347  ALIQR  351



>ref|XP_010540499.1| PREDICTED: protein trichome birefringence-like 38 [Tarenaya hassleriana]
Length=380

 Score =   149 bits (376),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 70/120 (58%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+D +KT+VFFQGIS  HY G EWNEP  + C  Q  P+ GS++PG   P  AV
Sbjct  260  AKWVDLNVDASKTRVFFQGISPTHYEGREWNEPK-KSCSGQMVPLSGSTYPGGAPPATAV  318

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL  M   VYLLDI  L+QLRKD HPSTY G G  DCSHWC+ G+PD+WN++LY+ L
Sbjct  319  VDKVLRTMKTPVYLLDITTLSQLRKDAHPSTYGGDGGTDCSHWCLPGLPDTWNRLLYAAL  378



>ref|NP_177992.1| trichome birefringence-like 42 [Arabidopsis thaliana]
 sp|Q9ZV89.1|TBL42_ARATH RecName: Full=Protein trichome birefringence-like 42 [Arabidopsis 
thaliana]
 gb|AAC83039.1| F9K20.25 [Arabidopsis thaliana]
 gb|AEE36141.1| trichome birefringence-like 42 [Arabidopsis thaliana]
Length=359

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 91/123 (74%), Gaps = 4/123 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            + W+D NIDP+KT+VF+QG+S VH +G EW +P  + C  +T P++G S+PG    GEA+
Sbjct  236  SKWIDHNIDPSKTRVFYQGVSPVHLNGGEWGKPG-KTCLGETVPVQGPSYPGRPNEGEAI  294

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            VK V+G M   V LLD+  +T++RKDGHPS YAGG   + DCSHWC+ GVPD+WNQ+LY+
Sbjct  295  VKSVIGRMAKPVELLDVTAMTEMRKDGHPSIYAGGGDRLNDCSHWCLPGVPDAWNQLLYT  354

Query  342  ILI  334
             L+
Sbjct  355  ALL  357



>gb|AFK49604.1| unknown [Lotus japonicus]
Length=367

 Score =   149 bits (375),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 87/125 (70%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WV++NIDP KT+V FQG+S  H +  +W EP    C  Q++P+ G ++PG  +P E V
Sbjct  243  AKWVNANIDPTKTRVLFQGVSPDHANAGQWGEPGANSCVGQSRPLLGFNYPGGPHPAELV  302

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV---VDCSHWCVAGVPDSWNQILYS  343
            ++ VLG M   VYLL+I  L+QLRKD HPS Y  G     DCSHWC+AGVPD+WNQ+LY+
Sbjct  303  LEKVLGTMKKPVYLLNITTLSQLRKDAHPSVYGAGGHRNADCSHWCLAGVPDTWNQLLYA  362

Query  342  ILIQN  328
             LIQN
Sbjct  363  TLIQN  367



>ref|XP_010273481.1| PREDICTED: protein trichome birefringence-like 41 [Nelumbo nucifera]
Length=366

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 86/124 (69%), Gaps = 3/124 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDS +DP KT VFFQGIS  H  G  WNEP   +C  QT+P+ GS++PG R+P   V
Sbjct  242  AEWVDSEVDPTKTDVFFQGISPDHMDGRGWNEPETTNCNGQTQPVLGSNYPGGRHPAAIV  301

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            V+ VL  M+  VYLL++  L+QLRKDGHPS Y  G    +DCSHWC+ GVPD+WN + Y+
Sbjct  302  VERVLSKMSKPVYLLNVTTLSQLRKDGHPSVYGHGGHRDMDCSHWCLPGVPDTWNLLFYA  361

Query  342  ILIQ  331
             LIQ
Sbjct  362  DLIQ  365



>gb|KJB69610.1| hypothetical protein B456_011G033800 [Gossypium raimondii]
Length=365

 Score =   149 bits (375),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 87/121 (72%), Gaps = 3/121 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVD+N+DP KTKVFFQGIS  HY G EWN+P  + C  + +P+ GS++     P  A+
Sbjct  244  ANWVDTNVDPTKTKVFFQGISPTHYEGREWNQPK-RSCYGEQEPLSGSTYQAGAPPSAAI  302

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            V  VLG+M   VYLLDI  L+QLRKD HPSTY+G     DCSHWC+ G+PD+WNQ+LY+ 
Sbjct  303  VNKVLGSMNKPVYLLDITTLSQLRKDAHPSTYSGDHSGNDCSHWCLPGLPDTWNQLLYAA  362

Query  339  L  337
            L
Sbjct  363  L  363



>gb|KJB74418.1| hypothetical protein B456_011G293800 [Gossypium raimondii]
Length=354

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 90/122 (74%), Gaps = 1/122 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDS++D N+TKV FQGIS  HY+G +WNEP V++C  QT P +GS +P      E V
Sbjct  233  AKWVDSDVDTNRTKVIFQGISPSHYNGIDWNEPGVRNCSRQTTPFKGSIYPTGLPLAEYV  292

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            VK V+ N+   V+LLDI +L+QLRKD HPSTY     +DC+HWCVAG+PD+WN +LY++L
Sbjct  293  VKEVIRNIKKPVHLLDITMLSQLRKDAHPSTYNDFNGMDCTHWCVAGLPDTWNLLLYAVL  352

Query  336  IQ  331
            I+
Sbjct  353  IK  354



>ref|XP_012091746.1| PREDICTED: protein trichome birefringence-like 38 [Jatropha curcas]
 gb|KDP21076.1| hypothetical protein JCGZ_21547 [Jatropha curcas]
Length=367

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 87/122 (71%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+DP+KTKVFFQGIS  HY G +WN+P  ++C  + +P+ GS++PG   P  AV
Sbjct  246  AKWVDLNVDPSKTKVFFQGISPTHYEGRDWNQPR-KNCYGEAQPLSGSTYPGGAPPAVAV  304

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA--GGVVDCSHWCVAGVPDSWNQILYSI  340
            V  V+  M   +YLLDI  L+QLRKD HPSTY+  G   DCSHWC+ G+PD WNQ+LY+ 
Sbjct  305  VNQVISTMKKPIYLLDITTLSQLRKDAHPSTYSGEGSGTDCSHWCLPGLPDIWNQLLYAA  364

Query  339  LI  334
            LI
Sbjct  365  LI  366



>ref|XP_006597476.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN18917.1| hypothetical protein glysoja_036096 [Glycine soja]
Length=364

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 87/123 (71%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVD N+DP+KTKVFFQGIS  HY G +WN+P  + C  + +P+ GS++P    P   +
Sbjct  243  ANWVDQNVDPSKTKVFFQGISPTHYQGKDWNQPK-RSCSGELQPLSGSTYPAGLPPATTI  301

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            +  VL  M+  VYLLDI LL+QLRKD HPS Y+G     DCSHWC+ G+PD+WNQ+LY+ 
Sbjct  302  LNNVLRKMSTPVYLLDITLLSQLRKDAHPSAYSGDHAGNDCSHWCLPGLPDTWNQLLYAA  361

Query  339  LIQ  331
            L +
Sbjct  362  LTK  364



>ref|XP_010509796.1| PREDICTED: protein trichome birefringence-like 37 [Camelina sativa]
Length=385

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 85/120 (71%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              WVD N+D ++T+VFFQGIS  HY G EWNEP  + C  Q +P+ GS++PG   P  ++
Sbjct  265  GQWVDQNVDISQTRVFFQGISPTHYMGREWNEPR-KTCNGQMQPLTGSTYPGGSLPAASI  323

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   VYLLDI  L+QLRKD HPSTY G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  324  VSRVLSSMRTPVYLLDITTLSQLRKDAHPSTYGGDGGTDCSHWCLPGLPDTWNQLLYAAL  383



>ref|XP_004485883.1| PREDICTED: uncharacterized protein LOC101498973 [Cicer arietinum]
Length=366

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 84/121 (69%), Gaps = 3/121 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVD N+DP+KTK FFQGIS  HY G EWNEP    C  Q +P+ GS++P    P   +
Sbjct  245  ANWVDLNVDPSKTKTFFQGISPTHYQGKEWNEPKTS-CSGQLEPLSGSTYPTGLPPASNI  303

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            +  VL  M   VYLLDI LL+QLRKD HPS+Y+G     DCSHWC+ G+PD+WNQ+LY+ 
Sbjct  304  LNNVLKKMKTPVYLLDITLLSQLRKDAHPSSYSGDHAGNDCSHWCLPGLPDTWNQLLYAA  363

Query  339  L  337
            L
Sbjct  364  L  364



>ref|XP_010469399.1| PREDICTED: protein trichome birefringence-like 37 [Camelina sativa]
Length=385

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 85/120 (71%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              WVD N+D ++T+VFFQGIS  HY G EWNEP  + C  Q +P+ GS++PG   P  ++
Sbjct  265  GQWVDQNVDISQTRVFFQGISPTHYMGREWNEPR-KTCNGQMQPLTGSTYPGGSLPAASI  323

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   VYLLDI  L+QLRKD HPSTY G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  324  VSRVLSSMRTPVYLLDITTLSQLRKDAHPSTYGGDGGTDCSHWCLPGLPDTWNQLLYAAL  383



>ref|XP_010413780.1| PREDICTED: protein trichome birefringence-like 37 [Camelina sativa]
Length=385

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 85/120 (71%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              WVD N+D ++T+VFFQGIS  HY G EWNEP  + C  Q +P+ GS++PG   P  ++
Sbjct  265  GQWVDQNVDISQTRVFFQGISPTHYMGREWNEPR-KTCNGQMQPLTGSTYPGGSLPAASI  323

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   VYLLDI  L+QLRKD HPSTY G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  324  VSRVLSSMRTPVYLLDITTLSQLRKDAHPSTYGGDGGTDCSHWCLPGLPDTWNQLLYAAL  383



>ref|NP_001043736.1| Os01g0652100 [Oryza sativa Japonica Group]
 dbj|BAB86568.1| lustrin A-like [Oryza sativa Japonica Group]
 dbj|BAF05650.1| Os01g0652100 [Oryza sativa Japonica Group]
 gb|EAY75199.1| hypothetical protein OsI_03091 [Oryza sativa Indica Group]
 dbj|BAG91361.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93258.1| unnamed protein product [Oryza sativa Japonica Group]
Length=392

 Score =   149 bits (375),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 91/122 (75%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSN+D +KT+V+FQGIS  HY+G +W E + + C  QT+P+ GS++P    P ++ 
Sbjct  271  ARWVDSNVDTSKTRVYFQGISPTHYNGADWGEGS-RSCAQQTQPVAGSAYPAGPVPAQSA  329

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            V+  +  M+  V+LLDI LL+QLR+DGHPS Y+GG    DCSHWC+AGVPD+WNQILY+ 
Sbjct  330  VRSAIAGMSKPVFLLDITLLSQLRRDGHPSGYSGGHPGNDCSHWCLAGVPDAWNQILYAS  389

Query  339  LI  334
            L+
Sbjct  390  LL  391



>ref|XP_008225213.1| PREDICTED: protein trichome birefringence-like 37 [Prunus mume]
Length=361

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 87/123 (71%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSN+DP+KT+VFFQGIS  HY G EWN P  ++C  +  P+ G+++P    P  AV
Sbjct  240  AKWVDSNVDPSKTRVFFQGISPTHYQGQEWNSPK-KNCYGELGPLSGTTYPAGPPPAYAV  298

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            V  VL  + N VYLLDI  L+QLRKD HPSTY+G     DCSHWC+ G+PD+WNQ+LY+ 
Sbjct  299  VNKVLSTIKNPVYLLDITTLSQLRKDAHPSTYSGDHSGNDCSHWCLPGLPDTWNQLLYAA  358

Query  339  LIQ  331
            LI 
Sbjct  359  LIM  361



>gb|AGV54877.1| hypothetical protein [Phaseolus vulgaris]
Length=318

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 83/122 (68%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              WVD NIDP KTKVFFQGIS  HY G EWNEP  + C  + +P+ GS++P    P   +
Sbjct  197  GEWVDENIDPTKTKVFFQGISPTHYQGQEWNEPR-KSCSGELEPLRGSTYPAGLPPAANI  255

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            V  VL  M N VYLLDI LL+QLRKD HPS Y+G     DCSHWC+ G+PD+WNQ+L + 
Sbjct  256  VNTVLKKMKNKVYLLDITLLSQLRKDAHPSAYSGDHAGNDCSHWCLPGLPDTWNQLLNAA  315

Query  339  LI  334
            LI
Sbjct  316  LI  317



>ref|XP_010499424.1| PREDICTED: protein trichome birefringence-like 38 [Camelina sativa]
Length=383

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+D  KT+VFFQGIS  HY G EWNEP  + C  Q +P+ GSS+P  + P   V
Sbjct  263  ARWVDQNVDTTKTRVFFQGISPTHYEGREWNEPR-KSCSGQMQPLGGSSYPSGQPPAAGV  321

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   V+LLDI  L+QLRKD HPS+Y G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  322  VSKVLSSMKKPVFLLDITTLSQLRKDAHPSSYGGDGGTDCSHWCLPGLPDTWNQLLYAAL  381



>ref|XP_010460674.1| PREDICTED: protein trichome birefringence-like 38 [Camelina sativa]
Length=384

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+D  KT+VFFQGIS  HY G EWNEP  + C  Q +P+ GSS+P  + P   V
Sbjct  264  ARWVDQNVDTTKTRVFFQGISPTHYEGREWNEPR-KSCSGQMQPLGGSSYPSGQPPAAGV  322

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   V+LLDI  L+QLRKD HPS+Y G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  323  VSKVLSSMKKPVFLLDITTLSQLRKDAHPSSYGGDGGTDCSHWCLPGLPDTWNQLLYAAL  382



>emb|CDX79555.1| BnaC03g18910D [Brassica napus]
Length=380

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N++ ++T+VFFQGIS  HY G EWNEP  + C  Q +P+ GS++PG   P  ++
Sbjct  260  AQWVDQNVNISQTRVFFQGISPTHYMGREWNEPR-KTCNGQMQPLTGSTYPGGSLPAASI  318

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   VYLLDI  L+QLRKD HPSTY G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  319  VSRVLSSMKTPVYLLDITTLSQLRKDAHPSTYGGDGGTDCSHWCLPGLPDTWNQLLYAAL  378



>ref|XP_010480710.1| PREDICTED: protein trichome birefringence-like 38, partial [Camelina 
sativa]
Length=406

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+D  KT+VFFQGIS  HY G EWNEP  + C  Q +P+ GSS+P  + P   V
Sbjct  286  ARWVDQNVDTTKTRVFFQGISPTHYEGREWNEPR-KSCSGQMQPLGGSSYPSGQPPAAGV  344

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   V+LLDI  L+QLRKD HPS+Y G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  345  VSKVLSSMKKPVFLLDITTLSQLRKDAHPSSYGGDGGTDCSHWCLPGLPDTWNQLLYAAL  404



>ref|XP_002305083.1| hypothetical protein POPTR_0004s05420g [Populus trichocarpa]
 gb|EEE85594.1| hypothetical protein POPTR_0004s05420g [Populus trichocarpa]
Length=411

 Score =   149 bits (375),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 86/122 (70%), Gaps = 2/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+DP+KTKVFFQGIS  HY G +WN+P  + C  +  P+ GS++P    P   V
Sbjct  291  ARWVDQNVDPSKTKVFFQGISPTHYQGKDWNQPQ-KSCSGEAVPLSGSTYPAGAPPAVGV  349

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYSIL  337
            V  VL ++T  VYLLDI  L+QLRKD HPSTY+ G   DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  350  VSKVLSSITKPVYLLDITTLSQLRKDAHPSTYSDGSGTDCSHWCLPGLPDTWNQLLYAAL  409

Query  336  IQ  331
            I 
Sbjct  410  IM  411



>ref|XP_009132974.1| PREDICTED: protein trichome birefringence-like 37 [Brassica rapa]
Length=381

 Score =   148 bits (373),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N++ ++T+VFFQGIS  HY G EWNEP  + C  Q +P+ GS++PG   P  ++
Sbjct  261  AQWVDQNVNISQTRVFFQGISPTHYMGREWNEPR-KTCNGQMQPLTGSTYPGGSLPAASI  319

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   VYLLDI  L+QLRKD HPSTY G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  320  VSRVLSSMKTPVYLLDITTLSQLRKDAHPSTYGGDGGTDCSHWCLPGLPDTWNQLLYAAL  379



>emb|CDX84658.1| BnaA03g15720D [Brassica napus]
Length=380

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N++ ++T+VFFQGIS  HY G EWNEP  + C  Q +P+ GS++PG   P  ++
Sbjct  260  AQWVDQNVNISQTRVFFQGISPTHYMGREWNEPR-KTCNGQMQPLTGSTYPGGSLPAASI  318

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   VYLLDI  L+QLRKD HPSTY G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  319  VSRVLSSMKTPVYLLDITTLSQLRKDAHPSTYGGDGGTDCSHWCLPGLPDTWNQLLYAAL  378



