BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2566

Length=779
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP04145.1|  unnamed protein product                                329   5e-108   Coffea canephora [robusta coffee]
ref|XP_009608692.1|  PREDICTED: V-type proton ATPase subunit H          329   5e-107   Nicotiana tomentosiformis
ref|XP_009792608.1|  PREDICTED: V-type proton ATPase subunit H          329   6e-107   Nicotiana sylvestris
ref|XP_011044458.1|  PREDICTED: V-type proton ATPase subunit H is...    328   1e-106   Populus euphratica
ref|XP_011084696.1|  PREDICTED: V-type proton ATPase subunit H-like     328   1e-106   Sesamum indicum [beniseed]
gb|KDP39537.1|  hypothetical protein JCGZ_02557                         328   1e-106   Jatropha curcas
ref|XP_012070239.1|  PREDICTED: V-type proton ATPase subunit H          328   2e-106   Jatropha curcas
ref|XP_002325805.1|  putative vacuolar ATPase subunit H family pr...    327   4e-106   
ref|XP_007217990.1|  hypothetical protein PRUPE_ppa005592mg             326   6e-106   Prunus persica
ref|XP_011044454.1|  PREDICTED: V-type proton ATPase subunit H is...    327   7e-106   Populus euphratica
gb|AIZ49542.1|  V-ATPase subunit H1                                     326   9e-106   Eriobotrya japonica [loquat]
gb|EYU39750.1|  hypothetical protein MIMGU_mgv1a006219mg                326   1e-105   Erythranthe guttata [common monkey flower]
ref|XP_009361140.1|  PREDICTED: V-type proton ATPase subunit H          325   2e-105   Pyrus x bretschneideri [bai li]
ref|XP_008357071.1|  PREDICTED: V-type proton ATPase subunit H-like     325   2e-105   Malus domestica [apple tree]
ref|XP_010087456.1|  V-type proton ATPase subunit H                     325   2e-105   Morus notabilis
ref|XP_006343605.1|  PREDICTED: V-type proton ATPase subunit H-li...    324   5e-105   Solanum tuberosum [potatoes]
ref|XP_008343829.1|  PREDICTED: V-type proton ATPase subunit H-like     323   7e-105   
ref|XP_004307846.1|  PREDICTED: V-type proton ATPase subunit H          323   8e-105   Fragaria vesca subsp. vesca
ref|XP_006437440.1|  hypothetical protein CICLE_v10031531mg             323   9e-105   
ref|XP_004242619.1|  PREDICTED: V-type proton ATPase subunit H          323   1e-104   Solanum lycopersicum
ref|XP_011077102.1|  PREDICTED: V-type proton ATPase subunit H-like     323   1e-104   Sesamum indicum [beniseed]
ref|XP_010662098.1|  PREDICTED: V-type proton ATPase subunit H          322   4e-104   Vitis vinifera
ref|XP_010251374.1|  PREDICTED: V-type proton ATPase subunit H          322   5e-104   Nelumbo nucifera [Indian lotus]
gb|EYU39492.1|  hypothetical protein MIMGU_mgv1a006273mg                321   6e-104   Erythranthe guttata [common monkey flower]
ref|XP_007029672.1|  Vacuolar ATP synthase subunit H family prote...    320   2e-103   
emb|CBI26482.3|  unnamed protein product                                321   2e-103   Vitis vinifera
ref|XP_007029671.1|  Vacuolar ATP synthase subunit H family prote...    320   2e-103   
gb|EPS61013.1|  hypothetical protein M569_13786                         320   2e-103   Genlisea aurea
ref|XP_004509230.1|  PREDICTED: V-type proton ATPase subunit H-li...    320   2e-103   Cicer arietinum [garbanzo]
ref|XP_006484607.1|  PREDICTED: V-type proton ATPase subunit H-li...    320   3e-103   Citrus sinensis [apfelsine]
ref|XP_009615905.1|  PREDICTED: V-type proton ATPase subunit H-like     313   7e-103   Nicotiana tomentosiformis
gb|KJB26714.1|  hypothetical protein B456_004G256400                    315   9e-103   Gossypium raimondii
gb|KFK33830.1|  hypothetical protein AALP_AA5G065600                    308   1e-102   Arabis alpina [alpine rockcress]
gb|KHN44512.1|  V-type proton ATPase subunit H                          317   1e-102   Glycine soja [wild soybean]
ref|XP_003548002.1|  PREDICTED: V-type proton ATPase subunit H-li...    317   2e-102   Glycine max [soybeans]
ref|XP_011652170.1|  PREDICTED: V-type proton ATPase subunit H is...    314   2e-102   Cucumis sativus [cucumbers]
ref|XP_011628722.1|  PREDICTED: V-type proton ATPase subunit H          317   4e-102   Amborella trichopoda
ref|XP_007156009.1|  hypothetical protein PHAVU_003G250900g             318   4e-102   Phaseolus vulgaris [French bean]
ref|XP_008800912.1|  PREDICTED: probable V-type proton ATPase sub...    317   5e-102   Phoenix dactylifera
gb|ERN20283.1|  hypothetical protein AMTR_s00066p00170500               317   7e-102   Amborella trichopoda
gb|KJB18498.1|  hypothetical protein B456_003G056300                    316   8e-102   Gossypium raimondii
ref|XP_004136630.1|  PREDICTED: V-type proton ATPase subunit H is...    316   9e-102   Cucumis sativus [cucumbers]
ref|XP_002520072.1|  vacuolar ATP synthase subunit h, putative          315   2e-101   
ref|XP_003629515.1|  V-type proton ATPase subunit H                     315   2e-101   
ref|XP_008443235.1|  PREDICTED: V-type proton ATPase subunit H          315   2e-101   Cucumis melo [Oriental melon]
gb|AET03991.2|  vacuolar H+-ATPase subunit H, putative                  315   5e-101   Medicago truncatula
gb|KJB26715.1|  hypothetical protein B456_004G256400                    314   9e-101   Gossypium raimondii
gb|KHG22602.1|  V-type proton ATPase subunit H -like protein            315   9e-101   Gossypium arboreum [tree cotton]
ref|XP_010547995.1|  PREDICTED: V-type proton ATPase subunit H          313   1e-100   Tarenaya hassleriana [spider flower]
gb|ACJ85007.1|  unknown                                                 313   1e-100   Medicago truncatula
gb|AFK35511.1|  unknown                                                 312   1e-100   Lotus japonicus
emb|CDX69032.1|  BnaC01g04210D                                          312   2e-100   
ref|XP_009115735.1|  PREDICTED: V-type proton ATPase subunit H-like     312   2e-100   Brassica rapa
ref|XP_010912760.1|  PREDICTED: probable V-type proton ATPase sub...    309   5e-100   
emb|CDY49280.1|  BnaA03g50930D                                          310   9e-100   Brassica napus [oilseed rape]
emb|CDX72455.1|  BnaC07g44770D                                          310   1e-99    
gb|KCW59595.1|  hypothetical protein EUGRSUZ_H02340                     310   1e-99    Eucalyptus grandis [rose gum]
ref|XP_009138267.1|  PREDICTED: V-type proton ATPase subunit H          310   1e-99    Brassica rapa
ref|XP_010912758.1|  PREDICTED: probable V-type proton ATPase sub...    309   1e-99    
ref|XP_010023341.1|  PREDICTED: V-type proton ATPase subunit H          309   2e-99    Eucalyptus grandis [rose gum]
ref|XP_006574707.1|  PREDICTED: V-type proton ATPase subunit H-like     310   2e-99    Glycine max [soybeans]
ref|XP_010912757.1|  PREDICTED: probable V-type proton ATPase sub...    309   3e-99    Elaeis guineensis
ref|XP_008791825.1|  PREDICTED: probable V-type proton ATPase sub...    308   3e-99    
ref|XP_010526971.1|  PREDICTED: V-type proton ATPase subunit H-like     309   4e-99    Tarenaya hassleriana [spider flower]
ref|XP_006437446.1|  hypothetical protein CICLE_v10032936mg             298   5e-99    
ref|XP_008791823.1|  PREDICTED: probable V-type proton ATPase sub...    308   5e-99    Phoenix dactylifera
ref|XP_010437658.1|  PREDICTED: V-type proton ATPase subunit H-li...    308   7e-99    Camelina sativa [gold-of-pleasure]
ref|XP_002869169.1|  vacuolar ATP synthase subunit H family protein     307   8e-99    
ref|XP_006283723.1|  hypothetical protein CARUB_v10004791mg             308   1e-98    Capsella rubella
ref|XP_010432453.1|  PREDICTED: V-type proton ATPase subunit H-like     308   1e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010437659.1|  PREDICTED: V-type proton ATPase subunit H-li...    308   1e-98    
ref|XP_010447124.1|  PREDICTED: V-type proton ATPase subunit H          307   1e-98    Camelina sativa [gold-of-pleasure]
gb|ACN34691.1|  unknown                                                 297   5e-98    Zea mays [maize]
ref|XP_009416984.1|  PREDICTED: probable V-type proton ATPase sub...    305   1e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010673864.1|  PREDICTED: V-type proton ATPase subunit H          305   2e-97    Beta vulgaris subsp. vulgaris [field beet]
dbj|BAH20255.1|  AT3G42050                                              304   2e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010930282.1|  PREDICTED: probable V-type proton ATPase sub...    304   2e-97    Elaeis guineensis
ref|NP_189791.1|  V-type proton ATPase subunit H                        304   2e-97    Arabidopsis thaliana [mouse-ear cress]
gb|AAK59761.1|  AT3g42050/F4M19_10                                      304   3e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006350112.1|  PREDICTED: V-type proton ATPase subunit H-like     304   4e-97    Solanum tuberosum [potatoes]
ref|XP_004251740.1|  PREDICTED: V-type proton ATPase subunit H-like     302   2e-96    Solanum lycopersicum
gb|AAO65974.1|  putative vacuolar ATPase subunit H protein              302   3e-96    Suaeda salsa
ref|XP_006412262.1|  hypothetical protein EUTSA_v10025183mg             301   3e-96    
emb|CAD27445.1|  putative vacuolar ATPase subunit H                     302   4e-96    Mesembryanthemum crystallinum
ref|XP_006657814.1|  PREDICTED: probable V-type proton ATPase sub...    301   6e-96    Oryza brachyantha
ref|XP_010237225.1|  PREDICTED: probable V-type proton ATPase sub...    300   7e-96    Brachypodium distachyon [annual false brome]
ref|XP_004957961.1|  PREDICTED: probable V-type proton ATPase sub...    300   9e-96    Setaria italica
sp|Q84ZC0.1|VATH_ORYSJ  RecName: Full=Probable V-type proton ATPa...    300   1e-95    Oryza sativa Japonica Group [Japonica rice]
gb|EMT32310.1|  Putative V-type proton ATPase subunit H                 299   2e-95    
gb|EMS54494.1|  putative V-type proton ATPase subunit H                 299   2e-95    Triticum urartu
dbj|BAJ84958.1|  predicted protein                                      298   6e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA63056.1|  TPA: hypothetical protein ZEAMMB73_267119              296   6e-95    
gb|EEC82241.1|  hypothetical protein OsI_26411                          299   7e-95    Oryza sativa Indica Group [Indian rice]
ref|XP_002460834.1|  hypothetical protein SORBIDRAFT_02g035880          298   8e-95    Sorghum bicolor [broomcorn]
gb|ACF84665.1|  unknown                                                 296   4e-94    Zea mays [maize]
ref|NP_001146965.1|  vacuolar ATPase subunit H protein                  296   9e-94    Zea mays [maize]
ref|NP_001288363.1|  uncharacterized protein LOC103647744               294   3e-93    Zea mays [maize]
gb|ABG75917.1|  vacuolar proton ATPase subunit H                        293   5e-93    Triticum aestivum [Canadian hard winter wheat]
emb|CDX76266.1|  BnaA08g11340D                                          293   8e-93    
ref|XP_009415033.1|  PREDICTED: probable V-type proton ATPase sub...    291   2e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002453051.1|  hypothetical protein SORBIDRAFT_04g037430          291   3e-92    
gb|KHN00570.1|  Protein DA1-related 1                                   305   6e-92    Glycine soja [wild soybean]
emb|CDY57740.1|  BnaC03g77060D                                          284   2e-89    Brassica napus [oilseed rape]
gb|ABR17502.1|  unknown                                                 283   7e-89    Picea sitchensis
tpg|DAA41086.1|  TPA: hypothetical protein ZEAMMB73_371057              280   5e-86    
ref|XP_008234540.1|  PREDICTED: V-type proton ATPase subunit H          272   4e-85    Prunus mume [ume]
gb|AEG78652.1|  vacuolar H+-ATPase subunit H                            267   7e-85    Avena sativa [cultivated oat]
gb|ERN17435.1|  hypothetical protein AMTR_s00037p00233030               253   2e-81    Amborella trichopoda
ref|XP_002980222.1|  hypothetical protein SELMODRAFT_444469             260   3e-80    
ref|XP_002963102.1|  hypothetical protein SELMODRAFT_141399             260   4e-80    Selaginella moellendorffii
ref|XP_001756205.1|  predicted protein                                  251   1e-76    
ref|XP_001761877.1|  predicted protein                                  241   1e-72    
emb|CAG27620.1|  putative vacuolar ATPase subunit H                     201   1e-61    Populus deltoides x Populus maximowiczii
gb|KDO40338.1|  hypothetical protein CISIN_1g034103mg                   199   1e-60    Citrus sinensis [apfelsine]
gb|KDO40334.1|  hypothetical protein CISIN_1g034108mg                   197   4e-60    Citrus sinensis [apfelsine]
gb|KDO40336.1|  hypothetical protein CISIN_1g034106mg                   196   1e-59    Citrus sinensis [apfelsine]
gb|ABF50108.1|  vacuolar ATPase subunit H                               191   1e-57    Musa acuminata AAA Group [Cavendish banana]
ref|XP_002319248.2|  hypothetical protein POPTR_0013s07630g             184   2e-51    
ref|XP_009778019.1|  PREDICTED: V-type proton ATPase subunit H-like     179   5e-50    Nicotiana sylvestris
ref|XP_002955475.1|  vacuolar ATP synthase, subunit H                   177   2e-48    Volvox carteri f. nagariensis
ref|XP_001689562.1|  vacuolar ATP synthase subunit H                    176   5e-48    Chlamydomonas reinhardtii
ref|XP_006437443.1|  hypothetical protein CICLE_v10033985mg             157   1e-44    
ref|XP_005646211.1|  vacuolar ATP synthase subunit H                    167   1e-44    Coccomyxa subellipsoidea C-169
ref|XP_002680972.1|  vacuolar ATP synthase subunit H                    147   3e-37    Naegleria gruberi strain NEG-M
ref|XP_004367300.1|  vacuolar ATP synthase subunit H                    146   7e-37    Cavenderia fasciculata
ref|XP_002500993.1|  H+-or Na+-translocating f-type, v-type and A...    142   2e-35    Micromonas commoda
emb|CDO69013.1|  hypothetical protein BN946_scf184834.g20               140   5e-35    Trametes cinnabarina
dbj|GAM29018.1|  hypothetical protein SAMD00019534_121940               140   6e-35    Acytostelium subglobosum LB1
dbj|GAM26531.1|  hypothetical protein SAMD00019534_097060               140   6e-35    Acytostelium subglobosum LB1
gb|EFA79805.1|  vacuolar ATP synthase subunit H                         133   1e-34    Heterostelium album PN500
ref|XP_008869403.1|  hypothetical protein H310_06210                    139   2e-34    Aphanomyces invadans
ref|XP_008901144.1|  hypothetical protein PPTG_07998                    139   3e-34    Phytophthora parasitica INRA-310
gb|KIM32034.1|  hypothetical protein M408DRAFT_327392                   138   4e-34    Serendipita vermifera MAFF 305830
ref|XP_004333409.1|  vacuolar atp synthase subunit h, putative          133   6e-34    Acanthamoeba castellanii str. Neff
ref|XP_011398291.1|  putative V-type proton ATPase subunit H            137   8e-34    Auxenochlorella protothecoides
ref|XP_002909335.1|  V-type proton ATPase subunit H, putative           137   1e-33    Phytophthora infestans T30-4
ref|XP_009529196.1|  hypothetical protein PHYSODRAFT_505321             137   1e-33    Phytophthora sojae
gb|KIO27114.1|  hypothetical protein M407DRAFT_73717                    136   2e-33    Tulasnella calospora MUT 4182
ref|XP_011500008.1|  PREDICTED: V-type proton ATPase subunit H          137   2e-33    Ceratosolen solmsi marchali
ref|XP_007863478.1|  ATPase, V1 complex, subunit H                      136   2e-33    Gloeophyllum trabeum ATCC 11539
ref|XP_003291419.1|  hypothetical protein DICPUDRAFT_156018             136   2e-33    Dictyostelium purpureum
ref|XP_005709836.1|  unnamed protein product                            136   3e-33    Chondrus crispus [carageen]
emb|CEF98096.1|  Armadillo-type fold                                    136   4e-33    Ostreococcus tauri
ref|XP_011150670.1|  PREDICTED: V-type proton ATPase subunit H is...    135   4e-33    Harpegnathos saltator
ref|XP_003079498.1|  putative vacuolar ATPase subunit H protein (...    135   4e-33    
ref|XP_011150661.1|  PREDICTED: V-type proton ATPase subunit H is...    135   5e-33    Harpegnathos saltator
gb|EFN88781.1|  Vacuolar proton pump subunit H                          135   5e-33    Harpegnathos saltator
gb|KIL69551.1|  hypothetical protein M378DRAFT_97213                    135   5e-33    Amanita muscaria Koide BX008
emb|CCA75096.1|  related to vacuolar ATP synthase subunit H             134   9e-33    Serendipita indica DSM 11827
gb|KDQ60593.1|  hypothetical protein JAAARDRAFT_31557                   134   1e-32    Jaapia argillacea MUCL 33604
gb|KIP10325.1|  hypothetical protein PHLGIDRAFT_125667                  134   1e-32    Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_006495502.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-32    Mus musculus [mouse]
ref|XP_004329545.1|  PREDICTED: V-type proton ATPase subunit H-like     130   1e-32    
ref|XP_011302355.1|  PREDICTED: V-type proton ATPase subunit H is...    134   2e-32    Fopius arisanus
ref|XP_010014842.1|  PREDICTED: V-type proton ATPase subunit H          128   2e-32    Nestor notabilis
ref|XP_011302354.1|  PREDICTED: V-type proton ATPase subunit H is...    134   2e-32    Fopius arisanus
gb|KDD71741.1|  V-ATPase subunit H                                      127   2e-32    Helicosporidium sp. ATCC 50920
gb|KDQ13172.1|  hypothetical protein BOTBODRAFT_33784                   133   3e-32    Botryobasidium botryosum FD-172 SS1
ref|XP_009308551.1|  ATP synthase                                       133   3e-32    Trypanosoma grayi
gb|KDO49208.1|  hypothetical protein CISIN_1g0474481mg                  124   3e-32    Citrus sinensis [apfelsine]
ref|XP_007396061.1|  hypothetical protein PHACADRAFT_121574             132   4e-32    Phanerochaete carnosa HHB-10118-sp
emb|CDH53184.1|  atpase v1 complex subunit h                            132   4e-32    Lichtheimia corymbifera JMRC:FSU:9682
gb|EPZ30805.1|  V-type proton ATPase subunit H-like protein             132   4e-32    Rozella allomycis CSF55
gb|ADR51673.1|  putative IgE binding protein                            127   4e-32    Culicoides nubeculosus
gb|KFM65821.1|  V-type proton ATPase subunit H                          132   4e-32    Stegodyphus mimosarum
emb|CDH53183.1|  atpase v1 complex subunit h                            132   4e-32    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_006495500.1|  PREDICTED: V-type proton ATPase subunit H is...    130   4e-32    Mus musculus [mouse]
gb|EXX71257.1|  Vma13p                                                  131   4e-32    Rhizophagus irregularis DAOM 197198w
gb|ERE85970.1|  V-type proton ATPase subunit H                          132   4e-32    Cricetulus griseus [Chinese hamsters]
ref|XP_011413699.1|  PREDICTED: V-type proton ATPase subunit H-li...    132   5e-32    Crassostrea gigas
gb|EMD38663.1|  hypothetical protein CERSUDRAFT_113838                  132   5e-32    Gelatoporia subvermispora B
ref|XP_011413698.1|  PREDICTED: V-type proton ATPase subunit H-li...    132   5e-32    Crassostrea gigas
ref|XP_011929197.1|  PREDICTED: V-type proton ATPase subunit H is...    131   5e-32    Cercocebus atys
ref|XP_009499916.1|  PREDICTED: V-type proton ATPase subunit H          130   5e-32    Phalacrocorax carbo [common cormorant]
gb|EGW09777.1|  V-type proton ATPase subunit H                          132   5e-32    Cricetulus griseus [Chinese hamsters]
emb|CDS14131.1|  hypothetical protein LRAMOSA06301                      132   6e-32    Lichtheimia ramosa
ref|XP_011413697.1|  PREDICTED: V-type proton ATPase subunit H-li...    132   6e-32    Crassostrea gigas
gb|KGL78057.1|  V-type proton ATPase subunit H                          129   6e-32    Tinamus guttatus
gb|EKF99745.1|  ATP synthase, putative                                  132   6e-32    Trypanosoma cruzi
ref|XP_010125506.1|  PREDICTED: V-type proton ATPase subunit H          129   6e-32    Chlamydotis macqueenii
ref|XP_010214153.1|  PREDICTED: V-type proton ATPase subunit H          129   7e-32    Tinamus guttatus
ref|XP_011413696.1|  PREDICTED: V-type proton ATPase subunit H-li...    132   7e-32    Crassostrea gigas
ref|NP_001016182.1|  V-type proton ATPase subunit H                     132   8e-32    Xenopus tropicalis [western clawed frog]
ref|XP_008542740.1|  PREDICTED: V-type proton ATPase subunit H is...    131   8e-32    Equus przewalskii [Przewalski horse]
ref|XP_003759824.1|  PREDICTED: V-type proton ATPase subunit H          132   9e-32    Sarcophilus harrisii
gb|KIM53725.1|  hypothetical protein SCLCIDRAFT_1222591                 131   9e-32    Scleroderma citrinum Foug A
sp|Q9TVC1.1|VATH_PIG  RecName: Full=V-type proton ATPase subunit ...    132   9e-32    Sus scrofa [pigs]
ref|NP_999405.1|  V-type proton ATPase subunit H                        132   9e-32    Sus scrofa [pigs]
ref|XP_006495499.1|  PREDICTED: V-type proton ATPase subunit H is...    131   9e-32    Mus musculus [mouse]
ref|XP_001833472.1|  MSTP042                                            131   9e-32    Coprinopsis cinerea okayama7#130
emb|CCO31419.1|  V-type H+-transporting ATPase 54 kD subunit            125   9e-32    Rhizoctonia solani AG-1 IB
ref|XP_008542739.1|  PREDICTED: V-type proton ATPase subunit H is...    131   9e-32    Equus przewalskii [Przewalski horse]
ref|XP_004410076.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Odobenus rosmarus divergens
ref|XP_007338813.1|  ATPase, V1 complex, subunit H                      131   1e-31    
ref|XP_008842646.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    
ref|XP_005638032.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    
gb|ESA21230.1|  hypothetical protein GLOINDRAFT_343254                  131   1e-31    
ref|XP_006924025.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Pteropus alecto
ref|XP_006924026.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    
gb|KIK18316.1|  hypothetical protein PISMIDRAFT_14479                   131   1e-31    Pisolithus microcarpus 441
ref|XP_007321482.1|  hypothetical protein SERLADRAFT_474431             131   1e-31    Serpula lacrymans var. lacrymans S7.9
ref|XP_010185105.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Mesitornis unicolor
ref|XP_811617.1|  ATP synthase                                          131   1e-31    Trypanosoma cruzi strain CL Brener
ref|XP_010586613.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Loxodonta africana [African bush elephant]
ref|XP_010586612.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    
ref|XP_011929198.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Cercocebus atys
ref|XP_009811839.1|  PREDICTED: V-type proton ATPase subunit H          129   1e-31    Gavia stellata
ref|XP_004679936.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Condylura cristata
ref|XP_008495781.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Calypte anna
ref|XP_010199764.1|  PREDICTED: V-type proton ATPase subunit H          129   1e-31    Colius striatus
ref|XP_007998823.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Chlorocebus sabaeus
ref|XP_011792987.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Colobus angolensis palliatus
ref|XP_004410073.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Odobenus rosmarus divergens
ref|XP_010185106.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Mesitornis unicolor
ref|XP_011740633.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Macaca nemestrina [pigtail macaque]
ref|XP_004011726.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Ovis aries [domestic sheep]
ref|XP_006994248.1|  PREDICTED: V-type proton ATPase subunit H-li...    131   1e-31    Peromyscus maniculatus bairdii
gb|ADI40572.1|  lysosomal H+-transporting ATPase V1 subunit H           131   1e-31    Miniopterus schreibersii [Common bent-wing bat]
ref|XP_008495780.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Calypte anna
ref|XP_004275066.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Orcinus orca [Orca]
ref|XP_005613222.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Equus caballus [domestic horse]
ref|XP_003408364.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Loxodonta africana [African bush elephant]
ref|XP_004679937.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Condylura cristata
ref|XP_007516038.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Erinaceus europaeus [common hedgehog]
ref|XP_004479904.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Dasypus novemcinctus
ref|XP_005638031.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Canis lupus familiaris [dogs]
ref|XP_004011727.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Ovis aries [domestic sheep]
gb|AAH09154.1|  ATPase, H+ transporting, lysosomal V1 subunit H         131   1e-31    Mus musculus [mouse]
ref|XP_007950398.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Orycteropus afer afer
ref|NP_598587.2|  V-type proton ATPase subunit H                        131   1e-31    Mus musculus [mouse]
ref|XP_007168672.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Balaenoptera acutorostrata scammoni
ref|XP_009671845.1|  PREDICTED: V-type proton ATPase subunit H          131   1e-31    Struthio camelus australis
ref|XP_009946371.1|  PREDICTED: V-type proton ATPase subunit H          129   1e-31    Leptosomus discolor
ref|XP_008761746.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Rattus norvegicus [brown rat]
ref|XP_005322961.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Ictidomys tridecemlineatus
ref|XP_004602396.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Sorex araneus [Eurasian shrew]
gb|ELK02307.1|  V-type proton ATPase subunit H                          131   1e-31    Pteropus alecto
ref|XP_006900599.1|  PREDICTED: V-type proton ATPase subunit H-like     131   1e-31    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_003999862.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    
ref|XP_011792986.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Colobus angolensis palliatus
ref|XP_007516039.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    
ref|XP_007105306.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Physeter catodon
ref|XP_004479905.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Dasypus novemcinctus
ref|XP_007464083.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Lipotes vexillifer [baiji]
ref|XP_004410075.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Odobenus rosmarus divergens
ref|XP_004602395.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Sorex araneus [Eurasian shrew]
emb|CAG12279.1|  unnamed protein product                                131   1e-31    Tetraodon nigroviridis
ref|XP_005613224.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Equus caballus [domestic horse]
ref|XP_007168671.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Balaenoptera acutorostrata scammoni
ref|XP_005362304.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Microtus ochrogaster [prairie voles]
ref|XP_004435757.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    
ref|XP_007105305.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Physeter catodon
ref|XP_004633431.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Octodon degus
ref|XP_003999861.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Felis catus [cat]
ref|XP_006994249.1|  PREDICTED: V-type proton ATPase subunit H-li...    131   1e-31    Peromyscus maniculatus bairdii
ref|XP_010609402.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Fukomys damarensis [Damara mole rat]
ref|XP_008842643.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Nannospalax galili
ref|XP_008253747.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    Oryctolagus cuniculus [domestic rabbit]
ref|XP_544082.2|  PREDICTED: V-type proton ATPase subunit H isofo...    131   1e-31    Canis lupus familiaris [dogs]
ref|XP_004375664.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    
gb|EKF31005.1|  ATP synthase, putative                                  131   1e-31    Trypanosoma cruzi marinkellei
ref|XP_006495498.1|  PREDICTED: V-type proton ATPase subunit H is...    131   1e-31    
gb|EAW86730.1|  ATPase, H+ transporting, lysosomal 50/57kDa, V1 s...    131   2e-31    Homo sapiens [man]
ref|XP_007090622.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    Panthera tigris altaica
ref|XP_004887507.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
ref|XP_007090623.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    Panthera tigris altaica
ref|XP_004275067.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
ref|XP_008048661.1|  PREDICTED: V-type proton ATPase subunit H          130   2e-31    
ref|XP_007950399.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    Orycteropus afer afer
ref|XP_004697613.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    Echinops telfairi [lesser hedgehog tenrec]
ref|NP_001270161.1|  uncharacterized protein LOC101926423               131   2e-31    Macaca fascicularis [crab eating macaque]
ref|XP_002758941.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    Callithrix jacchus [common marmoset]
ref|XP_005396120.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    Chinchilla lanigera
ref|XP_004653416.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    Jaculus jaculus
ref|XP_006237863.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    Rattus norvegicus [brown rat]
ref|XP_004479906.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
ref|XP_007384849.1|  ATPase V1 complex subunit H                        130   2e-31    Punctularia strigosozonata HHB-11173 SS5
ref|XP_006140948.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    Tupaia chinensis
ref|XP_004887509.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
ref|XP_004375665.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
ref|XP_009542498.1|  V-ATPase, subunit H                                130   2e-31    
ref|XP_007090621.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
ref|XP_004653417.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
ref|XP_003734984.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
ref|XP_007464084.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
gb|KFO20474.1|  V-type proton ATPase subunit H                          134   2e-31    
ref|XP_008141569.1|  PREDICTED: V-type proton ATPase subunit H          131   2e-31    
ref|XP_003940899.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
ref|XP_005362305.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
ref|XP_004697612.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
ref|XP_003506606.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
gb|ADI40571.1|  lysosomal H+-transporting ATPase V1 subunit H           131   2e-31    
ref|XP_010586611.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
ref|XP_008253748.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
ref|XP_004633432.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
ref|XP_004435755.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
ref|XP_006112246.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
ref|XP_003975495.1|  PREDICTED: V-type proton ATPase subunit H          131   2e-31    
ref|XP_006495497.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
ref|XP_003902802.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
ref|XP_006745755.1|  PREDICTED: V-type proton ATPase subunit H          131   2e-31    
ref|XP_005396122.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
ref|XP_006871918.1|  PREDICTED: V-type proton ATPase subunit H-li...    131   2e-31    
gb|EHH28502.1|  V-type proton ATPase subunit H                          131   2e-31    
ref|XP_005966485.1|  PREDICTED: V-type proton ATPase subunit H          131   2e-31    
ref|XP_006237866.1|  PREDICTED: V-type proton ATPase subunit H is...    130   2e-31    
ref|XP_007064175.1|  PREDICTED: V-type proton ATPase subunit H          131   2e-31    
gb|EPT05401.1|  ATPase V1 complex subunit H                             130   2e-31    
ref|XP_005322963.1|  PREDICTED: V-type proton ATPase subunit H is...    130   2e-31    
ref|XP_006112245.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
gb|AAD27720.1|AF132945_1  CGI-11 protein                                131   2e-31    
ref|XP_005085988.1|  PREDICTED: V-type proton ATPase subunit H          131   2e-31    
ref|XP_007904109.1|  PREDICTED: V-type proton ATPase subunit H is...    130   2e-31    
ref|NP_001126091.1|  V-type proton ATPase subunit H                     130   2e-31    
ref|XP_008547205.1|  PREDICTED: V-type proton ATPase subunit H is...    131   2e-31    
ref|XP_007645254.1|  PREDICTED: V-type proton ATPase subunit H is...    130   2e-31    
ref|XP_008842645.1|  PREDICTED: V-type proton ATPase subunit H is...    130   2e-31    
ref|NP_998785.1|  V-type proton ATPase subunit H isoform 1              131   2e-31    
ref|XP_003466039.2|  PREDICTED: V-type proton ATPase subunit H          131   2e-31    
ref|NP_998784.1|  V-type proton ATPase subunit H isoform 2              130   2e-31    
ref|XP_009078254.1|  PREDICTED: V-type proton ATPase subunit H is...    130   2e-31    
gb|AFM90690.1|  ATPase, H+ transporting, lysosomal, V1 subunit H        130   2e-31    
ref|NP_001279139.1|  ATPase, H+ transporting, lysosomal 50/57kDa,...    130   2e-31    
dbj|BAG64316.1|  unnamed protein product                                130   2e-31    
dbj|BAG53609.1|  unnamed protein product                                130   2e-31    
ref|XP_008547204.1|  PREDICTED: V-type proton ATPase subunit H is...    130   2e-31    
ref|XP_009453663.1|  PREDICTED: V-type proton ATPase subunit H          130   2e-31    
gb|KIJ17095.1|  hypothetical protein PAXINDRAFT_111825                  127   2e-31    
gb|KIM87633.1|  hypothetical protein PILCRDRAFT_815209                  130   2e-31    
ref|XP_009078245.1|  PREDICTED: V-type proton ATPase subunit H is...    130   3e-31    
ref|XP_820568.1|  ATP synthase                                          130   3e-31    
ref|XP_010152360.1|  PREDICTED: V-type proton ATPase subunit H          129   3e-31    
ref|XP_007428279.1|  PREDICTED: V-type proton ATPase subunit H is...    130   3e-31    
ref|NP_001089309.1|  ATPase, H+ transporting, lysosomal 50/57kDa,...    130   3e-31    
emb|CCA18464.1|  Vtype proton ATPase subunit H putative                 130   3e-31    
ref|XP_003224355.1|  PREDICTED: V-type proton ATPase subunit H          130   3e-31    
emb|CCI49390.1|  unnamed protein product                                130   3e-31    
ref|XP_010707226.1|  PREDICTED: V-type proton ATPase subunit H          130   3e-31    
ref|XP_009925501.1|  PREDICTED: V-type proton ATPase subunit H is...    129   4e-31    
ref|XP_009838905.1|  hypothetical protein H257_13146                    130   4e-31    
ref|XP_008467401.1|  PREDICTED: V-type proton ATPase subunit H          130   4e-31    
ref|XP_010141561.1|  PREDICTED: V-type proton ATPase subunit H          130   4e-31    
ref|XP_009706097.1|  PREDICTED: V-type proton ATPase subunit H          129   4e-31    
ref|XP_009901987.1|  PREDICTED: V-type proton ATPase subunit H          130   4e-31    
ref|XP_005152605.1|  PREDICTED: V-type proton ATPase subunit H          130   4e-31    
ref|NP_001184255.1|  V-type proton ATPase subunit H                     130   5e-31    
ref|XP_009935988.1|  PREDICTED: V-type proton ATPase subunit H is...    130   5e-31    
ref|XP_005025556.1|  PREDICTED: V-type proton ATPase subunit H is...    130   5e-31    
ref|XP_009925475.1|  PREDICTED: V-type proton ATPase subunit H is...    130   5e-31    
ref|XP_009568732.1|  PREDICTED: V-type proton ATPase subunit H is...    130   5e-31    
ref|XP_009638645.1|  PREDICTED: V-type proton ATPase subunit H is...    129   5e-31    
ref|XP_006191106.1|  PREDICTED: V-type proton ATPase subunit H is...    129   5e-31    
emb|CEP16084.1|  hypothetical protein                                   129   5e-31    
ref|XP_006023922.1|  PREDICTED: V-type proton ATPase subunit H is...    130   5e-31    
ref|XP_009638644.1|  PREDICTED: V-type proton ATPase subunit H is...    129   5e-31    
ref|XP_006259999.1|  PREDICTED: V-type proton ATPase subunit H          129   5e-31    
gb|EMC87078.1|  V-type proton ATPase subunit H                          130   5e-31    
ref|XP_009925491.1|  PREDICTED: V-type proton ATPase subunit H is...    129   5e-31    
ref|XP_005479350.1|  PREDICTED: V-type proton ATPase subunit H          129   5e-31    
ref|XP_010169924.1|  PREDICTED: V-type proton ATPase subunit H is...    129   5e-31    
ref|XP_009287620.1|  PREDICTED: V-type proton ATPase subunit H          129   5e-31    
ref|XP_008643145.1|  PREDICTED: V-type proton ATPase subunit H          129   5e-31    
ref|XP_002197593.1|  PREDICTED: V-type proton ATPase subunit H          129   5e-31    
ref|XP_009935989.1|  PREDICTED: V-type proton ATPase subunit H is...    129   5e-31    
ref|XP_006023923.1|  PREDICTED: V-type proton ATPase subunit H is...    129   5e-31    
ref|XP_011588894.1|  PREDICTED: V-type proton ATPase subunit H          129   5e-31    
ref|XP_009984629.1|  PREDICTED: V-type proton ATPase subunit H is...    129   5e-31    
ref|XP_005240812.1|  PREDICTED: V-type proton ATPase subunit H          129   5e-31    
ref|XP_010285565.1|  PREDICTED: V-type proton ATPase subunit H          129   5e-31    
ref|XP_005506565.1|  PREDICTED: V-type proton ATPase subunit H is...    129   5e-31    
ref|XP_008938694.1|  PREDICTED: V-type proton ATPase subunit H is...    129   5e-31    
ref|XP_009478934.1|  PREDICTED: V-type proton ATPase subunit H          129   5e-31    
ref|XP_005418370.1|  PREDICTED: V-type proton ATPase subunit H          129   5e-31    
ref|XP_005042123.1|  PREDICTED: V-type proton ATPase subunit H is...    129   5e-31    
gb|EOA97074.1|  Vacuolar proton pump subunit H                          129   5e-31    
ref|XP_005025558.1|  PREDICTED: V-type proton ATPase subunit H is...    129   5e-31    
ref|XP_009575443.1|  PREDICTED: V-type proton ATPase subunit H          129   5e-31    
ref|XP_010987846.1|  PREDICTED: V-type proton ATPase subunit H          129   5e-31    
ref|XP_009984630.1|  PREDICTED: V-type proton ATPase subunit H is...    129   6e-31    
ref|XP_005025557.1|  PREDICTED: V-type proton ATPase subunit H is...    129   6e-31    
ref|XP_008921674.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    129   6e-31    
emb|CAB39532.1|  54 kDa vacuolar H(+)-ATPase subunit                    129   6e-31    
tpg|DAA22751.1|  TPA: V-type proton ATPase subunit H                    129   6e-31    
ref|XP_009925483.1|  PREDICTED: V-type proton ATPase subunit H is...    129   6e-31    
ref|XP_003428501.1|  PREDICTED: V-type proton ATPase subunit H is...    129   6e-31    
gb|ETE73254.1|  V-type proton ATPase subunit H                          129   6e-31    
ref|XP_006769146.1|  PREDICTED: V-type proton ATPase subunit H is...    129   6e-31    
ref|XP_006191105.1|  PREDICTED: V-type proton ATPase subunit H is...    129   6e-31    
gb|AHF70968.1|  vacuolar ATP synthase subunit H                         129   6e-31    
ref|XP_001515221.1|  PREDICTED: V-type proton ATPase subunit H is...    129   6e-31    
ref|XP_005857374.1|  PREDICTED: V-type proton ATPase subunit H is...    129   6e-31    
ref|XP_005215461.1|  PREDICTED: V-type proton ATPase subunit H is...    129   7e-31    
ref|XP_010968999.1|  PREDICTED: LOW QUALITY PROTEIN: V-type proto...    129   7e-31    
sp|O46563.2|VATH_BOVIN  RecName: Full=V-type proton ATPase subuni...    129   7e-31    
ref|XP_005857375.1|  PREDICTED: V-type proton ATPase subunit H is...    129   7e-31    
ref|XP_005892054.1|  PREDICTED: V-type proton ATPase subunit H-like     129   7e-31    
dbj|BAM18133.1|  vacuolar H[+]-ATPase SFD subunit                       129   7e-31    
gb|KDQ33755.1|  hypothetical protein PLEOSDRAFT_1052588                 129   7e-31    
ref|XP_009969574.1|  PREDICTED: V-type proton ATPase subunit H          128   7e-31    
ref|XP_006769145.1|  PREDICTED: V-type proton ATPase subunit H is...    129   7e-31    
ref|XP_006077052.1|  PREDICTED: V-type proton ATPase subunit H is...    129   8e-31    
gb|KIK40766.1|  hypothetical protein CY34DRAFT_86648                    129   8e-31    
gb|ELK26175.1|  V-type proton ATPase subunit H                          129   9e-31    
ref|XP_006077050.1|  PREDICTED: V-type proton ATPase subunit H is...    129   9e-31    
gb|EHJ66535.1|  hypothetical protein KGM_18477                          129   9e-31    
gb|AAC02986.1|  vacuolar proton pump subunit SFD beta isoform           129   1e-30    
ref|XP_005301264.1|  PREDICTED: V-type proton ATPase subunit H          129   1e-30    
ref|XP_007487188.1|  PREDICTED: V-type proton ATPase subunit H is...    129   1e-30    
gb|AAC02987.1|  vacuolar proton pump subunit SFD alpha isoform          129   1e-30    
ref|XP_007487189.1|  PREDICTED: V-type proton ATPase subunit H is...    129   1e-30    
ref|XP_003793747.1|  PREDICTED: V-type proton ATPase subunit H is...    129   1e-30    
ref|XP_003793749.1|  PREDICTED: V-type proton ATPase subunit H is...    128   1e-30    
ref|XP_005181998.1|  PREDICTED: V-type proton ATPase subunit H          128   1e-30    
gb|ESL11474.1|  ATP synthase                                            128   1e-30    
emb|CCC93300.1|  putative ATP synthase                                  129   1e-30    
ref|XP_003793748.1|  PREDICTED: V-type proton ATPase subunit H is...    128   1e-30    
ref|XP_011485363.1|  PREDICTED: V-type proton ATPase subunit H is...    128   2e-30    
ref|XP_010789727.1|  PREDICTED: V-type proton ATPase subunit H is...    128   2e-30    
gb|AFN11665.1|  vacuolar ATPase subunit H                               128   2e-30    
ref|XP_010789726.1|  PREDICTED: V-type proton ATPase subunit H is...    128   2e-30    
ref|XP_004929804.1|  PREDICTED: V-type proton ATPase subunit H-like     128   2e-30    
ref|XP_004079489.1|  PREDICTED: V-type proton ATPase subunit H is...    128   2e-30    
ref|NP_001040488.1|  vacuolar ATP synthase subunit H                    128   2e-30    
ref|NP_001133475.1|  Vacuolar proton pump subunit H                     128   2e-30    
gb|KII88913.1|  hypothetical protein PLICRDRAFT_40550                   127   2e-30    
gb|EPY36528.1|  V-type H+-transporting ATPase 54 kD subunit             125   2e-30    
ref|XP_006634089.1|  PREDICTED: V-type proton ATPase subunit H-like     127   2e-30    
ref|XP_002808526.1|  PREDICTED: LOW QUALITY PROTEIN: v-type proto...    129   2e-30    
ref|XP_002003753.1|  GI21354                                            128   3e-30    
ref|XP_011547908.1|  PREDICTED: V-type proton ATPase subunit H is...    127   3e-30    
ref|XP_008285726.1|  PREDICTED: V-type proton ATPase subunit H          127   3e-30    
ref|XP_005845340.1|  hypothetical protein CHLNCDRAFT_32265              127   3e-30    
ref|XP_005742564.1|  PREDICTED: V-type proton ATPase subunit H-li...    127   3e-30    
ref|XP_010727568.1|  PREDICTED: V-type proton ATPase subunit H is...    127   3e-30    
ref|NP_723992.1|  vacuolar H[+]-ATPase SFD subunit, isoform B           128   3e-30    
ref|XP_004542994.1|  PREDICTED: V-type proton ATPase subunit H-li...    127   3e-30    
ref|XP_003438111.1|  PREDICTED: V-type proton ATPase subunit H-li...    127   3e-30    
ref|XP_001965291.1|  GF24362                                            128   3e-30    
ref|XP_010864266.1|  PREDICTED: V-type proton ATPase subunit H is...    127   3e-30    
ref|XP_004542995.1|  PREDICTED: V-type proton ATPase subunit H-li...    127   3e-30    
ref|XP_002079663.1|  GD21903                                            128   3e-30    
ref|XP_002014753.1|  GL19340                                            128   3e-30    
ref|XP_005476564.1|  PREDICTED: V-type proton ATPase subunit H-li...    127   3e-30    
ref|XP_011547907.1|  PREDICTED: V-type proton ATPase subunit H is...    127   3e-30    
gb|KIO04112.1|  hypothetical protein M404DRAFT_144318                   127   3e-30    
ref|XP_005742565.1|  PREDICTED: V-type proton ATPase subunit H-li...    127   3e-30    
ref|NP_723993.1|  vacuolar H[+]-ATPase SFD subunit, isoform D           127   3e-30    
ref|NP_523585.2|  vacuolar H[+]-ATPase SFD subunit, isoform A           127   3e-30    
ref|XP_010727569.1|  PREDICTED: V-type proton ATPase subunit H is...    127   3e-30    
ref|XP_001988830.1|  GH10362                                            127   3e-30    
ref|XP_010864268.1|  PREDICTED: V-type proton ATPase subunit H is...    127   3e-30    
ref|XP_002038845.1|  GM17165                                            127   3e-30    
gb|AHM92104.1|  vATPase subunit H                                       127   4e-30    
gb|ACI34030.1|  Vacuolar proton pump subunit H                          127   4e-30    
ref|XP_005993507.1|  PREDICTED: V-type proton ATPase subunit H is...    127   4e-30    
ref|XP_011168339.1|  PREDICTED: V-type proton ATPase subunit H-like     125   4e-30    
ref|XP_005993508.1|  PREDICTED: V-type proton ATPase subunit H is...    127   4e-30    
ref|XP_011049528.1|  PREDICTED: V-type proton ATPase subunit H-like     125   4e-30    
ref|XP_002736386.1|  PREDICTED: V-type proton ATPase subunit H-like     127   5e-30    
gb|KDR81383.1|  hypothetical protein GALMADRAFT_59324                   126   5e-30    
ref|XP_008217756.1|  PREDICTED: V-type proton ATPase subunit H is...    127   5e-30    
dbj|BAN20615.1|  vacuolar H[+] ATPase subunit                           127   5e-30    
ref|NP_001278637.1|  V-type proton ATPase subunit H isoform 1           127   5e-30    
ref|XP_001605466.1|  PREDICTED: V-type proton ATPase subunit H is...    127   5e-30    
ref|XP_002064801.1|  GK15126                                            127   5e-30    
ref|XP_008217755.1|  PREDICTED: V-type proton ATPase subunit H is...    127   5e-30    
ref|XP_003425170.1|  PREDICTED: V-type proton ATPase subunit H is...    127   5e-30    
gb|AAM34678.1|AF506234_1  vacuolar ATP synthase subunit H               126   6e-30    
gb|EPY76341.1|  V-type proton ATPase subunit H                          127   6e-30    
sp|Q9U5N0.1|VATH_MANSE  RecName: Full=V-type proton ATPase subuni...    126   6e-30    
ref|XP_007548605.1|  PREDICTED: V-type proton ATPase subunit H is...    126   6e-30    
ref|NP_775377.2|  V-type proton ATPase subunit H isoform 2              126   6e-30    
gb|ELW71992.1|  V-type proton ATPase subunit H                          127   6e-30    
emb|CCW70353.1|  unnamed protein product                                126   6e-30    
ref|XP_007548603.1|  PREDICTED: V-type proton ATPase subunit H is...    126   6e-30    
ref|XP_011777260.1|  ATP synthase, putative                             126   6e-30    
ref|XP_822331.1|  ATP synthase                                          126   6e-30    
ref|NP_777129.2|  V-type proton ATPase subunit H                        126   6e-30    
gb|KEP50199.1|  V-type proton ATPase subunit H                          126   7e-30    
gb|EUC56956.1|  V-type proton ATPase subunit H                          126   7e-30    
ref|XP_008432798.1|  PREDICTED: V-type proton ATPase subunit H          125   8e-30    
ref|XP_005815100.1|  PREDICTED: V-type proton ATPase subunit H-like     126   9e-30    
ref|XP_001949116.3|  PREDICTED: V-type proton ATPase subunit H          126   9e-30    
ref|XP_007364518.1|  ATPase V1 complex subunit H                        125   9e-30    
ref|XP_007260238.1|  PREDICTED: V-type proton ATPase subunit H is...    126   9e-30    
ref|XP_002398232.1|  hypothetical protein MPER_01211                    120   1e-29    
ref|XP_007260236.1|  PREDICTED: V-type proton ATPase subunit H is...    125   1e-29    
ref|XP_001564860.1|  putative ATP synthase                              125   1e-29    
ref|XP_008332710.1|  PREDICTED: V-type proton ATPase subunit H is...    125   1e-29    
ref|XP_007029673.1|  Vacuolar ATP synthase subunit H family prote...    124   1e-29    
ref|XP_008332709.1|  PREDICTED: V-type proton ATPase subunit H is...    125   1e-29    
gb|EFX87781.1|  hypothetical protein DAPPUDRAFT_306505                  125   1e-29    
ref|XP_002051650.1|  GJ11146                                            126   1e-29    
gb|AAL75942.1|AF125105_1  vacuolar proton pump subunit SFD alpha ...    125   1e-29    
gb|KDR12485.1|  V-type proton ATPase subunit H                          125   1e-29    
ref|XP_644034.1|  vacuolar ATP synthase subunit H                       125   1e-29    
ref|XP_001634877.1|  predicted protein                                  125   2e-29    
gb|EFZ22256.1|  hypothetical protein SINV_08430                         124   2e-29    
gb|AHF70969.1|  vacuolar ATP synthase subunit H                         125   2e-29    
gb|KIK63759.1|  hypothetical protein GYMLUDRAFT_450965                  125   2e-29    



