BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2493

Length=846
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009612011.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    362   1e-115   Nicotiana tomentosiformis
dbj|BAQ02862.1|  alpha-L-Arabinofuranosidase/beta-D-Xylopyrianosi...    347   1e-114   Nicotiana tabacum [American tobacco]
ref|XP_009628814.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    358   6e-114   Nicotiana tomentosiformis
ref|XP_009801214.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    358   7e-114   Nicotiana sylvestris
ref|XP_006351808.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    354   1e-112   Solanum tuberosum [potatoes]
ref|XP_009762535.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    354   1e-112   Nicotiana sylvestris
ref|XP_004230547.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    350   3e-111   
ref|XP_011092407.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    349   9e-111   Sesamum indicum [beniseed]
gb|KDO56532.1|  hypothetical protein CISIN_1g0476211mg                  325   6e-108   Citrus sinensis [apfelsine]
gb|EPS65933.1|  hypothetical protein M569_08842                         340   2e-107   Genlisea aurea
sp|A5JTQ3.1|XYL2_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    338   2e-106   Medicago sativa subsp. x varia
ref|XP_002298197.2|  beta-glucosidase family protein                    338   2e-106   
gb|KEH31243.1|  beta-xylosidase/alpha-L-arabinofuranosidase-like ...    337   5e-106   Medicago truncatula
gb|EYU35409.1|  hypothetical protein MIMGU_mgv1a001738mg                337   5e-106   Erythranthe guttata [common monkey flower]
ref|NP_001233910.1|  beta-D-xylosidase 1 precursor                      337   7e-106   Solanum lycopersicum
ref|XP_002303181.1|  beta-glucosidase family protein                    336   1e-105   
ref|XP_009354080.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    336   1e-105   Pyrus x bretschneideri [bai li]
ref|XP_009347830.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    336   1e-105   
ref|XP_008339210.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    336   1e-105   
ref|XP_012080785.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    335   2e-105   Jatropha curcas
ref|XP_008344154.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    335   2e-105   
ref|XP_004504774.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    335   3e-105   Cicer arietinum [garbanzo]
ref|XP_010546362.1|  PREDICTED: beta-D-xylosidase 4                     334   6e-105   Tarenaya hassleriana [spider flower]
ref|XP_009379698.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    334   7e-105   
ref|XP_011015574.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    334   7e-105   Populus euphratica
ref|XP_011046123.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    334   7e-105   Populus euphratica
ref|XP_006341844.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    335   8e-105   Solanum tuberosum [potatoes]
ref|XP_011004967.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    333   1e-104   Populus euphratica
emb|CAJ65922.1|  xylan 1,4-beta-xylosidase                              333   1e-104   Populus tremula x Populus alba [gray poplar]
ref|XP_010065527.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    332   7e-104   Eucalyptus grandis [rose gum]
ref|XP_002513707.1|  Beta-glucosidase, putative                         331   8e-104   Ricinus communis
emb|CAJ65921.1|  xylan 1,4-beta-xylosidase                              329   1e-103   Populus tremula x Populus alba [gray poplar]
ref|XP_007148433.1|  hypothetical protein PHAVU_006G208200g             330   2e-103   Phaseolus vulgaris [French bean]
ref|XP_010243340.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    330   3e-103   Nelumbo nucifera [Indian lotus]
emb|CDY18705.1|  BnaA09g06900D                                          330   4e-103   Brassica napus [oilseed rape]
ref|XP_009112141.1|  PREDICTED: beta-D-xylosidase 4-like                329   4e-103   Brassica rapa
ref|XP_010065531.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    329   7e-103   Eucalyptus grandis [rose gum]
gb|KFK28148.1|  hypothetical protein AALP_AA8G478800                    328   8e-103   Arabis alpina [alpine rockcress]
ref|XP_002268626.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    328   1e-102   Vitis vinifera
emb|CBI40687.3|  unnamed protein product                                327   1e-102   Vitis vinifera
ref|XP_002264183.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    328   2e-102   Vitis vinifera
ref|XP_006493288.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    327   2e-102   Citrus sinensis [apfelsine]
ref|XP_006432467.1|  hypothetical protein CICLE_v10000355mg             327   3e-102   Citrus clementina [clementine]
ref|XP_003547598.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    327   3e-102   Glycine max [soybeans]
emb|CDX81229.1|  BnaC09g06400D                                          327   5e-102   
ref|XP_003531557.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    326   6e-102   Glycine max [soybeans]
ref|XP_010261102.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    326   8e-102   Nelumbo nucifera [Indian lotus]
ref|XP_006280038.1|  hypothetical protein CARUB_v10025915mg             326   1e-101   Capsella rubella
emb|CDY46812.1|  BnaC02g43200D                                          325   1e-101   Brassica napus [oilseed rape]
ref|XP_007043027.1|  Beta-D-xylosidase 4                                325   2e-101   
ref|XP_011087838.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    325   2e-101   Sesamum indicum [beniseed]
ref|XP_007225245.1|  hypothetical protein PRUPE_ppa001692mg             325   3e-101   Prunus persica
ref|XP_010065529.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    325   4e-101   Eucalyptus grandis [rose gum]
gb|KGN43688.1|  hypothetical protein Csa_7G058620                       324   5e-101   Cucumis sativus [cucumbers]
ref|XP_006394136.1|  hypothetical protein EUTSA_v10003678mg             324   5e-101   Eutrema salsugineum [saltwater cress]
ref|XP_004136861.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    325   5e-101   Cucumis sativus [cucumbers]
ref|XP_010444394.1|  PREDICTED: beta-D-xylosidase 4-like                324   6e-101   Camelina sativa [gold-of-pleasure]
ref|XP_002866623.1|  beta-xylosidase 4                                  323   8e-101   Arabidopsis lyrata subsp. lyrata
ref|XP_008455235.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    323   1e-100   Cucumis melo [Oriental melon]
ref|NP_201262.1|  beta-D-xylosidase 4                                   323   1e-100   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010484241.1|  PREDICTED: beta-D-xylosidase 4                     323   1e-100   Camelina sativa [gold-of-pleasure]
emb|CDY31313.1|  BnaA02g34280D                                          322   2e-100   Brassica napus [oilseed rape]
ref|XP_010461983.1|  PREDICTED: beta-D-xylosidase 4-like                322   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_008218886.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    322   3e-100   Prunus mume [ume]
ref|XP_010103839.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2      322   5e-100   Morus notabilis
gb|KJB31995.1|  hypothetical protein B456_005G218000                    321   6e-100   Gossypium raimondii
ref|XP_009401393.1|  PREDICTED: beta-D-xylosidase 4-like                321   6e-100   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG10349.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           321   7e-100   Gossypium arboreum [tree cotton]
ref|XP_007159080.1|  hypothetical protein PHAVU_002G206800g             320   1e-99    Phaseolus vulgaris [French bean]
ref|XP_010065530.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    320   2e-99    Eucalyptus grandis [rose gum]
ref|XP_009130462.1|  PREDICTED: beta-D-xylosidase 4-like                319   4e-99    Brassica rapa
ref|XP_010520456.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    318   4e-99    
emb|CDY52884.1|  BnaC06g27770D                                          304   1e-98    Brassica napus [oilseed rape]
ref|XP_004485551.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    318   1e-98    Cicer arietinum [garbanzo]