>ref|XP_006646157.1| PREDICTED: protein YLS7-like [Oryza brachyantha]
Length=423

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 91/122 (75%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSN+D +KT+V+FQGIS  HY+G +W E + + C  QT+P+ GS++P    P ++ 
Sbjct  302  ARWVDSNVDTSKTRVYFQGISPTHYNGADWGEGS-RSCAQQTQPVAGSTYPAGPLPAQSA  360

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            V+  L  M+  V+LLDI LL+QLR+DGHP+ Y+GG    DCSHWC+AGVPD+WNQILY+ 
Sbjct  361  VRSALAGMSKPVFLLDITLLSQLRRDGHPAGYSGGHPGNDCSHWCLAGVPDAWNQILYAS  420

Query  339  LI  334
            L+
Sbjct  421  LL  422



>gb|KHN20810.1| hypothetical protein glysoja_049140 [Glycine soja]
Length=253

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 87/125 (70%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD NIDP +T+VFFQG+S  H +  +W EP    C  QT+PI G  +PG   P E V
Sbjct  129  AKWVDYNIDPTRTRVFFQGVSPGHQNPAQWGEPRANLCEGQTRPILGFRYPGGPLPAELV  188

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA-GGVV--DCSHWCVAGVPDSWNQILYS  343
            ++ VL  M   VYLLDI  L+QLR DGHPS Y  GG +  DCSHWC+AGVPD+WN++LY+
Sbjct  189  LEKVLRAMQKPVYLLDITTLSQLRIDGHPSVYGFGGHLDPDCSHWCLAGVPDTWNELLYA  248

Query  342  ILIQN  328
            IL++N
Sbjct  249  ILVKN  253



>ref|XP_009102887.1| PREDICTED: protein trichome birefringence-like 38 [Brassica rapa]
 emb|CDY57453.1| BnaA07g36480D [Brassica napus]
Length=378

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              WVD N+D  KTKVFFQGIS  HY G EWNEP  + C  Q +P++GS++P  + P   V
Sbjct  258  GRWVDQNVDTTKTKVFFQGISPTHYEGREWNEPR-KSCNGQMQPLDGSNYPSGQPPSAGV  316

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   V+LLDI  L+QLRKD HPSTY G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  317  VSKVLSSMKKRVFLLDITTLSQLRKDAHPSTYGGDGGNDCSHWCLPGLPDTWNQLLYAAL  376



>gb|AFK41428.1| unknown [Medicago truncatula]
Length=353

 Score =   147 bits (370),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 85/122 (70%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+NIDP K KVFFQGIS  HY+G  WNEP+ + C  +  P+ GS++PG   P   V
Sbjct  232  ARWVDANIDPAKVKVFFQGISPSHYNGTLWNEPSAKSCIREKTPLTGSTYPGGLQPAVGV  291

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTY---AGGVVDCSHWCVAGVPDSWNQILYS  343
            +KGVL  +   V LLDI  L+ LRKDGHPS Y       +DCSHWC++GVPD+WNQILY+
Sbjct  292  LKGVLSTIKKPVTLLDITTLSLLRKDGHPSIYGLFGSKGMDCSHWCLSGVPDTWNQILYN  351

Query  342  IL  337
            ++
Sbjct  352  LI  353



>gb|KJB12973.1| hypothetical protein B456_002G048100 [Gossypium raimondii]
Length=356

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 84/109 (77%), Gaps = 3/109 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVD+NIDP+KT+V FQG++AVH++  EW EP+ + C  QT+P++GS++PG   PGEA+
Sbjct  247  ANWVDTNIDPSKTRVLFQGVAAVHFNAKEWGEPSDKGCIKQTEPLKGSTYPGPPVPGEAI  306

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAG  376
            +K VL  MT   YLLDI LLTQLRKDGHPS YA     ++DCSHWC+A 
Sbjct  307  LKTVLSKMTKPAYLLDITLLTQLRKDGHPSIYARAGPKLIDCSHWCLAA  355



>emb|CDX94643.1| BnaC07g10150D [Brassica napus]
Length=378

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              WVD N+D  KTKVFFQGIS  HY G EWNEP  + C  Q +P++GS++P  + P   V
Sbjct  258  GRWVDQNVDTTKTKVFFQGISPTHYEGREWNEPR-KSCNGQMQPLDGSNYPSGQPPSAGV  316

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   V+LLDI  L+QLRKD HPSTY G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  317  VSKVLSSMKKRVFLLDITTLSQLRKDAHPSTYGGDGGNDCSHWCLPGLPDTWNQLLYAAL  376



>emb|CBI17734.3| unnamed protein product [Vitis vinifera]
Length=385

 Score =   147 bits (372),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 68/130 (52%), Positives = 93/130 (72%), Gaps = 4/130 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSN+D NKT+VFF+G++  HY G EW+EP V +C  +T+PI GS++P        V
Sbjct  237  AKWVDSNVDFNKTQVFFRGVTPAHYDGKEWDEPRVTNCSKETQPISGSTYPSGLPQSSYV  296

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG--GVVDCSHWCVAGVPDSWNQILYSI  340
            ++GVL  +T  V  L+I  L+QLRKDGHPS Y G    +DC+HWC+AGVPD+WNQ+LY+ 
Sbjct  297  LEGVLSGVTKPVQFLNITTLSQLRKDGHPSMYNGVNRSMDCTHWCIAGVPDTWNQLLYAA  356

Query  339  LIQN*FLLAS  310
            LI+  FL+ +
Sbjct  357  LIK--FLIQA  364



>gb|KJB34893.1| hypothetical protein B456_006G088800 [Gossypium raimondii]
Length=380

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 85/122 (70%), Gaps = 2/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVD+N+DPN TKVFFQGIS  HY G EWN+P  ++C  + +P+ G ++P    P  AV
Sbjct  260  ANWVDNNVDPNITKVFFQGISPTHYEGREWNQPN-KNCNGELEPLSGPTYPAGAPPAVAV  318

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VLG M   VYLLDI  L+QLRKD HPSTY G    DCSHWC+ G+PD+WN +LY+ L
Sbjct  319  VNKVLGTMKKPVYLLDITTLSQLRKDAHPSTYGGLSGNDCSHWCLPGLPDTWNHLLYAAL  378

Query  336  IQ  331
              
Sbjct  379  FM  380



>ref|XP_011460601.1| PREDICTED: protein trichome birefringence-like 38 [Fragaria vesca 
subsp. vesca]
Length=370

 Score =   147 bits (370),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 87/122 (71%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              WVD+N+DP+KTKVFFQGIS  HY G EWN P  ++C+ + +P+ GS++P    P   V
Sbjct  249  GKWVDTNVDPSKTKVFFQGISPTHYQGREWNSPK-KNCQGELEPLTGSTYPAGAPPEAGV  307

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            V  VL  + N VYLLDI  L+QLRKD HPSTY+G     DCSHWC+ G+PD+WNQ+LY+ 
Sbjct  308  VSKVLNTVKNPVYLLDITTLSQLRKDAHPSTYSGDHSGNDCSHWCLPGLPDTWNQLLYAA  367

Query  339  LI  334
            LI
Sbjct  368  LI  369



>ref|XP_008381176.1| PREDICTED: protein trichome birefringence-like 43 isoform X1 
[Malus domestica]
Length=365

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 91/125 (73%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+N++  KT+VFFQG+S  H +G+EW E A + C  QT+P+    +P   +P E V
Sbjct  229  ARWVDTNLESTKTRVFFQGVSPDHNNGSEWGEAASKHCEGQTQPMARDEYPAGSHPAEVV  288

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            V+ VL +M+N V+LL++  L+QLRKDGHPS Y  G    +DCSHWC+AGVPD+WNQ+LY+
Sbjct  289  VERVLRSMSNXVHLLNVTTLSQLRKDGHPSVYGHGGHRDMDCSHWCLAGVPDTWNQLLYA  348

Query  342  ILIQN  328
             LIQ+
Sbjct  349  SLIQS  353



>ref|XP_002283620.1| PREDICTED: protein trichome birefringence-like 38 [Vitis vinifera]
Length=328

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 88/121 (73%), Gaps = 2/121 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            + WVD NI+P  T VFFQGIS  H  G EW E  +  C+ QT+PI+GS++PG   P   V
Sbjct  207  SKWVDFNINPAMTNVFFQGISPTHNLGEEWKE-KLATCKGQTEPIKGSTYPGALPPAVGV  265

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG-VVDCSHWCVAGVPDSWNQILYSIL  337
            VK VL  M+  V LLDI +L+QLRKDGHPS Y GG + DCSHWC+AGVPD+WN++LY+I+
Sbjct  266  VKEVLSKMSKVVSLLDITILSQLRKDGHPSIYNGGQISDCSHWCLAGVPDTWNELLYAIV  325

Query  336  I  334
            I
Sbjct  326  I  326



>gb|KHG13558.1| Ethylene-responsive transcription factor [Gossypium arboreum]
Length=143

 Score =   140 bits (354),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 83/120 (69%), Gaps = 1/120 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            + WVDSN+D   T+VFFQGIS  HY G +WN      C+ +T P+ G+++PG   P   V
Sbjct  15   SKWVDSNVDRRTTQVFFQGISPTHYDGRQWNGSISATCKGETTPLNGTTYPGGLPPAVDV  74

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYSIL  337
            VK VL NM+  V LLDI  L+ LRKDGHPS Y+     DCSHWC+AGVPDSWN+ILY++L
Sbjct  75   VKQVLKNMSKGVTLLDITTLSLLRKDGHPSVYSRKEGNDCSHWCLAGVPDSWNEILYALL  134



>gb|KHN11944.1| hypothetical protein glysoja_019917 [Glycine soja]
Length=235

 Score =   143 bits (361),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 87/125 (70%), Gaps = 4/125 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WV+ N+DPNKT+VFFQG+S  H +G +W EP    C  Q  P++G  +PG  +P E V
Sbjct  112  AKWVEDNVDPNKTRVFFQGVSPDHLNGAKWGEPRAS-CEEQKVPVDGFKYPGGSHPAELV  170

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            ++ VLG M+  V LL+I  L+Q+RKDGHPS Y  G    +DCSHWC+ GVPD+WN +LY+
Sbjct  171  LQKVLGAMSKRVNLLNITTLSQMRKDGHPSVYGYGGHRDMDCSHWCLPGVPDTWNLLLYA  230

Query  342  ILIQN  328
             LIQN
Sbjct  231  ALIQN  235



>ref|XP_009352799.1| PREDICTED: protein trichome birefringence-like 37 [Pyrus x bretschneideri]
Length=361

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 88/123 (72%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSN+D + TKVFFQGIS  HY G EWN P  ++C  + +P+ GS++P    P  AV
Sbjct  240  AKWVDSNVDTSITKVFFQGISPTHYQGQEWNSPK-KNCLGELEPLSGSTYPAGAPPSAAV  298

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            V  VL  +T+ VYLLDI +L+QLRKD HPSTY+G     DCSHWC+ G+PD+WNQ+LY+ 
Sbjct  299  VYKVLSTITSPVYLLDITMLSQLRKDAHPSTYSGDHSGNDCSHWCLPGLPDTWNQLLYAA  358

Query  339  LIQ  331
            LI 
Sbjct  359  LIM  361



>gb|KJB12975.1| hypothetical protein B456_002G048100 [Gossypium raimondii]
Length=400

 Score =   147 bits (371),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 84/108 (78%), Gaps = 3/108 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVD+NIDP+KT+V FQG++AVH++  EW EP+ + C  QT+P++GS++PG   PGEA+
Sbjct  247  ANWVDTNIDPSKTRVLFQGVAAVHFNAKEWGEPSDKGCIKQTEPLKGSTYPGPPVPGEAI  306

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVA  379
            +K VL  MT   YLLDI LLTQLRKDGHPS YA     ++DCSHWC+A
Sbjct  307  LKTVLSKMTKPAYLLDITLLTQLRKDGHPSIYARAGPKLIDCSHWCLA  354



>ref|XP_003634905.1| PREDICTED: protein trichome birefringence-like 38 [Vitis vinifera]
Length=361

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 88/122 (72%), Gaps = 2/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSN+D NKT+VFF+G++  HY G EW+EP V +C  +T+PI GS++P        V
Sbjct  237  AKWVDSNVDFNKTQVFFRGVTPAHYDGKEWDEPRVTNCSKETQPISGSTYPSGLPQSSYV  296

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG--GVVDCSHWCVAGVPDSWNQILYSI  340
            ++GVL  +T  V  L+I  L+QLRKDGHPS Y G    +DC+HWC+AGVPD+WNQ+LY+ 
Sbjct  297  LEGVLSGVTKPVQFLNITTLSQLRKDGHPSMYNGVNRSMDCTHWCIAGVPDTWNQLLYAA  356

Query  339  LI  334
            LI
Sbjct  357  LI  358



>ref|XP_007153710.1| hypothetical protein PHAVU_003G058400g [Phaseolus vulgaris]
 gb|ESW25704.1| hypothetical protein PHAVU_003G058400g [Phaseolus vulgaris]
Length=364

 Score =   146 bits (369),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 83/120 (69%), Gaps = 3/120 (3%)
 Frame = -2

Query  687  WVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAVVK  508
            WVD NIDP KTKVFFQGIS  HY G EWNEP  + C  + +P+ GS++P    P   +V 
Sbjct  245  WVDENIDPTKTKVFFQGISPTHYQGQEWNEPR-KSCSGELEPLGGSTYPAGLPPAANIVN  303

Query  507  GVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSILI  334
             VL  M N VYLLDI LL+QLRKD HPS Y+G     DCSHWC+ G+PD+WNQ+L + LI
Sbjct  304  TVLKKMKNKVYLLDITLLSQLRKDAHPSAYSGDHAGNDCSHWCLPGLPDTWNQLLNAALI  363



>gb|KEH38565.1| Pmr5/Cas1p GDSL/SGNH-like acyl-esterase family protein [Medicago 
truncatula]
Length=353

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 85/122 (70%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+NIDP K KVFFQGIS  HY+G  WNEP+ + C  +  P+ GS++PG   P   V
Sbjct  232  ARWVDANIDPAKVKVFFQGISPSHYNGTLWNEPSAKSCIREKTPLTGSTYPGGLPPAVGV  291

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTY---AGGVVDCSHWCVAGVPDSWNQILYS  343
            +KGVL  +   V LLDI  L+ LRKDGHPS Y       +DCSHWC++GVPD+WNQILY+
Sbjct  292  LKGVLSTIKKPVTLLDITTLSLLRKDGHPSIYGLFGSKGMDCSHWCLSGVPDTWNQILYN  351

Query  342  IL  337
            ++
Sbjct  352  LI  353



>ref|XP_006348399.1| PREDICTED: uncharacterized protein LOC102583199 [Solanum tuberosum]
Length=382

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/130 (54%), Positives = 89/130 (68%), Gaps = 10/130 (8%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPA-VQDCRHQTKPIEGSSFPGERYPGEA  517
            +NWV+SNIDP KT+VFFQGIS  HY G EWN      +C  +T+PI GS +PG       
Sbjct  243  SNWVESNIDPTKTRVFFQGISPTHYSGKEWNASKPSSNCNGETQPISGSVYPGGPMTATT  302

Query  516  VVKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA-----GGVV----DCSHWCVAGVPDS  364
            +VK ++GNM+  V LLDI LL+QLRKDGHPS Y      G  +    DCSHWC+AGVPD+
Sbjct  303  IVKEIIGNMSKPVTLLDITLLSQLRKDGHPSIYGMNNNNGTKIKKGNDCSHWCLAGVPDT  362

Query  363  WNQILYSILI  334
            WNQ+ Y++L+
Sbjct  363  WNQLFYALLL  372



>ref|XP_004305456.2| PREDICTED: protein trichome birefringence-like 43 [Fragaria vesca 
subsp. vesca]
Length=363

 Score =   146 bits (369),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 90/125 (72%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+N+D  KT+VFFQG+S  H + ++W +P  + C  QTKP+ GS +P   +P E V
Sbjct  239  AKWVDTNVDQTKTRVFFQGVSPDHNNASDWRDPTAKACEGQTKPVAGSQYPAGPHPAEQV  298

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            V+ VL +M+  VYLL++  L+QLRKDGHPS Y  G    +DCSHWC+AGVPD+WN++LY 
Sbjct  299  VERVLHSMSFPVYLLNVTTLSQLRKDGHPSVYGHGGHRDMDCSHWCLAGVPDAWNELLYV  358

Query  342  ILIQN  328
             LIQ+
Sbjct  359  ALIQS  363



>gb|KJB12974.1| hypothetical protein B456_002G048100 [Gossypium raimondii]
Length=395

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 84/109 (77%), Gaps = 3/109 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVD+NIDP+KT+V FQG++AVH++  EW EP+ + C  QT+P++GS++PG   PGEA+
Sbjct  247  ANWVDTNIDPSKTRVLFQGVAAVHFNAKEWGEPSDKGCIKQTEPLKGSTYPGPPVPGEAI  306