>emb|CDP04145.1| unnamed protein product [Coffea canephora]
Length=370

 Score =   329 bits (843),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 159/176 (90%), Positives = 167/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLLHKG FGA +VDLG+  IVQ+LKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY
Sbjct  195  LRNLLHKGNFGAQMVDLGLPQIVQSLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  254

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+NIT FEENDFQILRVLITILDT++DPRTLAVACFDLS
Sbjct  255  KQEVLLGHLDWSPMHKDPIFWRENITTFEENDFQILRVLITILDTANDPRTLAVACFDLS  314

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQ HPAGRVIVTDLKAK+R MKL+NHEN EVTKNALLCIQRLFLGAKYASFLQV
Sbjct  315  QFIQHHPAGRVIVTDLKAKDRVMKLMNHENGEVTKNALLCIQRLFLGAKYASFLQV  370



>ref|XP_009608692.1| PREDICTED: V-type proton ATPase subunit H [Nicotiana tomentosiformis]
 ref|XP_009608693.1| PREDICTED: V-type proton ATPase subunit H [Nicotiana tomentosiformis]
Length=454

 Score =   329 bits (844),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL KG+F  L+VDLGVL IVQ+LKAQAWSDEDLL+ALNQLEEGLKDNIKKLSSFDKY
Sbjct  279  LRNLLSKGSFSILMVDLGVLQIVQSLKAQAWSDEDLLDALNQLEEGLKDNIKKLSSFDKY  338

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+NI +FEENDFQILRVLITILDTSSDPRTLAVAC+DLS
Sbjct  339  KQEVLLGHLDWSPMHKDPIFWRENINSFEENDFQILRVLITILDTSSDPRTLAVACYDLS  398

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQCH AGR+IV DLKAKER MKLLNHEN EVTKNALLCIQRLFLGAKYASFLQV
Sbjct  399  QFIQCHSAGRIIVNDLKAKERVMKLLNHENAEVTKNALLCIQRLFLGAKYASFLQV  454



>ref|XP_009792608.1| PREDICTED: V-type proton ATPase subunit H [Nicotiana sylvestris]
Length=454

 Score =   329 bits (843),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL KG+F  L+VDLGVL IVQ+LKAQAWSDEDLL+ALNQLEEGLKDNIKKLSSFDKY
Sbjct  279  LRNLLSKGSFSILMVDLGVLQIVQSLKAQAWSDEDLLDALNQLEEGLKDNIKKLSSFDKY  338

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+NI +FEENDFQILRVLITILDTSSDPRTLAVAC+DLS
Sbjct  339  KQEVLLGHLDWSPMHKDPIFWRENINSFEENDFQILRVLITILDTSSDPRTLAVACYDLS  398

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQCH AGR+IV DLKAKER MKLLNHEN EVTKNALLCIQRLFLGAKYASFLQV
Sbjct  399  QFIQCHSAGRIIVNDLKAKERVMKLLNHENAEVTKNALLCIQRLFLGAKYASFLQV  454



>ref|XP_011044458.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Populus 
euphratica]
Length=452

 Score =   328 bits (841),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             +NLL KG FGA +VDLG+  IVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY
Sbjct  277  FKNLLSKGAFGAQMVDLGLPQIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDPAFWR+NITNFEENDFQILRVLITILDTS+DPR LAVACFDLS
Sbjct  337  KQEVLLGHLDWSPMHKDPAFWRENITNFEENDFQILRVLITILDTSNDPRALAVACFDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQ HPAGRVIV DLK KER MKL+NHEN EVTKNALLCIQRLFLGAKYASFLQV
Sbjct  397  QFIQHHPAGRVIVADLKTKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFLQV  452



>ref|XP_011084696.1| PREDICTED: V-type proton ATPase subunit H-like [Sesamum indicum]
Length=453

 Score =   328 bits (841),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 167/175 (95%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLLHKGTFGA +VDLG+  +VQNLKAQAWSDEDLLE+LNQLEEGLK NIKKLSSF+KY
Sbjct  278  LRNLLHKGTFGAQMVDLGLPQLVQNLKAQAWSDEDLLESLNQLEEGLKVNIKKLSSFEKY  337

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+NITNFEE+DFQILRVLITILDT+SDPRTLAVAC+D+S
Sbjct  338  KQEVLLGHLDWSPMHKDPVFWRENITNFEEHDFQILRVLITILDTASDPRTLAVACYDIS  397

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  398  QFIQYHPAGRIIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFLQ  452



>gb|KDP39537.1| hypothetical protein JCGZ_02557 [Jatropha curcas]
Length=439

 Score =   328 bits (840),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+ HIVQ+LKAQAWSDEDLLEALNQLEEGL+DNIKKLSSFDKY
Sbjct  264  FRNLLSKGTFGAQMVDLGLPHIVQSLKAQAWSDEDLLEALNQLEEGLRDNIKKLSSFDKY  323

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDTS+DPR LAV CFDLS
Sbjct  324  KQEVLLGHLDWSPMHKDPIFWRENINNFEENDFQILRVLITILDTSNDPRALAVGCFDLS  383

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  384  QFIQYHPAGRIIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFLQ  438



>ref|XP_012070239.1| PREDICTED: V-type proton ATPase subunit H [Jatropha curcas]
Length=452

 Score =   328 bits (840),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+ HIVQ+LKAQAWSDEDLLEALNQLEEGL+DNIKKLSSFDKY
Sbjct  277  FRNLLSKGTFGAQMVDLGLPHIVQSLKAQAWSDEDLLEALNQLEEGLRDNIKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDTS+DPR LAV CFDLS
Sbjct  337  KQEVLLGHLDWSPMHKDPIFWRENINNFEENDFQILRVLITILDTSNDPRALAVGCFDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  397  QFIQYHPAGRIIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFLQ  451



>ref|XP_002325805.1| putative vacuolar ATPase subunit H family protein [Populus trichocarpa]
 gb|EEF00187.1| putative vacuolar ATPase subunit H family protein [Populus trichocarpa]
Length=447

 Score =   327 bits (837),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 156/176 (89%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL KGTFGA +VDLG+  IVQNLKAQAWSDEDLLEALNQ+EEG+KDNIKKLSSFDKY
Sbjct  272  LRNLLSKGTFGAQMVDLGLPQIVQNLKAQAWSDEDLLEALNQIEEGVKDNIKKLSSFDKY  331

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHK+PAFW +N TNFEENDFQILRVL+TILDTS+DPR LAVACFDLS
Sbjct  332  KQEVLLGHLDWSPMHKNPAFWCENFTNFEENDFQILRVLVTILDTSNDPRALAVACFDLS  391

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQ HPAGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFLQV
Sbjct  392  QFIQYHPAGRIIVTDLKAKERMMKLMNHENAEVTKNALLCIQRLFLGAKYASFLQV  447



>ref|XP_007217990.1| hypothetical protein PRUPE_ppa005592mg [Prunus persica]
 gb|EMJ19189.1| hypothetical protein PRUPE_ppa005592mg [Prunus persica]
Length=452

 Score =   326 bits (836),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL KGTFGA +VDLG+  +VQ+LKAQAWSDEDLLE LNQLEEGLKDNIKKLSSFDKY
Sbjct  277  LRNLLSKGTFGAQMVDLGLPQMVQSLKAQAWSDEDLLEGLNQLEEGLKDNIKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+N+TNFEENDFQILRVLITILDTSSDPR LAVACFD+S
Sbjct  337  KQEVLLGHLDWSPMHKDPIFWRENVTNFEENDFQILRVLITILDTSSDPRALAVACFDIS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QF+Q HPAGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  397  QFVQQHPAGRIIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFLQ  451



>ref|XP_011044454.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Populus 
euphratica]
 ref|XP_011044455.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Populus 
euphratica]
 ref|XP_011044456.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Populus 
euphratica]
 ref|XP_011044457.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Populus 
euphratica]
Length=483

 Score =   327 bits (839),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 158/176 (90%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             +NLL KG FGA +VDLG+  IVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY
Sbjct  308  FKNLLSKGAFGAQMVDLGLPQIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  367

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDPAFWR+NITNFEENDFQILRVLITILDTS+DPR LAVACFDLS
Sbjct  368  KQEVLLGHLDWSPMHKDPAFWRENITNFEENDFQILRVLITILDTSNDPRALAVACFDLS  427

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQ HPAGRVIV DLK KER MKL+NHEN EVTKNALLCIQRLFLGAKYASFLQV
Sbjct  428  QFIQHHPAGRVIVADLKTKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFLQV  483



>gb|AIZ49542.1| V-ATPase subunit H1 [Eriobotrya japonica]
Length=452

 Score =   326 bits (835),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 156/175 (89%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLE LNQLEEGLKDNIKKLSSFDKY
Sbjct  277  LRNLLSKGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEGLNQLEEGLKDNIKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+NITNFEENDFQILRVLITILDTSSDPR LAVACFD+S
Sbjct  337  KQEVLLGHLDWSPMHKDPIFWRENITNFEENDFQILRVLITILDTSSDPRALAVACFDIS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QF+Q HPAGRVIVTDLKAKER MKL++HE+ EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  397  QFVQQHPAGRVIVTDLKAKERVMKLMDHESAEVTKNALLCIQRLFLGAKYASFLQ  451



>gb|EYU39750.1| hypothetical protein MIMGU_mgv1a006219mg [Erythranthe guttata]
Length=452

 Score =   326 bits (835),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 168/176 (95%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLLHKGTFGA +VDLG+  +VQNLKAQAWSDEDLLE+LNQLEEG+KDNIKKLSSFDKY
Sbjct  277  LRNLLHKGTFGAQMVDLGLPQVVQNLKAQAWSDEDLLESLNQLEEGMKDNIKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKD  FWR+NIT+FEE+DFQILRVLITILDTSSDPRTLAVAC+DLS
Sbjct  337  KQEVLLGHLDWSPMHKDLIFWRENITSFEEHDFQILRVLITILDTSSDPRTLAVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQ HPAGR+IVTDLKAK+R MKL+NHEN EVTKNALLCIQRLFLGAKYASF+QV
Sbjct  397  QFIQNHPAGRIIVTDLKAKDRVMKLMNHENAEVTKNALLCIQRLFLGAKYASFVQV  452