ref|XP_003593145.1|  Beta-xylosidase/alpha-L-arabinofuranosidase        317   2e-98    Medicago truncatula
ref|XP_011087839.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    317   2e-98    Sesamum indicum [beniseed]
ref|XP_008784548.1|  PREDICTED: LOW QUALITY PROTEIN: beta-xylosid...    317   2e-98    
ref|XP_011465594.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    317   2e-98    Fragaria vesca subsp. vesca
sp|A5JTQ2.1|XYL1_MEDSV  RecName: Full=Beta-xylosidase/alpha-L-ara...    316   6e-98    Medicago sativa subsp. x varia
gb|KHN06823.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           301   8e-98    Glycine soja [wild soybean]
dbj|BAE44362.1|  alpha-L-arabinofuranosidase                            315   1e-97    Raphanus sativus
emb|CDY56487.1|  BnaCnng30450D                                          315   1e-97    Brassica napus [oilseed rape]
emb|CDY51290.1|  BnaA06g23560D                                          315   2e-97    Brassica napus [oilseed rape]
ref|XP_004300692.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    315   2e-97    Fragaria vesca subsp. vesca
ref|XP_009150540.1|  PREDICTED: beta-D-xylosidase 4                     315   3e-97    Brassica rapa
ref|XP_010068200.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    313   9e-97    Eucalyptus grandis [rose gum]
ref|XP_009403180.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    312   2e-96    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010937054.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    310   6e-96    Elaeis guineensis
ref|XP_003524073.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    305   1e-95    
ref|XP_003531047.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    309   2e-95    Glycine max [soybeans]
ref|XP_010687471.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    309   2e-95    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002873418.1|  beta-xylosidase 3                                  309   3e-95    Arabidopsis lyrata subsp. lyrata
ref|XP_010452969.1|  PREDICTED: beta-D-xylosidase 3-like                308   5e-95    Camelina sativa [gold-of-pleasure]
ref|XP_004301992.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    308   6e-95    Fragaria vesca subsp. vesca
ref|NP_196535.1|  beta-xylosidase 3                                     308   6e-95    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006827121.1|  PREDICTED: beta-D-xylosidase 4                     308   6e-95    Amborella trichopoda
emb|CDY01780.1|  BnaC06g28200D                                          308   8e-95    
gb|EYU18508.1|  hypothetical protein MIMGU_mgv1a001685mg                306   3e-94    Erythranthe guttata [common monkey flower]
gb|EYU18507.1|  hypothetical protein MIMGU_mgv1a001685mg                306   3e-94    Erythranthe guttata [common monkey flower]
ref|XP_006399455.1|  hypothetical protein EUTSA_v10012739mg             306   5e-94    Eutrema salsugineum [saltwater cress]
ref|XP_010422951.1|  PREDICTED: beta-D-xylosidase 3 isoform X2          304   9e-94    Camelina sativa [gold-of-pleasure]
gb|KFK25272.1|  hypothetical protein AALP_AA8G090500                    304   1e-93    Arabis alpina [alpine rockcress]
ref|XP_010422950.1|  PREDICTED: beta-D-xylosidase 3 isoform X1          305   2e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010491611.1|  PREDICTED: beta-D-xylosidase 3-like isoform X2     303   3e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010491610.1|  PREDICTED: beta-D-xylosidase 3-like isoform X1     303   4e-93    Camelina sativa [gold-of-pleasure]
gb|KJB77499.1|  hypothetical protein B456_012G140300                    303   5e-93    Gossypium raimondii
ref|XP_009105246.1|  PREDICTED: beta-D-xylosidase 3-like                303   6e-93    Brassica rapa
emb|CDY35825.1|  BnaC09g37570D                                          302   8e-93    Brassica napus [oilseed rape]
emb|CDY21595.1|  BnaC09g46970D                                          306   8e-93    Brassica napus [oilseed rape]
emb|CDX97115.1|  BnaC09g45100D                                          300   1e-92    
emb|CDX69892.1|  BnaA10g22410D                                          301   2e-92    
gb|KHG02719.1|  Beta-xylosidase/alpha-L-arabinofuranosidase 2           301   3e-92    Gossypium arboreum [tree cotton]
ref|XP_010491609.1|  PREDICTED: beta-D-xylosidase 4-like                301   3e-92    Camelina sativa [gold-of-pleasure]
ref|XP_009122535.1|  PREDICTED: beta-D-xylosidase 3-like                300   5e-92    Brassica rapa
ref|XP_010424711.1|  PREDICTED: beta-D-xylosidase 4-like                300   7e-92    
emb|CDX96113.1|  BnaA07g26180D                                          304   1e-91    
dbj|BAJ89945.1|  predicted protein                                      291   4e-91    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002448619.1|  hypothetical protein SORBIDRAFT_06g030270          291   9e-89    Sorghum bicolor [broomcorn]
ref|XP_010657638.1|  PREDICTED: beta-D-xylosidase 4-like                276   1e-88    
gb|EYU18509.1|  hypothetical protein MIMGU_mgv1a001665mg                291   1e-88    Erythranthe guttata [common monkey flower]
ref|XP_004976989.1|  PREDICTED: beta-D-xylosidase 4-like isoform X2     291   2e-88    Setaria italica
gb|AFW59619.1|  putative O-Glycosyl hydrolase superfamily protein       282   2e-88    
dbj|BAJ90315.1|  predicted protein                                      290   5e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ90420.1|  predicted protein                                      290   5e-88    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001054038.1|  Os04g0640700                                       289   8e-88    
emb|CDO97479.1|  unnamed protein product                                287   1e-87    Coffea canephora [robusta coffee]
gb|AAK38481.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase iso...    288   3e-87    Hordeum vulgare [barley]
gb|KHG24361.1|  Beta-D-xylosidase 1 -like protein                       271   1e-86    Gossypium arboreum [tree cotton]
ref|XP_004976988.1|  PREDICTED: beta-D-xylosidase 4-like isoform X1     287   1e-86    
ref|XP_008661822.1|  PREDICTED: uncharacterized protein LOC100279...    282   3e-85    
ref|XP_006855294.1|  PREDICTED: probable beta-D-xylosidase 2            281   6e-85    Amborella trichopoda
gb|KJB38536.1|  hypothetical protein B456_006G259500                    277   7e-85    Gossypium raimondii
ref|XP_006653810.1|  PREDICTED: beta-D-xylosidase 4-like                280   3e-84    
ref|XP_002515300.1|  Beta-glucosidase, putative                         279   5e-84    Ricinus communis
ref|XP_003580652.1|  PREDICTED: beta-D-xylosidase 4-like                278   9e-84    Brachypodium distachyon [annual false brome]
ref|XP_003625957.1|  Beta-xylosidase                                    278   2e-83    Medicago truncatula
gb|KDO87027.1|  hypothetical protein CISIN_1g0041902mg                  262   2e-83    Citrus sinensis [apfelsine]
ref|XP_010113184.1|  putative beta-D-xylosidase 5                       264   3e-83    Morus notabilis
gb|KJB38535.1|  hypothetical protein B456_006G259500                    277   3e-83    Gossypium raimondii
dbj|BAF00595.1|  xylosidase                                             263   5e-83    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010094323.1|  Beta-D-xylosidase 1                                276   1e-82    Morus notabilis
gb|KHN30647.1|  Putative beta-D-xylosidase 2                            271   1e-82    Glycine soja [wild soybean]
ref|XP_002974833.1|  hypothetical protein SELMODRAFT_101733             275   2e-82    Selaginella moellendorffii
ref|XP_011041424.1|  PREDICTED: probable beta-D-xylosidase 2            275   2e-82    Populus euphratica
ref|XP_011015623.1|  PREDICTED: probable beta-D-xylosidase 2            275   2e-82    Populus euphratica
ref|XP_010259348.1|  PREDICTED: putative beta-D-xylosidase              275   2e-82    Nelumbo nucifera [Indian lotus]
ref|XP_002963750.1|  hypothetical protein SELMODRAFT_80102              275   3e-82    Selaginella moellendorffii
emb|CDP17081.1|  unnamed protein product                                271   3e-82    Coffea canephora [robusta coffee]
ref|XP_002519194.1|  Periplasmic beta-glucosidase precursor, puta...    275   3e-82    Ricinus communis