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAG  376
            +K VL  MT   YLLDI LLTQLRKDGHPS YA     ++DCSHWC+A 
Sbjct  307  LKTVLSKMTKPAYLLDITLLTQLRKDGHPSIYARAGPKLIDCSHWCLAA  355



>ref|XP_002283611.1| PREDICTED: protein trichome birefringence-like 41 [Vitis vinifera]
 emb|CBI20120.3| unnamed protein product [Vitis vinifera]
Length=348

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 87/123 (71%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVD NIDP K+KVFFQG+S  HY+G  W EP  ++C H+ +P+  S++PG   P   V
Sbjct  226  ANWVDLNIDPTKSKVFFQGVSPSHYNGTSWGEPGAKNCIHEKEPLLVSTYPGGLPPALGV  285

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
             KGVL  M   V LLD+  L+ LRKDGHPS Y  G    +DCSHWC+AGVPD+WN+ILY+
Sbjct  286  QKGVLSKMKKPVVLLDVTNLSLLRKDGHPSMYGLGGPTGMDCSHWCLAGVPDTWNEILYN  345

Query  342  ILI  334
            +++
Sbjct  346  LIL  348



>ref|XP_006294394.1| hypothetical protein CARUB_v10023411mg [Capsella rubella]
 gb|EOA27292.1| hypothetical protein CARUB_v10023411mg [Capsella rubella]
Length=385

 Score =   147 bits (370),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 85/120 (71%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              WVD N++ ++T+VFFQGIS  HY G EWNEP  + C  Q +P+ GS++PG   P  ++
Sbjct  265  GQWVDQNVNISQTRVFFQGISPTHYMGREWNEPR-KTCNGQMQPLTGSTYPGGSLPAASI  323

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   VYLLDI  L+QLRKD HPSTY G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  324  VSQVLSSMRTPVYLLDITTLSQLRKDAHPSTYGGDGGTDCSHWCLPGLPDTWNQLLYAAL  383



>ref|XP_012068612.1| PREDICTED: protein trichome birefringence-like 38 [Jatropha curcas]
 gb|KDP40499.1| hypothetical protein JCGZ_24498 [Jatropha curcas]
Length=350

 Score =   146 bits (368),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVDS+++  KT+VFFQGIS  HY+G EWNEP V +C  +T+PI GS++PG       V
Sbjct  229  ANWVDSDVNTTKTRVFFQGISPSHYNGTEWNEPGVTNCGKETEPISGSTYPGGLPLALTV  288

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA-GGVVDCSHWCVAGVPDSWNQILYSIL  337
            V+ VL  +   V+LL+I  L+QLRKD HPS+Y     +DC+HWC+AGVPD+WNQ+LY+ L
Sbjct  289  VEDVLSGIKKPVHLLNITTLSQLRKDAHPSSYNWFRAMDCTHWCIAGVPDTWNQLLYTAL  348

Query  336  I  334
            I
Sbjct  349  I  349



>gb|KHG17132.1| CAS1 domain-containing 1 [Gossypium arboreum]
Length=360

 Score =   146 bits (368),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 91/125 (73%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+N++ +KT V FQG+S  H + ++W EP  ++C  Q +PI+G  +PG ++P E V
Sbjct  236  AKWVDANVNTSKTTVLFQGVSPDHINSSDWGEPKAKNCEGQKEPIKGGDYPGGQHPAEKV  295

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            V+ VL  M+  VYLL++  L+QLRKDGHPS Y  G    +DCSHWC+AGVPD+WNQ+LY+
Sbjct  296  VEKVLKTMSKPVYLLNVTNLSQLRKDGHPSVYGHGGHRDMDCSHWCLAGVPDTWNQLLYA  355

Query  342  ILIQN  328
             LIQ+
Sbjct  356  ALIQS  360



>ref|NP_565779.1| trichome birefringence-like 37 protein [Arabidopsis thaliana]
 sp|O22960.2|TBL37_ARATH RecName: Full=Protein trichome birefringence-like 37 [Arabidopsis 
thaliana]
 gb|AAB67625.2| expressed protein [Arabidopsis thaliana]
 gb|AAM63505.1| unknown [Arabidopsis thaliana]
 gb|AEC08913.1| trichome birefringence-like 37 protein [Arabidopsis thaliana]
Length=385

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 84/120 (70%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              WVD N++ ++T+VFFQGIS  HY G EWNEP  + C  Q +P+ GS++PG   P  ++
Sbjct  265  GQWVDQNVNVSQTRVFFQGISPTHYMGREWNEPR-KTCNGQMQPLTGSTYPGGSLPAASI  323

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL  M   VYLLDI  L+QLRKD HPSTY G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  324  VSRVLSTMRTPVYLLDITTLSQLRKDAHPSTYGGDGGTDCSHWCLPGLPDTWNQLLYAAL  383



>ref|XP_008371453.1| PREDICTED: protein trichome birefringence-like 38 [Malus domestica]
Length=361

 Score =   146 bits (368),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 85/123 (69%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSN+D ++TKVFFQGIS  HY G EWN P  + C  +  P+ GS++P    P  AV
Sbjct  240  ARWVDSNVDTSRTKVFFQGISPTHYQGKEWNSPK-KTCSGELGPLSGSTYPAGAPPSAAV  298

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            V  VL  + N VYLLDI  L+QLRKD HPSTY+G     DCSHWC+ G+PD+WNQ+LY+ 
Sbjct  299  VYKVLSTIKNPVYLLDITTLSQLRKDAHPSTYSGDHSGNDCSHWCLPGLPDTWNQLLYAA  358

Query  339  LIQ  331
            LI 
Sbjct  359  LIM  361



>ref|XP_009359364.1| PREDICTED: protein trichome birefringence-like 37 isoform X3 
[Pyrus x bretschneideri]
Length=218

 Score =   142 bits (358),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 84/123 (68%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            + WVD N+D + TKVFFQGIS  HY+G EWN      C  QT+P+ GS +PG   P   V
Sbjct  92   SKWVDYNVDFSNTKVFFQGISPTHYNGKEWNGSDSATCNGQTQPVRGSIYPGGSPPAATV  151

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTY---AGGVVDCSHWCVAGVPDSWNQILYS  343
            V  VL  MT++V LLDI LL+QLRKDGHPSTY        DCSHWC+AGVPD+WN++ Y+
Sbjct  152  VNQVLTAMTSAVILLDITLLSQLRKDGHPSTYGIDGKKGNDCSHWCLAGVPDTWNELFYA  211

Query  342  ILI  334
             L+
Sbjct  212  TLV  214



>ref|XP_010272739.1| PREDICTED: protein trichome birefringence-like 38 [Nelumbo nucifera]
Length=354

 Score =   145 bits (367),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 87/123 (71%), Gaps = 4/123 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVDSNIDP  TKVFFQGIS  HY G+EWN+ A  +C  QT+P+ GS++P       AV
Sbjct  232  ANWVDSNIDPASTKVFFQGISPTHYIGSEWNQ-ARMNCNGQTQPVSGSTYPEGSPESAAV  290

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTY---AGGVVDCSHWCVAGVPDSWNQILYS  343
            VK VL  M   V LLDI  L+QLRKDGHPS Y       +DCSHWC+AGVPD+WN++LY+
Sbjct  291  VKNVLSKMLKPVDLLDITTLSQLRKDGHPSAYGPDGAQGMDCSHWCLAGVPDTWNELLYA  350

Query  342  ILI  334
             L+
Sbjct  351  SLL  353



>ref|XP_003593750.1| hypothetical protein MTR_2g015720 [Medicago truncatula]
 gb|AES64001.1| trichome birefringence-like protein [Medicago truncatula]
Length=360

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+DP KTKVFFQGIS  HY G EWN+P    C  Q +P+ GS++P    P   +
Sbjct  239  AKWVDLNVDPTKTKVFFQGISPTHYMGKEWNQPK-NSCSGQLEPLSGSTYPAGLPPSSNI  297

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            +  VL +M + VYLLDI LL+QLRKD HPS+Y+G     DCSHWC+ G+PD+WNQ+LY+ 
Sbjct  298  LNNVLKSMKSPVYLLDITLLSQLRKDAHPSSYSGDHAGNDCSHWCLPGLPDTWNQLLYAA  357

Query  339  L  337
            L
Sbjct  358  L  358



>gb|EYU46053.1| hypothetical protein MIMGU_mgv1a008647mg [Erythranthe guttata]
Length=367

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 90/123 (73%), Gaps = 4/123 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WV ++++P+KTKVFFQGIS  HYHG EWNEP+  +C ++T P+ G+++PG       V
Sbjct  243  AKWVQTDVNPSKTKVFFQGISPFHYHGKEWNEPSATNCSNETTPVNGTTYPGGAPSALTV  302

Query  513  VKGVLGNMTN---SVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILY  346
            +K VL   T+    V+LLDI LL+QLRKDGHPS Y G   +DC+HWC+AGVPD+WN ILY
Sbjct  303  LKQVLNTNTSPSKPVHLLDITLLSQLRKDGHPSKYNGFHGMDCTHWCLAGVPDTWNTILY  362

Query  345  SIL  337
            S L
Sbjct  363  SEL  365



>ref|XP_008245553.1| PREDICTED: protein trichome birefringence-like 38 [Prunus mume]
Length=362

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 86/124 (69%), Gaps = 5/124 (4%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            + WVDSN+D N TKVFFQGIS  HY+G EW++P    C  QT+P+ G ++P    P   V
Sbjct  237  SKWVDSNVDANNTKVFFQGISPTHYNGKEWDDPNSASCSGQTQPVTGRTYPAGSPPAATV  296

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV----VDCSHWCVAGVPDSWNQILY  346
            V  VL  M++ V LLDI LL+QLRKDGHPS Y G V     DCSHWC+AGVPD+WNQ+ Y
Sbjct  297  VNDVLNAMSSPVTLLDITLLSQLRKDGHPSLY-GNVGRTGNDCSHWCLAGVPDTWNQLFY  355

Query  345  SILI  334
            + L+
Sbjct  356  ATLV  359



>gb|EYU38243.1| hypothetical protein MIMGU_mgv1a012415mg [Erythranthe guttata]
Length=251

 Score =   143 bits (360),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 85/122 (70%), Gaps = 2/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVD+NIDP  TKVFFQGIS  HY+G+ WNEP  + C  Q +P+ GS++PG       V
Sbjct  129  ANWVDTNIDPTITKVFFQGISPSHYNGSAWNEPGAKSCVGQKEPVVGSTYPGGLPAALTV  188

Query  513  VKGVLGNMTNSVY--LLDIALLTQLRKDGHPSTYAGGVVDCSHWCVAGVPDSWNQILYSI  340
            +K VL +    V   LLD+  L+ LRKDGHPS Y  G +DCSHWC+ GVPD+WN ILY++
Sbjct  189  LKKVLTSKIKKVRVELLDVTNLSLLRKDGHPSIYGLGAMDCSHWCLPGVPDTWNLILYNL  248

Query  339  LI  334
            +I
Sbjct  249  II  250



>ref|XP_002893546.1| hypothetical protein ARALYDRAFT_473111 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69805.1| hypothetical protein ARALYDRAFT_473111 [Arabidopsis lyrata subsp. 
lyrata]
Length=380

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+D  KT+VFFQGIS  HY G EWNEP  + C  Q +P+ GSS+P  + P   V
Sbjct  260  ARWVDQNVDTTKTRVFFQGISPTHYEGREWNEPR-KSCSGQMQPLGGSSYPSGQPPSAGV  318

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   V LLDI  L+QLRKD HPS+Y G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  319  VSKVLNSMKKPVTLLDITTLSQLRKDAHPSSYGGDGGTDCSHWCLPGLPDTWNQLLYAAL  378



>gb|AAF88130.1|AC021043_23 Unknown protein [Arabidopsis thaliana]
Length=368

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+D  KT+VFFQGIS  HY G EWNEP  + C  Q +P+ GSS+P  + P   V
Sbjct  248  ARWVDQNVDTAKTRVFFQGISPTHYEGREWNEPR-KTCSGQMQPLGGSSYPSGQPPSSGV  306

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   V LLDI  L+QLRKD HPS+Y G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  307  VSKVLSSMKKPVTLLDITTLSQLRKDAHPSSYGGDGGTDCSHWCLPGLPDTWNQLLYAAL  366



>ref|XP_007025417.1| Trichome birefringence-like 37 isoform 1 [Theobroma cacao]
 ref|XP_007025418.1| Trichome birefringence-like 37 isoform 1 [Theobroma cacao]
 gb|EOY28039.1| Trichome birefringence-like 37 isoform 1 [Theobroma cacao]
 gb|EOY28040.1| Trichome birefringence-like 37 isoform 1 [Theobroma cacao]
Length=363

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 89/122 (73%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVDSN+DP KTKVFFQGIS  HY G EWN+P  ++C  + +P+ GS++P    P  A+
Sbjct  242  ANWVDSNVDPTKTKVFFQGISPTHYEGREWNQPK-KNCYGELEPLSGSTYPAGAPPAAAI  300

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG--GVVDCSHWCVAGVPDSWNQILYSI  340
            +  VLG M   VYLLDI  L+QLRKD HPSTY+G     DCSHWC+ G+PD+WNQ+LY+ 
Sbjct  301  LNKVLGTMKKPVYLLDITTLSQLRKDAHPSTYSGEHSGNDCSHWCLPGLPDTWNQLLYAA  360

Query  339  LI  334
            L+
Sbjct  361  LV  362



>ref|XP_003593751.1| hypothetical protein MTR_2g015720 [Medicago truncatula]
Length=376

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+DP KTKVFFQGIS  HY G EWN+P    C  Q +P+ GS++P    P   +
Sbjct  255  AKWVDLNVDPTKTKVFFQGISPTHYMGKEWNQPK-NSCSGQLEPLSGSTYPAGLPPSSNI  313

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            +  VL +M + VYLLDI LL+QLRKD HPS+Y+G     DCSHWC+ G+PD+WNQ+LY+ 
Sbjct  314  LNNVLKSMKSPVYLLDITLLSQLRKDAHPSSYSGDHAGNDCSHWCLPGLPDTWNQLLYAA  373

Query  339  L  337
            L
Sbjct  374  L  374



>ref|XP_011042150.1| PREDICTED: protein trichome birefringence-like 41 [Populus euphratica]
Length=371

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDS++D +KT+V FQGIS  HYHG EW EP V +C  +T+P+ GS++PG       V
Sbjct  250  AKWVDSDVDTSKTRVIFQGISPFHYHGEEWGEPGVTNCGKETEPVSGSTYPGGSPLALQV  309

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYSIL  337
            V+ VL  +   V+LL+I  L+QLRKDGHPS+Y G   +DC+HWCVAGVPD+WN++LY+ +
Sbjct  310  VEDVLSTIKKPVHLLNITTLSQLRKDGHPSSYNGFKGMDCTHWCVAGVPDTWNELLYTAI  369

Query  336  I  334
            +
Sbjct  370  V  370



>ref|XP_011005473.1| PREDICTED: protein trichome birefringence-like 37 [Populus euphratica]
Length=359

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 85/121 (70%), Gaps = 2/121 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              WVD N+DP+KTKVFFQGIS  HY G +WN+P  + C  +  P+ GS++P    P   V
Sbjct  239  GRWVDQNVDPSKTKVFFQGISPTHYQGKDWNQPQ-KSCSGEAVPLSGSTYPAGAPPAVGV  297

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYSIL  337
            V  VL ++T  VYLLDI  L+QLRKD HPSTY+ G   DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  298  VSKVLSSITKPVYLLDITTLSQLRKDAHPSTYSDGSGTDCSHWCLPGLPDTWNQLLYAAL  357

Query  336  I  334
            +
Sbjct  358  L  358



>ref|XP_010915618.1| PREDICTED: protein trichome birefringence-like 39 [Elaeis guineensis]
Length=373

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 84/121 (69%), Gaps = 2/121 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+N++P  TKVFFQGIS  HY G +W EP  + C  QT+P+    +PG   P +A+
Sbjct  252  AGWVDANVNPATTKVFFQGISPTHYQGRDWGEPNAKRCYGQTQPLIRPRYPGGSLPAQAI  311

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTY--AGGVVDCSHWCVAGVPDSWNQILYSI  340
            VK VL  M+  VYLLD+  L+QLRKD HPS Y      +DCSHWCVAG+PD+WNQ+LY+ 
Sbjct  312  VKRVLQTMSMPVYLLDVTFLSQLRKDAHPSVYNRDDSGMDCSHWCVAGLPDTWNQLLYAA  371

Query  339  L  337
            L
Sbjct  372  L  372



>emb|CDP06044.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 85/121 (70%), Gaps = 2/121 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+N+DP KT VFF G+S  HY G++WN+P V++C  QT+P+ G ++PG   P  AV
Sbjct  220  AKWVDTNVDPAKTTVFFLGVSPSHYKGSDWNQPQVKNCAGQTRPLPGPTYPGVLPPALAV  279