>ref|XP_009361140.1| PREDICTED: V-type proton ATPase subunit H [Pyrus x bretschneideri]
Length=452

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLE LNQLEEG+KDNIKKLSSFDKY
Sbjct  277  LRNLLSKGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEGLNQLEEGMKDNIKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+NITNFEENDFQILRVLITILDTSSDPR LAVACFD+S
Sbjct  337  KQEVLLGHLDWSPMHKDPIFWRENITNFEENDFQILRVLITILDTSSDPRALAVACFDIS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QF+Q HPAGRVIVTDLKAKER MKL++HE+ EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  397  QFVQQHPAGRVIVTDLKAKERVMKLMDHESAEVTKNALLCIQRLFLGAKYASFLQ  451



>ref|XP_008357071.1| PREDICTED: V-type proton ATPase subunit H-like [Malus domestica]
 ref|XP_008357072.1| PREDICTED: V-type proton ATPase subunit H-like [Malus domestica]
Length=452

 Score =   325 bits (833),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 165/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLE LNQLEEGLKDNIKKLSSFDKY
Sbjct  277  LRNLLSKGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEGLNQLEEGLKDNIKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+NITNFEENDFQILRVLITILDTSSDPR LAVACFD+S
Sbjct  337  KQEVLLGHLDWSPMHKDPIFWRENITNFEENDFQILRVLITILDTSSDPRALAVACFDIS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QF+Q HPAGRV+VTDLKAKER MKL++HE+ EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  397  QFVQQHPAGRVVVTDLKAKERVMKLMDHESAEVTKNALLCIQRLFLGAKYASFLQ  451



>ref|XP_010087456.1| V-type proton ATPase subunit H [Morus notabilis]
 gb|EXB29137.1| V-type proton ATPase subunit H [Morus notabilis]
Length=453

 Score =   325 bits (832),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 157/176 (89%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLEALNQLE+GLKDNIKKL SFDKY
Sbjct  278  LRNLLSKGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEALNQLEDGLKDNIKKLRSFDKY  337

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLL HLDWSPMHKDPAFWR+N TNFEENDFQILRVL+TILDTSSDPR LAVACFDLS
Sbjct  338  KQEVLLAHLDWSPMHKDPAFWRENATNFEENDFQILRVLLTILDTSSDPRALAVACFDLS  397

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFLQ 
Sbjct  398  QFIQHHPAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFLQA  453



>ref|XP_006343605.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006343606.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343607.1| PREDICTED: V-type proton ATPase subunit H-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006343608.1| PREDICTED: V-type proton ATPase subunit H-like isoform X4 [Solanum 
tuberosum]
Length=454

 Score =   324 bits (830),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL KGTF A +VDLGVL IVQ+LKAQAWSDEDLL+ALNQLE+GLK+NIKKLSSFDKY
Sbjct  279  LRNLLSKGTFSAHMVDLGVLQIVQSLKAQAWSDEDLLDALNQLEQGLKENIKKLSSFDKY  338

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDTSSD RTLAVAC+DLS
Sbjct  339  KQEVLLGHLDWSPMHKDPIFWRENINNFEENDFQILRVLITILDTSSDARTLAVACYDLS  398

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQCH AGR+IV DLKAKER M+LLNHEN EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  399  QFIQCHSAGRIIVNDLKAKERVMRLLNHENAEVTKNALLCIQRLFLGAKYASFLQ  453



>ref|XP_008343829.1| PREDICTED: V-type proton ATPase subunit H-like [Malus domestica]
 ref|XP_008343831.1| PREDICTED: V-type proton ATPase subunit H-like [Malus domestica]
Length=452

 Score =   323 bits (829),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL KG FGA +VDLG+  IVQNLKAQAWSDEDLLE LNQLEEGLKDNIKKLSSFDKY
Sbjct  277  LRNLLSKGAFGAQMVDLGLPQIVQNLKAQAWSDEDLLEGLNQLEEGLKDNIKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+NITNFE+NDFQILRVLITILDTSSDPR LAVACFD+S
Sbjct  337  KQEVLLGHLDWSPMHKDPIFWRENITNFEDNDFQILRVLITILDTSSDPRALAVACFDIS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QF+Q HPAGR IVTDLKAKER MKL+NHE+ EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  397  QFVQQHPAGRSIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLFLGAKYASFLQ  451



>ref|XP_004307846.1| PREDICTED: V-type proton ATPase subunit H [Fragaria vesca subsp. 
vesca]
Length=451

 Score =   323 bits (829),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLE LNQLEEGLKDNIKKLSSFDKY
Sbjct  276  LRNLLSKGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEGLNQLEEGLKDNIKKLSSFDKY  335

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKD  FWR+NITNFEENDFQILRVLITILDTSSDPR LAVACFD+S
Sbjct  336  KQEVLLGHLDWSPMHKDAIFWRENITNFEENDFQILRVLITILDTSSDPRALAVACFDIS  395

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QF+Q HPAGR+IVTDLKAKER MKL+NHE+ EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  396  QFVQHHPAGRIIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLFLGAKYASFLQ  450



>ref|XP_006437440.1| hypothetical protein CICLE_v10031531mg [Citrus clementina]
 ref|XP_006437441.1| hypothetical protein CICLE_v10031531mg [Citrus clementina]
 gb|ESR50680.1| hypothetical protein CICLE_v10031531mg [Citrus clementina]
 gb|ESR50681.1| hypothetical protein CICLE_v10031531mg [Citrus clementina]
Length=447

 Score =   323 bits (828),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL KG F A ++DLG+  +VQ+LKAQAWSDEDLLE LNQLEEGLKDNIK+LSSFDKY
Sbjct  272  LRNLLPKGNFAAQMIDLGLPQVVQSLKAQAWSDEDLLEGLNQLEEGLKDNIKRLSSFDKY  331

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWRDNITNFEENDFQILRVL+TILDTSSDPR LAVACFDLS
Sbjct  332  KQEVLLGHLDWSPMHKDPLFWRDNITNFEENDFQILRVLLTILDTSSDPRALAVACFDLS  391

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKYASFLQ
Sbjct  392  QFIQYHPAGRVIVTDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYASFLQ  446



>ref|XP_004242619.1| PREDICTED: V-type proton ATPase subunit H [Solanum lycopersicum]
Length=454

 Score =   323 bits (828),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL KGTF A +VDLGVL IVQ+LKAQAWSDEDLL+ALNQLE+GLK+NIKKLSSFDKY
Sbjct  279  LRNLLSKGTFSAHMVDLGVLQIVQSLKAQAWSDEDLLDALNQLEQGLKENIKKLSSFDKY  338

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDTSSD RTLAVAC+DLS
Sbjct  339  KQEVLLGHLDWSPMHKDPIFWRENINNFEENDFQILRVLITILDTSSDARTLAVACYDLS  398

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQCH AGR+IV DLKAKER M+LLNH+N EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  399  QFIQCHSAGRIIVNDLKAKERVMRLLNHDNAEVTKNALLCIQRLFLGAKYASFLQ  453



>ref|XP_011077102.1| PREDICTED: V-type proton ATPase subunit H-like [Sesamum indicum]
Length=453

 Score =   323 bits (827),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 155/175 (89%), Positives = 166/175 (95%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLLHKG+FGA +VDLG+L IVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY
Sbjct  278  LRNLLHKGSFGAQMVDLGLLLIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  337

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+NITNFEE+DFQILRVLITILDTS+D RTLAVAC+DLS
Sbjct  338  KQEVLLGHLDWSPMHKDPTFWRENITNFEEHDFQILRVLITILDTSTDARTLAVACYDLS  397

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ H AGR+IV DLKAK+R MKL++HEN EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  398  QFIQYHSAGRIIVNDLKAKDRVMKLMDHENAEVTKNALLCIQRLFLGAKYASFLQ  452



>ref|XP_010662098.1| PREDICTED: V-type proton ATPase subunit H [Vitis vinifera]
Length=452

 Score =   322 bits (824),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            L+NLL KG FGA +VDLG+L IVQ+LKAQAWSDEDL+EALNQL+EGLK NIKKLSSFDKY
Sbjct  277  LKNLLSKGAFGAQMVDLGLLQIVQSLKAQAWSDEDLMEALNQLDEGLKANIKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW+P+HKDP FWRDNI+NFEENDFQILRVLITILDTSSDPR LAVACFDLS
Sbjct  337  KQEVLLGHLDWTPVHKDPMFWRDNISNFEENDFQILRVLITILDTSSDPRALAVACFDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGRVIV DLKAKER MKL+NHEN EVTKN+LLCIQRLFLGAKYASFLQ
Sbjct  397  QFIQYHPAGRVIVNDLKAKERVMKLMNHENAEVTKNSLLCIQRLFLGAKYASFLQ  451



>ref|XP_010251374.1| PREDICTED: V-type proton ATPase subunit H [Nelumbo nucifera]
 ref|XP_010251375.1| PREDICTED: V-type proton ATPase subunit H [Nelumbo nucifera]
Length=452

 Score =   322 bits (824),  Expect = 5e-104, Method: Compositional matrix adjust.
 Identities = 154/175 (88%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            L+NLL +GTFGA +VDLG+  IVQNLKAQAWSDEDLLEALN LEEGLKDNIKKLSSFDKY
Sbjct  277  LKNLLSRGTFGAQMVDLGLPQIVQNLKAQAWSDEDLLEALNHLEEGLKDNIKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+N+TNFEENDFQILRVLITILDTS+DPR LAVAC+DLS
Sbjct  337  KQEVLLGHLDWSPMHKDPWFWRENMTNFEENDFQILRVLITILDTSNDPRALAVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ H AGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  397  QFIQYHSAGRIIVTDLKAKERVMKLMNHENSEVTKNALLCIQRLFLGAKYASFLQ  451



>gb|EYU39492.1| hypothetical protein MIMGU_mgv1a006273mg [Erythranthe guttata]
Length=450

 Score =   321 bits (823),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 154/176 (88%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLLHKGTFGA +VDLG+  +VQ+LKAQAWSDEDLLEALNQLEEGLKDNIKKLSSF+KY
Sbjct  275  LRNLLHKGTFGAQMVDLGLPQLVQSLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFEKY  334

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQE LLGHLDWSPMHKDP FWRDNIT+FEE+DFQILRVLITILDTSSD RTLAVAC+DLS
Sbjct  335  KQEALLGHLDWSPMHKDPIFWRDNITHFEEHDFQILRVLITILDTSSDSRTLAVACYDLS  394

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQ HPAGR+IV DLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKYASFLQ 
Sbjct  395  QFIQYHPAGRIIVNDLKAKERVMKLMNHENAEVTKSALLCIQRLFLGAKYASFLQT  450



>ref|XP_007029672.1| Vacuolar ATP synthase subunit H family protein isoform 2 [Theobroma 
cacao]
 gb|EOY10174.1| Vacuolar ATP synthase subunit H family protein isoform 2 [Theobroma 
cacao]
Length=453

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLEALNQLE+GLKDNIKKLSSFDKY
Sbjct  278  FRNLLSKGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEALNQLEDGLKDNIKKLSSFDKY  337

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWRDNIT FEENDFQILRVLITI+D+S+D R LAVACFDLS
Sbjct  338  KQEVLLGHLDWSPMHKDPLFWRDNITCFEENDFQILRVLITIMDSSNDSRALAVACFDLS  397

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQ HPAGRVIVTDLKAKER MKL+NHE+ EVTKNALLCIQRLFLGAKYASFLQV
Sbjct  398  QFIQHHPAGRVIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLFLGAKYASFLQV  453



>emb|CBI26482.3| unnamed protein product [Vitis vinifera]
Length=483

 Score =   321 bits (823),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            L+NLL KG FGA +VDLG+L IVQ+LKAQAWSDEDL+EALNQL+EGLK NIKKLSSFDKY
Sbjct  308  LKNLLSKGAFGAQMVDLGLLQIVQSLKAQAWSDEDLMEALNQLDEGLKANIKKLSSFDKY  367

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW+P+HKDP FWRDNI+NFEENDFQILRVLITILDTSSDPR LAVACFDLS
Sbjct  368  KQEVLLGHLDWTPVHKDPMFWRDNISNFEENDFQILRVLITILDTSSDPRALAVACFDLS  427

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGRVIV DLKAKER MKL+NHEN EVTKN+LLCIQRLFLGAKYASFLQ
Sbjct  428  QFIQYHPAGRVIVNDLKAKERVMKLMNHENAEVTKNSLLCIQRLFLGAKYASFLQ  482



>ref|XP_007029671.1| Vacuolar ATP synthase subunit H family protein isoform 1 [Theobroma 
cacao]
 gb|EOY10173.1| Vacuolar ATP synthase subunit H family protein isoform 1 [Theobroma 
cacao]
Length=459

 Score =   320 bits (821),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 155/176 (88%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLEALNQLE+GLKDNIKKLSSFDKY
Sbjct  284  FRNLLSKGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEALNQLEDGLKDNIKKLSSFDKY  343

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWRDNIT FEENDFQILRVLITI+D+S+D R LAVACFDLS
Sbjct  344  KQEVLLGHLDWSPMHKDPLFWRDNITCFEENDFQILRVLITIMDSSNDSRALAVACFDLS  403

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQ HPAGRVIVTDLKAKER MKL+NHE+ EVTKNALLCIQRLFLGAKYASFLQV
Sbjct  404  QFIQHHPAGRVIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLFLGAKYASFLQV  459



>gb|EPS61013.1| hypothetical protein M569_13786, partial [Genlisea aurea]
Length=442

 Score =   320 bits (819),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/174 (87%), Positives = 162/174 (93%), Gaps = 0/174 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLLHKGTFGA +VD+G+  +VQNLKAQAW DEDLLE LNQLEEGLKDNIK+LSSFD Y
Sbjct  266  LRNLLHKGTFGAQMVDIGLPQLVQNLKAQAWRDEDLLETLNQLEEGLKDNIKRLSSFDNY  325

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWS MHKDPAFWR+N  NFEENDFQILRVL+TILDTS+DPRTLAVAC+DLS
Sbjct  326  KQEVLLGHLDWSIMHKDPAFWRENSANFEENDFQILRVLVTILDTSTDPRTLAVACYDLS  385

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            QFIQ HPAGR++VTDLKAKER MKLLNHEN EVTKNALLCIQRLFLGAKYASFL
Sbjct  386  QFIQHHPAGRIVVTDLKAKERVMKLLNHENAEVTKNALLCIQRLFLGAKYASFL  439



>ref|XP_004509230.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Cicer 
arietinum]
 ref|XP_004509231.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Cicer 
arietinum]
Length=452

 Score =   320 bits (820),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 166/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            L+NL+ KGT GA +VDL +  +VQ+LKAQAWSDEDLLEALN LEEGLKDNIKKLSSFDKY
Sbjct  277  LKNLMSKGTLGAQMVDLQLPQVVQSLKAQAWSDEDLLEALNSLEEGLKDNIKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLG+LDWSPMHKDP FWR+NITNFEE+DFQILRVL+TILDTS+DPRTLAVACFD+S
Sbjct  337  KQEVLLGNLDWSPMHKDPIFWRENITNFEEHDFQILRVLLTILDTSNDPRTLAVACFDIS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQCHPAGR+IVTDLKAKER MKL+NHE+ EVTKNALLCIQRLFLGAKYASFLQV
Sbjct  397  QFIQCHPAGRIIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLFLGAKYASFLQV  452



>ref|XP_006484607.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Citrus 
sinensis]
 ref|XP_006484608.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Citrus 
sinensis]
Length=452

 Score =   320 bits (819),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL KG F A ++DLG+  +VQ+LKAQAWSDEDLLE LNQLEEGLKDNIK+LSSFDKY
Sbjct  277  LRNLLPKGNFAAQMIDLGLPQVVQSLKAQAWSDEDLLEGLNQLEEGLKDNIKRLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWRDNITNFEENDFQILRVL+TIL TSSDPR LAVACFDLS
Sbjct  337  KQEVLLGHLDWSPMHKDPLFWRDNITNFEENDFQILRVLLTILHTSSDPRALAVACFDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKYASFLQ
Sbjct  397  QFIQYHPAGRVIVTDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYASFLQ  451



>ref|XP_009615905.1| PREDICTED: V-type proton ATPase subunit H-like [Nicotiana tomentosiformis]
Length=297

 Score =   313 bits (802),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL KGT+GA +VD+GVL IVQNLK QAWSDEDLL+ALNQLEEGLKDNIK LSS+DKY
Sbjct  122  LRNLLSKGTYGAQMVDVGVLQIVQNLKGQAWSDEDLLDALNQLEEGLKDNIKILSSYDKY  181

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLG+LDWSPMHKD  FW++NI NFEEN FQILRVL+TILDTSSD RTLAVAC+DLS
Sbjct  182  KQEVLLGNLDWSPMHKDLLFWKENINNFEENGFQILRVLMTILDTSSDARTLAVACYDLS  241

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQCHPAGR+IV DLKAKER MKLLNHE  EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  242  QFIQCHPAGRIIVADLKAKERVMKLLNHETAEVTKNALLCIQRLFLGAKYASFLQ  296



>gb|KJB26714.1| hypothetical protein B456_004G256400 [Gossypium raimondii]
Length=351

 Score =   315 bits (806),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLEALN LE+GLKDNIKKLSSFDKY
Sbjct  176  FRNLLSKGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEALNHLEDGLKDNIKKLSSFDKY  235

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWRDN++ FEENDFQ+LR+LITI++TSSDPR LAVACFDLS
Sbjct  236  KQEVLLGHLDWSPMHKDPLFWRDNVSCFEENDFQVLRILITIMETSSDPRALAVACFDLS  295

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGRVIV DLKAKER MKL+NH++ EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  296  QFIQHHPAGRVIVNDLKAKERVMKLMNHDSAEVTKNALLCIQRLFLGAKYASFLQ  350



>gb|KFK33830.1| hypothetical protein AALP_AA5G065600, partial [Arabis alpina]
Length=182

 Score =   308 bits (790),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKY
Sbjct  7    FRNLLPKGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKY  66

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDTSSDPR+LAVACFDLS
Sbjct  67   KQEVLLGHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDTSSDPRSLAVACFDLS  126

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ H AGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFLQ
Sbjct  127  QFIQYHAAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFLQ  181



>gb|KHN44512.1| V-type proton ATPase subunit H [Glycine soja]
Length=428

 Score =   317 bits (813),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            L+NL+ KGT GA +VDL +  +VQ+LKAQAWSDEDLLEALN LEEGLKDNIK+LSSFD Y
Sbjct  253  LKNLMSKGTLGAQMVDLQLAQVVQSLKAQAWSDEDLLEALNSLEEGLKDNIKRLSSFDMY  312

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDTS+DPRTLAVAC+DLS
Sbjct  313  KQEVLLGHLDWSPMHKDPIFWRENINNFEENDFQILRVLITILDTSNDPRTLAVACYDLS  372

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQCH AGR+IV+DLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFLQV
Sbjct  373  QFIQCHSAGRIIVSDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFLQV  428



>ref|XP_003548002.1| PREDICTED: V-type proton ATPase subunit H-like isoform 2 [Glycine 
max]
Length=452

 Score =   317 bits (813),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/176 (85%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            L+NL+ KGT GA +VDL +  +VQ+LKAQAWSDEDLLEALN LEEGLKDNIK+LSSFD Y
Sbjct  277  LKNLMSKGTLGAQMVDLQLAQVVQSLKAQAWSDEDLLEALNSLEEGLKDNIKRLSSFDMY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDTS+DPRTLAVAC+DLS
Sbjct  337  KQEVLLGHLDWSPMHKDPIFWRENINNFEENDFQILRVLITILDTSNDPRTLAVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQCH AGR+IV+DLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFLQV
Sbjct  397  QFIQCHSAGRIIVSDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFLQV  452



>ref|XP_011652170.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Cucumis 
sativus]
Length=369

 Score =   314 bits (805),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLLHKGTFGA +V LG+  +VQ+LK+QAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY
Sbjct  194  LRNLLHKGTFGAQMVGLGLPQVVQSLKSQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  253

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKD  FWR+NIT+FEEND +ILRVLITILD+S+DPR LAVACFDLS
Sbjct  254  KQEVLLGHLDWSPMHKDVNFWRENITSFEENDLKILRVLITILDSSTDPRALAVACFDLS  313

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK ALLCIQRLFLGAKYASFLQ
Sbjct  314  QFIQHHPAGRVIVTDLKAKERVMKLMNHENAEVTKYALLCIQRLFLGAKYASFLQ  368



>ref|XP_011628722.1| PREDICTED: V-type proton ATPase subunit H [Amborella trichopoda]
Length=449

 Score =   317 bits (811),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            L+NLL KGTFGA +VDLG+  IVQ LKAQAWSDEDLL+ALNQLEEGLKDNIKK+SSFDKY
Sbjct  274  LKNLLPKGTFGAQMVDLGLPQIVQILKAQAWSDEDLLDALNQLEEGLKDNIKKMSSFDKY  333

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMH+DP FWR+NI NFEENDFQI+RVL+TILDTS+DPR LAVAC+DLS
Sbjct  334  KQEVLLGHLDWSPMHRDPVFWRENIKNFEENDFQIVRVLLTILDTSTDPRALAVACYDLS  393

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGR I++DLKAK+R MKL+NHENPEVTKNALLCIQRLFLGAKYASFLQ
Sbjct  394  QFIQYHPAGRGILSDLKAKDRVMKLMNHENPEVTKNALLCIQRLFLGAKYASFLQ  448



>ref|XP_007156009.1| hypothetical protein PHAVU_003G250900g [Phaseolus vulgaris]
 gb|ESW28003.1| hypothetical protein PHAVU_003G250900g [Phaseolus vulgaris]
Length=491

 Score =   318 bits (814),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            L+NL+ KGT GA +VDL +  +VQ+LKAQAWSDEDLLEALN LEEGLKDNIKKLSSFD Y
Sbjct  316  LKNLMSKGTLGAQMVDLQLPQVVQSLKAQAWSDEDLLEALNSLEEGLKDNIKKLSSFDMY  375

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+NITNFEENDFQI RVLITILDTSSDPRTLAVAC+D+S
Sbjct  376  KQEVLLGHLDWSPMHKDPIFWRENITNFEENDFQIPRVLITILDTSSDPRTLAVACYDIS  435

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQ HPAGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFLQV
Sbjct  436  QFIQHHPAGRIIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFLQV  491



>ref|XP_008800912.1| PREDICTED: probable V-type proton ATPase subunit H [Phoenix dactylifera]
Length=452

 Score =   317 bits (811),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KG FGA ++DLG+ HIVQ+LKAQAWSDEDLL ALNQLE+GLKDNIK+LSSFDKY
Sbjct  277  FRNLLAKGAFGAQMIDLGLPHIVQSLKAQAWSDEDLLAALNQLEDGLKDNIKRLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWRDNITNFEENDFQILRVL+TILD S+DP  LAVAC+DLS
Sbjct  337  KQEVLLGHLDWSPMHKDPNFWRDNITNFEENDFQILRVLVTILDMSNDPTALAVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HP GR++V+DLKAKERAMKL+NHEN EVTKNALLC+QRLFLGAKYASFLQ
Sbjct  397  QFIQYHPGGRIVVSDLKAKERAMKLMNHENAEVTKNALLCVQRLFLGAKYASFLQ  451



>gb|ERN20283.1| hypothetical protein AMTR_s00066p00170500 [Amborella trichopoda]
Length=475

 Score =   317 bits (811),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 164/175 (94%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            L+NLL KGTFGA +VDLG+  IVQ LKAQAWSDEDLL+ALNQLEEGLKDNIKK+SSFDKY
Sbjct  300  LKNLLPKGTFGAQMVDLGLPQIVQILKAQAWSDEDLLDALNQLEEGLKDNIKKMSSFDKY  359

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMH+DP FWR+NI NFEENDFQI+RVL+TILDTS+DPR LAVAC+DLS
Sbjct  360  KQEVLLGHLDWSPMHRDPVFWRENIKNFEENDFQIVRVLLTILDTSTDPRALAVACYDLS  419

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGR I++DLKAK+R MKL+NHENPEVTKNALLCIQRLFLGAKYASFLQ
Sbjct  420  QFIQYHPAGRGILSDLKAKDRVMKLMNHENPEVTKNALLCIQRLFLGAKYASFLQ  474



>gb|KJB18498.1| hypothetical protein B456_003G056300 [Gossypium raimondii]
Length=463

 Score =   316 bits (810),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 152/176 (86%), Positives = 163/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGT GA +VDLG+  I+Q+LKAQAWSDEDLLEALNQLE+GLKDNIKKLSSFDKY
Sbjct  288  FRNLLSKGTCGAQMVDLGLPQIIQSLKAQAWSDEDLLEALNQLEDGLKDNIKKLSSFDKY  347

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWRDNIT FEENDFQILRVLITI+D+S+DPR LAVACFD+S
Sbjct  348  KQEVLLGHLDWSPMHKDPLFWRDNITCFEENDFQILRVLITIMDSSNDPRPLAVACFDIS  407

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQ HPAGRVIV DLKAKER MKL+NHE+ EVTKNALLCIQRLFLGAKYASFLQV
Sbjct  408  QFIQHHPAGRVIVNDLKAKERVMKLMNHESAEVTKNALLCIQRLFLGAKYASFLQV  463



>ref|XP_004136630.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Cucumis 
sativus]
 ref|XP_011652169.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Cucumis 
sativus]
 gb|KGN59423.1| hypothetical protein Csa_3G819800 [Cucumis sativus]
Length=454

 Score =   316 bits (809),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 152/175 (87%), Positives = 163/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLLHKGTFGA +V LG+  +VQ+LK+QAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY
Sbjct  279  LRNLLHKGTFGAQMVGLGLPQVVQSLKSQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  338

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKD  FWR+NIT+FEEND +ILRVLITILD+S+DPR LAVACFDLS
Sbjct  339  KQEVLLGHLDWSPMHKDVNFWRENITSFEENDLKILRVLITILDSSTDPRALAVACFDLS  398

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK ALLCIQRLFLGAKYASFLQ
Sbjct  399  QFIQHHPAGRVIVTDLKAKERVMKLMNHENAEVTKYALLCIQRLFLGAKYASFLQ  453



>ref|XP_002520072.1| vacuolar ATP synthase subunit h, putative [Ricinus communis]
 gb|EEF42396.1| vacuolar ATP synthase subunit h, putative [Ricinus communis]
Length=446

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             +NLL +GTFGA +VDLG+  +VQ+LK +AWSDEDLLEALNQLEEGL+DNIKKLSSFDKY
Sbjct  271  FKNLLSRGTFGAQMVDLGLPQVVQSLKTRAWSDEDLLEALNQLEEGLRDNIKKLSSFDKY  330

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW+PMHKDP FWR+N+ NFEENDFQILRVLITILDTS+D R LAVACFDLS
Sbjct  331  KQEVLLGHLDWTPMHKDPIFWRENLNNFEENDFQILRVLITILDTSNDSRALAVACFDLS  390

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGR+IVTDLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  391  QFIQNHPAGRIIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFLQ  445



>ref|XP_003629515.1| V-type proton ATPase subunit H [Medicago truncatula]
Length=448

 Score =   315 bits (806),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            L+NL+ KGT GA +VDL +  +VQ+LKAQAWSDEDLLEALN LEEGLKDNIKKLSSFDKY
Sbjct  273  LKNLMSKGTLGAQMVDLQLPQVVQSLKAQAWSDEDLLEALNSLEEGLKDNIKKLSSFDKY  332

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLG+LDWSPMHKDP FWR+NITNFEE+DFQILRVL+TILD+S+DPRTLAVACFD+S
Sbjct  333  KQEVLLGNLDWSPMHKDPIFWRENITNFEEHDFQILRVLLTILDSSNDPRTLAVACFDIS  392

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQ HPAGR+IVTDLKAKER MKL+NHE+ EVTKNALLCIQRLFLGAKYASFLQV
Sbjct  393  QFIQSHPAGRIIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLFLGAKYASFLQV  448



>ref|XP_008443235.1| PREDICTED: V-type proton ATPase subunit H [Cucumis melo]
 ref|XP_008443236.1| PREDICTED: V-type proton ATPase subunit H [Cucumis melo]
Length=454

 Score =   315 bits (807),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 153/175 (87%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLLHKGTFGA +V LG+  IVQ+LK+QAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY
Sbjct  279  LRNLLHKGTFGAQMVGLGLPQIVQSLKSQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  338

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKD  FWR+NI +FEEND +ILRVLITILD+SSDPR LAVACFDLS
Sbjct  339  KQEVLLGHLDWSPMHKDVNFWRENIMSFEENDLKILRVLITILDSSSDPRALAVACFDLS  398

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK ALLCIQRLFLGAKYASFLQ
Sbjct  399  QFIQHHPAGRVIVTDLKAKERVMKLMNHENAEVTKYALLCIQRLFLGAKYASFLQ  453



>gb|AET03991.2| vacuolar H+-ATPase subunit H, putative [Medicago truncatula]
Length=486

 Score =   315 bits (807),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 165/176 (94%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            L+NL+ KGT GA +VDL +  +VQ+LKAQAWSDEDLLEALN LEEGLKDNIKKLSSFDKY
Sbjct  311  LKNLMSKGTLGAQMVDLQLPQVVQSLKAQAWSDEDLLEALNSLEEGLKDNIKKLSSFDKY  370