ref|XP_002980053.1|  hypothetical protein SELMODRAFT_112087             274   3e-82    Selaginella moellendorffii
ref|XP_002987446.1|  hypothetical protein SELMODRAFT_426206             274   4e-82    Selaginella moellendorffii
ref|XP_002885319.1|  beta-1,4-xylosidase                                275   5e-82    
ref|XP_008384517.1|  PREDICTED: probable beta-D-xylosidase 5            274   5e-82    
ref|XP_002320310.2|  hypothetical protein POPTR_0014s11730g             273   6e-82    
gb|KJB77632.1|  hypothetical protein B456_012G147500                    274   6e-82    Gossypium raimondii
ref|XP_007035744.1|  Periplasmic beta-glucosidase, putative             273   6e-82    
ref|XP_011100796.1|  PREDICTED: beta-D-xylosidase 1                     273   7e-82    Sesamum indicum [beniseed]
emb|CDY67410.1|  BnaCnng54810D                                          268   7e-82    Brassica napus [oilseed rape]
gb|KHG14371.1|  Beta-D-xylosidase 1 -like protein                       273   8e-82    Gossypium arboreum [tree cotton]
gb|AAS17751.2|  beta xylosidase                                         273   9e-82    Fragaria x ananassa
ref|XP_012082876.1|  PREDICTED: probable beta-D-xylosidase 2            273   9e-82    Jatropha curcas
emb|CDY15255.1|  BnaC05g01340D                                          273   9e-82    Brassica napus [oilseed rape]
ref|XP_012093115.1|  PREDICTED: probable beta-D-xylosidase 5 isof...    273   1e-81    Jatropha curcas
ref|XP_010457247.1|  PREDICTED: probable beta-D-xylosidase 2            272   1e-81    Camelina sativa [gold-of-pleasure]
emb|CDX89954.1|  BnaA10g01280D                                          272   2e-81    
ref|XP_004295104.1|  PREDICTED: putative beta-D-xylosidase              272   2e-81    Fragaria vesca subsp. vesca
ref|XP_009119616.1|  PREDICTED: probable beta-D-xylosidase 2            272   2e-81    Brassica rapa
ref|XP_008223305.1|  PREDICTED: putative beta-D-xylosidase              272   2e-81    Prunus mume [ume]
ref|XP_007225668.1|  hypothetical protein PRUPE_ppa001718mg             272   2e-81    Prunus persica
ref|XP_009339788.1|  PREDICTED: probable beta-D-xylosidase 2            272   3e-81    Pyrus x bretschneideri [bai li]
ref|NP_188596.1|  putative beta-D-xylosidase 5                          272   3e-81    Arabidopsis thaliana [mouse-ear cress]
gb|KJB72795.1|  hypothetical protein B456_011G198200                    271   4e-81    Gossypium raimondii
gb|ACD93208.1|  beta xylosidase                                         271   4e-81    Camellia sinensis [black tea]
ref|XP_012093116.1|  PREDICTED: probable beta-D-xylosidase 5 isof...    274   4e-81    Jatropha curcas
ref|XP_002302758.2|  hypothetical protein POPTR_0002s19830g             271   5e-81    
ref|XP_006419427.1|  hypothetical protein CICLE_v10004369mg             271   5e-81    
ref|XP_010466113.1|  PREDICTED: probable beta-D-xylosidase 5            271   6e-81    Camelina sativa [gold-of-pleasure]
gb|KFK26586.1|  hypothetical protein AALP_AA8G267600                    271   7e-81    Arabis alpina [alpine rockcress]
ref|XP_011042236.1|  PREDICTED: probable beta-D-xylosidase 2            271   7e-81    Populus euphratica
dbj|BAB02547.1|  beta-1,4-xylosidase                                    272   8e-81    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306829.1|  hypothetical protein CARUB_v10008371mg             270   8e-81    Capsella rubella
ref|XP_003535953.1|  PREDICTED: probable beta-D-xylosidase 2            270   9e-81    Glycine max [soybeans]
ref|XP_012084033.1|  PREDICTED: putative beta-D-xylosidase              270   9e-81    Jatropha curcas
ref|XP_006406478.1|  hypothetical protein EUTSA_v10022061mg             270   1e-80    
ref|XP_003592512.1|  Xylosidase                                         270   1e-80    Medicago truncatula
ref|XP_002527511.1|  Beta-glucosidase, putative                         271   1e-80    Ricinus communis
emb|CDY33913.1|  BnaA02g30740D                                          270   1e-80    Brassica napus [oilseed rape]
emb|CDY05634.1|  BnaC02g39030D                                          270   1e-80    
ref|XP_010481135.1|  PREDICTED: probable beta-D-xylosidase 2            270   1e-80    Camelina sativa [gold-of-pleasure]
gb|AFU54452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           270   1e-80    Prunus salicina [Japanese plum]
ref|XP_006488872.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    271   2e-80    
ref|XP_009779847.1|  PREDICTED: probable beta-D-xylosidase 5            270   2e-80    Nicotiana sylvestris
gb|KHN19223.1|  Putative beta-D-xylosidase 2                            268   2e-80    Glycine soja [wild soybean]
ref|XP_008386729.1|  PREDICTED: probable beta-D-xylosidase 2            270   2e-80    
ref|XP_004487789.1|  PREDICTED: beta-D-xylosidase 1-like                270   2e-80    Cicer arietinum [garbanzo]
ref|XP_003519750.1|  PREDICTED: probable beta-D-xylosidase 2-like       269   3e-80    Glycine max [soybeans]
gb|KFK42620.1|  hypothetical protein AALP_AA1G019000                    269   3e-80    Arabis alpina [alpine rockcress]
ref|XP_002889410.1|  hypothetical protein ARALYDRAFT_470222             269   3e-80    
ref|XP_002316021.1|  beta-D-xylosidase family protein                   269   3e-80    Populus trichocarpa [western balsam poplar]
ref|XP_009111875.1|  PREDICTED: beta-D-xylosidase 1-like                269   3e-80    Brassica rapa
ref|XP_009804071.1|  PREDICTED: beta-D-xylosidase 1 isoform X2          267   3e-80    Nicotiana sylvestris
ref|XP_003594795.1|  Beta xylosidase                                    269   3e-80    Medicago truncatula
ref|XP_009129779.1|  PREDICTED: beta-D-xylosidase 1-like                269   3e-80    Brassica rapa
emb|CDY00033.1|  BnaC09g02680D                                          269   3e-80    
ref|XP_010546993.1|  PREDICTED: beta-D-xylosidase 1-like isoform X1     269   3e-80    Tarenaya hassleriana [spider flower]
ref|XP_009603126.1|  PREDICTED: probable beta-D-xylosidase 5            269   4e-80    
ref|XP_010679361.1|  PREDICTED: probable beta-D-xylosidase 2            268   4e-80    Beta vulgaris subsp. vulgaris [field beet]
emb|CDY58860.1|  BnaCnng33860D                                          269   4e-80    Brassica napus [oilseed rape]
gb|KHG05051.1|  putative beta-D-xylosidase 2 -like protein              269   4e-80    Gossypium arboreum [tree cotton]
ref|XP_008808663.1|  PREDICTED: beta-D-xylosidase 1-like                268   5e-80    Phoenix dactylifera
ref|XP_004151112.1|  PREDICTED: beta-D-xylosidase 1-like                268   5e-80    Cucumis sativus [cucumbers]
ref|XP_009145766.1|  PREDICTED: probable beta-D-xylosidase 5            268   5e-80    Brassica rapa
ref|XP_007042636.1|  Glycosyl hydrolase family protein                  270   6e-80    
gb|KJB09457.1|  hypothetical protein B456_001G143600                    268   6e-80    Gossypium raimondii
ref|NP_563659.1|  probable beta-D-xylosidase 2                          268   7e-80    Arabidopsis thaliana [mouse-ear cress]
gb|AAG10624.1|AC022521_2  Similar to xylosidase                         268   7e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009383731.1|  PREDICTED: probable beta-D-xylosidase 2            268   7e-80    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006395069.1|  hypothetical protein EUTSA_v10003681mg             268   7e-80    Eutrema salsugineum [saltwater cress]
ref|XP_002311398.2|  beta-D-xylosidase family protein                   268   7e-80    
gb|KHN08645.1|  Putative beta-D-xylosidase 2                            267   8e-80    Glycine soja [wild soybean]
dbj|BAG28345.1|  arabinofuranosidase                                    268   8e-80    Citrus unshiu [satsuma mandarin]
ref|XP_006280043.1|  hypothetical protein CARUB_v10025920mg             268   8e-80    Capsella rubella
ref|XP_009151303.1|  PREDICTED: beta-D-xylosidase 1                     268   9e-80    Brassica rapa
emb|CDX85405.1|  BnaC07g27160D                                          268   9e-80    
ref|XP_006298950.1|  hypothetical protein CARUB_v10015075mg             268   9e-80    
ref|XP_008390557.1|  PREDICTED: putative beta-D-xylosidase              268   9e-80    
ref|XP_010440503.1|  PREDICTED: beta-D-xylosidase 1                     268   9e-80    Camelina sativa [gold-of-pleasure]