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTY--AGGVVDCSHWCVAGVPDSWNQILYSI  340
             K VL  M   V LLDI  L+QLR D HPS Y  A    DC+HWC+AG+PD+WNQ+LY++
Sbjct  280  QKKVLSEMRVPVKLLDITTLSQLRVDAHPSFYGAATAAADCTHWCIAGLPDTWNQLLYNL  339

Query  339  L  337
            L
Sbjct  340  L  340



>ref|NP_564318.1| protein trichome birefringence-like 38 [Arabidopsis thaliana]
 sp|Q8VY22.1|TBL38_ARATH RecName: Full=Protein trichome birefringence-like 38 [Arabidopsis 
thaliana]
 gb|AAL66969.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20296.1| unknown protein [Arabidopsis thaliana]
 dbj|BAE99289.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE31037.1| protein trichome birefringence-like 38 [Arabidopsis thaliana]
Length=380

 Score =   145 bits (367),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+D  KT+VFFQGIS  HY G EWNEP  + C  Q +P+ GSS+P  + P   V
Sbjct  260  ARWVDQNVDTAKTRVFFQGISPTHYEGREWNEPR-KTCSGQMQPLGGSSYPSGQPPSSGV  318

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   V LLDI  L+QLRKD HPS+Y G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  319  VSKVLSSMKKPVTLLDITTLSQLRKDAHPSSYGGDGGTDCSHWCLPGLPDTWNQLLYAAL  378



>ref|XP_009359360.1| PREDICTED: protein trichome birefringence-like 37 isoform X2 
[Pyrus x bretschneideri]
 ref|XP_009359361.1| PREDICTED: protein trichome birefringence-like 37 isoform X2 
[Pyrus x bretschneideri]
 ref|XP_009359362.1| PREDICTED: protein trichome birefringence-like 37 isoform X2 
[Pyrus x bretschneideri]
Length=244

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 84/123 (68%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            + WVD N+D + TKVFFQGIS  HY+G EWN      C  QT+P+ GS +PG   P   V
Sbjct  118  SKWVDYNVDFSNTKVFFQGISPTHYNGKEWNGSDSATCNGQTQPVRGSIYPGGSPPAATV  177

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTY---AGGVVDCSHWCVAGVPDSWNQILYS  343
            V  VL  MT++V LLDI LL+QLRKDGHPSTY        DCSHWC+AGVPD+WN++ Y+
Sbjct  178  VNQVLTAMTSAVILLDITLLSQLRKDGHPSTYGIDGKKGNDCSHWCLAGVPDTWNELFYA  237

Query  342  ILI  334
             L+
Sbjct  238  TLV  240



>emb|CDY17220.1| BnaA05g09680D [Brassica napus]
Length=381

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 85/120 (71%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N++ ++T+VFFQGIS  HY G EWNEP  + C  Q +P+ GS++PG   P  ++
Sbjct  261  AQWVDQNVNTSQTRVFFQGISPTHYVGKEWNEPK-KTCNGQMQPLTGSTYPGGPLPASSI  319

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA-GGVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   VYLLDI  L+QLRKD HPSTY   G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  320  VSRVLRSMKTPVYLLDITTLSQLRKDAHPSTYGENGRTDCSHWCLPGLPDTWNQLLYAAL  379



>ref|XP_002887755.1| hypothetical protein ARALYDRAFT_316771 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64014.1| hypothetical protein ARALYDRAFT_316771 [Arabidopsis lyrata subsp. 
lyrata]
Length=359

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 93/125 (74%), Gaps = 4/125 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A W+D NIDP+KT+VF+QG+S VH  G EW +P  + C  +T+P++G S+ G+   GEA+
Sbjct  236  AKWIDHNIDPSKTRVFYQGVSPVHLIGGEWGKPG-KTCLGETEPVKGPSYCGQPNEGEAI  294

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            V+ V+G M   V LLD+  +T++RKDGHPS YAGG   + DCSHWC+ GVPD+WNQ+LY+
Sbjct  295  VRSVIGGMAKPVELLDVTNMTEMRKDGHPSIYAGGGNRLNDCSHWCLPGVPDAWNQLLYT  354

Query  342  ILIQN  328
             L+++
Sbjct  355  ALVRH  359



>ref|XP_006477896.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=379

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 87/123 (71%), Gaps = 4/123 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              WVDS++DP  TKVFFQGIS  HY+G EWNE +   C  QT+PI GS++PG   P   +
Sbjct  251  GKWVDSSVDPTTTKVFFQGISPTHYNGQEWNE-SKSTCVGQTQPINGSTYPGGSPPAVGI  309

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTY---AGGVVDCSHWCVAGVPDSWNQILYS  343
            VK VL +M+  V LLDI  ++Q+RKDGHPS Y        DCSHWC+AGVPD+WN+ILY+
Sbjct  310  VKEVLSSMSTQVTLLDITTMSQMRKDGHPSIYGLDGQKGSDCSHWCLAGVPDTWNEILYA  369

Query  342  ILI  334
            IL+
Sbjct  370  ILV  372



>ref|XP_002516811.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45425.1| conserved hypothetical protein [Ricinus communis]
Length=360

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 89/123 (72%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A W+  NIDP KT+VFFQGIS  H +  +W  P+ ++CR +T+P+   ++PG ++P EA+
Sbjct  232  ARWIQHNIDPTKTQVFFQGISPDHENSTDWGNPSRKNCRGETEPLLQPNYPGGKHPAEAI  291

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            V+ VL  ++  VYLL+I  L+QLRKDGHPS Y  G     DCSHWC+AGVPD+WN++LY+
Sbjct  292  VERVLRTISKPVYLLNITTLSQLRKDGHPSAYGYGDRQATDCSHWCLAGVPDAWNELLYA  351

Query  342  ILI  334
             LI
Sbjct  352  ALI  354



>gb|KJB68384.1| hypothetical protein B456_010G242200 [Gossypium raimondii]
Length=373

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 84/122 (69%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+N+D  KTKVFFQGIS  HY G EWN+P  + C  + +P+ GS +P    P  A+
Sbjct  252  AKWVDTNVDTTKTKVFFQGISPTHYEGREWNQPK-RSCNGELQPLSGSKYPVGAPPASAI  310

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            V  +L  M   VYLLDI  L+QLRKD HPSTY+G     DCSHWC+ G+PDSWNQ+LY+ 
Sbjct  311  VNTILRKMMKPVYLLDITTLSQLRKDAHPSTYSGDHSGNDCSHWCLPGLPDSWNQLLYAA  370

Query  339  LI  334
            L+
Sbjct  371  LL  372



>ref|XP_006415616.1| hypothetical protein EUTSA_v10007896mg [Eutrema salsugineum]
 gb|ESQ33969.1| hypothetical protein EUTSA_v10007896mg [Eutrema salsugineum]
Length=386

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 83/120 (69%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+D ++TKVFFQGIS  HY G EWNEP  + C  Q +P+ GS++P  + P   V
Sbjct  266  ARWVDQNVDTSRTKVFFQGISPTHYEGREWNEPR-KSCNGQAQPLSGSNYPSGQPPSAGV  324

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL  M   V+LLDI  L+QLRKD HPS Y G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  325  VSKVLNAMRKPVFLLDITTLSQLRKDAHPSIYGGDGGTDCSHWCLPGLPDTWNQLLYAAL  384



>gb|KHN21700.1| hypothetical protein glysoja_050079 [Glycine soja]
Length=253

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 86/125 (69%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD NIDP +T+VFFQG+S  H +  +W EP    C  QT+PI G  +PG   P E V
Sbjct  129  AKWVDYNIDPTRTRVFFQGVSPDHQNPAQWGEPRANLCEGQTRPILGFRYPGGPLPAELV  188

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA-GGVV--DCSHWCVAGVPDSWNQILYS  343
            ++ VL  M   VYLLDI  L+QLR DGHPS Y  GG +  DCSHWC+AGVPD+WN++LY+
Sbjct  189  LEKVLRAMQKPVYLLDITTLSQLRIDGHPSVYGFGGHLDPDCSHWCLAGVPDTWNELLYA  248

Query  342  ILIQN  328
             L++N
Sbjct  249  SLVKN  253



>gb|KHN13696.1| hypothetical protein glysoja_034006 [Glycine soja]
Length=364

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWV++ +D NKTKV FQGIS  HY+G EWNEP V++C  +T+PI GS++P        V
Sbjct  243  ANWVNAEVDTNKTKVLFQGISPSHYNGMEWNEPGVRNCSKETQPISGSTYPSGLPAALFV  302

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYS  343
            ++ VL N+T  V+LL+I  L+QLRKD HPS+Y G   +DC+HWCVAG+PD+WNQ+LY+
Sbjct  303  LEDVLKNITKPVHLLNITTLSQLRKDAHPSSYNGFRGMDCTHWCVAGLPDTWNQLLYA  360



>ref|XP_006591157.1| PREDICTED: protein YLS7-like [Glycine max]
Length=366

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/118 (56%), Positives = 89/118 (75%), Gaps = 1/118 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWV++ +D NKTKV FQGIS  HY+G EWNEP V++C  +T+PI GS++P        V
Sbjct  245  ANWVNAEVDTNKTKVLFQGISPSHYNGMEWNEPGVRNCSKETQPISGSTYPSGLPAALFV  304

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYS  343
            ++ VL N+T  V+LL+I  L+QLRKD HPS+Y G   +DC+HWCVAG+PD+WNQ+LY+
Sbjct  305  LEDVLKNITKPVHLLNITTLSQLRKDAHPSSYNGFRGMDCTHWCVAGLPDTWNQLLYA  362



>ref|XP_004500006.1| PREDICTED: uncharacterized protein LOC101510811 [Cicer arietinum]
Length=369

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 85/124 (69%), Gaps = 3/124 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A W+D N+D NKT+VFFQG+S  H +  +W EP    C  Q KP+ GS +PG  +P E V
Sbjct  245  AKWIDDNVDINKTRVFFQGVSPDHLNSEQWGEPKANFCEGQEKPLLGSIYPGGPHPAELV  304

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            ++ VL  M   V LLDI  L+QLRKDGHPS Y  G    +DCSHWC+AGVPD+WNQ+LY+
Sbjct  305  LERVLRAMQKPVNLLDITTLSQLRKDGHPSVYGHGGHRDMDCSHWCLAGVPDTWNQLLYA  364

Query  342  ILIQ  331
             LIQ
Sbjct  365  TLIQ  368



>ref|XP_006438892.1| hypothetical protein CICLE_v10033510mg [Citrus clementina]
 gb|ESR52132.1| hypothetical protein CICLE_v10033510mg [Citrus clementina]
Length=373

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 88/123 (72%), Gaps = 1/123 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDS++D  KT+V FQG+S  HY+G EW+EP V +C ++ +PI GS +PG       V
Sbjct  250  AKWVDSDVDTTKTRVIFQGVSPSHYNGTEWDEPEVTNCANEKQPIVGSKYPGGLPEAALV  309

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            VK VL  +   V+LLDI  L+QLRKD HPS++ G   +DC+HWCVAG+PD+WNQ+LY+ L
Sbjct  310  VKDVLRTVKKPVHLLDITTLSQLRKDAHPSSFNGFKAMDCTHWCVAGLPDTWNQLLYTAL  369

Query  336  IQN  328
            + N
Sbjct  370  VNN  372



>gb|KHG20284.1| Enolase [Gossypium arboreum]
Length=365

 Score =   145 bits (365),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 86/121 (71%), Gaps = 3/121 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVD+N+D  KTKVFFQGIS  HY G EWN+P  + C  + +P+ G+++     P  A+
Sbjct  244  ANWVDTNVDQTKTKVFFQGISPTHYEGREWNQPK-KSCYGEQEPLSGTTYQAGAPPAAAI  302

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            V  VLG+M   VYLLDI  L+QLRKD HPSTY+G     DCSHWC+ G+PD+WNQ+LY+ 
Sbjct  303  VNKVLGSMNKPVYLLDITTLSQLRKDAHPSTYSGDHSGNDCSHWCLPGLPDTWNQLLYAA  362

Query  339  L  337
            L
Sbjct  363  L  363



>ref|XP_003551303.1| PREDICTED: protein YLS7-like [Glycine max]
Length=272

 Score =   142 bits (359),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 87/125 (70%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD NIDP +T+VFFQG+S  H +  +W EP    C  +T+PI G  +PG   P E V
Sbjct  148  AKWVDYNIDPTRTRVFFQGVSPGHQNPAQWGEPRPNLCEGKTRPILGFRYPGGPLPAELV  207

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA-GGVV--DCSHWCVAGVPDSWNQILYS  343
            ++ VL  M   VYLLDI  L+QLR DGHPS Y  GG +  DCSHWC+AGVPD+WN++LY+
Sbjct  208  LEKVLRAMQKPVYLLDITTLSQLRIDGHPSVYGFGGHLDPDCSHWCLAGVPDTWNELLYA  267

Query  342  ILIQN  328
            IL++N
Sbjct  268  ILVKN  272



>ref|XP_008245550.1| PREDICTED: protein trichome birefringence-like 41 [Prunus mume]
Length=355

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 87/123 (71%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSNIDP KTKVFFQGIS  HY+G++W+EP  + C  Q  P+ GS++PG   P  +V
Sbjct  233  AGWVDSNIDPAKTKVFFQGISPSHYNGSQWDEPKARSCVGQKVPLLGSTYPGGLPPALSV  292

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            +K  L  +T  V LLD+  L+ LRKDGHPS Y  G    +DCSHWC+ GVPD+WN+ILY+
Sbjct  293  LKNALSKITKPVTLLDVTNLSLLRKDGHPSIYGLGGTTAMDCSHWCLCGVPDTWNEILYN  352

Query  342  ILI  334
             ++
Sbjct  353  FIL  355



>ref|XP_006346586.1| PREDICTED: uncharacterized protein LOC102604720 [Solanum tuberosum]
Length=344

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A W+D+NI+P KT VFFQGIS  HY+G +WN+P V+ C  Q +PI GS++PG   P   +
Sbjct  223  AKWIDTNINPAKTIVFFQGISPSHYNGTDWNQPGVKTCLRQMQPISGSTYPGGLPPALRI  282

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVVDCSHWCVAGVPDSWNQILYSILI  334
            +K VL  +   V LLD+  L  LRKDGHPS Y    +DCSHWC+AGVPD WN+ILY+ ++
Sbjct  283  LKKVLYTIEKQVTLLDVTNLCLLRKDGHPSIYGLSGMDCSHWCLAGVPDIWNEILYNFIV  342



>ref|XP_006364115.1| PREDICTED: uncharacterized protein LOC102591526 [Solanum tuberosum]
Length=209

 Score =   140 bits (354),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 89/122 (73%), Gaps = 4/122 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEA-  517
            A WVD NIDP+KTKVFFQGIS  HY G +WNEP+ + C+ QT+P  G+++P    P EA 
Sbjct  89   ARWVDKNIDPSKTKVFFQGISPTHYKGKDWNEPS-KSCKGQTQPFFGTNYPAGT-PQEAN  146

Query  516  VVKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG-VVDCSHWCVAGVPDSWNQILYSI  340
            VV  V+ N+ N+VYLLDI  L+Q RKDGHP  Y+     DCSHWC+ G+PD+WN +LY+I
Sbjct  147  VVNKVIKNIKNNVYLLDITTLSQYRKDGHPGYYSEMHGSDCSHWCLPGLPDTWNLLLYTI  206

Query  339  LI  334
            LI
Sbjct  207  LI  208



>gb|AFK45250.1| unknown [Lotus japonicus]
Length=361

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 84/124 (68%), Gaps = 3/124 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+DP+KTKVFFQGIS  HY G EWN+P  + C  Q +P+ GS++P        +
Sbjct  239  ARWVDLNVDPSKTKVFFQGISPTHYQGKEWNQPK-RSCSGQLEPLAGSTYPAGLPQAANI  297

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            +  VL  M N VYLLDI LL+QLRKD HPSTY       DCSHWC+ G+PD+WNQ+LY+ 
Sbjct  298  LNSVLKKMNNPVYLLDITLLSQLRKDAHPSTYGEDHSGNDCSHWCLPGLPDTWNQLLYAA  357

Query  339  LIQN  328
            L  N
Sbjct  358  LTNN  361



>ref|XP_009590179.1| PREDICTED: protein trichome birefringence-like 41 [Nicotiana 
tomentosiformis]
Length=351

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 85/122 (70%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A W+D+NIDP KT VFFQGIS  HY+G +WN+P V+ C  Q +P+ GS++PG   P   V
Sbjct  229  AKWIDTNIDPEKTMVFFQGISPSHYNGTDWNQPGVKTCLGQRQPVSGSTYPGGLPPALTV  288

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            +K VL  +   V LLD+  L  LRKDGHPS Y  G    +DCSHWC+AGVPD+WNQI Y+
Sbjct  289  LKNVLSTIEKPVTLLDVTNLCLLRKDGHPSIYGLGGRTGMDCSHWCLAGVPDTWNQIFYN  348