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLG+LDWSPMHKDP FWR+NITNFEE+DFQILRVL+TILD+S+DPRTLAVACFD+S
Sbjct  371  KQEVLLGNLDWSPMHKDPIFWRENITNFEEHDFQILRVLLTILDSSNDPRTLAVACFDIS  430

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQ HPAGR+IVTDLKAKER MKL+NHE+ EVTKNALLCIQRLFLGAKYASFLQV
Sbjct  431  QFIQSHPAGRIIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLFLGAKYASFLQV  486



>gb|KJB26715.1| hypothetical protein B456_004G256400 [Gossypium raimondii]
Length=481

 Score =   314 bits (805),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 149/175 (85%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLEALN LE+GLKDNIKKLSSFDKY
Sbjct  306  FRNLLSKGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEALNHLEDGLKDNIKKLSSFDKY  365

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWRDN++ FEENDFQ+LR+LITI++TSSDPR LAVACFDLS
Sbjct  366  KQEVLLGHLDWSPMHKDPLFWRDNVSCFEENDFQVLRILITIMETSSDPRALAVACFDLS  425

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGRVIV DLKAKER MKL+NH++ EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  426  QFIQHHPAGRVIVNDLKAKERVMKLMNHDSAEVTKNALLCIQRLFLGAKYASFLQ  480



>gb|KHG22602.1| V-type proton ATPase subunit H -like protein [Gossypium arboreum]
Length=494

 Score =   315 bits (806),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLEALN LE+GLKDNIKKLSSFDKY
Sbjct  319  FRNLLSKGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEALNHLEDGLKDNIKKLSSFDKY  378

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWRDN++ FEENDFQ+LRVLITI++TSSDPR LAVACFDLS
Sbjct  379  KQEVLLGHLDWSPMHKDPLFWRDNVSCFEENDFQVLRVLITIMETSSDPRALAVACFDLS  438

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGRVIV DLKAKER MKL+NH++ EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  439  QFIQHHPAGRVIVNDLKAKERVMKLMNHDSAEVTKNALLCIQRLFLGAKYASFLQ  493



>ref|XP_010547995.1| PREDICTED: V-type proton ATPase subunit H [Tarenaya hassleriana]
 ref|XP_010547996.1| PREDICTED: V-type proton ATPase subunit H [Tarenaya hassleriana]
Length=452

 Score =   313 bits (802),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+ HIV +LK QAWSDEDLLEALNQLEEGLKD I+KLSSFDKY
Sbjct  277  FRNLLPKGTFGAQMVDLGLPHIVASLKTQAWSDEDLLEALNQLEEGLKDKIRKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW+PMHKD AFWR+NI  FEENDFQILRVLITILD+SSDPR+LAVAC+DLS
Sbjct  337  KQEVLLGHLDWTPMHKDLAFWRENIMGFEENDFQILRVLITILDSSSDPRSLAVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFLQ
Sbjct  397  QFIQYHPAGRVIVNDLKAKERVMKLMNHENSEVTKNALLCIQRLLLGAKYASFLQ  451



>gb|ACJ85007.1| unknown [Medicago truncatula]
 gb|AFK33862.1| unknown [Medicago truncatula]
Length=452

 Score =   313 bits (801),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            L+NL+ KGT GA +VDL +  + Q+LKAQAWSDEDLLEALN LEEGLKDNIKKLSSFDKY
Sbjct  277  LKNLMSKGTLGAQMVDLQLPQVAQSLKAQAWSDEDLLEALNSLEEGLKDNIKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLG+LDWSPMHKDP FWR+NITNFEE+DFQILRVL+TILD+S+DPRTLAVACFD+S
Sbjct  337  KQEVLLGNLDWSPMHKDPIFWRENITNFEEHDFQILRVLLTILDSSNDPRTLAVACFDIS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQ HPAGR+IVTDLKAKER MKL+NHE+ EVTKNALLCIQRLFLGAKYASFLQV
Sbjct  397  QFIQSHPAGRIIVTDLKAKERVMKLMNHESAEVTKNALLCIQRLFLGAKYASFLQV  452



>gb|AFK35511.1| unknown [Lotus japonicus]
Length=429

 Score =   312 bits (799),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            L+NLL KGTFGA +V+L +  +VQ+LKAQAWSDEDLLEALN LE+GLKDNIKKLSS+DKY
Sbjct  254  LKNLLPKGTFGAQMVELQLPQVVQSLKAQAWSDEDLLEALNYLEDGLKDNIKKLSSYDKY  313

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQ VLLGHLDWSPMHKD  FWR+NITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS
Sbjct  314  KQGVLLGHLDWSPMHKDSIFWRENITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  373

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QF+Q HPAGR IVTDLKAKER MKL+NHEN EVTKNALLCIQRLFLG+KYASFLQ
Sbjct  374  QFVQHHPAGRFIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGSKYASFLQ  428



>emb|CDX69032.1| BnaC01g04210D [Brassica napus]
Length=452

 Score =   312 bits (800),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKDNIKKLSSFDKY
Sbjct  277  FRNLLPKGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDNIKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDTSSDPR+LAVAC+DLS
Sbjct  337  KQEVLLGHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDTSSDPRSLAVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ H AGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFLQ
Sbjct  397  QFIQYHAAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFLQ  451



>ref|XP_009115735.1| PREDICTED: V-type proton ATPase subunit H-like [Brassica rapa]
 gb|AID60130.1| AT3g42050-like protein [Brassica napus]
 emb|CDX75407.1| BnaA01g02950D [Brassica napus]
Length=452

 Score =   312 bits (799),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKDNIKKLSSFDKY
Sbjct  277  FRNLLPKGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDNIKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDTSSDPR+LAVAC+DLS
Sbjct  337  KQEVLLGHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDTSSDPRSLAVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ H AGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFLQ
Sbjct  397  QFIQYHAAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFLQ  451



>ref|XP_010912760.1| PREDICTED: probable V-type proton ATPase subunit H isoform X3 
[Elaeis guineensis]
Length=391

 Score =   309 bits (792),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = -1

Query  773  NLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQ  594
            NLL KG FGA ++DLG+  IVQ+LKAQAWSDEDLL+ALNQLE+GLKDN+K+LSSFDKYKQ
Sbjct  218  NLLAKGAFGAQMIDLGLPQIVQSLKAQAWSDEDLLDALNQLEDGLKDNMKRLSSFDKYKQ  277

Query  593  EVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQF  414
            EVLLGHLDWSPMHKDP FWR+NITNFEENDFQILRVLITILDTS+DP  LAVAC+DLSQF
Sbjct  278  EVLLGHLDWSPMHKDPNFWRENITNFEENDFQILRVLITILDTSNDPTALAVACYDLSQF  337

Query  413  IQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            IQ HP GR++++D+KAKER MKL+NHEN EVTKNALLC+QRLFLGAKYASFLQ
Sbjct  338  IQYHPGGRIVISDMKAKERVMKLMNHENAEVTKNALLCVQRLFLGAKYASFLQ  390



>emb|CDY49280.1| BnaA03g50930D [Brassica napus]
Length=450

 Score =   310 bits (795),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKY
Sbjct  275  FRNLLPKGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKY  334

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDTS+DPR+LAVACFD+S
Sbjct  335  KQEVLLGHLDWNPMHKEANFWRENVTCFEENDFQILRVLLTILDTSTDPRSLAVACFDIS  394

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFLQ
Sbjct  395  QFIQYHPAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFLQ  449



>emb|CDX72455.1| BnaC07g44770D [Brassica napus]
Length=450

 Score =   310 bits (795),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKY
Sbjct  275  FRNLLPKGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKY  334

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDTS+DPR+LAVACFD+S
Sbjct  335  KQEVLLGHLDWNPMHKEANFWRENVTCFEENDFQILRVLLTILDTSTDPRSLAVACFDIS  394

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFLQ
Sbjct  395  QFIQYHPAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFLQ  449



>gb|KCW59595.1| hypothetical protein EUGRSUZ_H02340 [Eucalyptus grandis]
Length=438

 Score =   310 bits (794),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGAL+VDLG+  IVQ+LK+QAWSDEDLLEALN+LE+GLKDNIKKLSSFDKY
Sbjct  263  FRNLLPKGTFGALMVDLGLPQIVQSLKSQAWSDEDLLEALNELEQGLKDNIKKLSSFDKY  322

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLG LDWSPMHKDP FWR+NIT+FE++DFQILRVL+TILDTSSD R LAVAC+DLS
Sbjct  323  KQEVLLGQLDWSPMHKDPIFWRENITSFEDSDFQILRVLVTILDTSSDARALAVACYDLS  382

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQ HPAGR+I++DLKAK+R MKLLNH+N EVTKNALLC QRLFLGAKYASFLQV
Sbjct  383  QFIQYHPAGRIILSDLKAKDRVMKLLNHDNAEVTKNALLCSQRLFLGAKYASFLQV  438



>ref|XP_009138267.1| PREDICTED: V-type proton ATPase subunit H [Brassica rapa]
Length=451

 Score =   310 bits (794),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKY
Sbjct  276  FRNLLPKGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKY  335

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDTS+DPR+LAVACFD+S
Sbjct  336  KQEVLLGHLDWNPMHKEANFWRENVTCFEENDFQILRVLLTILDTSTDPRSLAVACFDIS  395

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFLQ
Sbjct  396  QFIQYHPAGRVIVTDLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFLQ  450



>ref|XP_010912758.1| PREDICTED: probable V-type proton ATPase subunit H isoform X2 
[Elaeis guineensis]
Length=431

 Score =   309 bits (792),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = -1

Query  773  NLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQ  594
            NLL KG FGA ++DLG+  IVQ+LKAQAWSDEDLL+ALNQLE+GLKDN+K+LSSFDKYKQ
Sbjct  258  NLLAKGAFGAQMIDLGLPQIVQSLKAQAWSDEDLLDALNQLEDGLKDNMKRLSSFDKYKQ  317

Query  593  EVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQF  414
            EVLLGHLDWSPMHKDP FWR+NITNFEENDFQILRVLITILDTS+DP  LAVAC+DLSQF
Sbjct  318  EVLLGHLDWSPMHKDPNFWRENITNFEENDFQILRVLITILDTSNDPTALAVACYDLSQF  377

Query  413  IQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            IQ HP GR++++D+KAKER MKL+NHEN EVTKNALLC+QRLFLGAKYASFLQ
Sbjct  378  IQYHPGGRIVISDMKAKERVMKLMNHENAEVTKNALLCVQRLFLGAKYASFLQ  430



>ref|XP_010023341.1| PREDICTED: V-type proton ATPase subunit H [Eucalyptus grandis]
Length=443

 Score =   309 bits (792),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 147/176 (84%), Positives = 164/176 (93%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGAL+VDLG+  IVQ+LK+QAWSDEDLLEALN+LE+GLKDNIKKLSSFDKY
Sbjct  268  FRNLLPKGTFGALMVDLGLPQIVQSLKSQAWSDEDLLEALNELEQGLKDNIKKLSSFDKY  327

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLG LDWSPMHKDP FWR+NIT+FE++DFQILRVL+TILDTSSD R LAVAC+DLS
Sbjct  328  KQEVLLGQLDWSPMHKDPIFWRENITSFEDSDFQILRVLVTILDTSSDARALAVACYDLS  387

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQ HPAGR+I++DLKAK+R MKLLNH+N EVTKNALLC QRLFLGAKYASFLQV
Sbjct  388  QFIQYHPAGRIILSDLKAKDRVMKLLNHDNAEVTKNALLCSQRLFLGAKYASFLQV  443



>ref|XP_006574707.1| PREDICTED: V-type proton ATPase subunit H-like [Glycine max]
Length=452

 Score =   310 bits (793),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            L+NL+ KGT GA +VDL +  +V +LKAQAWSDEDLLEALN LEEGLKDNIK+LSSFD Y
Sbjct  277  LKNLMSKGTLGAQMVDLQLAQVVLSLKAQAWSDEDLLEALNSLEEGLKDNIKRLSSFDMY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVL+TILDTSSDPRTLAVAC+DLS
Sbjct  337  KQEVLLGHLDWSPMHKDPIFWRENINNFEENDFQILRVLLTILDTSSDPRTLAVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQ H AGR+IV+DLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFLQV
Sbjct  397  QFIQHHSAGRIIVSDLKAKERVMKLMNHENVEVTKNALLCIQRLFLGAKYASFLQV  452



>ref|XP_010912757.1| PREDICTED: probable V-type proton ATPase subunit H isoform X1 
[Elaeis guineensis]
Length=452

 Score =   309 bits (792),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 143/173 (83%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = -1

Query  773  NLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQ  594
            NLL KG FGA ++DLG+  IVQ+LKAQAWSDEDLL+ALNQLE+GLKDN+K+LSSFDKYKQ
Sbjct  279  NLLAKGAFGAQMIDLGLPQIVQSLKAQAWSDEDLLDALNQLEDGLKDNMKRLSSFDKYKQ  338

Query  593  EVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQF  414
            EVLLGHLDWSPMHKDP FWR+NITNFEENDFQILRVLITILDTS+DP  LAVAC+DLSQF
Sbjct  339  EVLLGHLDWSPMHKDPNFWRENITNFEENDFQILRVLITILDTSNDPTALAVACYDLSQF  398

Query  413  IQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            IQ HP GR++++D+KAKER MKL+NHEN EVTKNALLC+QRLFLGAKYASFLQ
Sbjct  399  IQYHPGGRIVISDMKAKERVMKLMNHENAEVTKNALLCVQRLFLGAKYASFLQ  451



>ref|XP_008791825.1| PREDICTED: probable V-type proton ATPase subunit H isoform X2 
[Phoenix dactylifera]
Length=431

 Score =   308 bits (790),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KG FGA ++DLG+  IVQ+LKAQAWSDEDLL+ALNQLE GLKDN+K+LSSFDKY
Sbjct  256  FRNLLTKGAFGAQMIDLGLPQIVQSLKAQAWSDEDLLDALNQLEAGLKDNMKRLSSFDKY  315

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDTS+DP  LAVAC+DLS
Sbjct  316  KQEVLLGHLDWSPMHKDPNFWRENIANFEENDFQILRVLITILDTSNDPTALAVACYDLS  375

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HP GR++V+D+KAKER MKL+NHEN EVTKNALLC+QRLFLGAKYASFLQ
Sbjct  376  QFIQHHPGGRIVVSDMKAKERVMKLMNHENAEVTKNALLCVQRLFLGAKYASFLQ  430



>ref|XP_010526971.1| PREDICTED: V-type proton ATPase subunit H-like [Tarenaya hassleriana]
Length=452

 Score =   309 bits (791),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 149/176 (85%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL K TFGA +VDLG+ HIV +L+ QAWSDEDLLEALNQLEEGLKDNI+K SSFDKY
Sbjct  277  FRNLLPKVTFGAQMVDLGLPHIVASLRTQAWSDEDLLEALNQLEEGLKDNIRKSSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW+PMHKDPAFWR+NI NFE NDFQILRVLITIL+TSSDPRTLAVACFD+S
Sbjct  337  KQEVLLGHLDWTPMHKDPAFWRENIVNFEGNDFQILRVLITILETSSDPRTLAVACFDIS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQ HPAGRVIV DLKAKER MKL++HEN EVTKNALL IQRL LGAKYASFLQV
Sbjct  397  QFIQFHPAGRVIVNDLKAKERVMKLMSHENVEVTKNALLSIQRLLLGAKYASFLQV  452



>ref|XP_006437446.1| hypothetical protein CICLE_v10032936mg [Citrus clementina]
 gb|ESR50686.1| hypothetical protein CICLE_v10032936mg [Citrus clementina]
Length=163

 Score =   298 bits (764),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 151/163 (93%), Gaps = 0/163 (0%)
 Frame = -1

Query  740  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  561
            ++DLG+  +VQ+LKAQAWSDEDLLE LNQLEEGLKDN K+LSS DKY QEVLLGHLDWSP
Sbjct  1    MIDLGLPQVVQSLKAQAWSDEDLLEGLNQLEEGLKDNTKRLSSLDKYMQEVLLGHLDWSP  60

Query  560  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAGRVIV  381
            MHKDP FWRDNITNFEENDFQILRVL+TILDTSSDPR LAVACFDLSQFIQ HPAGRVIV
Sbjct  61   MHKDPLFWRDNITNFEENDFQILRVLLTILDTSSDPRALAVACFDLSQFIQYHPAGRVIV  120

Query  380  TDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            TDLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKYASFLQ 
Sbjct  121  TDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYASFLQA  163



>ref|XP_008791823.1| PREDICTED: probable V-type proton ATPase subunit H isoform X1 
[Phoenix dactylifera]
 ref|XP_008791824.1| PREDICTED: probable V-type proton ATPase subunit H isoform X1 
[Phoenix dactylifera]
Length=452

 Score =   308 bits (790),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KG FGA ++DLG+  IVQ+LKAQAWSDEDLL+ALNQLE GLKDN+K+LSSFDKY
Sbjct  277  FRNLLTKGAFGAQMIDLGLPQIVQSLKAQAWSDEDLLDALNQLEAGLKDNMKRLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVLITILDTS+DP  LAVAC+DLS
Sbjct  337  KQEVLLGHLDWSPMHKDPNFWRENIANFEENDFQILRVLITILDTSNDPTALAVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HP GR++V+D+KAKER MKL+NHEN EVTKNALLC+QRLFLGAKYASFLQ
Sbjct  397  QFIQHHPGGRIVVSDMKAKERVMKLMNHENAEVTKNALLCVQRLFLGAKYASFLQ  451



>ref|XP_010437658.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Camelina 
sativa]
Length=452

 Score =   308 bits (789),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKY
Sbjct  277  FRNLLPKGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDTSSDPR+LAVACFD+S
Sbjct  337  KQEVLLGHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDTSSDPRSLAVACFDIS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFLQ
Sbjct  397  QFIQYHAAGRVIVADLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFLQ  451



>ref|XP_002869169.1| vacuolar ATP synthase subunit H family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45428.1| vacuolar ATP synthase subunit H family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=418

 Score =   307 bits (786),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+ HI+Q+LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKY
Sbjct  243  FRNLLPKGTFGAQMVDLGLPHIIQSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKY  302

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDTSSDPR+LAVACFD+S
Sbjct  303  KQEVLLGHLDWNPMHKEANFWRENVTCFEENDFQILRVLLTILDTSSDPRSLAVACFDIS  362

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFLQ
Sbjct  363  QFIQYHAAGRVIVADLKAKERVMKLMNHENTEVTKNALLCIQRLLLGAKYASFLQ  417



>ref|XP_006283723.1| hypothetical protein CARUB_v10004791mg [Capsella rubella]
 gb|EOA16621.1| hypothetical protein CARUB_v10004791mg [Capsella rubella]
Length=452

 Score =   308 bits (788),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKY
Sbjct  277  FRNLLPKGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDTSSDPR+LAVACFD+S
Sbjct  337  KQEVLLGHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDTSSDPRSLAVACFDIS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFLQ
Sbjct  397  QFIQYHAAGRVIVADLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFLQ  451



>ref|XP_010432453.1| PREDICTED: V-type proton ATPase subunit H-like [Camelina sativa]
Length=452

 Score =   308 bits (788),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKY
Sbjct  277  FRNLLPKGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDTSSDPR+LAVACFD+S
Sbjct  337  KQEVLLGHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDTSSDPRSLAVACFDIS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFLQ
Sbjct  397  QFIQYHAAGRVIVADLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFLQ  451



>ref|XP_010437659.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Camelina 
sativa]
Length=452

 Score =   308 bits (788),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKY
Sbjct  277  FRNLLPKGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDTSSDPR+LAVACFD+S
Sbjct  337  KQEVLLGHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDTSSDPRSLAVACFDIS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFLQ
Sbjct  397  QFIQYHAAGRVIVADLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFLQ  451



>ref|XP_010447124.1| PREDICTED: V-type proton ATPase subunit H [Camelina sativa]
Length=437

 Score =   307 bits (787),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKY
Sbjct  262  FRNLLPKGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKY  321

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDTSSDPR+LAVACFD+S
Sbjct  322  KQEVLLGHLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDTSSDPRSLAVACFDIS  381

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFLQ
Sbjct  382  QFIQYHAAGRVIVADLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFLQ  436



>gb|ACN34691.1| unknown [Zea mays]
Length=199

 Score =   297 bits (761),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KG F A ++DLG+  +VQNLKAQAW+DEDLL+ALNQLE GLK+N+KKLSSFDKY
Sbjct  24   FRNLLAKGAFAAQMIDLGLPQMVQNLKAQAWTDEDLLDALNQLEVGLKENLKKLSSFDKY  83

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQ+VLLGHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DTSSD   LAVAC+DLS
Sbjct  84   KQQVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSSDTTALAVACYDLS  143

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNAL+C+QRLFLGAKYASFLQ
Sbjct  144  QFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVRKNALICVQRLFLGAKYASFLQ  198



>ref|XP_009416984.1| PREDICTED: probable V-type proton ATPase subunit H [Musa acuminata 
subsp. malaccensis]
Length=452

 Score =   305 bits (781),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL K   GA ++DLG+  IVQ+LKAQAWSDEDLLEALNQLE+GLK++IK LSSFDKY
Sbjct  277  LRNLLPKAACGAQMIDLGLPQIVQSLKAQAWSDEDLLEALNQLEDGLKEHIKTLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW PMHKDP FWR+NITNFEENDFQILRVLITILDTS DP  LAVAC+DLS
Sbjct  337  KQEVLLGHLDWYPMHKDPGFWRENITNFEENDFQILRVLITILDTSGDPTALAVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGR+IV+DLKAK+R MKL+NHEN +VTKNALLCIQRLFLGAKYASFLQ
Sbjct  397  QFIQYHPAGRIIVSDLKAKDRVMKLMNHENADVTKNALLCIQRLFLGAKYASFLQ  451



>ref|XP_010673864.1| PREDICTED: V-type proton ATPase subunit H [Beta vulgaris subsp. 
vulgaris]
Length=465

 Score =   305 bits (782),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 162/175 (93%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             +NLL KGTFGA +VDLG+  IVQNLKAQAW DEDL+EAL+QL+EGLKDN+KK+SSFDKY
Sbjct  290  FKNLLPKGTFGAQMVDLGMPQIVQNLKAQAWGDEDLVEALSQLDEGLKDNVKKMSSFDKY  349

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSP+HKD  FWR+NI+NFEE DF+ILRVL+TILDTS+DPR+L+VACFDLS
Sbjct  350  KQEVLLGHLDWSPVHKDTFFWRENISNFEEKDFEILRVLLTILDTSNDPRSLSVACFDLS  409

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HP+GR+IV DLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  410  QFIQHHPSGRIIVKDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFLQ  464



>dbj|BAH20255.1| AT3G42050 [Arabidopsis thaliana]
Length=436

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKY
Sbjct  261  FRNLLPKGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKY  320

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDTSSDPR+LAVACFD+S
Sbjct  321  KQEVLLGHLDWNPMHKETNFWRENVTCFEENDFQILRVLLTILDTSSDPRSLAVACFDIS  380

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNA+LCIQRL LGAKYASFLQ
Sbjct  381  QFIQYHAAGRVIVADLKAKERVMKLINHENAEVTKNAILCIQRLLLGAKYASFLQ  435



>ref|XP_010930282.1| PREDICTED: probable V-type proton ATPase subunit H [Elaeis guineensis]
Length=452

 Score =   304 bits (779),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KG FG  +VDLG+  IVQNLKA+A SDEDLL+ALNQLE+GLKDNIK+LSSFDKY
Sbjct  277  FRNLLAKGAFGVQMVDLGLPQIVQNLKARALSDEDLLDALNQLEDGLKDNIKRLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWS MHKDP FWR+NITNFEENDFQILRVL+TILDTS+DP  LAVAC+DLS
Sbjct  337  KQEVLLGHLDWSLMHKDPNFWRENITNFEENDFQILRVLVTILDTSNDPTALAVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HP GR++V+DLKAKER MKL+NHEN EVTKNALLC+QRLFLGAKYASFLQ
Sbjct  397  QFIQYHPGGRIVVSDLKAKERVMKLMNHENAEVTKNALLCVQRLFLGAKYASFLQ  451



>ref|NP_189791.1| V-type proton ATPase subunit H [Arabidopsis thaliana]
 sp|Q9LX65.1|VATH_ARATH RecName: Full=V-type proton ATPase subunit H; Short=V-ATPase 
subunit H; AltName: Full=Vacuolar H(+)-ATPase subunit H; AltName: 
Full=Vacuolar proton pump subunit H [Arabidopsis thaliana]
 emb|CAB91576.1| vacuolar H(+)-ATPase subunit-like protein [Arabidopsis thaliana]
 gb|AAM10284.1| AT3g42050/F4M19_10 [Arabidopsis thaliana]
 gb|AEE77718.1| V-type proton ATPase subunit H [Arabidopsis thaliana]
Length=441

 Score =   304 bits (778),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKY
Sbjct  266  FRNLLPKGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKY  325

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDTSSDPR+LAVACFD+S
Sbjct  326  KQEVLLGHLDWNPMHKETNFWRENVTCFEENDFQILRVLLTILDTSSDPRSLAVACFDIS  385

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNA+LCIQRL LGAKYASFLQ
Sbjct  386  QFIQYHAAGRVIVADLKAKERVMKLINHENAEVTKNAILCIQRLLLGAKYASFLQ  440



>gb|AAK59761.1| AT3g42050/F4M19_10 [Arabidopsis thaliana]
Length=441

 Score =   304 bits (778),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEEGLKD IKKLSSFDKY
Sbjct  266  FRNLLPKGTFGAQMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIKKLSSFDKY  325

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDW+PMHK+  FWR+N+T FEENDFQILRVL+TILDTSSDPR+LAVACFD+S
Sbjct  326  KQEVLLGHLDWNPMHKETNFWRENVTCFEENDFQILRVLLTILDTSSDPRSLAVACFDIS  385

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNA+LCIQRL LGAKYASFLQ
Sbjct  386  QFIQYHAAGRVIVADLKAKERVMKLINHENAEVTKNAILCIQRLLLGAKYASFLQ  440



>ref|XP_006350112.1| PREDICTED: V-type proton ATPase subunit H-like [Solanum tuberosum]
Length=454

 Score =   304 bits (778),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 146/175 (83%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL +G+FGA +VDL VL IVQ+LKAQAWSDEDLL+ALNQLE GLK NIKKLSS+DKY
Sbjct  279  LRNLLARGSFGAQMVDLDVLQIVQSLKAQAWSDEDLLDALNQLEGGLKANIKKLSSYDKY  338

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLG LDWSPMHKDP FW++NIT FEEN FQILRVL+TILD+S+D RTL+VAC+DLS
Sbjct  339  KQEVLLGSLDWSPMHKDPLFWKENITCFEENGFQILRVLMTILDSSNDARTLSVACYDLS  398

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQCHPAGRVIV DLKAKER MKLLNH   EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  399  QFIQCHPAGRVIVADLKAKERVMKLLNHGTAEVTKNALLCIQRLFLGAKYASFLQ  453



>ref|XP_004251740.1| PREDICTED: V-type proton ATPase subunit H-like [Solanum lycopersicum]
Length=454

 Score =   302 bits (773),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/174 (83%), Positives = 158/174 (91%), Gaps = 0/174 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL +G+FG+ +VDL VL IVQ+LKAQAWSDEDLL+ALNQLE GLK NIKK+SS+DKY
Sbjct  279  LRNLLARGSFGSQMVDLDVLQIVQSLKAQAWSDEDLLDALNQLEGGLKANIKKMSSYDKY  338

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLG LDWSPMHKDP FW++NIT FEEN FQILRVL+TILDTS+D RTLAVAC+DLS
Sbjct  339  KQEVLLGSLDWSPMHKDPLFWKENITCFEENGFQILRVLMTILDTSNDSRTLAVACYDLS  398

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            QFIQCHPAGRVIV DLKAKER MKLLNH   EVTKNALLCIQRLFLGAKYASFL
Sbjct  399  QFIQCHPAGRVIVADLKAKERVMKLLNHGTAEVTKNALLCIQRLFLGAKYASFL  452



>gb|AAO65974.1| putative vacuolar ATPase subunit H protein [Suaeda salsa]
 gb|AEP40377.1| vacuolar proton pump ATPase subunit H [Suaeda corniculata]
Length=465

 Score =   302 bits (773),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             +NLL KG+FG L+VDLG+  IVQNLKA AW DEDL+EALNQL+EGLK N+K+LSSF+KY
Sbjct  290  FKNLLPKGSFGPLMVDLGMPQIVQNLKANAWGDEDLVEALNQLDEGLKYNVKQLSSFEKY  349

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSP+HKD  FWR+NI NFEENDFQILRVLITILDTS+DPR+LAVACFDLS
Sbjct  350  KQEVLLGHLDWSPVHKDAFFWRENIKNFEENDFQILRVLITILDTSNDPRSLAVACFDLS  409

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QF+Q HP+GR+IV DL+AKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  410  QFVQQHPSGRIIVNDLQAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFLQ  464



>ref|XP_006412262.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
 ref|XP_006412263.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
 ref|XP_006412264.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
 gb|ESQ53715.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
 gb|ESQ53716.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
 gb|ESQ53717.1| hypothetical protein EUTSA_v10025183mg [Eutrema salsugineum]
Length=452

 Score =   301 bits (772),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTFGA +V+LG+ HI+ +LK QAWSDEDLL+ALN+LEEGLKD I+KLSSFDKY
Sbjct  277  FRNLLPKGTFGAQMVELGLPHIIHSLKTQAWSDEDLLDALNKLEEGLKDKIRKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLG LDW+PMHK+  FWR+N+T+FEENDFQILRVL+TILDTSSDPR+LAVACFDLS
Sbjct  337  KQEVLLGQLDWNPMHKEANFWRENVTSFEENDFQILRVLLTILDTSSDPRSLAVACFDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ H AGRVIV DLKAKER MKL+NHEN EVTKNALLCIQRL LGAKYASFLQ
Sbjct  397  QFIQYHAAGRVIVNDLKAKERVMKLMNHENAEVTKNALLCIQRLLLGAKYASFLQ  451