ref|XP_006830079.1|  PREDICTED: probable beta-D-xylosidase 5            268   1e-79    
ref|XP_008341125.1|  PREDICTED: putative beta-D-xylosidase              268   1e-79    
ref|XP_003520749.2|  PREDICTED: probable beta-D-xylosidase 2-like       268   1e-79    Glycine max [soybeans]
ref|XP_010482214.1|  PREDICTED: beta-D-xylosidase 1-like                268   1e-79    Camelina sativa [gold-of-pleasure]
ref|XP_007145157.1|  hypothetical protein PHAVU_007G215100g             267   1e-79    Phaseolus vulgaris [French bean]
ref|XP_003546334.1|  PREDICTED: beta-D-xylosidase 1-like                268   1e-79    Glycine max [soybeans]
ref|XP_009378701.1|  PREDICTED: probable beta-D-xylosidase 2            268   1e-79    Pyrus x bretschneideri [bai li]
ref|XP_009369955.1|  PREDICTED: putative beta-D-xylosidase              267   1e-79    
ref|XP_011079568.1|  PREDICTED: probable beta-D-xylosidase 2            267   2e-79    Sesamum indicum [beniseed]
ref|XP_006418321.1|  hypothetical protein EUTSA_v10006876mg             267   2e-79    Eutrema salsugineum [saltwater cress]
ref|XP_010687347.1|  PREDICTED: probable beta-D-xylosidase 5            267   2e-79    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010087253.1|  putative beta-D-xylosidase 2                       267   2e-79    Morus notabilis
gb|AFU54451.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase           267   2e-79    Prunus salicina [Japanese plum]
ref|XP_003533205.2|  PREDICTED: beta-D-xylosidase 1-like                268   2e-79    
ref|XP_011020382.1|  PREDICTED: putative beta-D-xylosidase              267   2e-79    Populus euphratica
ref|XP_009804070.1|  PREDICTED: beta-D-xylosidase 1 isoform X1          266   2e-79    Nicotiana sylvestris
ref|XP_011009934.1|  PREDICTED: putative beta-D-xylosidase              266   2e-79    Populus euphratica
ref|XP_003591420.1|  Beta xylosidase                                    266   3e-79    Medicago truncatula
dbj|BAQ19511.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase          266   3e-79    Persea americana
ref|XP_004494414.1|  PREDICTED: probable beta-D-xylosidase 2-like       266   3e-79    Cicer arietinum [garbanzo]
ref|XP_007138975.1|  hypothetical protein PHAVU_009G254300g             266   3e-79    Phaseolus vulgaris [French bean]
ref|XP_007163167.1|  hypothetical protein PHAVU_001G212100g             266   3e-79    Phaseolus vulgaris [French bean]
ref|XP_009757165.1|  PREDICTED: probable beta-D-xylosidase 2            266   3e-79    Nicotiana sylvestris
emb|CDY49607.1|  BnaA09g03310D                                          266   3e-79    Brassica napus [oilseed rape]
ref|XP_010671663.1|  PREDICTED: beta-D-xylosidase 1                     266   4e-79    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010507856.1|  PREDICTED: probable beta-D-xylosidase 5            266   4e-79    Camelina sativa [gold-of-pleasure]
ref|XP_010268028.1|  PREDICTED: probable beta-D-xylosidase 2            266   4e-79    Nelumbo nucifera [Indian lotus]
ref|XP_009348894.1|  PREDICTED: putative beta-D-xylosidase              266   4e-79    
ref|XP_010914548.1|  PREDICTED: probable beta-D-xylosidase 2            266   5e-79    Elaeis guineensis
ref|XP_007051080.1|  Beta-xylosidase 2                                  266   6e-79    
ref|XP_004300463.1|  PREDICTED: probable beta-D-xylosidase 2            266   6e-79    Fragaria vesca subsp. vesca
ref|NP_199747.1|  bifunctional {beta}-D-xylosidase/{alpha}-L-arab...    265   7e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002264114.2|  PREDICTED: probable beta-D-xylosidase 5            266   8e-79    Vitis vinifera
ref|XP_010111676.1|  putative beta-D-xylosidase 5                       266   9e-79    
gb|KHN12900.1|  Beta-D-xylosidase 1                                     265   1e-78    Glycine soja [wild soybean]
gb|AAP83934.1|  auxin-induced beta-glucosidase                          265   1e-78    Oxybasis rubra [pigweed]
dbj|BAO45878.1|  beta-D-xylosidase                                      265   1e-78    Acacia mangium
ref|XP_002270249.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    265   1e-78    Vitis vinifera
ref|XP_002865732.1|  beta-xylosidase 1                                  265   1e-78    Arabidopsis lyrata subsp. lyrata
gb|EYU23074.1|  hypothetical protein MIMGU_mgv1a019840mg                264   2e-78    Erythranthe guttata [common monkey flower]
ref|XP_008235191.1|  PREDICTED: probable beta-D-xylosidase 2            264   2e-78    Prunus mume [ume]
emb|CBI22460.3|  unnamed protein product                                266   3e-78    Vitis vinifera
ref|XP_008445351.1|  PREDICTED: probable beta-D-xylosidase 7            264   3e-78    Cucumis melo [Oriental melon]
ref|XP_003554544.1|  PREDICTED: probable beta-D-xylosidase 2-like       263   3e-78    Glycine max [soybeans]
emb|CAN82161.1|  hypothetical protein VITISV_035506                     266   4e-78    Vitis vinifera
ref|XP_006444470.1|  hypothetical protein CICLE_v10018959mg             263   4e-78    Citrus clementina [clementine]
ref|NP_001280797.1|  putative beta-D-xylosidase precursor               263   4e-78    Malus domestica [apple tree]
ref|XP_007200621.1|  hypothetical protein PRUPE_ppa001656mg             263   5e-78    Prunus persica
ref|XP_008353169.1|  PREDICTED: putative beta-D-xylosidase              263   5e-78    
ref|XP_008454298.1|  PREDICTED: probable beta-D-xylosidase 2 isof...    263   5e-78    Cucumis melo [Oriental melon]
dbj|BAF79669.1|  beta-D-xylosidase                                      263   6e-78    Pyrus pyrifolia [sha li]
ref|NP_001266104.1|  SlArf/Xyl1 protein precursor                       263   6e-78    
gb|AGR44452.1|  alpha-L-arabinofuranosidase/beta-D-xylosidase 2         263   6e-78    
dbj|BAD98523.1|  alpha-L-arabinofuranosidase / beta-D-xylosidase        263   6e-78    
ref|XP_007200259.1|  hypothetical protein PRUPE_ppa015037mg             263   7e-78    
ref|XP_008458374.1|  PREDICTED: LOW QUALITY PROTEIN: beta-D-xylos...    263   8e-78    
ref|XP_008236322.1|  PREDICTED: probable beta-D-xylosidase 5            265   8e-78    
ref|NP_001266107.1|  SlArf/Xyl2 protein precursor                       262   1e-77    
gb|KDO49896.1|  hypothetical protein CISIN_1g003980mg                   262   1e-77    
ref|XP_009593976.1|  PREDICTED: probable beta-D-xylosidase 2            262   1e-77    
ref|XP_006487370.1|  PREDICTED: probable beta-D-xylosidase 5-like       262   1e-77    
ref|XP_010522822.1|  PREDICTED: probable beta-D-xylosidase 2            261   2e-77    
ref|XP_004136155.1|  PREDICTED: probable beta-D-xylosidase 2            261   2e-77    
ref|NP_001145980.1|  putative O-Glycosyl hydrolase superfamily pr...    261   2e-77    
ref|XP_006423474.1|  hypothetical protein CICLE_v10027856mg             261   2e-77    
gb|KCW61272.1|  hypothetical protein EUGRSUZ_H04033                     261   3e-77    
ref|XP_004152230.1|  PREDICTED: probable beta-D-xylosidase 2            261   4e-77    
ref|XP_008451490.1|  PREDICTED: probable beta-D-xylosidase 2            261   4e-77    
gb|KJB49844.1|  hypothetical protein B456_008G140600                    260   5e-77    
ref|XP_010024778.1|  PREDICTED: putative beta-D-xylosidase              260   7e-77    
ref|XP_010069867.1|  PREDICTED: probable beta-D-xylosidase 2            260   9e-77    
ref|XP_011012436.1|  PREDICTED: probable beta-D-xylosidase 5            260   1e-76    
ref|XP_006605998.1|  PREDICTED: probable beta-D-xylosidase 5-like       260   1e-76    
ref|XP_011030348.1|  PREDICTED: probable beta-D-xylosidase 5            260   1e-76    
ref|XP_006349198.1|  PREDICTED: probable beta-D-xylosidase 2-like       259   1e-76    
ref|XP_004150696.1|  PREDICTED: probable beta-D-xylosidase 7            259   2e-76    
ref|XP_006352077.1|  PREDICTED: beta-D-xylosidase 1-like                258   2e-76    
ref|XP_002451244.1|  hypothetical protein SORBIDRAFT_05g026400          258   7e-76    
ref|XP_003567059.2|  PREDICTED: beta-D-xylosidase 1-like                257   7e-76    
ref|XP_008234021.1|  PREDICTED: probable beta-D-xylosidase 7            256   2e-75    
ref|XP_002980054.1|  hypothetical protein SELMODRAFT_419541             256   2e-75    
ref|XP_002987447.1|  hypothetical protein SELMODRAFT_426207             256   2e-75    
ref|XP_006826952.1|  PREDICTED: probable beta-D-xylosidase 7            256   3e-75    