Query  342  IL  337
            ++
Sbjct  349  LI  350



>ref|XP_009804652.1| PREDICTED: protein trichome birefringence-like 41 isoform X2 
[Nicotiana sylvestris]
Length=271

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 85/122 (70%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A W+D+NI P KT VFFQGIS  HY+G +WN+P V+ C  Q +P+ GS++PG   P   V
Sbjct  149  AKWIDTNIYPAKTMVFFQGISPSHYNGTDWNQPGVKTCLGQRQPVSGSTYPGGLPPALTV  208

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            +K VL  +   V LLD+  L  LRKDGHPS Y  G    +DCSHWC+AGVPD+WNQILY+
Sbjct  209  LKNVLSTIEKPVTLLDVTNLCLLRKDGHPSIYGLGGRTGMDCSHWCLAGVPDTWNQILYN  268

Query  342  IL  337
            ++
Sbjct  269  LV  270



>ref|XP_004251923.1| PREDICTED: protein trichome birefringence-like 41 [Solanum lycopersicum]
Length=355

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 0/121 (0%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A W+D+NI+P KT VFFQGIS  HY+G  WNEP V+ C  Q +PI GS++PG   P   V
Sbjct  234  AKWIDTNINPAKTIVFFQGISPSHYNGTNWNEPGVKTCLGQMQPISGSTYPGGLPPALKV  293

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVVDCSHWCVAGVPDSWNQILYSILI  334
            +K VL  +   V LLD+  L  LRKDGHPS Y    +DCSHWC+AGVPD WN+ILY+ ++
Sbjct  294  LKKVLYTIEKQVTLLDVTNLCLLRKDGHPSIYGLSGMDCSHWCLAGVPDIWNEILYNFIV  353

Query  333  Q  331
             
Sbjct  354  M  354



>ref|XP_002304779.2| hypothetical protein POPTR_0003s20070g [Populus trichocarpa]
 gb|EEE79758.2| hypothetical protein POPTR_0003s20070g [Populus trichocarpa]
Length=371

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 88/120 (73%), Gaps = 1/120 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDS++D +KT V FQGIS  HYHG EW+EP V +C  +T+P+ GS++PG       V
Sbjct  250  AKWVDSDVDTSKTTVIFQGISPFHYHGEEWDEPGVTNCGKETEPVSGSTYPGGSPLALQV  309

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYSIL  337
            V+ VL  +   V+LL+I  L+QLRKDGHPS+Y G   +DC+HWCVAGVPD+WN++LY+ +
Sbjct  310  VEDVLSTIKKPVHLLNITTLSQLRKDGHPSSYNGFKGMDCTHWCVAGVPDTWNELLYTAI  369



>ref|XP_009143809.1| PREDICTED: protein trichome birefringence-like 37 [Brassica rapa]
Length=381

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 85/120 (71%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N++ ++T+VFFQGIS  HY G EWNEP  + C  Q +P+ GS++PG   P  ++
Sbjct  261  AQWVDQNVNNSQTRVFFQGISPTHYVGKEWNEPK-KTCNGQMQPLTGSTYPGGPLPASSI  319

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA-GGVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   VYLLDI  L+QLRKD HPSTY   G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  320  VSRVLRSMKTPVYLLDITTLSQLRKDAHPSTYGENGRTDCSHWCLPGLPDTWNQLLYAAL  379



>ref|XP_008383643.1| PREDICTED: protein trichome birefringence-like 38 [Malus domestica]
Length=361

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 86/123 (70%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSN+D ++TKVFFQGIS  HY G EWN P  + C  +  P+ GS++P    P  AV
Sbjct  240  AKWVDSNVDTSRTKVFFQGISPTHYQGQEWNSPK-KTCLGELGPLSGSTYPAGAPPSAAV  298

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            V  VL  + + VYLLDI +L+QLRKD HPSTY+G     DCSHWC+ G+PD+WNQ+LY+ 
Sbjct  299  VYKVLSAIKSPVYLLDITMLSQLRKDAHPSTYSGDHSGNDCSHWCLPGLPDTWNQLLYAA  358

Query  339  LIQ  331
            LI 
Sbjct  359  LIM  361



>ref|XP_007148060.1| hypothetical protein PHAVU_006G177100g [Phaseolus vulgaris]
 gb|ESW20054.1| hypothetical protein PHAVU_006G177100g [Phaseolus vulgaris]
Length=364

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 84/121 (69%), Gaps = 3/121 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVD N+D  KTK+FFQGIS  HY G +WN+P  + C  + +P+ GS++P    P   +
Sbjct  243  ANWVDQNVDTTKTKIFFQGISPTHYQGKDWNQPR-RSCSGELQPLSGSTYPAGLPPATTI  301

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            +  VL  M   VYLLDI LL+QLRKD HPS+Y+G     DCSHWC+ G+PD+WNQ+LY+ 
Sbjct  302  LNNVLKKMNTQVYLLDITLLSQLRKDAHPSSYSGDHAGNDCSHWCLPGLPDTWNQLLYAA  361

Query  339  L  337
            L
Sbjct  362  L  362



>ref|XP_009348409.1| PREDICTED: protein trichome birefringence-like 38 [Pyrus x bretschneideri]
Length=361

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 84/123 (68%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSN+D ++TKVFFQGIS  HY G EWN P  + C  +  P+ GS++P    P  AV
Sbjct  240  AKWVDSNVDTSRTKVFFQGISPTHYQGKEWNSPK-KTCSGELGPLSGSTYPAGAPPSAAV  298

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            V  VL  +   VYLLDI  L+QLRKD HPSTY+G     DCSHWC+ G+PD+WNQ+LY+ 
Sbjct  299  VYKVLSTIKKPVYLLDITTLSQLRKDAHPSTYSGDHSGNDCSHWCLPGLPDTWNQLLYAA  358

Query  339  LIQ  331
            LI 
Sbjct  359  LIM  361



>ref|XP_010670501.1| PREDICTED: protein trichome birefringence-like 38 [Beta vulgaris 
subsp. vulgaris]
Length=374

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 88/121 (73%), Gaps = 1/121 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDS I+P KT+V+FQG +  HY+G +W++  V+DC  +T P +GS++P    P   V
Sbjct  253  AKWVDSEINPLKTRVYFQGTNPSHYNGKDWDKTGVRDCSKETIPTKGSTYPSPVPPALEV  312

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYSIL  337
            VK +L  M+  VYLLDI  L+QLRKDGHP +Y G   +DC+HWCV+G+PD+WNQ+LY+ L
Sbjct  313  VKQILSTMSTPVYLLDITTLSQLRKDGHPGSYNGFRGIDCTHWCVSGLPDTWNQLLYTSL  372

Query  336  I  334
            I
Sbjct  373  I  373



>ref|XP_009626454.1| PREDICTED: protein trichome birefringence-like 41 [Nicotiana 
tomentosiformis]
Length=353

 Score =   144 bits (362),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 87/121 (72%), Gaps = 1/121 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WV++++D NKTKV FQG S  HYHG++W EP V +C ++T P+ GS++P        +
Sbjct  233  AKWVETDVDTNKTKVSFQGASPAHYHGSDWGEPNVNNCLNETTPVNGSTYPSGLPVAVEI  292

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTY-AGGVVDCSHWCVAGVPDSWNQILYSIL  337
            VK VL N++  V+LLDI  L+QLRKDGHPS Y A   +DC+HWC+AGVPD+WNQI Y  L
Sbjct  293  VKEVLSNISKPVFLLDITKLSQLRKDGHPSKYNAFKGMDCTHWCLAGVPDTWNQIFYGSL  352

Query  336  I  334
            I
Sbjct  353  I  353



>ref|XP_009334009.1| PREDICTED: protein trichome birefringence-like 41 [Pyrus x bretschneideri]
Length=368

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 88/123 (72%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDSNIDP K++VFFQGIS  HY+G+EW EP  + C  Q +P+ GS++PG   P  +V
Sbjct  246  AGWVDSNIDPAKSRVFFQGISPSHYNGSEWQEPRARSCVGQKEPLLGSTYPGGLPPALSV  305

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            +K VL  +   V LLDI  L+ LRKDGHPS Y  G    +DCSHWC+ GVPD+WN+ILY+
Sbjct  306  LKNVLSTIKKPVTLLDITNLSLLRKDGHPSIYVLGGRAGMDCSHWCLCGVPDTWNEILYN  365

Query  342  ILI  334
            +++
Sbjct  366  LIL  368



>ref|XP_006467669.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=366

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 86/121 (71%), Gaps = 3/121 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+DP+KTKVFFQGIS  HY G EWN    ++C  + +P+ GS++PG   P  +V
Sbjct  245  ARWVDLNVDPSKTKVFFQGISPTHYTGKEWNSRK-KNCLGELEPLSGSTYPGGAPPAASV  303

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG--GVVDCSHWCVAGVPDSWNQILYSI  340
            V  VL ++   VYLLDI  L+QLRKD HPSTY+G     DCSHWC+ G+PD+WNQ+LY+ 
Sbjct  304  VNKVLSSINKPVYLLDITTLSQLRKDAHPSTYSGKHSGTDCSHWCLPGLPDTWNQLLYAA  363

Query  339  L  337
            L
Sbjct  364  L  364



>ref|XP_006442366.1| hypothetical protein CICLE_v10024135mg [Citrus clementina]
 gb|ESR55606.1| hypothetical protein CICLE_v10024135mg [Citrus clementina]
Length=379

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 87/123 (71%), Gaps = 4/123 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              WVDS++DP  TKVFFQGIS  HY+G EW+E +   C  QT+PI GS++PG   P   +
Sbjct  251  GKWVDSSLDPTTTKVFFQGISPTHYNGQEWSE-SKSTCVGQTQPINGSTYPGGSPPAVGI  309

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTY---AGGVVDCSHWCVAGVPDSWNQILYS  343
            VK VL +M+  V LLDI  L+Q+RKDGHPS Y        DCSHWC+AGVPD+WN+ILY+
Sbjct  310  VKEVLSSMSTQVTLLDITTLSQMRKDGHPSIYGLDGQKGSDCSHWCLAGVPDTWNEILYA  369

Query  342  ILI  334
            IL+
Sbjct  370  ILV  372



>ref|XP_012068510.1| PREDICTED: protein trichome birefringence-like 42 [Jatropha curcas]
 gb|KDP41035.1| hypothetical protein JCGZ_03567 [Jatropha curcas]
Length=374

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 85/125 (68%), Gaps = 5/125 (4%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEP--AVQDCRHQTKPIEGSSFPGERYPGE  520
             NWVD+NIDP+   VFFQG++  H    EW +P    + C  QT+P++GS +PG   PGE
Sbjct  247  GNWVDNNIDPSNAWVFFQGVAVAHLDPREWEDPNPEARQCEGQTEPVKGSKYPGTVNPGE  306

Query  519  AVVKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV---DCSHWCVAGVPDSWNQIL  349
             VVK V+  M    YLLDI LLTQLRKDGHPS Y G  +   DCSHWC+ GVPD+WNQ+L
Sbjct  307  EVVKQVIRKMAKPAYLLDITLLTQLRKDGHPSLYYGQDMKQNDCSHWCLPGVPDTWNQLL  366

Query  348  YSILI  334
            Y+ L+
Sbjct  367  YAALL  371



>ref|XP_006449479.1| hypothetical protein CICLE_v10015687mg [Citrus clementina]
 gb|ESR62719.1| hypothetical protein CICLE_v10015687mg [Citrus clementina]
Length=366

 Score =   144 bits (363),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 86/121 (71%), Gaps = 3/121 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+DP+KTKVFFQGIS  HY G EWN    ++C  + +P+ GS++PG   P  +V
Sbjct  245  ARWVDLNVDPSKTKVFFQGISPTHYKGKEWNSRK-KNCLGELEPLSGSTYPGGVPPAASV  303

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG--GVVDCSHWCVAGVPDSWNQILYSI  340
            V  VL ++   VYLLDI  L+QLRKD HPSTY+G     DCSHWC+ G+PD+WNQ+LY+ 
Sbjct  304  VNKVLSSINKPVYLLDITTLSQLRKDAHPSTYSGEHSGTDCSHWCLPGLPDTWNQLLYAA  363

Query  339  L  337
            L
Sbjct  364  L  364



>ref|XP_006410551.1| hypothetical protein EUTSA_v10016785mg [Eutrema salsugineum]
 gb|ESQ52004.1| hypothetical protein EUTSA_v10016785mg [Eutrema salsugineum]
Length=385

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 86/120 (72%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N++ ++T+VFFQGIS  HY G EWNEP  + C  Q  P+ GS++PG   P  +V
Sbjct  265  AQWVDQNVNTSQTRVFFQGISPTHYVGKEWNEPR-KTCDGQMVPLSGSTYPGGSLPAASV  323

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   VYLLDI  L+QLRKD HPS+Y G G +DCSHWC+ G+PD+WNQ+LY+ +
Sbjct  324  VSHVLSSMKTFVYLLDITTLSQLRKDAHPSSYGGDGGLDCSHWCLPGLPDTWNQLLYAAI  383



>ref|XP_009365268.1| PREDICTED: protein trichome birefringence-like 43 [Pyrus x bretschneideri]
Length=384

 Score =   144 bits (363),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 91/125 (73%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+N++  KT+VFFQG+S  H +G+EW E A + C  QT+P+    +P   +P E V
Sbjct  256  ARWVDTNLESTKTRVFFQGVSPDHNNGSEWGEAASKHCEGQTQPMVRDDYPAGSHPAEVV  315

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            V+ VL +M+N V+LL++  L+QLRKDGHPS Y  G    +DCSHWC+AGVPD+WNQ+LY+
Sbjct  316  VERVLRSMSNPVHLLNVTTLSQLRKDGHPSVYGHGGHRDMDCSHWCLAGVPDTWNQLLYA  375

Query  342  ILIQN  328
             LI++
Sbjct  376  SLIES  380



>ref|XP_010052993.1| PREDICTED: protein trichome birefringence-like 38 [Eucalyptus 
grandis]
 gb|KCW89680.1| hypothetical protein EUGRSUZ_A01950 [Eucalyptus grandis]
Length=362

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 86/125 (69%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD NIDP  TKVFFQG+S VH +  +W +P  +DCR QT+P+ GSS+P    P EA+
Sbjct  238  AQWVDLNIDPKATKVFFQGVSPVHSNSRDWGDPRAKDCRAQTQPMLGSSYPVGTNPAEAI  297

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            V+ VL  M+  V LL+I  L+ LRKDGH   +  G    +DCSHWC+ GVPD+WN +LY+
Sbjct  298  VEKVLRGMSKPVQLLNITTLSALRKDGHVGVFGYGGPKAIDCSHWCLPGVPDTWNLLLYA  357

Query  342  ILIQN  328
             LIQN
Sbjct  358  SLIQN  362



>ref|XP_007022285.1| Trichome birefringence-like 38 [Theobroma cacao]
 gb|EOY13810.1| Trichome birefringence-like 38 [Theobroma cacao]
Length=367

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 87/121 (72%), Gaps = 1/121 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDS++D +++KV FQGIS  HY+G EWNEP V++C  +  P  GS +P        V
Sbjct  246  AKWVDSDVDTSRSKVIFQGISPSHYNGTEWNEPGVRNCSREMIPFNGSVYPVGLPQAAYV  305

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYSIL  337
            VK VLG+M   V+LLDI  L+QLRKD HPS+Y G   +DC+HWCVAG+PD+WNQ+LY+ L
Sbjct  306  VKEVLGSMKKPVHLLDITSLSQLRKDAHPSSYNGFKGMDCTHWCVAGLPDTWNQLLYAAL  365

Query  336  I  334
            I
Sbjct  366  I  366



>ref|XP_009143811.1| PREDICTED: protein trichome birefringence-like 37 [Brassica rapa]
Length=382

 Score =   144 bits (362),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 85/120 (71%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N++ ++T+VFFQGIS  HY G EWNEP ++ C  Q +P+ GS++PG   P  ++
Sbjct  262  AQWVDQNVNTSQTRVFFQGISPTHYVGKEWNEP-MKTCNGQMQPLTGSTYPGGSLPAASI  320

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA-GGVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   VYLLDI  L+QLRKD HPS Y   G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  321  VSRVLRSMKTPVYLLDITTLSQLRKDAHPSIYGVTGRTDCSHWCLPGLPDTWNQLLYAAL  380



>gb|KDO83226.1| hypothetical protein CISIN_1g017346mg [Citrus sinensis]
Length=373

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDS++D  KT V FQG+S  HY+G EW+EP V +C ++ +PI GS +PG       V
Sbjct  250  AKWVDSDVDTTKTTVIFQGVSPSHYNGTEWDEPEVTNCANEKQPIVGSKYPGGLPEAALV  309