>emb|CAD27445.1| putative vacuolar ATPase subunit H [Mesembryanthemum crystallinum]
Length=470

 Score =   302 bits (773),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 162/178 (91%), Gaps = 3/178 (2%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLH-IVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDK  603
             +NLL +GTFGA +VDLG+L  +VQNLKA AW DEDL+EALNQLEEG+K+NIKKLSSFDK
Sbjct  292  FKNLLPRGTFGAQMVDLGMLPLVVQNLKAHAWGDEDLVEALNQLEEGMKENIKKLSSFDK  351

Query  602  YKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVA-C-F  429
            YKQEVLLGHLDWSP+HKD  FWRDNITNFEENDFQILRVLITILDTSSDPR+LAV  C F
Sbjct  352  YKQEVLLGHLDWSPVHKDTFFWRDNITNFEENDFQILRVLITILDTSSDPRSLAVCKCEF  411

Query  428  DLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            DLSQFIQ HPAGR+IV DLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFLQ
Sbjct  412  DLSQFIQNHPAGRMIVNDLKAKERVMKLMNHENAEVTKNALLCIQRLFLGAKYASFLQ  469



>ref|XP_006657814.1| PREDICTED: probable V-type proton ATPase subunit H-like [Oryza 
brachyantha]
Length=452

 Score =   301 bits (770),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 139/176 (79%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            +RNLL KG F A ++DLG+ HIVQNLKAQAW+DEDLL+ALNQLE GLKDN+KKLSSF+KY
Sbjct  277  IRNLLAKGAFAAQMIDLGLPHIVQNLKAQAWTDEDLLDALNQLEIGLKDNLKKLSSFEKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQ+VLLGHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DTSSD   LAVAC+DLS
Sbjct  337  KQQVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSSDTTALAVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLC+QRLFLGAKYASFLQ 
Sbjct  397  QFLQYHPSGRIVVADLKAKDRVMKLMNHENGEVRKNALLCVQRLFLGAKYASFLQT  452



>ref|XP_010237225.1| PREDICTED: probable V-type proton ATPase subunit H [Brachypodium 
distachyon]
 ref|XP_010237228.1| PREDICTED: probable V-type proton ATPase subunit H [Brachypodium 
distachyon]
Length=452

 Score =   300 bits (769),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL KG F A ++DLG+ HIVQNLKAQAWSDEDLL+ALNQLE GLK+N+K+LSSFDKY
Sbjct  277  LRNLLAKGAFAAQMIDLGLPHIVQNLKAQAWSDEDLLDALNQLEVGLKENLKRLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQ+VLLGHLDWSPMHKDP+FWR+NITNFEENDFQILRVL+T++DTS+D   LAVAC+DLS
Sbjct  337  KQQVLLGHLDWSPMHKDPSFWRENITNFEENDFQILRVLMTVIDTSTDTTALAVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QF+Q HP+GR++V DLKAK+R MKL+NH+N EV KN+LLC+QRLFLGAKYASFLQ
Sbjct  397  QFLQYHPSGRIVVADLKAKDRVMKLMNHDNAEVRKNSLLCVQRLFLGAKYASFLQ  451



>ref|XP_004957961.1| PREDICTED: probable V-type proton ATPase subunit H-like [Setaria 
italica]
Length=452

 Score =   300 bits (769),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KG F A ++DLG+  IVQNLKAQAWSDEDLL+ALNQLE GLKDN+KKLSSFDKY
Sbjct  277  FRNLLAKGAFAAQMIDLGLPQIVQNLKAQAWSDEDLLDALNQLEVGLKDNLKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQ+VLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVL+TI+DTSSD   LAVAC+DLS
Sbjct  337  KQQVLLGHLDWSPMHKDPGFWRENINNFEENDFQILRVLMTIIDTSSDTTALAVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLCIQRLFLGAKYASFLQ
Sbjct  397  QFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVRKNALLCIQRLFLGAKYASFLQ  451



>sp|Q84ZC0.1|VATH_ORYSJ RecName: Full=Probable V-type proton ATPase subunit H; Short=V-ATPase 
subunit H; AltName: Full=Vacuolar proton pump subunit 
H [Oryza sativa Japonica Group]
 dbj|BAC57732.1| putative vacuolar ATP synthase subunit H [Oryza sativa Japonica 
Group]
 dbj|BAG90555.1| unnamed protein product [Oryza sativa Japonica Group]
Length=452

 Score =   300 bits (767),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            +RNLL KG F A ++DLG+ HIVQNLKAQAW+DEDLL+ALNQLE GLKDN+KKLSSF+KY
Sbjct  277  IRNLLAKGAFAAQMIDLGLPHIVQNLKAQAWTDEDLLDALNQLEIGLKDNLKKLSSFEKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQ+VLLGHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DTS+D   LAVAC+DLS
Sbjct  337  KQQVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSADTTALAVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLC+QRLFLGAKYASFLQ 
Sbjct  397  QFLQYHPSGRIVVADLKAKDRVMKLMNHENAEVRKNALLCVQRLFLGAKYASFLQT  452



>gb|EMT32310.1| Putative V-type proton ATPase subunit H [Aegilops tauschii]
Length=436

 Score =   299 bits (765),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KG F A ++DLG+ HIVQNLKAQAWSDEDLL+ALNQLE GLK+N+K+LSSFDKY
Sbjct  261  FRNLLAKGAFAAQMIDLGLPHIVQNLKAQAWSDEDLLDALNQLEVGLKENLKRLSSFDKY  320

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQ+VLLGHLDWSPMHKDP FWR+NITNFEENDFQILRVL+T++DTS+D   LAVAC+DLS
Sbjct  321  KQQVLLGHLDWSPMHKDPNFWRENITNFEENDFQILRVLMTVIDTSTDTTALAVACYDLS  380

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QF+Q HP+GR++V DLKAK+R MKL+NH+N EV KN+LLC+QRLFLGAKYASFLQV
Sbjct  381  QFLQYHPSGRLVVADLKAKDRVMKLMNHDNAEVRKNSLLCVQRLFLGAKYASFLQV  436



>gb|EMS54494.1| putative V-type proton ATPase subunit H [Triticum urartu]
Length=450

 Score =   299 bits (766),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KG F A ++DLG+ HIVQNLKAQAWSDEDLL+ALNQLE GLK+N+K+LSSFDKY
Sbjct  275  FRNLLAKGAFAAQMIDLGLPHIVQNLKAQAWSDEDLLDALNQLEVGLKENLKRLSSFDKY  334

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQ+VLLGHLDWSPMHKDP FWR+NITNFEENDFQILRVL+T++DTS+D   LAVAC+DLS
Sbjct  335  KQQVLLGHLDWSPMHKDPNFWRENITNFEENDFQILRVLMTVIDTSTDTTALAVACYDLS  394

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QF+Q HP+GR++V DLKAK+R MKL+NH+N EV KN+LLC+QRLFLGAKYASFLQV
Sbjct  395  QFLQYHPSGRLVVADLKAKDRVMKLMNHDNAEVRKNSLLCVQRLFLGAKYASFLQV  450



>dbj|BAJ84958.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ90688.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=452

 Score =   298 bits (763),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 137/176 (78%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KG F A ++DLG+ HIVQNLKAQAWSDEDLL+ALNQLE GLK+N+K+LSSFDKY
Sbjct  277  FRNLLAKGAFAAQMIDLGLPHIVQNLKAQAWSDEDLLDALNQLEVGLKENLKRLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQ+VLLGHLDWSPMHKDP FWR+NITNFEENDFQILRVL+T++DTS+D   LAVAC+DLS
Sbjct  337  KQQVLLGHLDWSPMHKDPNFWRENITNFEENDFQILRVLMTVIDTSTDTTALAVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QF+Q HP+GR++V DLKAK+R MKL+NH+N EV KN+LLC+QRLFLGAKYASFLQV
Sbjct  397  QFLQYHPSGRLVVADLKAKDRVMKLMNHDNAEVRKNSLLCVQRLFLGAKYASFLQV  452



>tpg|DAA63056.1| TPA: hypothetical protein ZEAMMB73_267119 [Zea mays]
Length=379

 Score =   296 bits (757),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KG F A ++DLG+  +VQNLKAQAW+DEDLL+ALNQLE GLK+N+KKLSSFDKY
Sbjct  204  FRNLLAKGAFAAQMIDLGLPQMVQNLKAQAWTDEDLLDALNQLEVGLKENLKKLSSFDKY  263

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQ+VLLGHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DTSSD   LAVAC+DLS
Sbjct  264  KQQVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSSDTTALAVACYDLS  323

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNAL+C+QRLFLGAKYASFLQ
Sbjct  324  QFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVRKNALICVQRLFLGAKYASFLQ  378



>gb|EEC82241.1| hypothetical protein OsI_26411 [Oryza sativa Indica Group]
 gb|EEE67371.1| hypothetical protein OsJ_24664 [Oryza sativa Japonica Group]
Length=495

 Score =   299 bits (766),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 160/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            +RNLL KG F A ++DLG+ HIVQNLKAQAW+DEDLL+ALNQLE GLKDN+KKLSSF+KY
Sbjct  320  IRNLLAKGAFAAQMIDLGLPHIVQNLKAQAWTDEDLLDALNQLEIGLKDNLKKLSSFEKY  379

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQ+VLLGHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DTS+D   LAVAC+DLS
Sbjct  380  KQQVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSADTTALAVACYDLS  439

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLC+QRLFLGAKYASFLQ 
Sbjct  440  QFLQYHPSGRIVVADLKAKDRVMKLMNHENAEVRKNALLCVQRLFLGAKYASFLQT  495



>ref|XP_002460834.1| hypothetical protein SORBIDRAFT_02g035880 [Sorghum bicolor]
 gb|EER97355.1| hypothetical protein SORBIDRAFT_02g035880 [Sorghum bicolor]
Length=452

 Score =   298 bits (762),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KG F A ++DLG+  IVQNLKAQAW+DEDLL+ALNQLE GLK+N+KKLSSFDKY
Sbjct  277  FRNLLAKGAFAAQMIDLGLPQIVQNLKAQAWTDEDLLDALNQLEVGLKENLKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQ+VLLGHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DTSSD   LAVAC+DLS
Sbjct  337  KQQVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSSDTTALAVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLC+QRLFLGAKYASFLQ
Sbjct  397  QFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVRKNALLCVQRLFLGAKYASFLQ  451



>gb|ACF84665.1| unknown [Zea mays]
 gb|ACL54657.1| unknown [Zea mays]
Length=452

 Score =   296 bits (758),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KG F A ++DLG+  +VQNLKAQAW+DEDLL+ALNQLE GLK+N+KKLSSFDKY
Sbjct  277  FRNLLAKGAFAAQMIDLGLPQMVQNLKAQAWTDEDLLDALNQLEVGLKENLKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQ+VLLGHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DTSSD   LAVAC+DLS
Sbjct  337  KQQVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSSDTTALAVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNAL+C+QRLFLGAKYASFLQ
Sbjct  397  QFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVRKNALICVQRLFLGAKYASFLQ  451



>ref|NP_001146965.1| vacuolar ATPase subunit H protein [Zea mays]
 gb|ACG24799.1| vacuolar ATPase subunit H protein [Zea mays]
Length=468

 Score =   296 bits (757),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KG F A ++DLG+  +VQNLKAQAW+DEDLL+ALNQLE GLK+N+KKLSSFDKY
Sbjct  293  FRNLLAKGAFAAQMIDLGLPQMVQNLKAQAWTDEDLLDALNQLEVGLKENLKKLSSFDKY  352

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQ+VLLGHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DTSSD   LAVAC+DLS
Sbjct  353  KQQVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSSDTTALAVACYDLS  412

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QF+Q HP+GR++V DLKAK+R MKL+NHEN EV KNAL+C+QRLFLGAKYASFLQ
Sbjct  413  QFLQYHPSGRIVVADLKAKDRVMKLMNHENTEVRKNALICVQRLFLGAKYASFLQ  467



>ref|NP_001288363.1| uncharacterized protein LOC103647744 [Zea mays]
 gb|ACN33576.1| unknown [Zea mays]
 tpg|DAA41089.1| TPA: vacuolar ATPase subunit H protein [Zea mays]
Length=452

 Score =   294 bits (752),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 157/173 (91%), Gaps = 0/173 (0%)
 Frame = -1

Query  773  NLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQ  594
            NLL KG F A ++DLG+  IVQNLKAQAW+DEDLL+ALNQLE GLK+N+KKLSSFDKYKQ
Sbjct  279  NLLAKGAFAAQMIDLGLPQIVQNLKAQAWTDEDLLDALNQLEVGLKENLKKLSSFDKYKQ  338

Query  593  EVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQF  414
            +VLLGHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DTSSD   LAVAC+DLSQF
Sbjct  339  QVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSSDTTALAVACYDLSQF  398

Query  413  IQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            +Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLC+QRLFLGAKYASFL+
Sbjct  399  LQYHPSGRIVVADLKAKDRVMKLMNHENTEVQKNALLCVQRLFLGAKYASFLR  451



>gb|ABG75917.1| vacuolar proton ATPase subunit H [Triticum aestivum]
Length=452

 Score =   293 bits (750),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 135/176 (77%), Positives = 159/176 (90%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KG F A ++DLG+ HIVQNLKAQAWSDEDLL+ALNQLE GLK+N+K+LSSFDKY
Sbjct  277  FRNLLAKGAFAAQMIDLGLPHIVQNLKAQAWSDEDLLDALNQLEVGLKENLKRLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQ+VLLGHLDWSPMHKDP FWR+NITNFEENDFQILRVL+T++DTS+D   LAVAC+DLS
Sbjct  337  KQQVLLGHLDWSPMHKDPNFWRENITNFEENDFQILRVLMTVIDTSTDTTALAVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QF+Q H +GR++V DLKAK+R MKL++H+N EV KN+LLC+QRLFLGAKYASFLQV
Sbjct  397  QFLQYHTSGRLVVADLKAKDRVMKLMSHDNAEVRKNSLLCVQRLFLGAKYASFLQV  452



>emb|CDX76266.1| BnaA08g11340D [Brassica napus]
Length=468

 Score =   293 bits (750),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 157/176 (89%), Gaps = 0/176 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KGTF   +VDL + HI+ +LK QAWSDEDLL+ALNQLEEGLKD I KLSSFDKY
Sbjct  293  FRNLLPKGTFVVQMVDLRLPHIIHSLKTQAWSDEDLLDALNQLEEGLKDKIWKLSSFDKY  352

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHL+W+PMHK+  FWR+N+++FEENDFQILRVL+TILDTSSDPR+LAVAC+DLS
Sbjct  353  KQEVLLGHLEWNPMHKEANFWRENVSSFEENDFQILRVLLTILDTSSDPRSLAVACYDLS  412

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
            QFIQ H AGRVIVTDLKAKER M+L+ HEN EVTKNALLCIQRL LGAKYASFLQV
Sbjct  413  QFIQYHAAGRVIVTDLKAKERVMRLMGHENAEVTKNALLCIQRLLLGAKYASFLQV  468



>ref|XP_009415033.1| PREDICTED: probable V-type proton ATPase subunit H [Musa acuminata 
subsp. malaccensis]
Length=452

 Score =   291 bits (746),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            L NLL K   GA ++DLG+  IVQ+LKAQAWSDEDLL ALNQLE+GLK++IK LSSFDKY
Sbjct  277  LLNLLPKAACGAQMIDLGLPQIVQSLKAQAWSDEDLLGALNQLEDGLKEHIKTLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVL GHLDW PMHKDP FWR+NITNFEENDFQILRVLITILDTSSDP  L+VAC+DLS
Sbjct  337  KQEVLQGHLDWYPMHKDPGFWRENITNFEENDFQILRVLITILDTSSDPTALSVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGR++V DLKAK+R MKL+NHEN EVT++ALLCIQRLFLGAKYAS LQ
Sbjct  397  QFIQYHPAGRIMVADLKAKDRVMKLMNHENAEVTRHALLCIQRLFLGAKYASLLQ  451



>ref|XP_002453051.1| hypothetical protein SORBIDRAFT_04g037430 [Sorghum bicolor]
 gb|EES06027.1| hypothetical protein SORBIDRAFT_04g037430 [Sorghum bicolor]
Length=452

 Score =   291 bits (745),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KG F A ++DLG+  IVQNLKAQAW+DEDLL+ALNQLE GLK+N+KKLSSFDKY
Sbjct  277  FRNLLAKGAFAAQMIDLGLPQIVQNLKAQAWTDEDLLDALNQLEVGLKENLKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQ+VLLGHLDWSPMHKDP+FWR+NI +FEENDFQILRVL+TI+DTSSD   LAVAC+DLS
Sbjct  337  KQQVLLGHLDWSPMHKDPSFWRENINSFEENDFQILRVLMTIIDTSSDTTALAVACYDLS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QF+Q HP+GR++V DLKAK++ MKL+NH N EV KNALLC+QRLFLGAKYASFLQ
Sbjct  397  QFLQYHPSGRIVVADLKAKDQVMKLMNHGNTEVRKNALLCVQRLFLGAKYASFLQ  451



>gb|KHN00570.1| Protein DA1-related 1 [Glycine soja]
Length=1212

 Score =   305 bits (782),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 148/176 (84%), Positives = 161/176 (91%), Gaps = 0/176 (0%)
 Frame = -1

Query  779   LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             L+NL+ KGT GA +VDL +  +V +LKAQAWSDEDLLEALN LEEGLKDNIK+LSSFD Y
Sbjct  1037  LKNLMSKGTLGAQMVDLQLAQVVLSLKAQAWSDEDLLEALNSLEEGLKDNIKRLSSFDMY  1096

Query  599   KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
             KQEVLLGHLDWSPMHKDP FWR+NI NFEENDFQILRVL+TILDTSSDPRTLAVAC+DLS
Sbjct  1097  KQEVLLGHLDWSPMHKDPIFWRENINNFEENDFQILRVLLTILDTSSDPRTLAVACYDLS  1156

Query  419   QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
             QFIQ H AGR+IV+DLKAKER MKL+NHEN EVTKNALLCIQRLFLGAKYASFLQV
Sbjct  1157  QFIQHHSAGRIIVSDLKAKERVMKLMNHENVEVTKNALLCIQRLFLGAKYASFLQV  1212



>emb|CDY57740.1| BnaC03g77060D [Brassica napus]
Length=459

 Score =   284 bits (727),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = -1

Query  761  KGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLL  582
            K +    +VDLG+ HI+ +LK QAWSDEDLL+ALNQLEE LKD I+KLSSFDKYKQEVLL
Sbjct  290  KSSTKEKMVDLGLPHIIHSLKTQAWSDEDLLDALNQLEEDLKDKIRKLSSFDKYKQEVLL  349

Query  581  GHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCH  402
            GHLDW+PMHK+  FWR+N+T+FEEND QILRVL+TILDTSSDPR+LAVAC+DLSQFIQ H
Sbjct  350  GHLDWNPMHKEANFWRENVTSFEENDLQILRVLLTILDTSSDPRSLAVACYDLSQFIQYH  409

Query  401  PAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQV  252
             AGRVIVTDLKAKER MKL+ HEN EVTKNALLCIQRL LGAKYASFLQV
Sbjct  410  AAGRVIVTDLKAKERVMKLMAHENAEVTKNALLCIQRLLLGAKYASFLQV  459



>gb|ABR17502.1| unknown [Picea sitchensis]
Length=458

 Score =   283 bits (723),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 130/175 (74%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            L+NLL +GTF + +VDLG+  IVQNLK+QAWSDEDL+EALN LEEGLKD+IK+LSSFDKY
Sbjct  283  LKNLLFRGTFASEMVDLGLPQIVQNLKSQAWSDEDLVEALNSLEEGLKDSIKRLSSFDKY  342

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLG+LDWSPMHKDP FWR+NI  FE+NDFQ+LR+LITILDTS + R LAVAC+D+S
Sbjct  343  KQEVLLGNLDWSPMHKDPVFWRENINKFEDNDFQVLRILITILDTSGESRALAVACYDIS  402

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGR IVTDLK KER +KL++HE+ EV KNALLC+Q+L L AKY S+LQ
Sbjct  403  QFIQYHPAGRGIVTDLKVKERVIKLMDHESSEVRKNALLCVQKLLLSAKYVSYLQ  457



>tpg|DAA41086.1| TPA: hypothetical protein ZEAMMB73_371057, partial [Zea mays]
Length=607

 Score =   280 bits (715),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/165 (78%), Positives = 149/165 (90%), Gaps = 0/165 (0%)
 Frame = -1

Query  773  NLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQ  594
            NLL KG F A ++DLG+  IVQNLKAQAW+DEDLL+ALNQLE GLK+N+KKLSSFDKYKQ
Sbjct  433  NLLAKGAFAAQMIDLGLPQIVQNLKAQAWTDEDLLDALNQLEVGLKENLKKLSSFDKYKQ  492

Query  593  EVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQF  414
            +VLLGHLDWSPMHKDP+FWR+NI NFEENDFQILRVL+TI+DTSSD   LAVAC+DLSQF
Sbjct  493  QVLLGHLDWSPMHKDPSFWRENINNFEENDFQILRVLMTIIDTSSDTTALAVACYDLSQF  552

Query  413  IQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLG  279
            +Q HP+GR++V DLKAK+R MKL+NHEN EV KNALLC+QRLFLG
Sbjct  553  LQYHPSGRIVVADLKAKDRVMKLMNHENTEVQKNALLCVQRLFLG  597



>ref|XP_008234540.1| PREDICTED: V-type proton ATPase subunit H, partial [Prunus mume]
Length=423

 Score =   272 bits (695),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL KGTFGA +VDLG+  IVQ+LKAQAWSDEDLLE LNQLEEGLKDNIKKLSSFDKY
Sbjct  277  LRNLLSKGTFGAQMVDLGLPQIVQSLKAQAWSDEDLLEGLNQLEEGLKDNIKKLSSFDKY  336

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDP FWR+N+TNFEENDFQILRVLITILDTS+DPR LAVACFD+S
Sbjct  337  KQEVLLGHLDWSPMHKDPIFWRENVTNFEENDFQILRVLITILDTSTDPRALAVACFDIS  396

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLN  339
            QF+Q HPAGR+IVTDLKAKER MKL+N
Sbjct  397  QFVQQHPAGRIIVTDLKAKERVMKLMN  423



>gb|AEG78652.1| vacuolar H+-ATPase subunit H, partial [Avena sativa]
Length=298

 Score =   267 bits (683),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNLL KG F A ++DLG+ HIVQNLKAQAWSDEDLL+ALNQLE GLK+N+K+ SSFDKY
Sbjct  123  FRNLLAKGAFAAQMIDLGLPHIVQNLKAQAWSDEDLLDALNQLEVGLKENLKRXSSFDKY  182

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQ+VLLGHLDWSPMHKDP FW +NIT FE N+FQI RVL+T++DTS+D   LAVAC+DLS
Sbjct  183  KQQVLLGHLDWSPMHKDPNFWXENITXFEGNEFQIXRVLMTVIDTSTDTHALAVACYDLS  242

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            Q +Q HP GR+   DLKA  R M L NH+N EV KN+LLC+QRLFLGAKY SFLQ
Sbjct  243  QXLQYHPXGRLXXADLKAXXRVMXLXNHDNAEVRKNSLLCVQRLFLGAKYXSFLQ  297



>gb|ERN17435.1| hypothetical protein AMTR_s00037p00233030 [Amborella trichopoda]
Length=157

 Score =   253 bits (647),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = -1

Query  677  DLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQ  498
            DLL+ALNQLEEGLKDNIKKL SFDKY+QEVLLGHLDWSPMH+DP FWR+NITNFEENDFQ
Sbjct  16   DLLDALNQLEEGLKDNIKKLCSFDKYEQEVLLGHLDWSPMHRDPVFWRENITNFEENDFQ  75

Query  497  ILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVT  318
            I+RVL+TILDTS+DPR LAVAC+DLSQFIQ HPAGR I++DLKAK+  MKL+NHENPEV 
Sbjct  76   IVRVLLTILDTSTDPRALAVACYDLSQFIQYHPAGRGILSDLKAKDWVMKLMNHENPEVI  135

Query  317  KNALLCIQRLFLGAKYASFLQV  252
            KNALL IQRLFLGAKYASFLQ 
Sbjct  136  KNALLGIQRLFLGAKYASFLQA  157



>ref|XP_002980222.1| hypothetical protein SELMODRAFT_444469 [Selaginella moellendorffii]
 gb|EFJ18482.1| hypothetical protein SELMODRAFT_444469 [Selaginella moellendorffii]
Length=451

 Score =   260 bits (665),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL KGTF   +V+LG+  I+QNLK QAWSDEDL EALN +EE LK N+K LSSF+KY
Sbjct  275  LRNLLTKGTFARDMVELGMPKIIQNLKMQAWSDEDLTEALNLMEETLKKNLKLLSSFEKY  334

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVL G+LDW+PMHKDP FW++NI  FEENDFQ+LR+L+TILD S DPRT AVAC D++
Sbjct  335  KQEVLSGNLDWTPMHKDPLFWKENIKKFEENDFQVLRILVTILDNSRDPRTQAVACQDIA  394

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGR IV D++AK+R M+L+NH+N EV K AL+C+Q+L L AKYASF+Q
Sbjct  395  QFIQFHPAGRGIVLDMRAKDRVMRLMNHDNSEVRKEALICVQKLLLNAKYASFMQ  449



>ref|XP_002963102.1| hypothetical protein SELMODRAFT_141399 [Selaginella moellendorffii]
 gb|EFJ36565.1| hypothetical protein SELMODRAFT_141399 [Selaginella moellendorffii]
Length=451

 Score =   260 bits (664),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 120/175 (69%), Positives = 146/175 (83%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL KGTF   +V+LG+  I+QNLK QAWSDEDL EALN +EE LK N+K LSSF+KY
Sbjct  275  LRNLLTKGTFARDMVELGMPKIIQNLKMQAWSDEDLTEALNFMEETLKKNLKLLSSFEKY  334

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVL G+LDW+PMHKDP FW++NI  FEENDFQ+LR+L+TILD S DPRT AVAC D++
Sbjct  335  KQEVLSGNLDWTPMHKDPLFWKENIKKFEENDFQVLRILVTILDNSRDPRTQAVACQDIA  394

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGR IV D++AK+R M+L+NH+N EV K AL+C+Q+L L AKYASF+Q
Sbjct  395  QFIQFHPAGRGIVLDMRAKDRVMRLMNHDNSEVRKEALICVQKLLLNAKYASFMQ  449



>ref|XP_001756205.1| predicted protein [Physcomitrella patens]
 gb|EDQ79071.1| predicted protein [Physcomitrella patens]
Length=448

 Score =   251 bits (640),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 143/175 (82%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            L NL  KG F A +VDLG+  +VQ+LK QAW+DEDLL+AL+ ++  LKD I+KLSSFD+Y
Sbjct  274  LNNLSSKGNFAAEMVDLGMSKVVQSLKLQAWNDEDLLQALDVVDAALKDIIRKLSSFDRY  333

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            K EV  G+LDWSPMHKDP FWR+NI+ FEE+DFQ+LR+LIT+LD S DP+TLAVAC D++
Sbjct  334  KGEVFSGNLDWSPMHKDPVFWRENISKFEESDFQVLRILITLLDNSRDPKTLAVACHDIA  393

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGR I+ DLKAKER MK ++H NPEV   ALLC+Q++ L AKYAS++Q
Sbjct  394  QFIQNHPAGRGIILDLKAKERVMKHMSHPNPEVATQALLCVQKVLLSAKYASYMQ  448



>ref|XP_001761877.1| predicted protein [Physcomitrella patens]
 gb|EDQ73318.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   241 bits (614),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 111/175 (63%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             RNL  KG   + +VDLG+  IVQ+L+  AWSDEDLL+AL  L+  LKD+I+KLSSFDK+
Sbjct  276  FRNLSSKGNSASEMVDLGLPKIVQSLQLYAWSDEDLLQALEVLDAALKDSIRKLSSFDKF  335

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            K +V  G+LDW+ MHKDP FWR+NIT FEENDFQ+LR+LIT+LD S D +TLAVAC D+S
Sbjct  336  KGQVFSGNLDWTSMHKDPVFWRENITKFEENDFQVLRILITLLDISRDSKTLAVACHDIS  395

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            QFIQ HPAGR IV DLKAKER MK ++H +PE+ K ALLC+Q++ L AKY S++Q
Sbjct  396  QFIQFHPAGRGIVVDLKAKERVMKHMSHPDPELAKQALLCVQKILLSAKYVSYMQ  450



>emb|CAG27620.1| putative vacuolar ATPase subunit H [Populus deltoides x Populus 
maximowiczii]
Length=105

 Score =   201 bits (511),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = -1

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            KQEVLLGHLDWSPMHKDPAFWR+NITNFEENDFQILRVLITILDTSSDPR LAVACFDLS
Sbjct  1    KQEVLLGHLDWSPMHKDPAFWRENITNFEENDFQILRVLITILDTSSDPRALAVACFDLS  60

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  285
            QFIQ HPAGRVIVTDLK KER MKL+NHEN EVTKNALLCIQ  F
Sbjct  61   QFIQHHPAGRVIVTDLKTKERVMKLMNHENAEVTKNALLCIQGSF  105



>gb|KDO40338.1| hypothetical protein CISIN_1g034103mg [Citrus sinensis]
Length=103

 Score =   199 bits (505),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/102 (92%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = -1