ref|XP_010556264.1|  PREDICTED: beta-D-xylosidase 1-like                255   3e-75    
gb|KCW68842.1|  hypothetical protein EUGRSUZ_F02442                     254   4e-75    
dbj|BAK01582.1|  predicted protein                                      254   5e-75    
ref|XP_006301942.1|  hypothetical protein CARUB_v10022420mg             255   5e-75    
gb|KDO80914.1|  hypothetical protein CISIN_1g004054mg                   251   8e-75    
ref|XP_006858943.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    255   8e-75    
gb|KFK25328.1|  hypothetical protein AALP_AA8G098500                    254   9e-75    
ref|XP_008362602.1|  PREDICTED: probable beta-D-xylosidase 7            246   9e-75    
ref|XP_010064766.1|  PREDICTED: probable beta-D-xylosidase 7            254   1e-74    
ref|XP_007225247.1|  hypothetical protein PRUPE_ppa001675mg             254   1e-74    
gb|ERN20410.1|  hypothetical protein AMTR_s00068p00088730               255   1e-74    
ref|XP_004979939.1|  PREDICTED: probable beta-D-xylosidase 2-like       254   1e-74    
gb|KCW68841.1|  hypothetical protein EUGRSUZ_F02441                     251   1e-74    
ref|NP_001266114.1|  SlArf/Xyl4 protein precursor                       254   1e-74    
gb|KJB16241.1|  hypothetical protein B456_002G219100                    253   2e-74    
ref|XP_003615008.1|  Xylan 1 4-beta-xylosidase                          254   2e-74    
ref|XP_006354009.1|  PREDICTED: probable beta-D-xylosidase 7-like       253   3e-74    
ref|XP_002285805.1|  PREDICTED: probable beta-D-xylosidase 7            253   3e-74    
emb|CAJ41429.1|  beta (1,4)-xylosidase                                  252   3e-74    
ref|XP_002276351.1|  PREDICTED: putative beta-D-xylosidase              253   3e-74    
emb|CBI22910.3|  unnamed protein product                                252   4e-74    
gb|AES97966.2|  glycoside hydrolase family 3 protein                    253   4e-74    
emb|CDO98788.1|  unnamed protein product                                252   5e-74    
ref|XP_006448620.1|  hypothetical protein CICLE_v10018262mg             253   6e-74    
ref|XP_008808189.1|  PREDICTED: probable beta-D-xylosidase 7            252   7e-74    
ref|XP_011457868.1|  PREDICTED: probable beta-D-xylosidase 5            252   1e-73    
ref|XP_010030625.1|  PREDICTED: probable beta-D-xylosidase 5            252   1e-73    
ref|XP_006390030.1|  hypothetical protein EUTSA_v10018160mg             251   1e-73    
gb|KFK42187.1|  hypothetical protein AALP_AA2G222800                    251   1e-73    
gb|KJB59941.1|  hypothetical protein B456_009G282000                    247   2e-73    
gb|KDO80913.1|  hypothetical protein CISIN_1g004054mg                   251   2e-73    
ref|XP_004513829.1|  PREDICTED: probable beta-D-xylosidase 7-like       251   2e-73    
ref|XP_010061816.1|  PREDICTED: probable beta-D-xylosidase 7            251   2e-73    
ref|XP_006434020.1|  hypothetical protein CICLE_v10000352mg             251   2e-73    
ref|XP_006472631.1|  PREDICTED: probable beta-D-xylosidase 7-like       251   2e-73    
ref|XP_002513887.1|  hypothetical protein RCOM_1034150                  236   3e-73    
ref|XP_003615003.1|  Xylan 1 4-beta-xylosidase                          250   4e-73    
gb|KEH28065.1|  glycoside hydrolase family 3 amino-terminal domai...    246   4e-73    
gb|KJB29303.1|  hypothetical protein B456_005G093200                    250   5e-73    
ref|XP_009404942.1|  PREDICTED: probable beta-D-xylosidase 6            251   5e-73    
gb|KJB29304.1|  hypothetical protein B456_005G093200                    250   6e-73    
ref|NP_177929.1|  putative beta-D-xylosidase 7                          249   6e-73    
gb|EYU46800.1|  hypothetical protein MIMGU_mgv1a018473mg                249   6e-73    
ref|XP_002306583.2|  hypothetical protein POPTR_0005s16660g             249   7e-73    
ref|XP_002302285.1|  glycosyl hydrolase family 3 family protein         249   8e-73    
ref|XP_007136230.1|  hypothetical protein PHAVU_009G029300g             249   8e-73    
ref|XP_011011483.1|  PREDICTED: probable beta-D-xylosidase 7            249   9e-73    
ref|XP_006468650.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    249   9e-73    
ref|XP_006287090.1|  hypothetical protein CARUB_v10000252mg             249   9e-73    
ref|XP_011074159.1|  PREDICTED: probable beta-D-xylosidase 7            249   1e-72    
ref|XP_011016184.1|  PREDICTED: probable beta-D-xylosidase 7            249   1e-72    
ref|XP_002513892.1|  Periplasmic beta-glucosidase precursor, puta...    248   1e-72    
emb|CBI19138.3|  unnamed protein product                                253   1e-72    
ref|XP_006448621.1|  hypothetical protein CICLE_v10014325mg             248   2e-72    
ref|XP_006300771.1|  hypothetical protein CARUB_v10019845mg             248   2e-72    
ref|XP_011098370.1|  PREDICTED: probable beta-D-xylosidase 7            248   2e-72    
ref|XP_010269208.1|  PREDICTED: probable beta-D-xylosidase 7            248   3e-72    
ref|XP_009592501.1|  PREDICTED: probable beta-D-xylosidase 7            248   3e-72    
emb|CAN72807.1|  hypothetical protein VITISV_033721                     233   3e-72    
gb|KJB59940.1|  hypothetical protein B456_009G282000                    247   4e-72    
ref|XP_004301317.1|  PREDICTED: probable beta-D-xylosidase 7            247   4e-72    
gb|EYU33325.1|  hypothetical protein MIMGU_mgv1a001753mg                247   4e-72    
gb|KHG13360.1|  putative beta-D-xylosidase 7 -like protein              247   4e-72    
ref|XP_009782574.1|  PREDICTED: probable beta-D-xylosidase 7            247   4e-72    
gb|EPS60429.1|  hypothetical protein M569_14372                         247   4e-72    
ref|XP_008236665.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    247   5e-72    
ref|XP_010472005.1|  PREDICTED: probable beta-D-xylosidase 7            247   5e-72    
gb|KJB59094.1|  hypothetical protein B456_009G239100                    248   5e-72    
ref|XP_008385726.1|  PREDICTED: probable beta-D-xylosidase 6            247   6e-72    
ref|XP_008375790.1|  PREDICTED: probable beta-D-xylosidase 7            247   6e-72    
ref|XP_010416771.1|  PREDICTED: probable beta-D-xylosidase 7            246   6e-72    
ref|XP_010676938.1|  PREDICTED: probable beta-D-xylosidase 7            246   8e-72    
gb|EYU33328.1|  hypothetical protein MIMGU_mgv1a001688mg                246   8e-72    
ref|XP_010428909.1|  PREDICTED: probable beta-D-xylosidase 7 isof...    246   9e-72    
gb|KJB29307.1|  hypothetical protein B456_005G093300                    246   9e-72    
ref|XP_009106451.1|  PREDICTED: probable beta-D-xylosidase 7            246   9e-72    
ref|XP_009369659.1|  PREDICTED: probable beta-D-xylosidase 7            246   9e-72    
gb|AES97964.2|  glycoside hydrolase family 3 amino-terminal domai...    246   1e-71    
ref|XP_010937520.1|  PREDICTED: uncharacterized protein LOC105056876    251   1e-71    
emb|CDX87482.1|  BnaA07g33910D                                          246   1e-71    
gb|EYU23228.1|  hypothetical protein MIMGU_mgv1a018779mg                243   1e-71    
ref|XP_008236660.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    246   2e-71    
ref|XP_002873465.1|  glycosyl hydrolase family 3 protein                246   2e-71    
emb|CDX88410.1|  BnaC06g38540D                                          245   2e-71    
ref|XP_002889174.1|  glycosyl hydrolase family 3 protein                245   2e-71    
ref|XP_006449653.1|  hypothetical protein CICLE_v10017977mg             244   3e-71    
gb|KHG02565.1|  putative beta-D-xylosidase 7                            246   3e-71    
ref|XP_003638778.1|  Xylan 1 4-beta-xylosidase                          245   3e-71    
ref|XP_008796726.1|  PREDICTED: probable beta-D-xylosidase 6            245   3e-71    
ref|XP_006581546.1|  PREDICTED: probable beta-D-xylosidase 7-like...    241   4e-71    
ref|XP_001775759.1|  predicted protein                                  245   4e-71    
emb|CBI25718.3|  unnamed protein product                                244   4e-71    
ref|XP_006399554.1|  hypothetical protein EUTSA_v10012725mg             245   4e-71    
gb|ERN01969.1|  hypothetical protein AMTR_s00045p00064060               244   4e-71    
ref|XP_006840294.2|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    244   4e-71    