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            VK VL  +   V+LLDI  L+QLRKD HPS++ G   +DC+HWCVAG+PD+WNQ+LY+ L
Sbjct  310  VKDVLRTVKKPVHLLDITTLSQLRKDAHPSSFNGFKAMDCTHWCVAGLPDTWNQLLYTAL  369

Query  336  IQN  328
            + N
Sbjct  370  VNN  372



>ref|XP_006482975.1| PREDICTED: protein YLS7-like [Citrus sinensis]
Length=373

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 87/123 (71%), Gaps = 1/123 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDS++D  KT V FQG+S  HY+G EW+EP V +C ++ +PI GS +PG       V
Sbjct  250  AKWVDSDVDTTKTTVIFQGVSPSHYNGTEWDEPEVTNCANEKQPIVGSKYPGGLPEAALV  309

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            VK VL  +   V+LLDI  L+QLRKD HPS++ G   +DC+HWCVAG+PD+WNQ+LY+ L
Sbjct  310  VKDVLRTVKKPVHLLDITTLSQLRKDAHPSSFNGFKAMDCTHWCVAGLPDTWNQLLYTAL  369

Query  336  IQN  328
            + N
Sbjct  370  VNN  372



>gb|KHF98470.1| Transmembrane protein [Gossypium arboreum]
Length=280

 Score =   142 bits (357),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 86/122 (70%), Gaps = 2/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVD+N+DPN TKVFFQGIS  HY G EWN+P  ++C  + +P+ G ++P    P  AV
Sbjct  160  ANWVDNNVDPNITKVFFQGISPTHYEGREWNQPN-KNCNGELEPLSGPTYPAGAPPAAAV  218

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VLG M N VYLLDI  L+QLRKD HPSTY G    DCSHWC+ G+PD+WN +LY+ L
Sbjct  219  VNKVLGTMKNPVYLLDITTLSQLRKDAHPSTYGGLSGNDCSHWCLPGLPDTWNHLLYAAL  278

Query  336  IQ  331
              
Sbjct  279  FM  280



>emb|CDY17219.1| BnaA05g09690D [Brassica napus]
Length=382

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 85/120 (71%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N++ ++T+VFFQGIS  HY G EWNEP ++ C  Q +P+ GS++PG   P  ++
Sbjct  262  AQWVDQNVNTSQTRVFFQGISPTHYVGKEWNEP-MKTCNGQMQPLTGSTYPGGSLPAASI  320

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA-GGVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   VYLLDI  L+QLRKD HPS Y   G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  321  VSRVLRSMKTPVYLLDITTLSQLRKDAHPSIYGVTGRTDCSHWCLPGLPDTWNQLLYAAL  380



>ref|XP_006852470.2| PREDICTED: protein trichome birefringence-like 38 [Amborella 
trichopoda]
Length=371

 Score =   144 bits (362),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 84/120 (70%), Gaps = 1/120 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVDSN+ P +TKV+FQGIS  HY  NEW++   +DC  QT+P+ GS++PG       V
Sbjct  250  ANWVDSNVMPMRTKVYFQGISPTHYSANEWHDGRYKDCYGQTQPLSGSTYPGSLPDQLGV  309

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA-GGVVDCSHWCVAGVPDSWNQILYSIL  337
            +K V+ +MT   YLLDI  L+QLRKD HPS Y      DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  310  IKNVIKSMTKPAYLLDITTLSQLRKDAHPSIYGLMSARDCSHWCLPGLPDTWNQLLYTAL  369



>gb|KHN08449.1| hypothetical protein glysoja_014214 [Glycine soja]
Length=364

 Score =   143 bits (361),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 86/123 (70%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WV+ N+DP+KTKVFFQGIS  HY G +WN+P  + C  + +PI GS++P    P    
Sbjct  243  AKWVEQNVDPSKTKVFFQGISPGHYQGKDWNQPK-KTCSGELQPISGSAYPAGLPPATTT  301

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            +  VL  M+  VYLLDI LL+QLRKD HPS Y+G     DCSHWC+ G+PD+WNQ+LY++
Sbjct  302  LNNVLRKMSTPVYLLDITLLSQLRKDAHPSAYSGSHKGNDCSHWCLPGLPDTWNQLLYAV  361

Query  339  LIQ  331
            L +
Sbjct  362  LTR  364



>ref|XP_009104567.1| PREDICTED: protein trichome birefringence-like 42 [Brassica rapa]
Length=362

 Score =   143 bits (361),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 92/125 (74%), Gaps = 5/125 (4%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD NIDP+KT+VF+QG+S VH +G++W EP  + C  +T+P+EGS++P     GE +
Sbjct  239  AKWVDQNIDPSKTRVFYQGVSPVHLNGSDWGEPG-KSCLGETEPVEGSNYP-HTNEGEDI  296

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            VK V+  M   V LLD+  +T+LRKDGHPS YAGG   + DCSHWC+ G+PD+WNQ+LY+
Sbjct  297  VKSVIRGMAKPVSLLDVTTMTELRKDGHPSIYAGGGSKLNDCSHWCLPGLPDAWNQLLYT  356

Query  342  ILIQN  328
             L+ N
Sbjct  357  DLLGN  361



>ref|XP_003569466.1| PREDICTED: protein trichome birefringence-like 38 [Brachypodium 
distachyon]
Length=385

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 87/122 (71%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDS +D +KTKV+FQGIS  HY+G +W E + + C  QT+PI G ++PG   P +  
Sbjct  264  ARWVDSKVDTSKTKVYFQGISPTHYNGAQWGE-SSRSCAQQTQPITGPAYPGGPLPAQGA  322

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            V+  L  M+  V+LLDI LL+QLR+D HPS Y+G     DCSHWC+AG+PD+WNQILY+ 
Sbjct  323  VRRALSGMSKPVFLLDITLLSQLRRDAHPSAYSGQHPGNDCSHWCLAGLPDTWNQILYAS  382

Query  339  LI  334
            L+
Sbjct  383  LL  384



>ref|XP_004488994.1| PREDICTED: uncharacterized protein LOC101512890 [Cicer arietinum]
Length=368

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 86/123 (70%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+NIDP K +VFFQGIS  HY+G+ WNEP+ + C  +  P+ GS++PG   P   V
Sbjct  246  AAWVDANIDPAKVQVFFQGISPSHYNGSLWNEPSAKSCIREKTPVAGSTYPGGLPPAVDV  305

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTY---AGGVVDCSHWCVAGVPDSWNQILYS  343
            +K VL  +   V LLDI  L+ LRKDGHPS Y       +DCSHWC++GVPD+WN+ILY+
Sbjct  306  LKSVLSTIKKPVTLLDITTLSLLRKDGHPSIYGLFGAKGMDCSHWCLSGVPDTWNEILYN  365

Query  342  ILI  334
            I+I
Sbjct  366  III  368



>ref|XP_003542986.1| PREDICTED: protein YLS7-like isoform X1 [Glycine max]
Length=375

 Score =   143 bits (361),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 86/123 (70%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WV+ N+DP+KTKVFFQGIS  HY G +WN+P  + C  + +PI GS++P    P    
Sbjct  254  AKWVEQNVDPSKTKVFFQGISPGHYQGKDWNQPK-KTCSGELQPISGSAYPAGLPPATTT  312

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            +  VL  M+  VYLLDI LL+QLRKD HPS Y+G     DCSHWC+ G+PD+WNQ+LY++
Sbjct  313  LNNVLRKMSTPVYLLDITLLSQLRKDAHPSAYSGSHKGNDCSHWCLPGLPDTWNQLLYAV  372

Query  339  LIQ  331
            L +
Sbjct  373  LTR  375



>ref|XP_004229288.2| PREDICTED: protein trichome birefringence-like 41 isoform X1 
[Solanum lycopersicum]
Length=372

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 2/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WV+ +ID  KTKVF+QG SA HYHG+EW +P V++C ++T+P+ GS++P        +
Sbjct  243  AKWVERDIDTKKTKVFYQGASATHYHGSEWGKPEVKNCFNETRPVRGSTYPSGLPIPVNI  302

Query  513  VKGVLGNMTNSVY-LLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSI  340
            VK VL NM+  +  LLDI  LTQLRKDGHPS Y G    DC+HWC+ GVPD+WNQILY++
Sbjct  303  VKQVLQNMSKPIVNLLDITKLTQLRKDGHPSIYNGIHGFDCTHWCIGGVPDTWNQILYAL  362

Query  339  LI  334
            L 
Sbjct  363  LF  364



>ref|XP_006594557.1| PREDICTED: protein YLS7-like isoform X2 [Glycine max]
Length=390

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 86/123 (70%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WV+ N+DP+KTKVFFQGIS  HY G +WN+P  + C  + +PI GS++P    P    
Sbjct  269  AKWVEQNVDPSKTKVFFQGISPGHYQGKDWNQPK-KTCSGELQPISGSAYPAGLPPATTT  327

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            +  VL  M+  VYLLDI LL+QLRKD HPS Y+G     DCSHWC+ G+PD+WNQ+LY++
Sbjct  328  LNNVLRKMSTPVYLLDITLLSQLRKDAHPSAYSGSHKGNDCSHWCLPGLPDTWNQLLYAV  387

Query  339  LIQ  331
            L +
Sbjct  388  LTR  390



>ref|XP_009141359.1| PREDICTED: protein trichome birefringence-like 37 [Brassica rapa]
Length=384

 Score =   143 bits (361),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 85/120 (71%), Gaps = 2/120 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A W D N++ ++T+VFFQGIS  HY G EWNEP   +C  Q +P+ GS++PG   P  ++
Sbjct  264  AQWGDQNVNISQTRVFFQGISPTHYVGKEWNEPR-DNCNGQMQPLSGSTYPGGSLPAASI  322

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTY-AGGVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VL +M   VYLLDI  L+QLRKD HPSTY A G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  323  VSRVLSSMKTPVYLLDITTLSQLRKDAHPSTYGAAGGSDCSHWCLPGLPDTWNQLLYAAL  382



>gb|KHN19645.1| hypothetical protein glysoja_042542 [Glycine soja]
Length=288

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 82/125 (66%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A W+D NIDP +T+V FQG+S  H +  +W EP    C  QTKPI G  +PG   P E V
Sbjct  164  AKWIDYNIDPTRTRVLFQGVSPDHQNPAQWGEPRANFCAGQTKPISGLRYPGGPNPAEVV  223

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            ++ VL  M   VYLLDI  L+QLR DGHPS Y  G    +DCSHWC+AGVPD+WN++LY 
Sbjct  224  LEKVLKAMQKPVYLLDITTLSQLRIDGHPSVYGHGGHLDMDCSHWCLAGVPDTWNELLYV  283

Query  342  ILIQN  328
             L QN
Sbjct  284  SLFQN  288



>ref|XP_003545134.1| PREDICTED: protein YLS7-like [Glycine max]
Length=355

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 87/125 (70%), Gaps = 4/125 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WV+ N+DPNKT+VFFQG+S  H +G +W EP    C  Q  P++G  +PG  +P E V
Sbjct  232  AKWVEDNVDPNKTRVFFQGVSPDHLNGAKWGEPRAS-CEEQKVPVDGFKYPGGSHPAELV  290

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            ++ VLG M+  V LL+I  L+Q+RKDGHPS Y  G    +DCSHWC+ GVPD+WN +LY+
Sbjct  291  LQKVLGAMSKRVNLLNITTLSQMRKDGHPSVYGYGGHRDMDCSHWCLPGVPDTWNLLLYA  350

Query  342  ILIQN  328
             LIQN
Sbjct  351  ALIQN  355



>gb|KJB12978.1| hypothetical protein B456_002G048200 [Gossypium raimondii]
Length=365

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 84/120 (70%), Gaps = 1/120 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            + WVDSN+DP  T+V+FQGIS  HY G +WN      C+ +T P+ G+++PG   P   V
Sbjct  237  SKWVDSNVDPRTTQVYFQGISPTHYDGRQWNGSISATCKGETTPLNGTTYPGGLPPAVDV  296

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYSIL  337
            VK VL NM+  V LLDI  L+ LRKDGHPS Y G    DCSHWC+AGVPDSWN+ILY++L
Sbjct  297  VKQVLKNMSKGVTLLDITTLSLLRKDGHPSVYFGKEGNDCSHWCLAGVPDSWNEILYALL  356



>ref|XP_010093464.1| hypothetical protein L484_017525 [Morus notabilis]
 gb|EXB54088.1| hypothetical protein L484_017525 [Morus notabilis]
Length=281

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 84/128 (66%), Gaps = 6/128 (5%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGN---EWNEPAVQDCRHQTKPIEGSSFPGERYPG  523
            + WVDSNIDPNKT VFFQGIS  HY GN   EWN+     C+ Q++P  GS++PG   P 
Sbjct  153  SEWVDSNIDPNKTTVFFQGISPTHYSGNSGEEWNDSKSATCKGQSEPESGSTYPGGWPPA  212

Query  522  EAVVKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV---DCSHWCVAGVPDSWNQI  352
              +   VL  M+  V LL+I  L+QLRKDGHPS Y  G     DCSHWC+ GVPD+WN +
Sbjct  213  ATIEDQVLSKMSTPVTLLNITTLSQLRKDGHPSAYGFGGPKGNDCSHWCLPGVPDTWNAL  272

Query  351  LYSILIQN  328
            LY+IL  N
Sbjct  273  LYAILFSN  280



>gb|KJB12977.1| hypothetical protein B456_002G048200 [Gossypium raimondii]
Length=366

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 84/120 (70%), Gaps = 1/120 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            + WVDSN+DP  T+V+FQGIS  HY G +WN      C+ +T P+ G+++PG   P   V
Sbjct  238  SKWVDSNVDPRTTQVYFQGISPTHYDGRQWNGSISATCKGETTPLNGTTYPGGLPPAVDV  297

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYSIL  337
            VK VL NM+  V LLDI  L+ LRKDGHPS Y G    DCSHWC+AGVPDSWN+ILY++L
Sbjct  298  VKQVLKNMSKGVTLLDITTLSLLRKDGHPSVYFGKEGNDCSHWCLAGVPDSWNEILYALL  357



>ref|XP_003537664.1| PREDICTED: protein YLS7-like [Glycine max]
Length=364

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 89/120 (74%), Gaps = 1/120 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWV++ +D NKTKV FQGIS  HY+G  WNEP V++C  +T+PI GS++P        V
Sbjct  243  ANWVNAEVDTNKTKVLFQGISPSHYNGTGWNEPGVRNCSKETQPISGSTYPNGLPAALFV  302

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYSIL  337
            ++ VL N+T  V+LL+I  L+QLRKD HPS+Y G   +DC+HWCVAG+PD+WNQ+LY+ +
Sbjct  303  LEDVLKNITKPVHLLNITTLSQLRKDAHPSSYNGFRGMDCTHWCVAGLPDTWNQLLYAAI  362



>ref|XP_010064517.1| PREDICTED: protein trichome birefringence-like 42 [Eucalyptus 
grandis]
Length=548

 Score =   145 bits (365),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 87/124 (70%), Gaps = 3/124 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            + W+D +IDP  T+VFFQGISA H++G +WNE + + C+ QT+P+ GS +PG   P E +
Sbjct  215  SRWIDGHIDPLSTQVFFQGISAAHFNGQDWNETSEKTCKGQTQPVLGSVYPGPSIPAEGI  274

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG---GVVDCSHWCVAGVPDSWNQILYS  343
            +  VL  M     LLD+ LLTQLRKDGHPS Y G      DCSHWC+AGVPD+ N++LY+
Sbjct  275  LSNVLSMMEKPAKLLDVTLLTQLRKDGHPSIYTGQAESTDDCSHWCLAGVPDTCNELLYT  334

Query  342  ILIQ  331
             L++
Sbjct  335  TLLK  338



>gb|ACU19344.1| unknown [Glycine max]
 gb|KHN41859.1| hypothetical protein glysoja_003599 [Glycine soja]
Length=364

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 89/120 (74%), Gaps = 1/120 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWV++ +D NKTKV FQGIS  HY+G  WNEP V++C  +T+PI GS++P        V
Sbjct  243  ANWVNAEVDTNKTKVLFQGISPSHYNGTGWNEPGVRNCSKETQPISGSTYPNGLPAALFV  302

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYSIL  337
            ++ VL N+T  V+LL+I  L+QLRKD HPS+Y G   +DC+HWCVAG+PD+WNQ+LY+ +
Sbjct  303  LEDVLKNITKPVHLLNITTLSQLRKDAHPSSYNGFRGMDCTHWCVAGLPDTWNQLLYAAI  362



>ref|XP_002282459.1| PREDICTED: protein trichome birefringence-like 43 [Vitis vinifera]
Length=361

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 87/123 (71%), Gaps = 4/123 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              W+DSNID +KT+VFFQGIS  H  G++WNEP    CR QT+ ++G+ +PG   P + V
Sbjct  237  GRWIDSNIDSSKTQVFFQGISPDHSSGSDWNEPKA-SCRGQTRAVQGTKYPGGSNPAQVV  295