Query  560  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAGRVIV  381
            MHKDP FWRDNITNFEENDFQILRVL+TILDTSSDPR LAVACFDLSQFIQ HPAGRVIV
Sbjct  1    MHKDPLFWRDNITNFEENDFQILRVLLTILDTSSDPRALAVACFDLSQFIQYHPAGRVIV  60

Query  380  TDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            TDLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKYASFLQ
Sbjct  61   TDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYASFLQ  102



>gb|KDO40334.1| hypothetical protein CISIN_1g034108mg [Citrus sinensis]
Length=103

 Score =   197 bits (501),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -1

Query  560  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAGRVIV  381
            MHKDP FWRDNITNFEENDFQILRVL+TILDTSSDPR LAVACFDLSQFIQ HPAGRVIV
Sbjct  1    MHKDPLFWRDNITNFEENDFQILRVLLTILDTSSDPRALAVACFDLSQFIQYHPAGRVIV  60

Query  380  TDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            TDLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKY SFLQ
Sbjct  61   TDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYTSFLQ  102



>gb|KDO40336.1| hypothetical protein CISIN_1g034106mg [Citrus sinensis]
Length=103

 Score =   196 bits (498),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/102 (91%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = -1

Query  560  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAGRVIV  381
            MHKDP FW DNITNFEENDFQILRVL+TILDTSSDPR LAVACFDLSQFIQ HPAGRVIV
Sbjct  1    MHKDPLFWHDNITNFEENDFQILRVLLTILDTSSDPRALAVACFDLSQFIQYHPAGRVIV  60

Query  380  TDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            TDLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKYASFLQ
Sbjct  61   TDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYASFLQ  102



>gb|ABF50108.1| vacuolar ATPase subunit H [Musa acuminata AAA Group]
Length=105

 Score =   191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 97/104 (93%), Gaps = 0/104 (0%)
 Frame = -1

Query  719  HIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAF  540
             IVQ+LKAQAWSDEDLLEALNQLE+GLK++IK LSSFDKYKQEVLLGHLDW PMHKDP F
Sbjct  2    QIVQSLKAQAWSDEDLLEALNQLEDGLKEHIKTLSSFDKYKQEVLLGHLDWYPMHKDPGF  61

Query  539  WRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQ  408
            WR+NITNFEENDFQILRVLITILDTS DP  LAVAC+DLSQFIQ
Sbjct  62   WRENITNFEENDFQILRVLITILDTSGDPTALAVACYDLSQFIQ  105



>ref|XP_002319248.2| hypothetical protein POPTR_0013s07630g [Populus trichocarpa]
 gb|EEE95171.2| hypothetical protein POPTR_0013s07630g [Populus trichocarpa]
Length=397

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/104 (83%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             +NLL KG FGA +VDLG+  IVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY
Sbjct  294  FKNLLSKGAFGAQMVDLGLPQIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  353

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILD  468
            KQEVLLGHLDWSPMHKDPAFWR+NITNFEENDFQ+L  + + L+
Sbjct  354  KQEVLLGHLDWSPMHKDPAFWRENITNFEENDFQVLVFIFSYLN  397



>ref|XP_009778019.1| PREDICTED: V-type proton ATPase subunit H-like, partial [Nicotiana 
sylvestris]
Length=370

 Score =   179 bits (455),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL KGTFGA +VD+GVL IVQNLKAQAWSDEDLL+ALNQLEEGLKDNIKKLSS+DKY
Sbjct  267  LRNLLSKGTFGAQMVDVGVLQIVQNLKAQAWSDEDLLDALNQLEEGLKDNIKKLSSYDKY  326

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITIL  471
            KQEVLLG+LDWSPMHKDP FW++NI NFEEN FQ++ V+  IL
Sbjct  327  KQEVLLGNLDWSPMHKDPLFWKENINNFEENGFQVMPVVFNIL  369



>ref|XP_002955475.1| vacuolar ATP synthase, subunit H [Volvox carteri f. nagariensis]
 gb|EFJ43546.1| vacuolar ATP synthase, subunit H [Volvox carteri f. nagariensis]
Length=477

 Score =   177 bits (450),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 119/177 (67%), Gaps = 2/177 (1%)
 Frame = -1

Query  779  LRNLLHKGTFG--ALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFD  606
            LRNLL     G  + +V+ G+  +V   + Q+W D+D++E L  +EE LK  I  LS+F+
Sbjct  300  LRNLLAYEDLGLASDMVEAGLNKVVIVRQLQSWGDDDVVEMLGFVEEKLKQGIIILSNFE  359

Query  605  KYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFD  426
            KYK+EV+ G LDWSPMH    FWR+N+  FEE DFQ+LRVL+ I++T+ D +TLAV C D
Sbjct  360  KYKKEVMSGQLDWSPMHSSDLFWRENVEKFEERDFQVLRVLLKIIETNRDVKTLAVGCHD  419

Query  425  LSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            L QFI  HP GR IV DL+ KE  M+LL+H + EV K ALLC+Q+L L      FL+
Sbjct  420  LGQFIVNHPQGRYIVNDLRGKELVMRLLSHSDAEVQKQALLCVQKLMLSKDKLDFLK  476



>ref|XP_001689562.1| vacuolar ATP synthase subunit H [Chlamydomonas reinhardtii]
 gb|EDP09300.1| vacuolar ATP synthase subunit H [Chlamydomonas reinhardtii]
Length=463

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 116/177 (66%), Gaps = 2/177 (1%)
 Frame = -1

Query  779  LRNLLHKGTFG--ALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFD  606
            LRNLL     G  + +V+ G+  +V   + Q+W DED++E L  ++E LK+ I  LS+FD
Sbjct  286  LRNLLGYQDLGLASDMVEAGLNKVVVTRQMQSWGDEDVVEMLTYVDEKLKEGIVFLSNFD  345

Query  605  KYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFD  426
            KYK+EVL   LDWSPMH    FWR N   FEE DFQ+LRVL+ I++T+ D +TLAV C D
Sbjct  346  KYKKEVLSNTLDWSPMHTSDLFWRQNAEKFEERDFQVLRVLLKIIETNRDVKTLAVGCHD  405

Query  425  LSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
            L QFI  HP GR IV DL+ KE  M+LL H + EV K ALLC+Q+L L      F++
Sbjct  406  LGQFIVYHPQGRYIVNDLRGKELVMRLLGHSDVEVQKQALLCVQKLMLSKDKLDFIK  462



>ref|XP_006437443.1| hypothetical protein CICLE_v10033985mg [Citrus clementina]
 gb|ESR50683.1| hypothetical protein CICLE_v10033985mg [Citrus clementina]
Length=114

 Score =   157 bits (398),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 75/82 (91%), Positives = 78/82 (95%), Gaps = 0/82 (0%)
 Frame = -1

Query  500  QILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEV  321
            QILRVL+TILDTSSDPR LAVACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHEN EV
Sbjct  32   QILRVLLTILDTSSDPRALAVACFDLSQFIQYHPAGRVIVTDLKAKERVMKLMNHENTEV  91

Query  320  TKNALLCIQRLFLGAKYASFLQ  255
            TK+ALLCIQRLFLGAKYASFLQ
Sbjct  92   TKSALLCIQRLFLGAKYASFLQ  113



>ref|XP_005646211.1| vacuolar ATP synthase subunit H [Coccomyxa subellipsoidea C-169]
 gb|EIE21667.1| vacuolar ATP synthase subunit H [Coccomyxa subellipsoidea C-169]
Length=465

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 106/161 (66%), Gaps = 0/161 (0%)
 Frame = -1

Query  740  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  561
            +V+  +  +VQ    Q W DED+  AL  L+E L  NIK LSS+DKYK+EVL G LDWSP
Sbjct  303  MVEAALPKVVQQRLLQNWEDEDVTAALEALKEALAANIKLLSSWDKYKKEVLSGSLDWSP  362

Query  560  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAGRVIV  381
            MH    FW +N   FEE DFQ+LRVL+ +L+ S + RTLAVA  DL  FI  HP GR IV
Sbjct  363  MHTSDLFWLENAPKFEERDFQVLRVLLKLLEQSRENRTLAVAASDLGHFISAHPHGRNIV  422

Query  380  TDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            TDL+ KE AM+L+ H + EV K ALL +Q++ L     ++L
Sbjct  423  TDLRGKELAMRLMMHPDAEVQKQALLAVQKILLAKDKVAYL  463



>ref|XP_002680972.1| vacuolar ATP synthase subunit H [Naegleria gruberi]
 gb|EFC48228.1| vacuolar ATP synthase subunit H [Naegleria gruberi]
Length=478

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 107/166 (64%), Gaps = 0/166 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
             +NL+    F   +V++ V   + NL+ +++ D+D+ E L  L E L  +I ++SSFD Y
Sbjct  306  FKNLMKYPKFVTAMVNVSVPKTLLNLQKRSFEDKDITEELKSLSENLDAHIDEISSFDDY  365

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            +QEVL GHL+W+P+H    FW++N+   E+N+F ILR LI +LD  S+   LA+ C D+ 
Sbjct  366  RQEVLSGHLEWTPVHSSEKFWKENMDKMEQNNFYILRELIKLLDDESNTDNLAIGCHDIG  425

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            +F++ H  G+ +VTDL AK R ++L+ H N EV K AL C Q++ +
Sbjct  426  EFVRYHNRGKRVVTDLGAKARILQLMEHPNDEVKKYALECCQKIMI  471



>ref|XP_004367300.1| vacuolar ATP synthase subunit H [Dictyostelium fasciculatum]
 gb|EGG20317.1| vacuolar ATP synthase subunit H [Dictyostelium fasciculatum]
Length=493

 Score =   146 bits (369),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 105/166 (63%), Gaps = 0/166 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            L+NL+ KG     +++ G + ++  L  + W DED++  L  L  GL ++I  +SSFDKY
Sbjct  319  LKNLMGKGNNNEEMIECGFIRMLNFLSNKKWGDEDIVTDLTDLSTGLSEDIAIMSSFDKY  378

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            K EVL   L+W+P+HK   FW+DN + FEEN+F +L+ L  IL  SS+P  L+VAC DL 
Sbjct  379  KAEVLSNELEWTPVHKSEQFWKDNASKFEENNFNVLKFLHLILQKSSNPLHLSVACHDLG  438

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            +F+  HP G+ IV  L+ K   M L+ + N EV K+AL  +Q++ +
Sbjct  439  EFVIHHPRGKHIVEQLQIKPDIMSLMANTNEEVKKHALFALQKMMI  484



>ref|XP_002500993.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
 gb|ACO62251.1| H+-or Na+-translocating f-type, v-type and A-type ATPase superfamily 
[Micromonas sp. RCC299]
Length=504

 Score =   142 bits (359),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/158 (46%), Positives = 103/158 (65%), Gaps = 7/158 (4%)
 Frame = -1

Query  716  IVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDPAFW  537
            +VQNL+ + + DE+LL AL  LE+G+    K+ SS+D+Y+ EV  G LDW+  H D  FW
Sbjct  346  LVQNLRLRDFHDEELLAALADLEDGVLARRKEASSWDRYRAEVTSGALDWTAAHIDEGFW  405

Query  536  RDNITNFEENDFQILRVLITIL-DTSSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKAKE  360
            R+N +   +N+ Q+LR+L+    D  ++PRTLAV C DL +F   +PAGR +V DLK K+
Sbjct  406  RENASKLTDNNCQLLRMLVAAASDPGAEPRTLAVVCHDLGEFATHYPAGRFLVQDLKGKD  465

Query  359  RAMKLLNHENPEVTKNALLCIQRL------FLGAKYAS  264
             AM+LL H + EV K ALLC Q+L      FLG + +S
Sbjct  466  CAMRLLAHADDEVRKQALLCTQKLLVQKWQFLGGEVSS  503



>emb|CDO69013.1| hypothetical protein BN946_scf184834.g20 [Trametes cinnabarina]
Length=398

 Score =   140 bits (352),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 109/167 (65%), Gaps = 4/167 (2%)
 Frame = -1

Query  779  LRNLLHKG---TFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSF  609
             RNL+ K       A+LV   +L   +NL  + W+DED++E +  L + L    + L+++
Sbjct  208  FRNLVSKAPQANLPAMLV-AQLLPFAKNLSGRKWTDEDIVEDIQFLRDELSARFESLTTY  266

Query  608  DKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACF  429
            D+Y+ E+L GHL W+P+H+   FW++N T   +ND+++L++LI +L+ S+DP  LAVA  
Sbjct  267  DEYRSELLSGHLSWTPVHESDLFWKENATRLNDNDYELLKILIRLLNESNDPTVLAVASH  326

Query  428  DLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            D+ Q+++ +  G+ I+TDL  K R M+L++H NP+V   AL+ +QRL
Sbjct  327  DIGQYVKHYERGKKILTDLGGKTRVMELMSHPNPDVRYQALISVQRL  373



>dbj|GAM29018.1| hypothetical protein SAMD00019534_121940 [Acytostelium subglobosum 
LB1]
Length=450

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 103/167 (62%), Gaps = 0/167 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL  G     +++ G + ++  L  + W D+D+++ ++ L E L  +I ++SSFDKY
Sbjct  276  LRNLLGHGDNNEEMIECGFVRMLNFLSNKKWGDQDIVDDISTLSETLSQDIARMSSFDKY  335

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            + EVL   L+WSP+HK   FW++N   FEEN   +L+ L  IL  S +P  +++AC DL 
Sbjct  336  RAEVLSKELEWSPVHKSEKFWKENAVRFEENSHNVLKFLHLILQKSDNPLHISIACHDLG  395

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLG  279
            +F++ HP G++I+  L  K   MKL+ + N EV K AL  +Q++ + 
Sbjct  396  EFVRFHPRGKIIIETLGIKTDIMKLMTNPNEEVKKQALFALQKMMIN  442



>dbj|GAM26531.1| hypothetical protein SAMD00019534_097060 [Acytostelium subglobosum 
LB1]
Length=449

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 105/166 (63%), Gaps = 0/166 (0%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNL++ G     +++ G + ++ +L ++ W D+D+++ +  L E L  ++ ++SSFDKY
Sbjct  275  LRNLVNHGNNNEEMIECGSIRMLNHLSSKKWGDQDIVDDITYLSEVLSLDVARMSSFDKY  334

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            K EVL   L+WSP+HK   FW++N   FEE    +L+ L  IL  S +P  L+VACFDL 
Sbjct  335  KAEVLARELEWSPVHKSEKFWKENALRFEEQSHSVLKFLHLILQKSDNPLHLSVACFDLG  394

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            +F++ HP G+ IV  L  K+  M L+ + N +V KNAL  +Q++ +
Sbjct  395  EFVRFHPRGKQIVEALGIKKDIMALMTNPNEDVKKNALFALQKMMI  440



>gb|EFA79805.1| vacuolar ATP synthase subunit H [Polysphondylium pallidum PN500]
Length=162

 Score =   133 bits (335),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 98/153 (64%), Gaps = 0/153 (0%)
 Frame = -1

Query  740  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  561
            +++ G++ ++  L  + W D+D+++ L +L E L  +I K+SSFDKY+ EV    L+WSP
Sbjct  1    MIEGGLIRMLNFLSNKKWGDQDIVDDLEKLSEALSQDIAKMSSFDKYRTEVQTNELEWSP  60

Query  560  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAGRVIV  381
            +HK   FW++N   FEEN   +L++L  IL  S +P  L++AC DL +F + HP G++I+
Sbjct  61   VHKSENFWKENALRFEENSHSVLKLLHLILQKSENPVHLSIACHDLGEFARFHPRGKIII  120

Query  380  TDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
              L  K+  M+L+ + N EV K AL  +Q++ +
Sbjct  121  EALGIKQDIMRLMTNPNEEVKKQALFALQKMMI  153



>ref|XP_008869403.1| hypothetical protein H310_06210 [Aphanomyces invadans]
 gb|ETW01555.1| hypothetical protein H310_06210 [Aphanomyces invadans]
Length=461

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 113/168 (67%), Gaps = 4/168 (2%)
 Frame = -1

Query  779  LRNLLHK--GTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFD  606
            L NLL K  G +   ++D G+L  + NL+ + W+DED+ +++  + + L    K+L++ +
Sbjct  289  LENLLGKANGAYNERMIDGGLLKTLTNLRDRKWTDEDIAKSITAIRDVLIREFKELNTME  348

Query  605  KYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFD  426
            +Y++EV  G L W  +H +  FWR+N+ +FE N+F+++R+LI +L+ S DP+T++VA +D
Sbjct  349  RYEKEVRTGSLAWGLLHTEK-FWRENVMSFEANEFELIRLLIDLLE-SDDPKTVSVALYD  406

Query  425  LSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L  F++ +P G+ I   L AK+ AMKL+ HEN EV K+AL CI ++ +
Sbjct  407  LGDFVRFYPNGKHIAKRLGAKKVAMKLMTHENAEVQKHALTCISKMMV  454



>ref|XP_008901144.1| hypothetical protein PPTG_07998 [Phytophthora parasitica INRA-310]
 gb|ETI53062.1| hypothetical protein F443_03935 [Phytophthora parasitica P1569]
 gb|ETI53076.1| hypothetical protein F443_03932 [Phytophthora parasitica P1569]
 gb|ETK92905.1| hypothetical protein L915_03827 [Phytophthora parasitica]
 gb|ETL46332.1| hypothetical protein L916_03768 [Phytophthora parasitica]
 gb|ETL99471.1| hypothetical protein L917_03682 [Phytophthora parasitica]
 gb|ETM52630.1| hypothetical protein L914_03787 [Phytophthora parasitica]
 gb|ETN13060.1| hypothetical protein PPTG_07998 [Phytophthora parasitica INRA-310]
 gb|ETO81753.1| hypothetical protein F444_03993 [Phytophthora parasitica P1976]
 gb|ETP22880.1| hypothetical protein F441_03916 [Phytophthora parasitica CJ01A1]
 gb|ETP50858.1| hypothetical protein F442_03923 [Phytophthora parasitica P10297]
Length=463

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 110/168 (65%), Gaps = 4/168 (2%)
 Frame = -1

Query  779  LRNLLHK--GTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFD  606
            L+NLL K  G F   ++D G+L  + N++ + W+DED+ + +  + + L    K+L++ +
Sbjct  291  LQNLLGKLSGFFNERMIDSGLLKTLNNMRERKWADEDIAKGIQAIRDVLIREYKELNTME  350

Query  605  KYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFD  426
            +Y++E+  G L+W  +H D  FW+DN   FE  DF+++R+LI +L+ S DP+T+AVA FD
Sbjct  351  RYEKELRTGTLNWGLLHTDK-FWKDNFMTFENKDFELIRLLIDLLE-SDDPKTVAVALFD  408

Query  425  LSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L +F++ +P G+ I   L AK+  MKL+ HEN EV K AL CI ++ +
Sbjct  409  LGEFVRFYPNGKHIAKRLGAKKMTMKLMTHENAEVQKQALQCISKMMV  456



>gb|KIM32034.1| hypothetical protein M408DRAFT_327392 [Serendipita vermifera 
MAFF 305830]
Length=438

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/168 (40%), Positives = 103/168 (61%), Gaps = 4/168 (2%)
 Frame = -1

Query  779  LRNLLHKG---TFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSF  609
             +NL+ K       A+LV + +L  V+NL  + W+DED++E +  L+E L  N + L+++
Sbjct  265  FKNLVAKAPDSNLPAMLV-VKLLPFVKNLAGRKWTDEDIVEDIQYLKEELSANFQSLTTY  323

Query  608  DKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACF  429
            D+Y  E+  GHL WSP+H    FW++N     E D+Q LRVLI +L +S+DP  LAV   
Sbjct  324  DEYTSELASGHLSWSPVHTSEGFWKENAVKLNEKDYQQLRVLIDLLKSSTDPVVLAVGAH  383

Query  428  DLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  285
            D+ Q+++ +  G+  V DL  K R M+L+ HEN +V   ALL +QRL 
Sbjct  384  DVGQYVKFYDRGKQKVADLGGKTRIMELMTHENNDVQYQALLTVQRLI  431



>ref|XP_004333409.1| vacuolar atp synthase subunit h, putative [Acanthamoeba castellanii 
str. Neff]
 gb|ELR11396.1| vacuolar atp synthase subunit h, putative [Acanthamoeba castellanii 
str. Neff]
Length=217

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 108/167 (65%), Gaps = 8/167 (5%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRN+L KG     ++  G++ +   L  + W DED+ + L  L E L+ ++  L+SF+ Y
Sbjct  48   LRNILSKGENNEQMIKAGMVKLAAGLTQKKWKDEDIEQDLAVLNEVLEKDVNVLNSFELY  107

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLS  420
            ++EV+ G+L WS +H+   FWR+N+  FEEN+F+       +L +S++P+ LA+AC+DL 
Sbjct  108  REEVMSGNLVWSLVHRSEKFWRENVGRFEENNFK-------VLGSSNNPQVLAIACYDLG  160

Query  419  QFIQCHPAGRVIVTDLKAKERAMKLL-NHENPEVTKNALLCIQRLFL  282
            +F++ HP GR +++ +  K   M L+ N+ + EV K+ALLC+Q++ +
Sbjct  161  EFVRFHPRGRKVLSKMDGKVDIMNLMTNNPDAEVQKHALLCVQKMMV  207



>ref|XP_011398291.1| putative V-type proton ATPase subunit H [Auxenochlorella protothecoides]
 gb|KFM25396.1| putative V-type proton ATPase subunit H [Auxenochlorella protothecoides]
Length=471

 Score =   137 bits (346),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 101/161 (63%), Gaps = 0/161 (0%)
 Frame = -1

Query  740  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  561
            +VD G+  +++    Q+W D D+ E L  L   L+  + +LSSF++Y++E+LLG L W P
Sbjct  305  IVDKGLRRVLEVRATQSWDDGDVPELLAALGASLERGVCELSSFERYRRELLLGQLAWGP  364

Query  560  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAGRVIV  381
            +H    FW  N     E + Q+LRVL+ ++++S D  TLAV C D+++F+  +P GR IV
Sbjct  365  LHTADDFWAQNAERLAEGNGQLLRVLLKLVESSRDATTLAVGCNDVARFVAAYPHGRGIV  424

Query  380  TDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFL  258
            T+L+ KE  M+L+ H +  V + AL C+QR+ L   +AS L
Sbjct  425  TELRGKELVMRLMVHPDQAVQRQALACVQRILLSKDHASAL  465



>ref|XP_002909335.1| V-type proton ATPase subunit H, putative [Phytophthora infestans 
T30-4]
 gb|EEY58149.1| V-type proton ATPase subunit H, putative [Phytophthora infestans 
T30-4]
Length=463

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 110/168 (65%), Gaps = 4/168 (2%)
 Frame = -1

Query  779  LRNLLHK--GTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFD  606
            L+NLL K  G F   ++D G+L  + N++ + W+DED+ + +  + + L    K+L++ +
Sbjct  291  LQNLLGKLSGFFNERMIDSGLLKTLNNMRERKWADEDIAKGIQAIRDVLIREYKELNTME  350

Query  605  KYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFD  426
            +Y++E+  G L+W  +H D  FW+DN   FE  DF+++R+LI +L+ S +P+T+AVA FD
Sbjct  351  RYEKELRTGTLNWGLLHTDK-FWKDNFMTFENKDFELIRLLIDLLE-SDEPKTVAVALFD  408

Query  425  LSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L +F++ +P G+ I   L AK+  MKL+ HEN EV K AL CI ++ +
Sbjct  409  LGEFVRFYPNGKHIAKRLGAKKMTMKLMTHENAEVQKQALQCISKMMV  456



>ref|XP_009529196.1| hypothetical protein PHYSODRAFT_505321 [Phytophthora sojae]
 gb|EGZ15447.1| hypothetical protein PHYSODRAFT_505321 [Phytophthora sojae]
Length=463

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 110/168 (65%), Gaps = 4/168 (2%)
 Frame = -1

Query  779  LRNLLHK--GTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFD  606
            L+NLL K  G F   ++D G+L  + N++ + W+DED+ + +  + + L    K+L++ +
Sbjct  291  LQNLLGKLSGFFNERMIDSGLLKTLNNMRERKWADEDIAKGIQAVRDVLIREYKELNTME  350

Query  605  KYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFD  426
            +Y++E+  G L+W  +H D  FW+DN   FE  DF+++R+LI +L+ S D +T+AVA FD
Sbjct  351  RYEKELRTGTLNWGLLHTDK-FWKDNFMTFENKDFELIRLLIDLLE-SDDSKTVAVALFD  408

Query  425  LSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            L +F++ +P G+ I   L AK+ AMKL+ HEN EV K AL CI ++ +
Sbjct  409  LGEFVRFYPNGKHIAKTLGAKKVAMKLMTHENAEVQKQALQCISKMMV  456



>gb|KIO27114.1| hypothetical protein M407DRAFT_73717 [Tulasnella calospora MUT 
4182]
Length=437

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/170 (40%), Positives = 107/170 (63%), Gaps = 4/170 (2%)
 Frame = -1

Query  776  RNLLHKG---TFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFD  606
            RNL+ K       A+LV   +L  V+NL  + WSDE+++E +  L+E L  N + L+++D
Sbjct  266  RNLVAKAPSQNLPAMLV-AKLLPYVKNLSTRKWSDEEIVEDIEFLKEELTKNFESLTTYD  324

Query  605  KYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFD  426
            +Y  E+  GHL W+P+H   AFW++N T   + D++ L+VL+ +L  S+DP  LAVA  D
Sbjct  325  EYTSELASGHLSWTPVHDSEAFWKENATKLNDKDYEQLKVLVKLLKESTDPVVLAVAAHD  384

Query  425  LSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGA  276
            + Q+ + +  G+  ++DL AK R M+L++H+NP+V   ALL  QRL   A
Sbjct  385  VGQYTKHYERGKKTLSDLGAKTRVMELMSHDNPDVRYQALLTTQRLVSQA  434



>ref|XP_011500008.1| PREDICTED: V-type proton ATPase subunit H [Ceratosolen solmsi 
marchali]
Length=484

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 102/153 (67%), Gaps = 0/153 (0%)
 Frame = -1

Query  740  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  561
            +V   VL  +  L  + + DEDL + +  L + L+ +++ LSSFD+Y  EV  G L+WSP
Sbjct  299  MVQCKVLKQLSILSQRKFDDEDLTDDIEFLNDKLQASVQDLSSFDEYATEVKSGRLEWSP  358

Query  560  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAGRVIV  381
            +HK   FWR+N +   E ++++LR+L+ +L+TS DP  L+VACFD+ ++++ +P G+ I+
Sbjct  359  VHKSGKFWRENSSRLNEKNYELLRILVHLLETSKDPLVLSVACFDVGEYVRHYPRGKHII  418

Query  380  TDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
              L  K+R M+LL+HE+P V   ALL +Q+L +
Sbjct  419  EQLGGKQRVMQLLSHEDPNVRYEALLAVQKLMV  451



>ref|XP_007863478.1| ATPase, V1 complex, subunit H [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ58239.1| ATPase, V1 complex, subunit H [Gloeophyllum trabeum ATCC 11539]
Length=437

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 102/166 (61%), Gaps = 2/166 (1%)
 Frame = -1

Query  779  LRNLLHKGTFGAL--LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFD  606
             RNL+ K     L  ++   +L  ++NL  + WSDED+LE +  L + LK     L+++D
Sbjct  264  FRNLIAKAPSANLPSMLVAQLLPFMKNLSTRKWSDEDILEDVQFLRDELKSRFDSLTNYD  323

Query  605  KYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFD  426
            +Y  E+  GHL W+P+H+   FW++N T   E D++ L+ L+ +L  SSD   LAVA  D
Sbjct  324  EYTSELASGHLSWTPVHESEVFWKENATKLNEKDYEQLKTLVRLLKESSDALVLAVAAHD  383

Query  425  LSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            L Q+++ +  G+ +VTDL AK R M+L+ H NP+V   AL+ +QRL
Sbjct  384  LGQYVKHYERGKKVVTDLGAKTRVMELMTHPNPDVRYQALISVQRL  429



>ref|XP_003291419.1| hypothetical protein DICPUDRAFT_156018 [Dictyostelium purpureum]
 gb|EGC32065.1| hypothetical protein DICPUDRAFT_156018 [Dictyostelium purpureum]
Length=446

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 103/167 (62%), Gaps = 1/167 (1%)
 Frame = -1

Query  779  LRNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKY  600
            LRNLL++G     ++D G + ++  L  + W DED+   +  L  GL  +I  +SSF+KY
Sbjct  269  LRNLLNQGNNNEEMIDNGFVRMLNILNIKKWGDEDIPADIEVLVNGLAKDIDNMSSFNKY  328

Query  599  KQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTS-SDPRTLAVACFDL  423
            K E++ G L+W+P+HK   FW++NIT FEE ++ +++ L  IL    S P  L++AC DL
Sbjct  329  KAEIVSGELEWTPVHKSERFWKENITKFEEQNYYVIKSLHQILSNGQSTPIQLSIACHDL  388

Query  422  SQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
             +F++ HP G+ I+  L+ K   M L+ + N EV K AL  +Q++ L
Sbjct  389  GEFVRHHPRGKAIIDFLQIKPAIMALMANPNEEVKKQALFALQKMML  435



>ref|XP_005709836.1| unnamed protein product [Chondrus crispus]
 emb|CDF39542.1| unnamed protein product [Chondrus crispus]
Length=471

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 100/167 (60%), Gaps = 1/167 (1%)
 Frame = -1

Query  779  LRNLLHKG-TFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDK  603
            LRN+L    T    +V  G++  + +L  + W+DED+ E L  L E L+  +  +S+FD 
Sbjct  298  LRNILKMSVTLRKEMVGAGLVGALHSLCFRRWNDEDIREDLGVLAEALESELASMSNFDV  357