ref|XP_006468195.1|  PREDICTED: probable beta-D-xylosidase 5-like       245   5e-71    
ref|NP_196618.1|  putative beta-D-xylosidase 6                          244   5e-71    
ref|XP_010453089.1|  PREDICTED: probable beta-D-xylosidase 6            244   6e-71    
ref|XP_007018825.1|  Glycosyl hydrolase family protein isoform 3        249   7e-71    
ref|XP_007018823.1|  Glycosyl hydrolase family protein isoform 1        249   7e-71    
ref|XP_007018824.1|  Glycosyl hydrolase family protein isoform 2        249   7e-71    
ref|XP_011016128.1|  PREDICTED: probable beta-D-xylosidase 7            244   8e-71    
ref|XP_002302284.2|  glycosyl hydrolase family 3 family protein         243   8e-71    
ref|XP_012092755.1|  PREDICTED: probable beta-D-xylosidase 7            244   8e-71    
gb|KJB16242.1|  hypothetical protein B456_002G219200                    244   9e-71    
gb|KDP42384.1|  hypothetical protein JCGZ_02441                         233   1e-70    
gb|KJB16243.1|  hypothetical protein B456_002G219200                    243   2e-70    
ref|XP_006369869.1|  hypothetical protein POPTR_0001s34340g             235   2e-70    
gb|EYU23224.1|  hypothetical protein MIMGU_mgv1a001695mg                243   2e-70    
ref|XP_003544783.1|  PREDICTED: probable beta-D-xylosidase 7-like       243   2e-70    
emb|CDO97277.1|  unnamed protein product                                243   2e-70    
gb|EYU23223.1|  hypothetical protein MIMGU_mgv1a001417mg                243   2e-70    
ref|XP_009400278.1|  PREDICTED: probable beta-D-xylosidase 6            243   2e-70    
ref|XP_008364222.1|  PREDICTED: probable beta-D-xylosidase 5            233   3e-70    
ref|XP_009390583.1|  PREDICTED: probable beta-D-xylosidase 7            242   3e-70    
emb|CDP01027.1|  unnamed protein product                                247   3e-70    
ref|XP_012072480.1|  PREDICTED: probable beta-D-xylosidase 5            243   3e-70    
gb|EYU23226.1|  hypothetical protein MIMGU_mgv1a025071mg                241   3e-70    
ref|XP_009391116.1|  PREDICTED: probable beta-D-xylosidase 7            242   3e-70    
ref|XP_003612944.1|  Beta-D-xylosidase                                  242   4e-70    
gb|KJB44020.1|  hypothetical protein B456_007G230000                    242   4e-70    
ref|XP_010918501.1|  PREDICTED: LOW QUALITY PROTEIN: probable bet...    242   4e-70    
ref|XP_012092754.1|  PREDICTED: probable beta-D-xylosidase 7            242   5e-70    
gb|KDP37939.1|  hypothetical protein JCGZ_04582                         243   5e-70    
ref|XP_003526589.1|  PREDICTED: probable beta-D-xylosidase 7-like...    241   5e-70    
ref|XP_010664313.1|  PREDICTED: probable beta-D-xylosidase 7            241   5e-70    
ref|XP_011082425.1|  PREDICTED: probable beta-D-xylosidase 2            242   6e-70    
gb|ABY48135.1|  beta-D-xylosidase                                       241   6e-70    
ref|XP_010491733.1|  PREDICTED: probable beta-D-xylosidase 6            242   6e-70    
gb|AAF17692.1|AC009243_19  F28K19.27                                    240   6e-70    
ref|XP_009612183.1|  PREDICTED: probable beta-D-xylosidase 6            241   7e-70    
ref|XP_004953945.1|  PREDICTED: probable beta-D-xylosidase 7-like       241   7e-70    
gb|KGN49379.1|  hypothetical protein Csa_6G522730                       238   7e-70    
ref|XP_012066816.1|  PREDICTED: probable beta-D-xylosidase 5            234   1e-69    
ref|XP_003615019.1|  hypothetical protein MTR_5g062650                  241   1e-69    
ref|XP_011657934.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    241   1e-69    
ref|XP_003542472.1|  PREDICTED: probable beta-D-xylosidase 7-like       241   1e-69    
ref|XP_012066812.1|  PREDICTED: probable beta-D-xylosidase 5            234   1e-69    
ref|XP_006354008.1|  PREDICTED: probable beta-D-xylosidase 7-like       240   1e-69    
ref|XP_010250379.1|  PREDICTED: probable beta-D-xylosidase 5            241   2e-69    
ref|XP_012065820.1|  PREDICTED: probable beta-D-xylosidase 5            234   2e-69    
ref|XP_011460171.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    240   2e-69    
ref|XP_007206430.1|  hypothetical protein PRUPE_ppa001583mg             240   2e-69    
ref|XP_006354074.1|  PREDICTED: probable beta-D-xylosidase 7-like       239   3e-69    
ref|XP_008808183.1|  PREDICTED: probable beta-D-xylosidase 7            239   3e-69    
gb|KDP43295.1|  hypothetical protein JCGZ_24216                         234   3e-69    
ref|XP_008383565.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    240   3e-69    
ref|XP_010254644.1|  PREDICTED: probable beta-D-xylosidase 6            239   3e-69    
gb|EEC74020.1|  hypothetical protein OsI_08964                          239   4e-69    
ref|XP_009360864.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    239   4e-69    
ref|NP_001266109.1|  SlArf/Xyl3 protein precursor                       239   4e-69    
ref|NP_001048140.1|  Os02g0752200                                       239   4e-69    
ref|XP_011466576.1|  PREDICTED: probable beta-D-xylosidase 6 isof...    237   5e-69    
emb|CDP01028.1|  unnamed protein product                                239   5e-69    
ref|XP_009122041.1|  PREDICTED: probable beta-D-xylosidase 6            239   6e-69    
gb|KDO78121.1|  hypothetical protein CISIN_1g047862mg                   238   8e-69    
ref|XP_008439653.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    239   8e-69    
ref|NP_001130324.1|  putative O-Glycosyl hydrolase superfamily pr...    238   8e-69    
ref|XP_006449654.1|  hypothetical protein CICLE_v10018058mg             238   8e-69    
gb|EAY80660.1|  hypothetical protein OsI_35838                          238   8e-69    
ref|XP_008440505.1|  PREDICTED: probable beta-D-xylosidase 6            238   9e-69    
ref|XP_010676949.1|  PREDICTED: probable beta-D-xylosidase 7            238   1e-68    
ref|XP_002309869.2|  hypothetical protein POPTR_0007s03380g             238   1e-68    
ref|XP_009391118.1|  PREDICTED: probable beta-D-xylosidase 7            238   1e-68    
gb|AAK38482.1|  beta-D-xylosidase                                       238   1e-68    
ref|XP_007214466.1|  hypothetical protein PRUPE_ppa023763mg             237   1e-68    
ref|XP_002977427.1|  hypothetical protein SELMODRAFT_106899             238   1e-68    
ref|XP_010046160.1|  PREDICTED: probable beta-D-xylosidase 5            238   1e-68    
gb|KCW75948.1|  hypothetical protein EUGRSUZ_D00316                     237   1e-68    
ref|XP_002264031.2|  PREDICTED: probable beta-D-xylosidase 6            238   1e-68    
ref|XP_011023042.1|  PREDICTED: beta-xylosidase/alpha-L-arabinofu...    238   2e-68    
ref|XP_006468193.1|  PREDICTED: probable beta-D-xylosidase 5-like       238   2e-68    
ref|XP_003576084.1|  PREDICTED: probable beta-D-xylosidase 7 isof...    238   2e-68    
ref|XP_006449655.1|  hypothetical protein CICLE_v10014315mg             238   2e-68    
ref|XP_011099456.1|  PREDICTED: probable beta-D-xylosidase 6            238   2e-68    
ref|XP_007018826.1|  Glycosyl hydrolase family protein                  238   2e-68    
ref|XP_004500608.1|  PREDICTED: probable beta-D-xylosidase 7-like       239   2e-68    
ref|XP_006468194.1|  PREDICTED: probable beta-D-xylosidase 5-like       238   2e-68    
gb|EYU23220.1|  hypothetical protein MIMGU_mgv1a001636mg                237   3e-68    
gb|EYU39877.1|  hypothetical protein MIMGU_mgv1a018879mg                236   3e-68    
ref|XP_010558471.1|  PREDICTED: probable beta-D-xylosidase 2            237   3e-68    
gb|AFW65093.1|  putative O-Glycosyl hydrolase superfamily protein       226   3e-68    
ref|XP_004288313.2|  PREDICTED: probable beta-D-xylosidase 6 isof...    237   4e-68    
gb|EYU23824.1|  hypothetical protein MIMGU_mgv1a020334mg                236   4e-68    
gb|AFW65097.1|  putative O-Glycosyl hydrolase superfamily protein       228   4e-68    
emb|CDP06334.1|  unnamed protein product                                236   4e-68    
gb|KDO78122.1|  hypothetical protein CISIN_1g040836mg                   236   4e-68    
ref|XP_006647908.1|  PREDICTED: probable beta-D-xylosidase 7-like       236   5e-68    
ref|XP_009782575.1|  PREDICTED: probable beta-D-xylosidase 7            236   5e-68    
ref|XP_007140931.1|  hypothetical protein PHAVU_008G153300g             236   5e-68    