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV---DCSHWCVAGVPDSWNQILYS  343
            V+ VL  M+  VYLL++  L+QLRKDGHPS Y  G     DCSHWC+ GVPD+WNQ+LY+
Sbjct  296  VEQVLSQMSKPVYLLNVTSLSQLRKDGHPSIYGYGGKRGNDCSHWCLPGVPDTWNQLLYA  355

Query  342  ILI  334
             LI
Sbjct  356  SLI  358



>ref|XP_003634906.1| PREDICTED: protein trichome birefringence-like 38 [Vitis vinifera]
 ref|XP_010645687.1| PREDICTED: protein trichome birefringence-like 38 [Vitis vinifera]
 emb|CBI17736.3| unnamed protein product [Vitis vinifera]
Length=367

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 88/121 (73%), Gaps = 1/121 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD  +D  KT+VFFQGIS  HY+G EW +P V +C  +T+PI GS++P    P   V
Sbjct  246  AKWVDLEVDLTKTQVFFQGISPSHYNGKEWGKPGVTNCSKETQPISGSTYPAGLPPASHV  305

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            ++ VLG+MT  ++LL++  L+QLRKD HPSTY G G +DC+HWC+ G+ D+WNQ+LY+ L
Sbjct  306  LEEVLGSMTKPIHLLNVTNLSQLRKDAHPSTYNGLGNMDCTHWCLPGLLDTWNQLLYTTL  365

Query  336  I  334
            I
Sbjct  366  I  366



>gb|KDO77820.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=366

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 86/121 (71%), Gaps = 3/121 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+DP++TKVFFQGIS  HY G EWN    ++C  + +P+ GS++PG   P  +V
Sbjct  245  ARWVDLNVDPSQTKVFFQGISPTHYTGKEWNSRK-KNCLGELEPLSGSTYPGGAPPAASV  303

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG--GVVDCSHWCVAGVPDSWNQILYSI  340
            V  VL ++   VYLLDI  L+QLRKD HPSTY+G     DCSHWC+ G+PD+WNQ+LY+ 
Sbjct  304  VNKVLSSINKPVYLLDITTLSQLRKDAHPSTYSGKHSGTDCSHWCLPGLPDTWNQLLYAA  363

Query  339  L  337
            L
Sbjct  364  L  364



>ref|XP_004229160.1| PREDICTED: protein trichome birefringence-like 38 [Solanum lycopersicum]
Length=349

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 88/122 (72%), Gaps = 2/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWV++++D  KTKVFFQG S  HYHG+EW EP V +C ++T P++GS++P        +
Sbjct  228  ANWVETDVDTTKTKVFFQGASPAHYHGSEWGEPTVNNCLNETTPVKGSTYPSGLPIPVNI  287

Query  513  VKGVLGNMTNSVY-LLDIALLTQLRKDGHPSTYAGG-VVDCSHWCVAGVPDSWNQILYSI  340
            VK  L NM+  +  LLDI  L+QLRKDGHPS Y G   +DC+HWC+ GVPD+WNQILY+ 
Sbjct  288  VKQELQNMSKQIVNLLDITKLSQLRKDGHPSKYNGNHGMDCTHWCIGGVPDTWNQILYAS  347

Query  339  LI  334
            LI
Sbjct  348  LI  349



>gb|KDO77822.1| hypothetical protein CISIN_1g017263mg [Citrus sinensis]
Length=368

 Score =   143 bits (360),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 86/121 (71%), Gaps = 3/121 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD N+DP++TKVFFQGIS  HY G EWN    ++C  + +P+ GS++PG   P  +V
Sbjct  247  ARWVDLNVDPSQTKVFFQGISPTHYTGKEWNSRK-KNCLGELEPLSGSTYPGGAPPAASV  305

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG--GVVDCSHWCVAGVPDSWNQILYSI  340
            V  VL ++   VYLLDI  L+QLRKD HPSTY+G     DCSHWC+ G+PD+WNQ+LY+ 
Sbjct  306  VNKVLSSINKPVYLLDITTLSQLRKDAHPSTYSGKHSGTDCSHWCLPGLPDTWNQLLYAA  365

Query  339  L  337
            L
Sbjct  366  L  366



>ref|XP_010272737.1| PREDICTED: protein trichome birefringence-like 41 isoform X1 
[Nelumbo nucifera]
Length=371

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/122 (52%), Positives = 90/122 (74%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WV++N+DP KTKV FQGIS  HY+G+EWN P +  C  Q +P+E S        GEA+
Sbjct  244  AKWVEANVDPLKTKVLFQGISPAHYNGSEWNAPRMTTCFRQIRPVESSDQLQGSSEGEAL  303

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPS---TYAGGVVDCSHWCVAGVPDSWNQILYS  343
            V+ +L +M+  VYLLD+ +L++LRKDGHPS   +Y+   +DCSHWC++GVPD+WN++LY+
Sbjct  304  VQKMLSSMSTPVYLLDVTMLSRLRKDGHPSIYTSYSHTGMDCSHWCLSGVPDAWNELLYA  363

Query  342  IL  337
            +L
Sbjct  364  VL  365



>ref|XP_007021950.1| Trichome birefringence-like 41 [Theobroma cacao]
 gb|EOY13475.1| Trichome birefringence-like 41 [Theobroma cacao]
Length=356

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 88/123 (72%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+NIDP K+ VFFQGIS  HY+G+ WNEP  ++C  Q +P+ G+++PG   P   V
Sbjct  234  ARWVDANIDPAKSLVFFQGISPSHYNGSSWNEPNAKNCLGQKQPLLGTTYPGGLPPALDV  293

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG---GVVDCSHWCVAGVPDSWNQILYS  343
            +K VL  +   V LLDI +L+ LRKDGHPS Y       +DCSHWC+AGVPD+WN+ILY+
Sbjct  294  LKKVLSTVKKPVKLLDITMLSLLRKDGHPSMYGREGPTGMDCSHWCLAGVPDTWNEILYN  353

Query  342  ILI  334
            +++
Sbjct  354  LIL  356



>ref|XP_009359359.1| PREDICTED: protein trichome birefringence-like 37 isoform X1 
[Pyrus x bretschneideri]
Length=358

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 84/123 (68%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            + WVD N+D + TKVFFQGIS  HY+G EWN      C  QT+P+ GS +PG   P   V
Sbjct  232  SKWVDYNVDFSNTKVFFQGISPTHYNGKEWNGSDSATCNGQTQPVRGSIYPGGSPPAATV  291

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTY---AGGVVDCSHWCVAGVPDSWNQILYS  343
            V  VL  MT++V LLDI LL+QLRKDGHPSTY        DCSHWC+AGVPD+WN++ Y+
Sbjct  292  VNQVLTAMTSAVILLDITLLSQLRKDGHPSTYGIDGKKGNDCSHWCLAGVPDTWNELFYA  351

Query  342  ILI  334
             L+
Sbjct  352  TLV  354



>ref|XP_007215869.1| hypothetical protein PRUPE_ppa010517mg [Prunus persica]
 gb|EMJ17068.1| hypothetical protein PRUPE_ppa010517mg [Prunus persica]
Length=247

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 87/126 (69%), Gaps = 4/126 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQD-CRHQTKPIEGSSFPGERYPGEA  517
            A WV+S++DP+KTKVFFQG+S  H    EW + A  + C  QT P+ G+ +PG  +P + 
Sbjct  122  ARWVESSVDPSKTKVFFQGVSPDHMRSREWGDSAKSETCFGQTAPVLGTQYPGGSHPAQV  181

Query  516  VVKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILY  346
            +++ VL  M+  VYLL+I  L+QLRKDGHPS Y  G    +DC+HWC+ G+PDSWNQIL+
Sbjct  182  ILERVLRTMSKPVYLLNITTLSQLRKDGHPSFYGFGGRRSIDCTHWCLPGIPDSWNQILF  241

Query  345  SILIQN  328
            + L Q 
Sbjct  242  AALFQR  247



>gb|KCW67609.1| hypothetical protein EUGRSUZ_F01364 [Eucalyptus grandis]
Length=537

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 87/124 (70%), Gaps = 3/124 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            + W+D +IDP  T+VFFQGISA H++G +WNE + + C+ QT+P+ GS +PG   P E +
Sbjct  204  SRWIDGHIDPLSTQVFFQGISAAHFNGQDWNETSEKTCKGQTQPVLGSVYPGPSIPAEGI  263

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG---GVVDCSHWCVAGVPDSWNQILYS  343
            +  VL  M     LLD+ LLTQLRKDGHPS Y G      DCSHWC+AGVPD+ N++LY+
Sbjct  264  LSNVLSMMEKPAKLLDVTLLTQLRKDGHPSIYTGQAESTDDCSHWCLAGVPDTCNELLYT  323

Query  342  ILIQ  331
             L++
Sbjct  324  TLLK  327



>gb|ERN13934.1| hypothetical protein AMTR_s00021p00122990 [Amborella trichopoda]
Length=432

 Score =   143 bits (361),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 84/120 (70%), Gaps = 1/120 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWVDSN+ P +TKV+FQGIS  HY  NEW++   +DC  QT+P+ GS++PG       V
Sbjct  311  ANWVDSNVMPMRTKVYFQGISPTHYSANEWHDGRYKDCYGQTQPLSGSTYPGSLPDQLGV  370

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA-GGVVDCSHWCVAGVPDSWNQILYSIL  337
            +K V+ +MT   YLLDI  L+QLRKD HPS Y      DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  371  IKNVIKSMTKPAYLLDITTLSQLRKDAHPSIYGLMSARDCSHWCLPGLPDTWNQLLYTAL  430



>emb|CDY30832.1| BnaC05g22080D [Brassica napus]
Length=376

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/121 (56%), Positives = 81/121 (67%), Gaps = 2/121 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              WVD N+D  KTKVFFQGIS  HY G EWNEP  + C  Q +P+ GS++P  +     V
Sbjct  256  GRWVDQNVDTTKTKVFFQGISPTHYEGREWNEPR-KSCTGQMQPLGGSNYPSGQPASAGV  314

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            V  VLG M   V LLDI  L+QLRKD HPSTY G G  DCSHWC+ G+PD+WNQ+LY+ L
Sbjct  315  VSKVLGAMKTRVSLLDITTLSQLRKDAHPSTYGGDGGNDCSHWCLPGLPDTWNQLLYAAL  374

Query  336  I  334
             
Sbjct  375  F  375



>ref|XP_006358930.1| PREDICTED: uncharacterized protein LOC102599643 [Solanum tuberosum]
Length=251

 Score =   139 bits (351),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 83/123 (67%), Gaps = 1/123 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A W+D+NI+P KT +FFQGIS  HY+G  WNEP V+ C  Q +PI GS++PG   P   V
Sbjct  129  AKWIDTNINPAKTLLFFQGISPSHYNGTNWNEPGVKTCLGQRQPISGSTYPGGLPPALTV  188

Query  513  VKGVLGN-MTNSVYLLDIALLTQLRKDGHPSTYAGGVVDCSHWCVAGVPDSWNQILYSIL  337
            +K VL   M   V LLD+  L  LRKDGHPS Y    +DCSHWC+ GVPD WNQILY+ +
Sbjct  189  LKKVLYTLMEKPVTLLDVTNLCLLRKDGHPSIYGLTGMDCSHWCLPGVPDIWNQILYNFI  248

Query  336  IQN  328
            + +
Sbjct  249  VTS  251



>ref|XP_009370960.1| PREDICTED: protein trichome birefringence-like 43 [Pyrus x bretschneideri]
Length=365

 Score =   142 bits (358),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 89/125 (71%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WV +N +  KT+VFFQG+S  H +G+EW E     C  QT+P+ G ++P   +P E V
Sbjct  229  ARWVATNSESTKTRVFFQGVSPDHNNGSEWGEATSSQCEGQTQPMSGDAYPAGSHPAEVV  288

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            V+ VL +M+N V+LL++  L+QLRKDGHPS Y  G    +DCSHWC+AGVPD+WNQ+LY+
Sbjct  289  VERVLRSMSNPVHLLNVTTLSQLRKDGHPSVYGHGGHRDMDCSHWCLAGVPDTWNQLLYA  348

Query  342  ILIQN  328
             LI++
Sbjct  349  SLIKS  353



>ref|XP_006367983.1| PREDICTED: uncharacterized protein LOC102605300 [Solanum tuberosum]
Length=238

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 87/122 (71%), Gaps = 2/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WV+ +I+  KTKVF+QG SA HYHG+EW EP V++C ++T+P+ GS++P        +
Sbjct  109  AKWVERDINTKKTKVFYQGASATHYHGSEWGEPEVKNCFNETRPVRGSTYPSGLPIPVDI  168

Query  513  VKGVLGNMTNSVY-LLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSI  340
            VK VL NM+  +  LLDI  LTQLRKDGHPS Y G   +DC+HWC+ GVPD+WN ILY+ 
Sbjct  169  VKQVLKNMSKPIVNLLDITKLTQLRKDGHPSIYNGIHGLDCTHWCIGGVPDTWNNILYAS  228

Query  339  LI  334
            L 
Sbjct  229  LF  230



>ref|XP_009354247.1| PREDICTED: protein trichome birefringence-like 43 [Pyrus x bretschneideri]
Length=365

 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 89/125 (71%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WV +N +  KT+VFFQG+S  H +G+EW E     C  QT+P+ G ++P   +P E V
Sbjct  229  ARWVATNSESTKTRVFFQGVSPDHNNGSEWGEATSSQCEGQTQPMSGDAYPAGSHPAEVV  288

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            V+ VL +M+N V+LL++  L+QLRKDGHPS Y  G    +DCSHWC+AGVPD+WNQ+LY+
Sbjct  289  VERVLRSMSNPVHLLNVTTLSQLRKDGHPSVYGHGGHRDMDCSHWCLAGVPDTWNQLLYA  348

Query  342  ILIQN  328
             LI++
Sbjct  349  SLIKS  353



>ref|XP_003543193.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN36928.1| hypothetical protein glysoja_001659 [Glycine soja]
Length=344

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 82/120 (68%), Gaps = 3/120 (3%)
 Frame = -2

Query  687  WVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAVVK  508
            WVD+N+DP + KVFFQGIS  HY+G+ WNEP V  C  Q  P+ GS +PG   P  AV+K
Sbjct  225  WVDANVDPTRVKVFFQGISPSHYNGSLWNEPGVTSCVRQKTPVPGSIYPGGLPPAVAVLK  284

Query  507  GVLGNMTNSVYLLDIALLTQLRKDGHPSTY---AGGVVDCSHWCVAGVPDSWNQILYSIL  337
             VL  +   V LLDI  L+ LRKDGHPS Y       +DCSHWC+ GVPD+WN+ILY+++
Sbjct  285  SVLSTIRKPVTLLDITTLSLLRKDGHPSIYGLTGAAGMDCSHWCLPGVPDTWNEILYNLI  344



>gb|KHN32337.1| hypothetical protein glysoja_032520 [Glycine soja]
Length=371

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 82/121 (68%), Gaps = 3/121 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD NID NKTKV FQGIS  HY G EWN+P  + C  + +P+ GS++P    P   +
Sbjct  250  AGWVDQNIDLNKTKVLFQGISPTHYQGQEWNQPR-KSCSGELEPLAGSTYPAGLPPAANI  308

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            V  VL NM N VYLLDI LL+QLRKD HPS Y       DCSHWC+ G+PD+WN++LY+ 
Sbjct  309  VNKVLKNMKNQVYLLDITLLSQLRKDAHPSVYGVDHTGNDCSHWCLPGLPDTWNELLYAA  368

Query  339  L  337
            L
Sbjct  369  L  369



>ref|XP_010547339.1| PREDICTED: protein trichome birefringence-like 40 isoform X3 
[Tarenaya hassleriana]
Length=252

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 84/121 (69%), Gaps = 1/121 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              WV+S ++   TK+FFQGIS  HY+G+EWNEP V +C  + +P++GS++PG +     V
Sbjct  131  TRWVNSQVNATSTKIFFQGISPSHYNGSEWNEPGVTNCLREEQPVDGSTYPGGKPMAATV  190

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSIL  337
            ++  L  + N V LLDI LL+QLRKD HPS Y G   +DC+HWCV G+PD WNQ+L++ L
Sbjct  191  LRSALAPVRNKVQLLDITLLSQLRKDAHPSRYNGFKSMDCTHWCVPGLPDIWNQLLFASL  250

Query  336  I  334
             
Sbjct  251  F  251



>ref|XP_003518885.1| PREDICTED: protein YLS7-like [Glycine max]
Length=371

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 82/121 (68%), Gaps = 3/121 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD NID NKTKV FQGIS  HY G EWN+P  + C  + +P+ GS++P    P   +
Sbjct  250  AGWVDQNIDLNKTKVLFQGISPTHYQGQEWNQPR-KSCSGELEPLAGSTYPAGLPPAANI  308