Query  602  YKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDL  423
            Y+ EVL G L+W+P H+D  FWR+N+   + N  ++LR L+ +L  S D   LAVAC DL
Sbjct  358  YRAEVLSGALEWTPAHRDEMFWRENVEKLDRNQQEVLRCLVRVLHESGDETVLAVACNDL  417

Query  422  SQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            +QFI+ HP GRVI   L  K R M+L+     EV + AL C+Q L +
Sbjct  418  AQFIKFHPRGRVIAQSLGVKARLMELMVSGEGEVRRYALNCVQVLMI  464



>emb|CEF98096.1| Armadillo-type fold [Ostreococcus tauri]
Length=512

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 100/154 (65%), Gaps = 2/154 (1%)
 Frame = -1

Query  737  VDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSPM  558
            VD  +  +V+NL  + + DE+L   L +L+E L    K+ SS+++Y+ EV+ G L+WS  
Sbjct  346  VDEPLQKLVRNLSLKGFEDEELSVTLTELDEDLLHRRKEASSWERYRDEVMSGSLEWSAA  405

Query  557  HKDPAFWRDNITNFEENDFQILRVLITILDTSS--DPRTLAVACFDLSQFIQCHPAGRVI  384
            H+D  FWR+  T   +N+ QILRVLI ++D +   D +TLAVAC D+ +F   +PAGR +
Sbjct  406  HRDEGFWRECATKLTDNNCQILRVLIKLIDGNEPMDSKTLAVACNDIGEFAVHYPAGRFL  465

Query  383  VTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
              DL  KE  M+L+NHE+ EV K AL C+Q+L +
Sbjct  466  ANDLGGKEHTMRLMNHEDDEVRKYALQCVQKLLV  499



>ref|XP_011150670.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Harpegnathos 
saltator]
Length=484

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 106/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGTFGAL-------LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RNL+ K   G +       +V   VL  +  L  + + DED+   +  L + L+ +++ 
Sbjct  279  FRNLIEKVEDGQVAKEHCIAMVQCKVLKQLSILSQRKFDDEDITADIEFLNDKLQASVQD  338

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  EV  G L+WSP+HK   FWR+N +   E ++++LR+LI +LDTS DP  L+
Sbjct  339  LSSFDEYSTEVKSGRLEWSPVHKSGKFWRENASRLNEKNYELLRILIHLLDTSKDPLVLS  398

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  399  VASFDIGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  451



>ref|XP_003079498.1| putative vacuolar ATPase subunit H protein (ISS) [Ostreococcus 
tauri]
Length=525

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 101/156 (65%), Gaps = 2/156 (1%)
 Frame = -1

Query  737  VDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSPM  558
            VD  +  +V+NL  + + DE+L   L +L+E L    K+ SS+++Y+ EV+ G L+WS  
Sbjct  359  VDEPLQKLVRNLSLKGFEDEELSVTLTELDEDLLHRRKEASSWERYRDEVMSGSLEWSAA  418

Query  557  HKDPAFWRDNITNFEENDFQILRVLITILDTSS--DPRTLAVACFDLSQFIQCHPAGRVI  384
            H+D  FWR+  T   +N+ QILRVLI ++D +   D +TLAVAC D+ +F   +PAGR +
Sbjct  419  HRDEGFWRECATKLTDNNCQILRVLIKLIDGNEPMDSKTLAVACNDIGEFAVHYPAGRFL  478

Query  383  VTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGA  276
              DL  KE  M+L+NHE+ EV K AL C+Q+L + +
Sbjct  479  ANDLGGKEHTMRLMNHEDDEVRKYALQCVQKLLVSS  514



>ref|XP_011150661.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Harpegnathos 
saltator]
Length=519

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 106/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGTFGAL-------LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RNL+ K   G +       +V   VL  +  L  + + DED+   +  L + L+ +++ 
Sbjct  314  FRNLIEKVEDGQVAKEHCIAMVQCKVLKQLSILSQRKFDDEDITADIEFLNDKLQASVQD  373

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  EV  G L+WSP+HK   FWR+N +   E ++++LR+LI +LDTS DP  L+
Sbjct  374  LSSFDEYSTEVKSGRLEWSPVHKSGKFWRENASRLNEKNYELLRILIHLLDTSKDPLVLS  433

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  434  VASFDIGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  486



>gb|EFN88781.1| Vacuolar proton pump subunit H [Harpegnathos saltator]
Length=529

 Score =   135 bits (341),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/173 (39%), Positives = 106/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGTFGAL-------LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RNL+ K   G +       +V   VL  +  L  + + DED+   +  L + L+ +++ 
Sbjct  324  FRNLIEKVEDGQVAKEHCIAMVQCKVLKQLSILSQRKFDDEDITADIEFLNDKLQASVQD  383

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  EV  G L+WSP+HK   FWR+N +   E ++++LR+LI +LDTS DP  L+
Sbjct  384  LSSFDEYSTEVKSGRLEWSPVHKSGKFWRENASRLNEKNYELLRILIHLLDTSKDPLVLS  443

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA FD+ ++++ +P G+ I+  L  K+R M+LL HE+P V   ALL +Q+L +
Sbjct  444  VASFDIGEYVRHYPRGKHIIEQLGGKQRVMQLLGHEDPNVRYEALLAVQKLMV  496



>gb|KIL69551.1| hypothetical protein M378DRAFT_97213 [Amanita muscaria Koide 
BX008]
Length=437

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 107/167 (64%), Gaps = 4/167 (2%)
 Frame = -1

Query  779  LRNLLHKG---TFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSF  609
             RNL+ K       A+LV   +L  V+NL  +  SDED+ E    L + L    + L++F
Sbjct  264  FRNLVTKAPSENLPAMLV-ARLLPFVKNLCTRKLSDEDIFEDAQFLRDELNARFQSLTTF  322

Query  608  DKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACF  429
            D+YK E+L GH  W+P+H+   FW++N     + D+Q+LR+L+ +++ S+DP  LAVA  
Sbjct  323  DEYKSELLSGHPSWTPVHESEDFWKENAVKLNDADYQLLRILLRLVNESNDPTILAVAVH  382

Query  428  DLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            DL Q+++ +  G+ +++DL +K R M+L++HENP+V   ALLC+Q+L
Sbjct  383  DLGQYVKHYERGKKVISDLGSKARIMQLMSHENPDVAYRALLCVQQL  429



>emb|CCA75096.1| related to vacuolar ATP synthase subunit H [Piriformospora indica 
DSM 11827]
Length=438

 Score =   134 bits (338),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 104/167 (62%), Gaps = 4/167 (2%)
 Frame = -1

Query  779  LRNLLHKG---TFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSF  609
             RNL+ K       ++LV + +L  ++ L A+ W+DED++E L  L++ L  N + L+++
Sbjct  265  FRNLVTKAPQNNLPSMLV-VQLLPFIKTLLARKWTDEDIVEDLQFLKDELTANFQSLTTY  323

Query  608  DKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACF  429
            D+Y  E+  GHL W+P+H    FW++N     E D+Q LRVLI +L +S+DP  LAV   
Sbjct  324  DEYTSELASGHLSWTPVHTSDDFWKENAVRLNERDYQQLRVLIGLLQSSTDPLVLAVGSH  383

Query  428  DLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            D+ Q+++ +  G+ IV DL  K R M+L+ HEN +V   AL+ +QRL
Sbjct  384  DIGQYVKFYDRGKKIVADLGGKTRIMELMGHENGDVRYEALIAVQRL  430



>gb|KDQ60593.1| hypothetical protein JAAARDRAFT_31557 [Jaapia argillacea MUCL 
33604]
Length=437

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 105/166 (63%), Gaps = 2/166 (1%)
 Frame = -1

Query  779  LRNLLHKGTFGAL--LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFD  606
             RNL+ K     L  ++   +L   +NL ++ WSD+D+LE +  L + L+     L+++D
Sbjct  264  FRNLVTKAPSANLPSMLVAQLLPFSKNLCSRKWSDDDVLEDVQFLRDELRARFDSLTTYD  323

Query  605  KYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFD  426
            +Y  E+  GHL W+P+H+   FW++N     +  +Q L+ L++++  S+DP  LAVA  D
Sbjct  324  EYTSELSSGHLSWTPVHESETFWKENAVKLNDKGYQQLKTLVSLMQESADPIVLAVAVHD  383

Query  425  LSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            L Q+++ +  G+ I+TDL  KERAM+L++HENP+V   AL+ +QRL
Sbjct  384  LGQYVKHYDRGKKIITDLGGKERAMQLMSHENPDVRYQALISVQRL  429



>gb|KIP10325.1| hypothetical protein PHLGIDRAFT_125667 [Phlebiopsis gigantea 
11061_1 CR5-6]
Length=437

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 104/167 (62%), Gaps = 4/167 (2%)
 Frame = -1

Query  779  LRNLLHKG---TFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSF  609
             RNL+ K       A+LV   VL  V+NL  + W+DED+LE +  L E L      L+++
Sbjct  264  FRNLVLKAPSANLPAMLV-AQVLPFVKNLSTRKWTDEDILEDIQYLREELTARFDSLTTY  322

Query  608  DKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACF  429
            D+Y  E+L GHL W+P+H+   FW++N+T   + D+  L++L+ +L  SSD   LAVA  
Sbjct  323  DEYSSELLSGHLSWTPVHESELFWKENVTKLNDKDYAQLKLLVNLLKESSDAIVLAVAAH  382

Query  428  DLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            D+ Q+++ +  G+ ++TDL AK R M+L+ H++P V   AL+ +QRL
Sbjct  383  DVGQYVKHYERGKKVLTDLGAKTRVMELMTHKDPNVRYQALVSVQRL  429



>ref|XP_006495502.1| PREDICTED: V-type proton ATPase subunit H isoform X6 [Mus musculus]
 ref|XP_011236637.1| PREDICTED: V-type proton ATPase subunit H isoform X6 [Mus musculus]
 ref|XP_011236638.1| PREDICTED: V-type proton ATPase subunit H isoform X6 [Mus musculus]
 ref|XP_011236639.1| PREDICTED: V-type proton ATPase subunit H isoform X6 [Mus musculus]
 ref|XP_011515844.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Homo sapiens]
Length=276

 Score =   131 bits (329),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  82   FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  141

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  142  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  201

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  202  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  254



>ref|XP_004329545.1| PREDICTED: V-type proton ATPase subunit H-like [Tursiops truncatus]
Length=240

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/172 (35%), Positives = 105/172 (61%), Gaps = 7/172 (4%)
 Frame = -1

Query  776  RNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKL  618
            +N L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ L
Sbjct  47   KNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQDL  106

Query  617  SSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAV  438
            SSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAV
Sbjct  107  SSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAV  166

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            A  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  167  AAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  218



>ref|XP_011302355.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Fopius 
arisanus]
Length=483

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 101/153 (66%), Gaps = 0/153 (0%)
 Frame = -1

Query  740  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  561
            +V   VL  +  L  + + DED+ E +  L E L+ +++ LSSFD+Y  +V  G L+WSP
Sbjct  299  MVQCKVLKQLSILSQRKFDDEDITEDIEFLNEKLQASVQDLSSFDEYSTQVKSGRLEWSP  358

Query  560  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAGRVIV  381
            +HK   FWR+N +   E ++++LR+L+ +L+TS DP  L+VA FD+ ++++ +P G+ ++
Sbjct  359  VHKSSKFWRENASRLNEKNYELLRILVHLLETSKDPLVLSVASFDIGEYVRHYPRGKHVI  418

Query  380  TDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
              L  K+R M+LL+HE+P V   AL+ +Q+L +
Sbjct  419  EQLGGKQRVMQLLSHEDPNVRYEALIAVQKLMV  451



>ref|XP_010014842.1| PREDICTED: V-type proton ATPase subunit H, partial [Nestor notabilis]
Length=193

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/171 (35%), Positives = 104/171 (61%), Gaps = 7/171 (4%)
 Frame = -1

Query  773  NLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLS  615
            NLL K T       +   ++   VL  ++NL  Q + DED+ E +  L + L ++++ LS
Sbjct  1    NLLEKSTERETRQEYALAMIQCKVLKQLENLDQQKYDDEDISEDIKFLLDKLGESVQDLS  60

Query  614  SFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVA  435
            SFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LAVA
Sbjct  61   SFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLAVA  120

Query  434  CFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
              D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  121  AHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  171



>ref|XP_011302354.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Fopius 
arisanus]
Length=518

 Score =   134 bits (336),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 101/153 (66%), Gaps = 0/153 (0%)
 Frame = -1

Query  740  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  561
            +V   VL  +  L  + + DED+ E +  L E L+ +++ LSSFD+Y  +V  G L+WSP
Sbjct  334  MVQCKVLKQLSILSQRKFDDEDITEDIEFLNEKLQASVQDLSSFDEYSTQVKSGRLEWSP  393

Query  560  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAGRVIV  381
            +HK   FWR+N +   E ++++LR+L+ +L+TS DP  L+VA FD+ ++++ +P G+ ++
Sbjct  394  VHKSSKFWRENASRLNEKNYELLRILVHLLETSKDPLVLSVASFDIGEYVRHYPRGKHVI  453

Query  380  TDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
              L  K+R M+LL+HE+P V   AL+ +Q+L +
Sbjct  454  EQLGGKQRVMQLLSHEDPNVRYEALIAVQKLMV  486



>gb|KDD71741.1| V-ATPase subunit H, partial [Helicosporidium sp. ATCC 50920]
Length=178

 Score =   127 bits (320),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/162 (38%), Positives = 100/162 (62%), Gaps = 0/162 (0%)
 Frame = -1

Query  740  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  561
            +V  G+  +V+   AQAW D D+ + L QL   L++ +++LSS + +++EVL G L W P
Sbjct  13   VVAKGLPRVVEARLAQAWDDADVPQLLEQLRGVLEEGVQRLSSLECFRREVLAGVLSWGP  72

Query  560  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAGRVIV  381
            +H+  AFW ++     + +  +L+ L+ +++T+ +P TLAVAC DL +F+   PAGR +V
Sbjct  73   LHRQGAFWYEHADKLLDQNALLLKALLRVVETAQEPTTLAVACNDLHRFVSHCPAGRGLV  132

Query  380  TDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYASFLQ  255
             DL  K+  M+L+ H + +V + ALLCIQ + L       LQ
Sbjct  133  VDLGGKQLVMRLVAHPDADVRREALLCIQNILLSKDKVDVLQ  174



>gb|KDQ13172.1| hypothetical protein BOTBODRAFT_33784 [Botryobasidium botryosum 
FD-172 SS1]
Length=445

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/168 (38%), Positives = 108/168 (64%), Gaps = 4/168 (2%)
 Frame = -1

Query  779  LRNLLHKG---TFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSF  609
             RNL+ K       A+LV   +L  V+NL  + WSD++++E +  L++ L  N + L+++
Sbjct  273  FRNLVSKAPSANLPAMLV-AQLLPFVKNLATRKWSDDEIVEDIAFLKDELAKNFESLTTY  331

Query  608  DKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACF  429
            D+Y  E+  GHL W+P+H+   FW++N     + +F+ L++L+ +L+ S+DP  LAVA  
Sbjct  332  DEYTSELSSGHLSWTPVHESEMFWKENALRLNDREFEQLKILVELLNDSTDPLVLAVAAH  391

Query  428  DLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLF  285
            DL Q+++    G+ +VTDL AK R M+L+ H+NP+V  +AL+ +QRL 
Sbjct  392  DLGQYVKYCDRGKQVVTDLGAKARVMELMTHDNPDVRYHALISVQRLI  439



>ref|XP_009308551.1| ATP synthase [Trypanosoma grayi]
 gb|KEG13226.1| ATP synthase [Trypanosoma grayi]
Length=472

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/161 (39%), Positives = 105/161 (65%), Gaps = 3/161 (2%)
 Frame = -1

Query  755  TFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGH  576
             F A +V +G+L  +  L  + + DED+   ++ L+  L+ +++KL+SF +Y+ EVL G 
Sbjct  302  AFIAEMVGIGMLKTLAQLSRRKFGDEDISTLIHDLQNVLEQSMEKLTSFSEYRGEVLSGA  361

Query  575  LDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPA  396
            L+W+P+H    FW++N+  FE N++++L  L  I+ T+    TLAVAC+DL + ++ HP 
Sbjct  362  LEWTPVHTSAKFWKENVMQFESNNYEVLAALGNIIMTTRQDLTLAVACYDLGEVVRHHPT  421

Query  395  GR--VIVTDLKA-KERAMKLLNHENPEVTKNALLCIQRLFL  282
            GR  +++  L+  K R M L++H NPEV KNALL +Q++ +
Sbjct  422  GRALLLLPQLEGVKTRVMALMSHANPEVAKNALLAVQKIMV  462



>gb|KDO49208.1| hypothetical protein CISIN_1g0474481mg, partial [Citrus sinensis]
Length=65

 Score =   124 bits (310),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/64 (92%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = -1

Query  446  LAVACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYA  267
            LAVACFDLSQFIQ HPAGRVIVTDLKAKER MKL+NHEN EVTK+ALLCIQRLFLGAKYA
Sbjct  1    LAVACFDLSQFIQYHPAGRVIVTDLKAKERVMKLMNHENTEVTKSALLCIQRLFLGAKYA  60

Query  266  SFLQ  255
            SFLQ
Sbjct  61   SFLQ  64



>ref|XP_007396061.1| hypothetical protein PHACADRAFT_121574 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM55742.1| hypothetical protein PHACADRAFT_121574 [Phanerochaete carnosa 
HHB-10118-sp]
Length=436

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 104/167 (62%), Gaps = 4/167 (2%)
 Frame = -1

Query  779  LRNLLHKG---TFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSF  609
             RNL+ K       A+LV   VL  V+NL  + W+DED+LE +  L++ L      L+++
Sbjct  264  FRNLVSKAPQANLPAMLV-AHVLQFVKNLSTRKWTDEDILEDIQYLKDELTARFDSLTTY  322

Query  608  DKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACF  429
            D+Y  E++ GHL W+P+H+   FW++N+T   + D++ L++L+ +L  S D   LAVA  
Sbjct  323  DEYSSELMSGHLSWTPVHESELFWKENVTKLNDKDYEQLKLLVRLLKESQDSVVLAVAAH  382

Query  428  DLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            D+ Q+++ +  G+ ++TDL AK R M+L+ H +P V   AL+ +QRL
Sbjct  383  DVGQYVKHYERGKKVLTDLDAKTRVMELMTHPDPNVRYQALVSVQRL  429



>emb|CDH53184.1| atpase v1 complex subunit h [Lichtheimia corymbifera JMRC:FSU:9682]
Length=445

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 108/167 (65%), Gaps = 5/167 (3%)
 Frame = -1

Query  779  LRNLLHKG---TFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSF  609
            LRNL+ K       A+LV + +L  ++NL ++ WSD D+LE ++ ++E L++N + L++F
Sbjct  272  LRNLVEKAPAENLAAMLV-VKLLPFMENLGSRKWSDSDILEDIDYVKERLQENFQSLTTF  330

Query  608  DKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACF  429
            ++Y  E+  G L+WSP HK  AFW++N +  EE+++Q+LR L  IL TS+ P  LAV   
Sbjct  331  EQYASEIETGKLEWSPPHKSEAFWKENYSRLEEHNYQLLRALARILSTSTSPVILAVGAN  390

Query  428  DLSQFIQ-CHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQR  291
            D+ Q+ +    AG+  + D+ AK+R M+L+ HE+ +V   AL  +Q+
Sbjct  391  DVGQYSKYASKAGKRFLQDIGAKQRVMELMTHEDSDVRYQALAAVQK  437



>gb|EPZ30805.1| V-type proton ATPase subunit H-like protein [Rozella allomycis 
CSF55]
Length=440

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/170 (39%), Positives = 102/170 (60%), Gaps = 6/170 (4%)
 Frame = -1

Query  779  LRNLLHKGTFGAL--LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFD  606
             RN+L K     +  L+    L +++ L  + ++DED+   +  L E L++    LSSFD
Sbjct  263  FRNMLEKAKAENMHALIGAKTLSVIETLAGRKFTDEDITNDIKFLGEELRNVFNTLSSFD  322

Query  605  KYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQIL----RVLITILDTSSDPRTLAV  438
            +Y  E+  G L+WSP H+   FW+ N+  F E DF++L    R+LI IL TS DP  L+V
Sbjct  323  EYVSELRSGKLEWSPPHQSELFWKQNVIKFNEKDFEVLNNWSRILIRILATSEDPTVLSV  382

Query  437  ACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            AC D+  + + +P GR  + +L AK++ MKL++HEN EV  +AL+ +Q L
Sbjct  383  ACNDIGNYAKFYPNGRRYLQELGAKQKVMKLMSHENSEVKYHALMSVQNL  432



>gb|ADR51673.1| putative IgE binding protein [Culicoides nubeculosus]
Length=181

 Score =   127 bits (319),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/153 (38%), Positives = 99/153 (65%), Gaps = 0/153 (0%)
 Frame = -1

Query  740  LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSP  561
            +V   VL  +  L+ + + DED+   +  L E L+++++ LSSFD+Y   V    L+WSP
Sbjct  1    MVQCKVLKQLSILEQRRFDDEDITGDVEFLTEKLQNSVQDLSSFDEYSTGVKSARLEWSP  60

Query  560  MHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAGRVIV  381
            +HK   FWR+N     E ++++LR+L+ +L+TS+DP  LAVA FD+ ++++ +P G+ ++
Sbjct  61   VHKSAKFWRENAQRLNEKNYELLRILVHLLETSTDPLVLAVASFDIGEYVRHYPRGKNVI  120

Query  380  TDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
              L  K+  M+LL+HE+P V   ALL +Q+L +
Sbjct  121  EQLGGKQLVMQLLSHEDPNVRYEALLAVQKLMV  153



>gb|KFM65821.1| V-type proton ATPase subunit H, partial [Stegodyphus mimosarum]
Length=475

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/173 (38%), Positives = 107/173 (62%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGTFGAL-------LVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
            LRNL+ K    A+       +V   VL  +  L+++ + D D++E L  L E L+ +I+ 
Sbjct  281  LRNLIEKPEDPAISRDHAIVMVQCKVLKQLDILQSRRFDDPDIVEDLEFLNEKLQTSIQD  340

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+H    FWR+N     E ++++L++LI IL TS DP  L+
Sbjct  341  LSSFDEYSTEIKSGRLEWSPVHNSEKFWRENTHRLNEKNYELLKILIYILQTSKDPLALS  400

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K++ M LL+HE+P V   ALLC+Q+L +
Sbjct  401  VAAHDIGEYVRHYPRGKHVIEGLGGKQQVMHLLSHEDPNVRYQALLCVQKLMV  453



>emb|CDH53183.1| atpase v1 complex subunit h [Lichtheimia corymbifera JMRC:FSU:9682]
Length=452

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 108/167 (65%), Gaps = 5/167 (3%)
 Frame = -1

Query  779  LRNLLHKG---TFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSF  609
            LRNL+ K       A+LV + +L  ++NL ++ WSD D+LE ++ ++E L++N + L++F
Sbjct  272  LRNLVEKAPAENLAAMLV-VKLLPFMENLGSRKWSDSDILEDIDYVKERLQENFQSLTTF  330

Query  608  DKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACF  429
            ++Y  E+  G L+WSP HK  AFW++N +  EE+++Q+LR L  IL TS+ P  LAV   
Sbjct  331  EQYASEIETGKLEWSPPHKSEAFWKENYSRLEEHNYQLLRALARILSTSTSPVILAVGAN  390

Query  428  DLSQFIQ-CHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQR  291
            D+ Q+ +    AG+  + D+ AK+R M+L+ HE+ +V   AL  +Q+
Sbjct  391  DVGQYSKYASKAGKRFLQDIGAKQRVMELMTHEDSDVRYQALAAVQK  437



>ref|XP_006495500.1| PREDICTED: V-type proton ATPase subunit H isoform X5 [Mus musculus]
Length=322

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  128  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  187

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  188  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  247

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  248  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  300



>gb|EXX71257.1| Vma13p [Rhizophagus irregularis DAOM 197198w]
Length=345

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 107/171 (63%), Gaps = 4/171 (2%)
 Frame = -1

Query  779  LRNLLHKG---TFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSF  609
             RNL+ K       A+LV   +L+  +NL ++ W+D++++E ++ L+E L++N   L++F
Sbjct  174  FRNLVEKAPEANLPAMLVA-RLLNFCENLSSRKWTDKEIVEDIDFLKERLQENFHSLTTF  232

Query  608  DKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACF  429
            D+Y  E+  G L WSP H+   FWR N+    E D +++R+L  +L  SSD   L++A  
Sbjct  233  DEYASEITSGMLQWSPPHESDQFWRQNVAKLNEKDHELVRILARLLSQSSDNAVLSIAAH  292

Query  428  DLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGA  276
            DL Q+++ +P+G+  + ++ AK+R M+L+ HE+PEV   AL+ +Q+    A
Sbjct  293  DLGQYVKYYPSGKKFLQEIGAKQRIMELMTHEDPEVRYRALIAVQKYMTHA  343



>gb|ERE85970.1| V-type proton ATPase subunit H [Cricetulus griseus]
Length=476

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 107/178 (60%), Gaps = 7/178 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYA  267
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +   YA
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWYA  466



>ref|XP_011413699.1| PREDICTED: V-type proton ATPase subunit H-like isoform X4 [Crassostrea 
gigas]
Length=468

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 109/165 (66%), Gaps = 2/165 (1%)
 Frame = -1

Query  776  RNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYK  597
            R+L+H+      +V   VL  ++ L+A+ + D D+++ L  L E L+++++ LSSFD+Y 
Sbjct  280  RDLIHEHAVA--MVQCKVLKQLELLEARKFDDPDIVDDLEFLNEKLQESVQDLSSFDEYT  337

Query  596  QEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQ  417
             EV  G L+WSP+HK+  FWR+N     EN++ +L++L+ +L++S DP  L+VA  DL +
Sbjct  338  SEVKSGRLEWSPVHKNEKFWRENAIRLNENNYSLLKMLVRLLESSKDPLILSVAAHDLGE  397

Query  416  FIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            +++ +P G+V++  L  K+  M+ L+HE+P V   AL+ +Q+L +
Sbjct  398  YVRHYPRGKVVIEQLGGKQMVMQYLSHEDPNVRFEALIAVQKLMV  442



>gb|EMD38663.1| hypothetical protein CERSUDRAFT_113838 [Ceriporiopsis subvermispora 
B]
Length=437

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 103/167 (62%), Gaps = 4/167 (2%)
 Frame = -1

Query  779  LRNLLHKGT---FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSF  609
             RNL+ K       A+LV   +L   +NL  + WSDED+LE +  L + L    + L+++
Sbjct  264  FRNLVTKAPSQNLPAMLV-AHLLPFAKNLATRKWSDEDVLEDVQFLRDELNARFESLTTY  322

Query  608  DKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACF  429
            D+Y  E+  GHL WSP+H+   FW++N T   + D++ ++ L+ +L  SSDP  LAVA  
Sbjct  323  DEYSSELTSGHLSWSPVHESELFWKENATKLNDKDYEQVKTLVRLLKESSDPVVLAVAAH  382

Query  428  DLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            D+ Q+++ +  G+ +++DL  K R M+L++H N +V   AL+C+QRL
Sbjct  383  DIGQYVKHYERGKKVISDLSGKTRVMELMSHGNSDVRYQALVCVQRL  429



>ref|XP_011413698.1| PREDICTED: V-type proton ATPase subunit H-like isoform X3 [Crassostrea 
gigas]
 gb|EKC28169.1| V-type proton ATPase subunit H [Crassostrea gigas]
Length=478

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 109/165 (66%), Gaps = 2/165 (1%)
 Frame = -1

Query  776  RNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYK  597
            R+L+H+      +V   VL  ++ L+A+ + D D+++ L  L E L+++++ LSSFD+Y 
Sbjct  290  RDLIHEHAVA--MVQCKVLKQLELLEARKFDDPDIVDDLEFLNEKLQESVQDLSSFDEYT  347

Query  596  QEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQ  417
             EV  G L+WSP+HK+  FWR+N     EN++ +L++L+ +L++S DP  L+VA  DL +
Sbjct  348  SEVKSGRLEWSPVHKNEKFWRENAIRLNENNYSLLKMLVRLLESSKDPLILSVAAHDLGE  407

Query  416  FIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            +++ +P G+V++  L  K+  M+ L+HE+P V   AL+ +Q+L +
Sbjct  408  YVRHYPRGKVVIEQLGGKQMVMQYLSHEDPNVRFEALIAVQKLMV  452



>ref|XP_011929197.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Cercocebus 
atys]
Length=355

 Score =   131 bits (329),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  161  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  220

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  221  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  280

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  281  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  333



>ref|XP_009499916.1| PREDICTED: V-type proton ATPase subunit H, partial [Phalacrocorax 
carbo]
Length=308

 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RNLL K T       +   ++   VL  ++NL  Q + DED+ E +  L + L ++++ 
Sbjct  114  FRNLLEKSTERETRQEYALAMIQCKVLKQLENLDQQKYDDEDITEDIKFLLDKLGESVQD  173

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  174  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  233

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  234  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  286



>gb|EGW09777.1| V-type proton ATPase subunit H [Cricetulus griseus]
Length=473

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/178 (35%), Positives = 107/178 (60%), Gaps = 7/178 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  286  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVED  345

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  346  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  405

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGAKYA  267
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +   YA
Sbjct  406  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMVHNWYA  463



>emb|CDS14131.1| hypothetical protein LRAMOSA06301 [Absidia idahoensis var. thermophila]
Length=445

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 108/167 (65%), Gaps = 5/167 (3%)
 Frame = -1

Query  779  LRNLLHKG---TFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSF  609
            LRNL+ K       A+LV + +L  ++NL ++ WSD D+LE ++ ++E L++N + L++F
Sbjct  272  LRNLVEKAPAENLAAMLV-VKLLPFMENLSSRKWSDSDILEDIDYVKERLQENFQSLTTF  330