>ref|XP_009612011.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=778

 Score =   362 bits (930),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 163/211 (77%), Positives = 184/211 (87%), Gaps = 0/211 (0%)
 Frame = +2

Query  140  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  319
            PV +QT+PV+ACD   NPG+K+  FC+  LDV +RV DLVKRLTL EKIT LVNTAG+VS
Sbjct  31   PVLAQTSPVFACDVANNPGVKNFAFCDVSLDVSSRVNDLVKRLTLEEKITMLVNTAGSVS  90

Query  320  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            RLGIPTYEWWSEALHG+SYTGPGV F GVVP ATSFPQP+LT+ASFNETLF TIGK +ST
Sbjct  91   RLGIPTYEWWSEALHGISYTGPGVKFNGVVPGATSFPQPILTSASFNETLFETIGKAVST  150

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGN  679
            EARAM+N GLAGLTYWSPN+NI+RDPRWGRGQE PGEDPTL  KY   +V+GLQ+RDDG 
Sbjct  151  EARAMYNVGLAGLTYWSPNVNIYRDPRWGRGQETPGEDPTLASKYGVGYVKGLQQRDDGK  210

Query  680  KEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
            K+ LKVA+CCKHYTAYDVDDWKG QRYNFN+
Sbjct  211  KDMLKVASCCKHYTAYDVDDWKGIQRYNFNA  241



>dbj|BAQ02862.1| alpha-L-Arabinofuranosidase/beta-D-Xylopyrianosidase, partial 
[Nicotiana tabacum]
Length=368

 Score =   347 bits (890),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/212 (75%), Positives = 180/212 (85%), Gaps = 1/212 (0%)
 Frame = +2

Query  140  PVQSQT-APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  316
            PV +QT +P +ACD   NPG+K+  FC+  LDV  RV DLVKRLTL EKIT LVNTAG+V
Sbjct  31   PVLAQTTSPAFACDVANNPGVKNFGFCDVSLDVSARVNDLVKRLTLEEKITMLVNTAGSV  90

Query  317  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  496
            SRLGIP YEWWSEALHG+SYTGPGV F GVVP ATSFP  +LT+ASFNETLF TIGK +S
Sbjct  91   SRLGIPKYEWWSEALHGISYTGPGVKFNGVVPGATSFPPTILTSASFNETLFETIGKAVS  150

Query  497  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDG  676
            TEARAM+N GLAGLTYWSPN+NI+RDPRWGRGQE PGEDPTL  KY  A+V+GLQ+RDDG
Sbjct  151  TEARAMYNVGLAGLTYWSPNVNIYRDPRWGRGQETPGEDPTLASKYGVAYVKGLQQRDDG  210

Query  677  NKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
             K+ LKVA+CCKHYTAYDVDDWKG QRYNFN+
Sbjct  211  KKDMLKVASCCKHYTAYDVDDWKGIQRYNFNA  242



>ref|XP_009628814.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 {ECO:0000303|PubMed:17615411, 
ECO:0000312|EMBL:ABQ45228.1}-like 
[Nicotiana tomentosiformis]
Length=781

 Score =   358 bits (918),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = +2

Query  140  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  319
            PV +Q +PV+ACD   NPGL +L FC+  L V+TRV DLV+RLTL EKI FLV+ AG VS
Sbjct  37   PVLAQNSPVFACDITSNPGLANLTFCDASLTVETRVNDLVQRLTLSEKIGFLVSGAGGVS  96

Query  320  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            RLGIP YEWWSEALHG+SYTGPGV+F+G++PAATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  97   RLGIPRYEWWSEALHGVSYTGPGVHFSGLIPAATSFPQVILTAASFNVTLFETIGKVVST  156

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGN  679
            EARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDPTLT KY AA+VRGLQ+ DDG+
Sbjct  157  EARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPTLTSKYGAAYVRGLQQTDDGS  216

Query  680  KEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            K+KLKVAACCKHYTAYDVD+WKG QRYNFN+V
Sbjct  217  KDKLKVAACCKHYTAYDVDNWKGIQRYNFNAV  248



>ref|XP_009801214.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=784

 Score =   358 bits (918),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 164/212 (77%), Positives = 187/212 (88%), Gaps = 0/212 (0%)
 Frame = +2

Query  140  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  319
            PV +Q +PV+ACD   NPGL +L FC+  L V+TRV+DLV+RLTL EKI FLV+ AG VS
Sbjct  40   PVLAQNSPVFACDITSNPGLANLTFCDASLTVETRVSDLVQRLTLSEKIGFLVSGAGGVS  99

Query  320  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            RLGIP YEWWSEALHG+SYTGPGV+F+G+VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  100  RLGIPRYEWWSEALHGVSYTGPGVHFSGLVPGATSFPQVILTAASFNVTLFETIGKVVST  159

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGN  679
            EARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDPTLT KY AA+VRGLQ+ DDG+
Sbjct  160  EARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPTLTSKYGAAYVRGLQQTDDGS  219

Query  680  KEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            K+KLKVAACCKHYTAYDVD+WKG QRYNFN+V
Sbjct  220  KDKLKVAACCKHYTAYDVDNWKGIQRYNFNAV  251



>ref|XP_006351808.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=778

 Score =   354 bits (909),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/211 (76%), Positives = 180/211 (85%), Gaps = 0/211 (0%)
 Frame = +2

Query  140  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  319
            PV +QT+ V+ACDT  NP LKS PFC+  L V  RV DLVKRLTL EKIT LVNTAGNVS
Sbjct  34   PVSAQTSAVFACDTATNPSLKSFPFCDVSLGVSARVKDLVKRLTLQEKITMLVNTAGNVS  93

Query  320  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            RLGIP YEWWSEALHG+SYTGPGV F  +VP ATSFPQP+LT+ASFNETLF TIGKV+ST
Sbjct  94   RLGIPKYEWWSEALHGISYTGPGVKFNNIVPHATSFPQPILTSASFNETLFETIGKVVST  153

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGN  679
            E RAM+N G AGLTYWSPN+NI+RDPRWGRGQE  GEDPTL+ KY  A+V+GLQ+RDDG 
Sbjct  154  EGRAMYNVGQAGLTYWSPNVNIYRDPRWGRGQETAGEDPTLSSKYGVAYVKGLQQRDDGK  213

Query  680  KEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
            K+ LKVA+CCKHYTAYD+DDWKG QRYNFN+
Sbjct  214  KDMLKVASCCKHYTAYDIDDWKGIQRYNFNA  244



>ref|XP_009762535.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nicotiana sylvestris]
Length=779

 Score =   354 bits (909),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 162/212 (76%), Positives = 182/212 (86%), Gaps = 1/212 (0%)
 Frame = +2

Query  140  PVQSQT-APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  316
            PV +QT +P +ACD   NPG+K+  FC+  LDV  RV DLVKRLTL EKIT LVNTAG+V
Sbjct  31   PVLAQTTSPAFACDVANNPGVKNFGFCDVSLDVSARVNDLVKRLTLEEKITMLVNTAGSV  90

Query  317  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  496
            SRLGIP YEWWSEALHG+SYTGPGV F GVVP ATSFPQP+LT+ASFNETLF TIGK +S
Sbjct  91   SRLGIPKYEWWSEALHGISYTGPGVKFNGVVPGATSFPQPILTSASFNETLFETIGKAVS  150

Query  497  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDG  676
            TEARAM+N GLAGLTYWSPN+NI+RDPRWGRGQE PGEDPTL  KY  A+V+GLQ+RDDG
Sbjct  151  TEARAMYNVGLAGLTYWSPNVNIYRDPRWGRGQETPGEDPTLASKYGVAYVKGLQQRDDG  210

Query  677  NKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
             K+ LKVA+CCKHYTAYDVDDWKG QRYNFN+
Sbjct  211  KKDMLKVASCCKHYTAYDVDDWKGIQRYNFNA  242



>ref|XP_004230547.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Solanum 
lycopersicum]
Length=778

 Score =   350 bits (899),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/211 (75%), Positives = 180/211 (85%), Gaps = 0/211 (0%)
 Frame = +2

Query  140  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  319
            PV +QT+ V+ACDT  NP LKS PFC+  L V  RV DLVKRLTL EKI+ LVNTAG+VS
Sbjct  34   PVSAQTSAVFACDTANNPSLKSFPFCDVSLGVSDRVNDLVKRLTLQEKISMLVNTAGSVS  93

Query  320  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            RLGIP YEWWSEALHG+SYTGPGV F  +VP ATSFPQP+LT+ASFNETLF TIGKV+ST
Sbjct  94   RLGIPKYEWWSEALHGISYTGPGVKFNNIVPHATSFPQPILTSASFNETLFQTIGKVVST  153

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGN  679
            E RAM+N G AGLTYWSPN+NI+RDPRWGRGQE  GEDPTL+ +Y  A+V+GLQ+RDDG 
Sbjct  154  EGRAMYNVGQAGLTYWSPNVNIYRDPRWGRGQETAGEDPTLSSRYGVAYVKGLQQRDDGK  213

Query  680  KEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
            K+ LKVA+CCKHYTAYDVDDWKG QRYNFN+
Sbjct  214  KDMLKVASCCKHYTAYDVDDWKGIQRYNFNA  244



>ref|XP_011092407.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   349 bits (896),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 158/212 (75%), Positives = 183/212 (86%), Gaps = 0/212 (0%)
 Frame = +2

Query  140  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  319
            PV +QT P +ACD   NPGLK+  FC+Q LDVK+RVADLV RLTL EKI +LVNTA  VS
Sbjct  24   PVFAQTKPAFACDVSNNPGLKNFSFCDQSLDVKSRVADLVGRLTLQEKIGWLVNTAKGVS  83

Query  320  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            RLGIP Y+WWSEALHG+SY GPG  F+G+VP ATSFPQ +LTAA+FNE+LF  IGKV+ST
Sbjct  84   RLGIPDYQWWSEALHGVSYVGPGTKFSGLVPGATSFPQVILTAATFNESLFEIIGKVVST  143

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGN  679
            EARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE  GEDP L+ KY AA+VRGLQERDDG+
Sbjct  144  EARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETAGEDPLLSSKYGAAYVRGLQERDDGD  203