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGVV--DCSHWCVAGVPDSWNQILYSI  340
            V  VL NM N VYLLDI LL+QLRKD HPS Y       DCSHWC+ G+PD+WN++LY+ 
Sbjct  309  VNKVLKNMKNQVYLLDITLLSQLRKDAHPSVYGVDHTGNDCSHWCLPGLPDTWNELLYAA  368

Query  339  L  337
            L
Sbjct  369  L  369



>ref|XP_009804651.1| PREDICTED: protein trichome birefringence-like 41 isoform X1 
[Nicotiana sylvestris]
Length=350

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 85/122 (70%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A W+D+NI P KT VFFQGIS  HY+G +WN+P V+ C  Q +P+ GS++PG   P   V
Sbjct  228  AKWIDTNIYPAKTMVFFQGISPSHYNGTDWNQPGVKTCLGQRQPVSGSTYPGGLPPALTV  287

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            +K VL  +   V LLD+  L  LRKDGHPS Y  G    +DCSHWC+AGVPD+WNQILY+
Sbjct  288  LKNVLSTIEKPVTLLDVTNLCLLRKDGHPSIYGLGGRTGMDCSHWCLAGVPDTWNQILYN  347

Query  342  IL  337
            ++
Sbjct  348  LV  349



>ref|XP_008365735.1| PREDICTED: LOW QUALITY PROTEIN: protein trichome birefringence-like 
41 [Malus domestica]
Length=220

 Score =   138 bits (348),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 4/124 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQD-CRHQTKPIEGSSFPGERYPGEA  517
            A WVDSNIDP K++VFFQGIS  HY+G+EW EP  +  C  + +P+ GS++PG   P  +
Sbjct  97   AGWVDSNIDPAKSRVFFQGISPSHYNGSEWQEPKARSLCXGKKEPLLGSTYPGGLPPALS  156

Query  516  VVKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILY  346
            V+K VL  +   V LLDI  L+ LRKDGHPS Y  G    +DCSHWC+ GVPD+WN+ILY
Sbjct  157  VLKNVLSTIKKPVTLLDITNLSLLRKDGHPSIYGLGGRTGMDCSHWCLCGVPDTWNEILY  216

Query  345  SILI  334
            + ++
Sbjct  217  NFIL  220



>ref|XP_008783903.1| PREDICTED: protein trichome birefringence-like 38 [Phoenix dactylifera]
Length=358

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 85/123 (69%), Gaps = 2/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDS+I P  TKVF+QGIS  HYHG +W     + C  Q++P+  S++PG   P EA+
Sbjct  236  ARWVDSSIIPATTKVFYQGISPSHYHGEDWGASYKESCSRQSEPLNASTYPGGPAPQEAI  295

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTY--AGGVVDCSHWCVAGVPDSWNQILYSI  340
            VK VL  ++  VYLLDI  L+QLRKD HPS Y   G   DCSHWC+ G+PD+WNQ++Y+ 
Sbjct  296  VKNVLSTISKPVYLLDITFLSQLRKDAHPSKYDGVGFQNDCSHWCLPGLPDTWNQLMYAA  355

Query  339  LIQ  331
            +++
Sbjct  356  VMR  358



>gb|KHN19485.1| hypothetical protein glysoja_026100 [Glycine soja]
Length=408

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 83/120 (69%), Gaps = 3/120 (3%)
 Frame = -2

Query  687  WVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAVVK  508
            WVD+N+DP + KVFFQGIS  HY+G+ WNEP+   C  Q  P+ GS++PG   P  AV+K
Sbjct  289  WVDANVDPTRVKVFFQGISPSHYNGSLWNEPSATSCIRQKTPVPGSTYPGGLPPAVAVLK  348

Query  507  GVLGNMTNSVYLLDIALLTQLRKDGHPSTY---AGGVVDCSHWCVAGVPDSWNQILYSIL  337
             VL  +   V LLDI  L+ LRKDGHPS Y       +DCSHWC+ GVPD+WN+ILY+++
Sbjct  349  SVLSTIRKPVTLLDITTLSLLRKDGHPSIYGLTGAAGMDCSHWCLPGVPDTWNEILYNLI  408



>ref|XP_003540507.2| PREDICTED: protein YLS7-like [Glycine max]
Length=407

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 83/120 (69%), Gaps = 3/120 (3%)
 Frame = -2

Query  687  WVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAVVK  508
            WVD+N+DP + KVFFQGIS  HY+G+ WNEP+   C  Q  P+ GS++PG   P  AV+K
Sbjct  288  WVDANVDPTRVKVFFQGISPSHYNGSLWNEPSATSCIRQKTPVPGSTYPGGLPPAVAVLK  347

Query  507  GVLGNMTNSVYLLDIALLTQLRKDGHPSTY---AGGVVDCSHWCVAGVPDSWNQILYSIL  337
             VL  +   V LLDI  L+ LRKDGHPS Y       +DCSHWC+ GVPD+WN+ILY+++
Sbjct  348  SVLSTIRKPVTLLDITTLSLLRKDGHPSIYGLNGAAGMDCSHWCLPGVPDTWNEILYNLI  407



>ref|XP_006602443.1| PREDICTED: protein YLS7-like [Glycine max]
Length=372

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 86/125 (69%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD NIDP +T+VFFQG+S  H +  +W EP    C  QT+PI G  +PG   P E V
Sbjct  248  AKWVDYNIDPTRTRVFFQGVSPDHQNPAQWGEPRANLCEGQTRPILGFRYPGGPLPAELV  307

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA-GGVV--DCSHWCVAGVPDSWNQILYS  343
            ++ VL  M   VYLLDI  L+QLR DGHPS Y  GG +  DCSHWC+AGVPD+WN++LY+
Sbjct  308  LEKVLRAMQKPVYLLDITTLSQLRIDGHPSVYGFGGHLDPDCSHWCLAGVPDTWNELLYA  367

Query  342  ILIQN  328
             L++N
Sbjct  368  SLVKN  372



>ref|XP_003552076.2| PREDICTED: protein YLS7-like [Glycine max]
Length=372

 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 86/125 (69%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD NIDP +T+VFFQG+S  H +  +W EP    C  QT+PI G  +PG   P E V
Sbjct  248  AKWVDYNIDPTRTRVFFQGVSPDHQNPAQWGEPRANLCEGQTRPILGFRYPGGPLPAELV  307

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYA-GGVV--DCSHWCVAGVPDSWNQILYS  343
            ++ VL  M   VYLLDI  L+QLR DGHPS Y  GG +  DCSHWC+AGVPD+WN++LY+
Sbjct  308  LEKVLRAMQKPVYLLDITTLSQLRIDGHPSVYGFGGHLDPDCSHWCLAGVPDTWNELLYA  367

Query  342  ILIQN  328
             L++N
Sbjct  368  SLVKN  372



>ref|XP_010472706.1| PREDICTED: protein trichome birefringence-like 42 [Camelina sativa]
Length=360

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 94/126 (75%), Gaps = 6/126 (5%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSS-FPGERYPGEA  517
            A W+D NIDP+KT+VF+QG+S VH +G+EW +P  + C  +T+P++GSS +PG    GEA
Sbjct  237  AKWIDHNIDPSKTRVFYQGVSPVHLNGSEWGKPG-KTCLGETEPLKGSSNYPGHNI-GEA  294

Query  516  VVKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILY  346
            +V+ V+G M   V LLD+  +T+LRKD HPS YAGG   + DCSHWC+ GVPD+WNQ+LY
Sbjct  295  IVRRVIGGMAKPVELLDLTAMTELRKDAHPSIYAGGGSRLNDCSHWCLPGVPDAWNQLLY  354

Query  345  SILIQN  328
            + L+ +
Sbjct  355  TALLSH  360



>ref|XP_002513104.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49607.1| conserved hypothetical protein [Ricinus communis]
Length=358

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 89/121 (74%), Gaps = 1/121 (1%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVDS++D NKT VFFQGIS  HY+G+EWNEP V +C  +T+PI GSS+        +V
Sbjct  237  AKWVDSDVDTNKTSVFFQGISPSHYNGSEWNEPGVTNCSKETEPISGSSYSRGSPLALSV  296

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-VDCSHWCVAGVPDSWNQILYSIL  337
            ++ VL +M   V+LL+I  L+QLRKD HPS++ G   +DC+HWC+AG+PD+WN +LY+ L
Sbjct  297  LEDVLSSMKKPVHLLNITTLSQLRKDAHPSSHNGFRGMDCTHWCIAGLPDTWNDLLYTAL  356

Query  336  I  334
            +
Sbjct  357  L  357



>gb|KDO54062.1| hypothetical protein CISIN_1g036968mg [Citrus sinensis]
Length=352

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 91/126 (72%), Gaps = 5/126 (4%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            ANWV++NIDP KT+VFFQG+S  H +G +W +P V+ C  +T+P+ GSS+PG ++  E V
Sbjct  226  ANWVENNIDPTKTEVFFQGVSPDHANGADWGQPKVKSCTKETEPVIGSSYPGGKHKAEIV  285

Query  513  VKGVLGNMTN--SVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQIL  349
            ++ V+  M+   +V LL+I  L+QLRKDGHPS Y  G     DCSHWC+ GVPD+WN +L
Sbjct  286  LEKVINKMSKLEAVNLLNITTLSQLRKDGHPSFYGTGGHSTPDCSHWCLPGVPDTWNHLL  345

Query  348  YSILIQ  331
            Y+ +IQ
Sbjct  346  YATIIQ  351



>ref|XP_004248190.1| PREDICTED: protein trichome birefringence-like 39 [Solanum lycopersicum]
Length=354

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 88/122 (72%), Gaps = 4/122 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEA-  517
            A WVD NIDP+KTKVFFQGIS  HY G +WNEP+ + C+ QT+P  G+++P    P EA 
Sbjct  234  ARWVDKNIDPSKTKVFFQGISPTHYKGKDWNEPS-KSCKGQTQPFFGTNYPAGT-PQEAN  291

Query  516  VVKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG-GVVDCSHWCVAGVPDSWNQILYSI  340
            VV  V+ N+ N VYLLDI  L+Q RKDGHP  Y+     DCSHWC+ G+PD+WN +LY+I
Sbjct  292  VVNKVIKNIKNKVYLLDITTLSQYRKDGHPGYYSDIHGSDCSHWCLPGLPDTWNLLLYTI  351

Query  339  LI  334
            LI
Sbjct  352  LI  353



>gb|AHN91976.1| TBL1 [Citrus sinensis]
Length=366

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 85/121 (70%), Gaps = 3/121 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD ++DP+KTKVFFQGIS  HY G EWN    ++C  + +P+ GS++PG   P  +V
Sbjct  245  ARWVDLDVDPSKTKVFFQGISPTHYTGKEWNSRK-KNCLGELEPLSGSTYPGGAPPAASV  303

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG--GVVDCSHWCVAGVPDSWNQILYSI  340
            V  VL  +   VYLLDI  L+QLRKD HPSTY+G     DCSHWC+ G+PD+WNQ+LY+ 
Sbjct  304  VNKVLSPINKPVYLLDITTLSQLRKDAHPSTYSGKHSGTDCSHWCLPGLPDTWNQLLYAA  363

Query  339  L  337
            L
Sbjct  364  L  364



>ref|XP_004295667.1| PREDICTED: protein trichome birefringence-like 41 [Fragaria vesca 
subsp. vesca]
Length=365

 Score =   141 bits (356),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/123 (53%), Positives = 84/123 (68%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
              WVD+N+DP KT+VFFQGIS  HY+G +W EP  + C  Q +P+ GS++PG   P   V
Sbjct  243  GQWVDTNVDPAKTRVFFQGISPSHYNGTDWGEPRARTCEGQKEPLLGSTYPGGLPPAVGV  302

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            +K  L  +T  V LLDI  L+ LRKDGHPS Y  G    +DCSHWC+ GVPD+WN+ILY+
Sbjct  303  LKTALRKITKPVTLLDITNLSLLRKDGHPSIYGLGGRPGMDCSHWCLCGVPDTWNEILYN  362

Query  342  ILI  334
             L+
Sbjct  363  FLL  365



>ref|XP_003529365.1| PREDICTED: protein YLS7-like [Glycine max]
 gb|KHN31006.1| hypothetical protein glysoja_020304 [Glycine soja]
Length=368

 Score =   141 bits (356),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 81/123 (66%), Gaps = 4/123 (3%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD  +D  KTKVFFQGIS  HY G EWN+P  + C  + +P  GS++P    P   +
Sbjct  246  AGWVDQKVDSTKTKVFFQGISPTHYQGQEWNQPR-KSCSGELEPSAGSTYPAGLPPAANI  304

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG---GVVDCSHWCVAGVPDSWNQILYS  343
            V  VL NM N VYLLDI LL+QLRKD HPS Y G      DCSHWC+ GVPD+WN++LY+
Sbjct  305  VNKVLKNMKNQVYLLDITLLSQLRKDAHPSAYGGLDHTGNDCSHWCLPGVPDTWNELLYA  364

Query  342  ILI  334
             L 
Sbjct  365  ALF  367



>ref|XP_003551901.1| PREDICTED: protein YLS7-like [Glycine max]
Length=352

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 82/125 (66%), Gaps = 3/125 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A W+D NIDP +T+V FQG+S  H +  +W EP    C  QTKPI G  +PG   P E V
Sbjct  228  AKWIDYNIDPTRTRVLFQGVSPDHQNPAQWGEPRANFCAGQTKPISGLRYPGGPNPAEVV  287

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGG---VVDCSHWCVAGVPDSWNQILYS  343
            ++ VL  M   VYLLDI  L+QLR DGHPS Y  G    +DCSHWC+AGVPD+WN++LY 
Sbjct  288  LEKVLKAMQKPVYLLDITTLSQLRIDGHPSVYGHGGHLDMDCSHWCLAGVPDTWNELLYV  347

Query  342  ILIQN  328
             L QN
Sbjct  348  SLFQN  352



>gb|KCW69906.1| hypothetical protein EUGRSUZ_F03235 [Eucalyptus grandis]
Length=364

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 83/123 (67%), Gaps = 3/123 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            + WVDSNIDP  T V FQGIS  HY+G EWNE +   C  QT+PI GS +P    P  AV
Sbjct  237  SKWVDSNIDPATTTVIFQGISPTHYNGKEWNESSTTTCDGQTQPISGSEYPAGPPPPAAV  296

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAG---GVVDCSHWCVAGVPDSWNQILYS  343
            V  VLG M   V LLDI  L+QLRKDGHPS +        DCSHWC+AGVPD+WNQ+LY+
Sbjct  297  VSEVLGKMATEVTLLDITKLSQLRKDGHPSAFGSEGHRGNDCSHWCLAGVPDTWNQLLYT  356

Query  342  ILI  334
            ILI
Sbjct  357  ILI  359



>ref|XP_006843604.1| PREDICTED: protein PMR5 [Amborella trichopoda]
 gb|ERN05279.1| hypothetical protein AMTR_s00007p00137180 [Amborella trichopoda]
Length=377

 Score =   141 bits (356),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/132 (51%), Positives = 88/132 (67%), Gaps = 13/132 (10%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEA-  517
            ANWVDSN+D  +T+VFFQ IS  HY+  EW +P  ++C  QT+P+ G S+PG  YP +  
Sbjct  246  ANWVDSNVDTTRTRVFFQSISPTHYNPLEWQDPMAKNCYGQTEPVSGWSYPGA-YPDQMR  304

Query  516  VVKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV-----------VDCSHWCVAGVP  370
            VV+ VL  + N VYLLDI  L+QLRKDGHPS Y+G +            DCSHWC+ G+P
Sbjct  305  VVQAVLNKVQNPVYLLDITTLSQLRKDGHPSVYSGDLSPDQRANPDRSADCSHWCLPGLP  364

Query  369  DSWNQILYSILI  334
            D+WNQ+ Y+ L 
Sbjct  365  DTWNQLFYTALF  376



>ref|XP_003608140.1| hypothetical protein MTR_4g088030 [Medicago truncatula]
Length=217

 Score =   137 bits (346),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 82/122 (67%), Gaps = 3/122 (2%)
 Frame = -2

Query  693  ANWVDSNIDPNKTKVFFQGISAVHYHGNEWNEPAVQDCRHQTKPIEGSSFPGERYPGEAV  514
            A WVD+N+DP KTK+FFQGIS  H  G +WNEP  + C  + +P+ G+++P    P   V
Sbjct  96   AGWVDANVDPTKTKLFFQGISPTHNKGQDWNEPK-KTCSGEVEPLPGTTYPAPLPPANDV  154

Query  513  VKGVLGNMTNSVYLLDIALLTQLRKDGHPSTYAGGV--VDCSHWCVAGVPDSWNQILYSI  340
            V  VL NM   VYLLDI LL+QLRKD HPS Y      +DCSHWC+ G+PD+WN +L + 
Sbjct  155  VNKVLKNMKKQVYLLDITLLSQLRKDAHPSIYTKDPTGIDCSHWCLPGLPDTWNILLNAA  214

Query  339  LI  334
            LI
Sbjct  215  LI  216



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1197759904156