Query  608  DKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACF  429
            ++Y  E+  G L+WSP HK   FW++N +  EE+++Q+LR L  IL TS++P  LAV   
Sbjct  331  EQYASEIETGKLEWSPPHKSETFWKENYSRLEEHNYQLLRALARILSTSTNPVVLAVGAN  390

Query  428  DLSQFIQ-CHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQR  291
            D+ Q+ +    AG+  + D+ AK+R M+L+ HE+ +V   AL  +Q+
Sbjct  391  DVGQYSKYASKAGKRFLQDIGAKQRVMELMTHEDSDVRYQALAAVQK  437



>ref|XP_011413697.1| PREDICTED: V-type proton ATPase subunit H-like isoform X2 [Crassostrea 
gigas]
Length=484

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 109/165 (66%), Gaps = 2/165 (1%)
 Frame = -1

Query  776  RNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYK  597
            R+L+H+      +V   VL  ++ L+A+ + D D+++ L  L E L+++++ LSSFD+Y 
Sbjct  296  RDLIHEHAVA--MVQCKVLKQLELLEARKFDDPDIVDDLEFLNEKLQESVQDLSSFDEYT  353

Query  596  QEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQ  417
             EV  G L+WSP+HK+  FWR+N     EN++ +L++L+ +L++S DP  L+VA  DL +
Sbjct  354  SEVKSGRLEWSPVHKNEKFWRENAIRLNENNYSLLKMLVRLLESSKDPLILSVAAHDLGE  413

Query  416  FIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            +++ +P G+V++  L  K+  M+ L+HE+P V   AL+ +Q+L +
Sbjct  414  YVRHYPRGKVVIEQLGGKQMVMQYLSHEDPNVRFEALIAVQKLMV  458



>gb|KGL78057.1| V-type proton ATPase subunit H, partial [Tinamus guttatus]
Length=271

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 104/173 (60%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RNLL K         +   ++   VL  ++NL  Q + DED+ E +  L E L ++++ 
Sbjct  96   FRNLLEKSAERETRQEYALAMIQCKVLKQLENLDQQKYDDEDISEDIKFLLEKLGESVQD  155

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  156  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  215

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  216  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  268



>gb|EKF99745.1| ATP synthase, putative [Trypanosoma cruzi]
Length=474

 Score =   132 bits (332),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 103/160 (64%), Gaps = 3/160 (2%)
 Frame = -1

Query  752  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  573
            F A +V +G+L  +  L  + + DED+   +N+L+  L+ +++KL+SF +Y+ EVL G +
Sbjct  304  FIAEMVGVGMLKTLAQLSRRKFGDEDISVVINELKNVLEHSMEKLTSFSEYRGEVLSGEM  363

Query  572  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAG  393
            +W+P+H    FWR+N+  FE ND+++L  L   + T+    TLAVAC+DL + ++ HP G
Sbjct  364  EWTPVHTSNKFWRENVMQFENNDYEVLVALGNTIMTTHQDLTLAVACYDLGEVVRHHPTG  423

Query  392  RVIVTDLK---AKERAMKLLNHENPEVTKNALLCIQRLFL  282
            + ++   +    K R M L++H NPEV KNALL +Q++ +
Sbjct  424  KSLLLLPRMEGVKNRVMALMSHPNPEVAKNALLAVQKIMV  463



>ref|XP_010125506.1| PREDICTED: V-type proton ATPase subunit H, partial [Chlamydotis 
macqueenii]
Length=290

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RNLL K T       +   ++   VL  ++NL  Q + DED+ E +  L + L ++++ 
Sbjct  96   FRNLLEKSTERETRQEYALAMIQCKVLKQLENLDQQKYDDEDISEDIKFLLDKLGESVQD  155

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  156  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  215

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  216  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  268



>ref|XP_010214153.1| PREDICTED: V-type proton ATPase subunit H, partial [Tinamus guttatus]
Length=290

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 104/173 (60%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RNLL K         +   ++   VL  ++NL  Q + DED+ E +  L E L ++++ 
Sbjct  96   FRNLLEKSAERETRQEYALAMIQCKVLKQLENLDQQKYDDEDISEDIKFLLEKLGESVQD  155

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  156  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  215

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  216  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  268



>ref|XP_011413696.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Crassostrea 
gigas]
Length=582

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/165 (37%), Positives = 109/165 (66%), Gaps = 2/165 (1%)
 Frame = -1

Query  776  RNLLHKGTFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYK  597
            R+L+H+      +V   VL  ++ L+A+ + D D+++ L  L E L+++++ LSSFD+Y 
Sbjct  394  RDLIHEHAVA--MVQCKVLKQLELLEARKFDDPDIVDDLEFLNEKLQESVQDLSSFDEYT  451

Query  596  QEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQ  417
             EV  G L+WSP+HK+  FWR+N     EN++ +L++L+ +L++S DP  L+VA  DL +
Sbjct  452  SEVKSGRLEWSPVHKNEKFWRENAIRLNENNYSLLKMLVRLLESSKDPLILSVAAHDLGE  511

Query  416  FIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            +++ +P G+V++  L  K+  M+ L+HE+P V   AL+ +Q+L +
Sbjct  512  YVRHYPRGKVVIEQLGGKQMVMQYLSHEDPNVRFEALIAVQKLMV  556



>ref|NP_001016182.1| V-type proton ATPase subunit H [Xenopus (Silurana) tropicalis]
 gb|AAI70670.1| ATPase, H+ transporting, lysosomal, V1 subunit H [Xenopus (Silurana) 
tropicalis]
 gb|AAI70668.1| ATPase, H+ transporting, lysosomal, V1 subunit H [Xenopus (Silurana) 
tropicalis]
Length=479

 Score =   132 bits (331),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 107/173 (62%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             +NLL K T       +   ++   VL  ++NL+ Q + DED++E +  L E L ++++ 
Sbjct  285  FKNLLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDIVEDIKFLLEKLGESVQD  344

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  345  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAARLNEKNYELLKILTKLLEVSDDPQVLA  404

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  405  VAAHDIGEYVRHYPRGKRVIEQLDGKQLVMNHMHHEDQQVRYNALLAVQKLMV  457



>ref|XP_008542740.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Equus przewalskii]
Length=385

 Score =   131 bits (329),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  191  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  250

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  251  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  310

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  311  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  363



>ref|XP_003759824.1| PREDICTED: V-type proton ATPase subunit H [Sarcophilus harrisii]
Length=483

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 106/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RNLL K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNLLEKSTERETRQEYALAMIQCKVLKQLENLELQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAARLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>gb|KIM53725.1| hypothetical protein SCLCIDRAFT_1222591 [Scleroderma citrinum 
Foug A]
Length=437

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 103/167 (62%), Gaps = 4/167 (2%)
 Frame = -1

Query  779  LRNLLHKGT---FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSF  609
             RNL+ +       A+LV   +L  ++NL A  WSDED+LE +  + + L+ N   L+++
Sbjct  264  FRNLIARAPSANLPAMLV-AQLLPFIKNLAAGKWSDEDILEDIQFVRDELETNFASLTTY  322

Query  608  DKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACF  429
            D+Y  E+  GHL W+P+H+   FWR+N T   E D+  L+ L+ +L+   D  TLAVA  
Sbjct  323  DEYTSELASGHLSWTPVHESEEFWRENATRLNERDYAQLKSLLRLLNMDDDSVTLAVAVH  382

Query  428  DLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            D+ Q+++ +  G+ I+TD  AK RAM+L+ H +P+V   ALL +Q+L
Sbjct  383  DIGQYVKHYERGKKIITDFGAKGRAMELMTHSDPDVRYRALLAVQQL  429



>sp|Q9TVC1.1|VATH_PIG RecName: Full=V-type proton ATPase subunit H; Short=V-ATPase 
subunit H; AltName: Full=V-ATPase 50/57 kDa subunits; AltName: 
Full=Vacuolar proton pump subunit H; AltName: Full=Vacuolar 
proton pump subunit SFD [Sus scrofa]
 emb|CAB39537.1| 54 kDa vacuolar H(+)-ATPase subunit [Sus scrofa]
Length=483

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   L+   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERETRQEYALALIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|NP_999405.1| V-type proton ATPase subunit H [Sus scrofa]
 emb|CAB39533.1| 54 kDa vacuolar H(+)-ATPase subunit [Sus scrofa]
Length=483

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   L+   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERETRQEYALALIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_006495499.1| PREDICTED: V-type proton ATPase subunit H isoform X4 [Mus musculus]
Length=388

 Score =   131 bits (329),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  194  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  253

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  254  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  313

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  314  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  366



>ref|XP_001833472.1| MSTP042 [Coprinopsis cinerea okayama7#130]
 gb|EAU88406.1| MSTP042 [Coprinopsis cinerea okayama7#130]
Length=415

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 104/167 (62%), Gaps = 4/167 (2%)
 Frame = -1

Query  779  LRNLLHKG---TFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSF  609
             RNL+ K       A+LV   +L   +NL A+ W+DED++E +  L+E L +  + L+++
Sbjct  242  FRNLIVKAPAANLPAMLV-CQLLPFSKNLVARKWTDEDIVEDVKFLKEELTNRFQSLTTW  300

Query  608  DKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACF  429
            D+Y  E+  GHL W+P+H+   FW++N T   E   + L+VLI +L  S+DP  LAVAC 
Sbjct  301  DEYTSELASGHLSWTPVHQSDEFWKENATKLNEKGHEQLKVLINLLKESNDPVVLAVACH  360

Query  428  DLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            D+ Q+++ +  G+ IV DL  K R M L+ H++P+V   ALL +Q+L
Sbjct  361  DIGQYVKYYERGKKIVNDLGGKNRVMSLMTHKDPDVRYRALLSVQQL  407



>emb|CCO31419.1| V-type H+-transporting ATPase 54 kD subunit [Rhizoctonia solani 
AG-1 IB]
Length=159

 Score =   125 bits (315),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/146 (39%), Positives = 94/146 (64%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP  546
            +L   +NL  + W+DE++L+ +  L + L+ + + L+++D+Y  E+  GHL WSP+H+  
Sbjct  6    LLPFCKNLTTRKWTDEEILDDITFLRDLLQQSFESLTTYDEYTSELASGHLSWSPVHESE  65

Query  545  AFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKA  366
            AFW++N    +E DF  L+ L+ +L TS +   LAVA  DL Q+++ H  G+  VT+L  
Sbjct  66   AFWKENAARLDEKDFAQLKRLVELLKTSENNTVLAVAAHDLGQYVKHHDRGKKFVTELGG  125

Query  365  KERAMKLLNHENPEVTKNALLCIQRL  288
            KER M+L++H + +V   ALL +QRL
Sbjct  126  KERVMELMSHSDADVRYRALLSVQRL  151



>ref|XP_008542739.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Equus przewalskii]
Length=403

 Score =   131 bits (329),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  209  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  268

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  269  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  328

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  329  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  381



>ref|XP_004410076.1| PREDICTED: V-type proton ATPase subunit H isoform 4 [Odobenus 
rosmarus divergens]
Length=419

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  225  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  284

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  285  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  344

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  345  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  397



>ref|XP_007338813.1| ATPase, V1 complex, subunit H [Auricularia delicata TFB-10046 
SS5]
 gb|EJD53236.1| ATPase, V1 complex, subunit H [Auricularia delicata TFB-10046 
SS5]
Length=438

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/146 (40%), Positives = 95/146 (65%), Gaps = 0/146 (0%)
 Frame = -1

Query  725  VLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHLDWSPMHKDP  546
            +L  V+NL  + WSDED++E +  L   L  N + L+++D+Y  E+  GHL W+P+H   
Sbjct  286  LLPFVKNLAGRKWSDEDIIEDITFLRTELAANFESLTTYDEYTSELQSGHLSWTPVHDSQ  345

Query  545  AFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAGRVIVTDLKA  366
             FW++N+T   +++++ L++L+ +L TS DP  LAVA  D+ Q+++ +  G+  VTDL A
Sbjct  346  TFWKENVTKLNDDNYKQLKLLVGLLKTSDDPLVLAVAAHDIGQYVKFYDRGKKAVTDLGA  405

Query  365  KERAMKLLNHENPEVTKNALLCIQRL  288
            K R M+L+ H N +V   AL+ +QRL
Sbjct  406  KTRVMELMTHTNADVRYQALISVQRL  431



>ref|XP_008842646.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Nannospalax 
galili]
Length=403

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  209  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  268

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  269  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  328

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  329  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  381



>ref|XP_005638032.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Canis lupus 
familiaris]
Length=443

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  249  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  308

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  309  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  368

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  369  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  421



>gb|ESA21230.1| hypothetical protein GLOINDRAFT_343254 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX71256.1| Vma13p [Rhizophagus irregularis DAOM 197198w]
Length=446

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/171 (36%), Positives = 107/171 (63%), Gaps = 4/171 (2%)
 Frame = -1

Query  779  LRNLLHKG---TFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSF  609
             RNL+ K       A+LV   +L+  +NL ++ W+D++++E ++ L+E L++N   L++F
Sbjct  275  FRNLVEKAPEANLPAMLV-ARLLNFCENLSSRKWTDKEIVEDIDFLKERLQENFHSLTTF  333

Query  608  DKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACF  429
            D+Y  E+  G L WSP H+   FWR N+    E D +++R+L  +L  SSD   L++A  
Sbjct  334  DEYASEITSGMLQWSPPHESDQFWRQNVAKLNEKDHELVRILARLLSQSSDNAVLSIAAH  393

Query  428  DLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFLGA  276
            DL Q+++ +P+G+  + ++ AK+R M+L+ HE+PEV   AL+ +Q+    A
Sbjct  394  DLGQYVKYYPSGKKFLQEIGAKQRIMELMTHEDPEVRYRALIAVQKYMTHA  444



>ref|XP_006924025.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Pteropus 
alecto]
 ref|XP_011357456.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Pteropus 
vampyrus]
 ref|XP_011357457.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Pteropus 
vampyrus]
Length=483

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDIGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_006924026.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Pteropus 
alecto]
 ref|XP_011357458.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Pteropus 
vampyrus]
 ref|XP_011357459.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Pteropus 
vampyrus]
Length=465

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  271  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  330

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  331  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  390

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  391  VAAHDIGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>gb|KIK18316.1| hypothetical protein PISMIDRAFT_14479 [Pisolithus microcarpus 
441]
Length=436

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 102/167 (61%), Gaps = 5/167 (3%)
 Frame = -1

Query  779  LRNLLHKG---TFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSF  609
             RNL+ K       A+LV   +L   +NL A  WSDED+LE +  + + L+ N   L+++
Sbjct  264  FRNLVTKAPSANLPAMLVS-ELLSFTKNLAAAKWSDEDILEDIQFVRDELERNFASLTTY  322

Query  608  DKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACF  429
            D Y  E+   HL W+P+H+   FWR+N     E DF  L+ LI +LD S+DP TLAVA  
Sbjct  323  DVYTSELASNHLSWTPVHESEEFWRENAHRLHERDFAQLKALIQLLD-SNDPVTLAVAVH  381

Query  428  DLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            D+ Q+++    G+ +VTDL AK RAM+L+ H +P+V  +ALL +Q L
Sbjct  382  DVGQYVKHCERGKKVVTDLGAKARAMELMTHSDPDVRYHALLAVQEL  428



>ref|XP_007321482.1| hypothetical protein SERLADRAFT_474431 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN96156.1| hypothetical protein SERLA73DRAFT_185746 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO21696.1| hypothetical protein SERLADRAFT_474431 [Serpula lacrymans var. 
lacrymans S7.9]
Length=436

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 106/167 (63%), Gaps = 4/167 (2%)
 Frame = -1

Query  779  LRNLLHKG---TFGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSF  609
             RN + K       A+LV   +L  ++NL  + WSDED+LE +  +++ L+ N + L+++
Sbjct  263  FRNFVTKAPSANLPAMLV-AQLLPFIKNLSGRKWSDEDILEDVQFVKDELETNFQTLTTY  321

Query  608  DKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACF  429
            D+Y  E+  GHL W+P+H+   FW++N     + D++ LR+LI +LD S+DP  LAVA  
Sbjct  322  DEYTSELASGHLSWTPVHESEDFWKENAAKLNDKDYEQLRILIRLLDDSNDPLVLAVAVH  381

Query  428  DLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRL  288
            D+ ++++ +  G+ +VTDL AK RAM L+ H + +V  +ALL +Q L
Sbjct  382  DIGRYVKHYDRGKKVVTDLGAKTRAMDLMRHSDSDVRYHALLSVQLL  428



>ref|XP_010185105.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Mesitornis 
unicolor]
Length=480

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RNLL K T       +   ++   VL  ++NL  Q + DED+ E +  L E L ++++ 
Sbjct  286  FRNLLEKSTERETRQEYALAMIQCKVLKQLENLDQQKYDDEDISEDIKFLLEKLGESVQD  345

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  346  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  405

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  406  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  458



>ref|XP_811617.1| ATP synthase [Trypanosoma cruzi strain CL Brener]
 gb|EAN89766.1| ATP synthase, putative [Trypanosoma cruzi]
Length=474

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/160 (38%), Positives = 103/160 (64%), Gaps = 3/160 (2%)
 Frame = -1

Query  752  FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKKLSSFDKYKQEVLLGHL  573
            F A +V +G+L  +  L  + + DED+   +N+L+  L+ +++KL+SF +Y+ EVL G +
Sbjct  304  FIAEMVGVGMLKTLAQLSRRKFGDEDISVVINELKNVLEHSMEKLTSFSEYRGEVLSGEM  363

Query  572  DWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLAVACFDLSQFIQCHPAG  393
            +W+P+H    FW++N+  FE ND+++L  L   + T+    TLAVAC+DL + ++ HP G
Sbjct  364  EWTPVHTSNKFWKENVMQFENNDYEVLVALGNTIMTTHQDLTLAVACYDLGEVVRHHPTG  423

Query  392  RVIVTDLK---AKERAMKLLNHENPEVTKNALLCIQRLFL  282
            + ++   +    K R M L++H NPEV KNALL +Q++ +
Sbjct  424  KSLLLLPRMEGVKSRVMALMSHPNPEVAKNALLAVQKIMV  463



>ref|XP_010586613.1| PREDICTED: V-type proton ATPase subunit H isoform X4 [Loxodonta 
africana]
Length=443

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  249  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  308

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  309  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  368

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  369  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  421



>ref|XP_010586612.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Loxodonta 
africana]
Length=453

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  259  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  318

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  319  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  378

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  379  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  431



>ref|XP_011929198.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Cercocebus 
atys]
Length=465

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  271  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  330

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  331  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  390

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  391  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_009811839.1| PREDICTED: V-type proton ATPase subunit H, partial [Gavia stellata]
Length=323

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RNLL K T       +   ++   VL  ++NL  Q + DED+ E +  L + L ++++ 
Sbjct  149  FRNLLEKSTERETRQEYALAMIQCKVLKQLENLDQQKYDDEDISEDIKFLLDKLGESVQD  208

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  209  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  268

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  269  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  321



>ref|XP_004679936.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Condylura 
cristata]
Length=483

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_008495781.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Calypte 
anna]
Length=462

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RNLL K T       +   ++   VL  ++NL  Q + DED+ E +  L E L ++++ 
Sbjct  268  FRNLLEKSTERETRQEYALAMIQCKVLKQLENLDQQKYDDEDISEDIKFLLEKLGESVQD  327

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  328  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  387

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  388  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  440



>ref|XP_010199764.1| PREDICTED: V-type proton ATPase subunit H, partial [Colius striatus]
Length=322

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RNLL K T       +   ++   VL  ++NL  Q + DED+ E +  L + L ++++ 
Sbjct  114  FRNLLEKSTERETRQEYALAMIQCKVLKQLENLDQQKYDDEDISEDIKFLLDKLGESVQD  173

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  174  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  233

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  234  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  286



>ref|XP_007998823.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Chlorocebus 
sabaeus]
Length=453

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  259  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  318

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  319  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  378

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  379  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  431



>ref|XP_011792987.1| PREDICTED: V-type proton ATPase subunit H isoform X4 [Colobus 
angolensis palliatus]
 ref|XP_011853504.1| PREDICTED: V-type proton ATPase subunit H isoform X4 [Mandrillus 
leucophaeus]
Length=419

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  225  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  284

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  285  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  344

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  345  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  397



>ref|XP_004410073.1| PREDICTED: V-type proton ATPase subunit H isoform 1 [Odobenus 
rosmarus divergens]
 ref|XP_004410074.1| PREDICTED: V-type proton ATPase subunit H isoform 2 [Odobenus 
rosmarus divergens]
 ref|XP_004768878.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Mustela 
putorius furo]
 ref|XP_004768879.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Mustela 
putorius furo]
 ref|XP_004819700.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Mustela 
putorius furo]
 ref|XP_004819701.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Mustela 
putorius furo]
 ref|XP_008704908.1| PREDICTED: V-type proton ATPase subunit H [Ursus maritimus]
 ref|XP_008704909.1| PREDICTED: V-type proton ATPase subunit H [Ursus maritimus]
 ref|XP_008704910.1| PREDICTED: V-type proton ATPase subunit H [Ursus maritimus]
Length=483

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_010185106.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Mesitornis 
unicolor]
Length=462

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RNLL K T       +   ++   VL  ++NL  Q + DED+ E +  L E L ++++ 
Sbjct  268  FRNLLEKSTERETRQEYALAMIQCKVLKQLENLDQQKYDDEDISEDIKFLLEKLGESVQD  327

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  328  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  387

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  388  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  440



>ref|XP_011740633.1| PREDICTED: V-type proton ATPase subunit H isoform X4 [Macaca 
nemestrina]
Length=425

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  231  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  290

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  291  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  350

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  351  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  403



>ref|XP_004011726.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Ovis aries]
 ref|XP_005689031.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Capra hircus]
 ref|XP_011989826.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Ovis aries 
musimon]
Length=465

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  271  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  330

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  331  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAARLNEKNYELLKILTKLLEVSDDPQVLA  390

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  391  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_006994248.1| PREDICTED: V-type proton ATPase subunit H-like isoform X1 [Peromyscus 
maniculatus bairdii]
Length=483

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>gb|ADI40572.1| lysosomal H+-transporting ATPase V1 subunit H [Miniopterus schreibersii]
Length=483

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_008495780.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Calypte 
anna]
Length=480

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RNLL K T       +   ++   VL  ++NL  Q + DED+ E +  L E L ++++ 
Sbjct  286  FRNLLEKSTERETRQEYALAMIQCKVLKQLENLDQQKYDDEDISEDIKFLLEKLGESVQD  345

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  346  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  405

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  406  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  458



>ref|XP_004275066.1| PREDICTED: V-type proton ATPase subunit H isoform 1 [Orcinus 
orca]
Length=480

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  286  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  345

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  346  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  405

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  406  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  458



>ref|XP_005613222.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Equus caballus]
 ref|XP_005613223.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Equus caballus]
Length=483

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_003408364.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Loxodonta 
africana]
Length=483

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_004679937.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Condylura 
cristata]
Length=465

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  271  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  330

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  331  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  390

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  391  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_007516038.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Erinaceus 
europaeus]
Length=483

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_004479904.1| PREDICTED: V-type proton ATPase subunit H isoform 1 [Dasypus 
novemcinctus]
Length=483

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERESRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_005638031.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Canis lupus 
familiaris]
Length=465

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  271  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  330

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  331  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  390

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  391  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_004011727.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Ovis aries]
 ref|XP_005689030.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Capra hircus]
 ref|XP_011989825.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Ovis aries 
musimon]
Length=483

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAARLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>gb|AAH09154.1| ATPase, H+ transporting, lysosomal V1 subunit H [Mus musculus]
 gb|EDL14258.1| ATPase, H+ transporting, lysosomal V1 subunit H [Mus musculus]
Length=483

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_007950398.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Orycteropus 
afer afer]
Length=483

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|NP_598587.2| V-type proton ATPase subunit H [Mus musculus]
 ref|XP_006495496.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Mus musculus]
 sp|Q8BVE3.1|VATH_MOUSE RecName: Full=V-type proton ATPase subunit H; Short=V-ATPase 
subunit H; AltName: Full=Vacuolar proton pump subunit H [Mus 
musculus]
 dbj|BAC37382.1| unnamed protein product [Mus musculus]
Length=483

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_007168672.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Balaenoptera 
acutorostrata scammoni]
Length=465

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  271  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  330

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  331  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  390

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  391  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_009671845.1| PREDICTED: V-type proton ATPase subunit H [Struthio camelus australis]
Length=480

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/173 (36%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RNLL K T       +   ++   VL  ++NL  Q + DED+ E +  L E L ++++ 
Sbjct  286  FRNLLEKSTERETRQEYALAMIQCKVLKQLENLDQQKYDDEDISEDIKFLLEKLGESVQD  345

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  346  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  405

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  406  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  458



>ref|XP_009946371.1| PREDICTED: V-type proton ATPase subunit H, partial [Leptosomus 
discolor]
Length=343

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RNLL K T       +   ++   VL  ++NL  Q + DED+ E +  L + L ++++ 
Sbjct  149  FRNLLEKSTERETRQEYALAMIQCKVLKQLENLDQQKYDDEDISEDIKFLLDKLGESVQD  208

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  209  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  268

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  269  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  321



>ref|XP_008761746.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Rattus 
norvegicus]
Length=443

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  249  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  308

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  309  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  368

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  369  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  421



>ref|XP_005322961.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Ictidomys 
tridecemlineatus]
 ref|XP_005322962.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Ictidomys 
tridecemlineatus]
Length=483

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_004602396.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Sorex araneus]
Length=465

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  271  FRNFLEKSTERESRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  330

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  331  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  390

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  391  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>gb|ELK02307.1| V-type proton ATPase subunit H [Pteropus alecto]
Length=443

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  268  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  327

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  328  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  387

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  388  VAAHDIGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  440



>ref|XP_006900599.1| PREDICTED: V-type proton ATPase subunit H-like [Elephantulus 
edwardii]
Length=483

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_003999862.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Felis catus]
Length=465

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  271  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  330

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  331  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  390

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  391  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_011792986.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Colobus 
angolensis palliatus]
 ref|XP_011853503.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Mandrillus 
leucophaeus]
 ref|XP_011740632.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Macaca 
nemestrina]
Length=443

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  249  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  308

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  309  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  368

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  369  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  421



>ref|XP_007516039.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Erinaceus 
europaeus]
Length=465

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  271  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  330

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  331  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  390

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  391  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_007105306.1| PREDICTED: V-type proton ATPase subunit H isoform X2 [Physeter 
catodon]
Length=465

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  271  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  330

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  331  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  390

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  391  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_004479905.1| PREDICTED: V-type proton ATPase subunit H isoform 2 [Dasypus 
novemcinctus]
Length=465

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  271  FRNFLEKSTERESRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  330

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  331  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  390

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  391  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_007464083.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Lipotes 
vexillifer]
Length=480

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  286  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  345

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  346  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  405

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  406  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  458



>ref|XP_004410075.1| PREDICTED: V-type proton ATPase subunit H isoform 3 [Odobenus 
rosmarus divergens]
 ref|XP_004768880.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Mustela 
putorius furo]
 ref|XP_004819702.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Mustela 
putorius furo]
Length=465

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  271  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  330

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  331  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  390

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  391  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_004602395.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Sorex araneus]
Length=483

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERESRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>emb|CAG12279.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=479

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RNLL K         +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  286  FRNLLEKAAERETRQEYALAMIQCKVLKQLENLEQQKYDDEDITEDIKFLLERLGESVQD  345

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ +A
Sbjct  346  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTRLLEVSDDPQVIA  405

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+  V  NALLC+Q+L +
Sbjct  406  VAAHDIGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQLVRYNALLCVQKLMV  458



>ref|XP_005613224.1| PREDICTED: V-type proton ATPase subunit H isoform X3 [Equus caballus]
Length=465

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  271  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  330

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  331  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  390

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  391  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  443



>ref|XP_007168671.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Balaenoptera 
acutorostrata scammoni]
Length=483

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



>ref|XP_005362304.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Microtus 
ochrogaster]
 ref|XP_007632664.1| PREDICTED: V-type proton ATPase subunit H isoform X1 [Cricetulus 
griseus]
 gb|ERE85968.1| V-type proton ATPase subunit H [Cricetulus griseus]
Length=483

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/173 (35%), Positives = 105/173 (61%), Gaps = 7/173 (4%)
 Frame = -1

Query  779  LRNLLHKGT-------FGALLVDLGVLHIVQNLKAQAWSDEDLLEALNQLEEGLKDNIKK  621
             RN L K T       +   ++   VL  ++NL+ Q + DED+ E +  L E L ++++ 
Sbjct  289  FRNFLEKSTERETRQEYALAMIQCKVLKQLENLEQQKYDDEDISEDIKFLLEKLGESVQD  348

Query  620  LSSFDKYKQEVLLGHLDWSPMHKDPAFWRDNITNFEENDFQILRVLITILDTSSDPRTLA  441
            LSSFD+Y  E+  G L+WSP+HK   FWR+N     E ++++L++L  +L+ S DP+ LA
Sbjct  349  LSSFDEYSSELKSGRLEWSPVHKSEKFWRENAVRLNEKNYELLKILTKLLEVSDDPQVLA  408

Query  440  VACFDLSQFIQCHPAGRVIVTDLKAKERAMKLLNHENPEVTKNALLCIQRLFL  282
            VA  D+ ++++ +P G+ ++  L  K+  M  ++HE+ +V  NALL +Q+L +
Sbjct  409  VAAHDVGEYVRHYPRGKRVIEQLGGKQLVMNHMHHEDQQVRYNALLAVQKLMV  461



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1566421839775