Query  680  KEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            K++LKVAACCKHYTAYDVD+WKG QRYNFN++
Sbjct  204  KDRLKVAACCKHYTAYDVDNWKGIQRYNFNAL  235



>gb|KDO56532.1| hypothetical protein CISIN_1g0476211mg, partial [Citrus sinensis]
Length=250

 Score =   325 bits (834),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKITFLV++AG+VSRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEARAM+N
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILTAASFNASLFQAIGKVVSTEARAMYN  155

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KYA  +V+GLQ+ D G+  +LKVA
Sbjct  156  VGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYATGYVKGLQQTDGGSPNRLKVA  215

Query  701  ACCKHYTAYDVDDWKGYQRYNFNSVRLF  784
            ACCKHYTAYD+D+WKG  RY+FN++ ++
Sbjct  216  ACCKHYTAYDLDNWKGTDRYHFNAMVIY  243



>gb|EPS65933.1| hypothetical protein M569_08842, partial [Genlisea aurea]
Length=763

 Score =   340 bits (873),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 152/205 (74%), Positives = 176/205 (86%), Gaps = 0/205 (0%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P++ACD   +P LK+L FC+  LDVKTRV DLV RLTLPEK+ +L N+A  VSRLGIP Y
Sbjct  20   PIFACDVSADPALKTLAFCDSSLDVKTRVDDLVNRLTLPEKLGWLANSAKGVSRLGIPDY  79

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSE LHG+SYTGPGV FT +VP ATSFPQ +LT+ASFNE+LF  IGKV+STEARAM+N
Sbjct  80   EWWSEVLHGVSYTGPGVRFTSLVPGATSFPQVILTSASFNESLFRAIGKVVSTEARAMYN  139

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             G AGLT+WSPN+NIFRDPRWGRGQE PGEDP LT KY  A+VRGLQERDDGNKEKLKVA
Sbjct  140  VGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLTSKYGVAYVRGLQERDDGNKEKLKVA  199

Query  701  ACCKHYTAYDVDDWKGYQRYNFNSV  775
            +CCKHYTAYD+D+WKG QRY+FN++
Sbjct  200  SCCKHYTAYDLDNWKGIQRYSFNAI  224



>sp|A5JTQ3.1|XYL2_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 2; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
2; Short=MsXyl2; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor 
[Medicago sativa subsp. x varia]
 gb|ABQ45228.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   338 bits (867),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 153/213 (72%), Positives = 175/213 (82%), Gaps = 0/213 (0%)
 Frame = +2

Query  137  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  316
            G V SQT+ V+ACD  KNP L +  FCN++L V  RV DLV+RLTL EK+  LVN+A +V
Sbjct  29   GRVSSQTSAVFACDVAKNPALANYGFCNKKLSVDARVKDLVRRLTLQEKVGNLVNSAVDV  88

Query  317  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  496
            SRLGIP YEWWSEALHG+S  GPG +F+ V+P ATSFP P+L AASFN +LF TIGKV+S
Sbjct  89   SRLGIPKYEWWSEALHGVSNIGPGTHFSNVIPGATSFPMPILIAASFNASLFQTIGKVVS  148

Query  497  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDG  676
            TEARAMHN GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ+ DDG
Sbjct  149  TEARAMHNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLASKYAAGYVKGLQQTDDG  208

Query  677  NKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            +  KLKVAACCKHYTAYDVDDWKG QRY FN+V
Sbjct  209  DSNKLKVAACCKHYTAYDVDDWKGVQRYTFNAV  241



>ref|XP_002298197.2| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE83002.2| beta-glucosidase family protein [Populus trichocarpa]
Length=778

 Score =   338 bits (867),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/211 (72%), Positives = 177/211 (84%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLVKRLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVKRLTLQEKILFLVNSAGSVSR  92

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVVSTE  152

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +V+GLQ+RDDGN 
Sbjct  153  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVKGLQQRDDGNP  212

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            + LKVAACCKHYTAYD+D+WKG  RY+FN+V
Sbjct  213  DGLKVAACCKHYTAYDLDNWKGVDRYHFNAV  243



>gb|KEH31243.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=774

 Score =   337 bits (864),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 152/213 (71%), Positives = 175/213 (82%), Gaps = 0/213 (0%)
 Frame = +2

Query  137  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  316
            G V SQT+ V+ACD  KNP L +  FCN++L V  RV DLV+RLTL EK+  LVN+A +V
Sbjct  29   GRVSSQTSAVFACDVAKNPALANYGFCNKKLSVDARVKDLVRRLTLQEKVGNLVNSAVDV  88

Query  317  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  496
            SRLGIP YEWWSEALHG+S  GPG +F+ V+P +TSFP P+L AASFN +LF TIGKV+S
Sbjct  89   SRLGIPKYEWWSEALHGVSNIGPGTHFSNVIPGSTSFPMPILIAASFNASLFQTIGKVVS  148

Query  497  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDG  676
            TEARAMHN GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ+ DDG
Sbjct  149  TEARAMHNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLASKYAAGYVKGLQQTDDG  208

Query  677  NKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            +  KLKVAACCKHYTAYDVDDWKG QRY FN+V
Sbjct  209  DSNKLKVAACCKHYTAYDVDDWKGVQRYTFNAV  241



>gb|EYU35409.1| hypothetical protein MIMGU_mgv1a001738mg [Erythranthe guttata]
Length=767

 Score =   337 bits (863),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 157/214 (73%), Positives = 177/214 (83%), Gaps = 0/214 (0%)
 Frame = +2

Query  134  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  313
             GPV SQ  PV+ACD   NPGLK+  FC+  LDVK RV DLV RLTL EKI +LV+ A  
Sbjct  20   FGPVCSQAQPVFACDVSSNPGLKNFSFCDPSLDVKARVDDLVARLTLQEKIGWLVHAAKG  79

Query  314  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  493
            VSRLGIP+Y WWSEALHG+S  G G  FTG VPAATSFPQ +LT A+FNE+LF  IGKV+
Sbjct  80   VSRLGIPSYGWWSEALHGVSDVGGGSRFTGPVPAATSFPQVILTGATFNESLFQAIGKVV  139

Query  494  STEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDD  673
            STEARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDP LT KYAAA+VRGLQER+D
Sbjct  140  STEARAMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLTSKYAAAYVRGLQERED  199

Query  674  GNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            G+K +LKVAACCKHYTAYDVD+WKG QRYNFN+V
Sbjct  200  GDKSRLKVAACCKHYTAYDVDNWKGIQRYNFNAV  233



>ref|NP_001233910.1| beta-D-xylosidase 1 precursor [Solanum lycopersicum]
 dbj|BAC98298.1| LEXYL1 [Solanum lycopersicum]
Length=770

 Score =   337 bits (863),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 155/215 (72%), Positives = 179/215 (83%), Gaps = 0/215 (0%)
 Frame = +2

Query  131  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  310
            ++  V +Q +PV+ACD   NP L +L FC+  L V+ RV DLV RLTL EKI FLV+ AG
Sbjct  23   LLKQVLAQNSPVFACDVTSNPALGNLTFCDASLAVENRVNDLVNRLTLGEKIGFLVSGAG  82

Query  311  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  490
             VSRLGIP YEWWSEALHG++YTGPGV+FT +VP ATSFPQ +LTAASFN TLF TIGKV
Sbjct  83   GVSRLGIPKYEWWSEALHGVAYTGPGVHFTSLVPGATSFPQVILTAASFNVTLFQTIGKV  142

Query  491  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERD  670
            +STEARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDPTLT KY  A+V GLQ+ D
Sbjct  143  VSTEARAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLTSKYGVAYVEGLQQTD  202

Query  671  DGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            DG+  KLKVAACCKHYTAYDVD+WKG +RY+FN+V
Sbjct  203  DGSTNKLKVAACCKHYTAYDVDNWKGIERYSFNAV  237



>ref|XP_002303181.1| beta-glucosidase family protein [Populus trichocarpa]
 gb|EEE78160.1| beta-glucosidase family protein [Populus trichocarpa]
Length=773

 Score =   336 bits (862),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 177/211 (84%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V +Q++PV+ACD V NP L SL FCN  + +  RV DLVKRLTL EKI FLVN+AGNVSR
Sbjct  30   VSAQSSPVFACDVVSNPSLASLGFCNTSIGINDRVVDLVKRLTLQEKIVFLVNSAGNVSR  89

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+SY GPG +F+  V  ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTHFSDDVAGATSFPQVILTAASFNTSLFEAIGKVVSTE  149

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +V+GLQ+RDDG+ 
Sbjct  150  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSCYVKGLQQRDDGDP  209

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            +KLKVAACCKHYTAYD+D+WKG  RY+FN+V
Sbjct  210  DKLKVAACCKHYTAYDLDNWKGSDRYHFNAV  240



>ref|XP_009354080.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   336 bits (862),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V  Q++PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTTLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFQAIGRVVSTE  149

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KY + +VRGLQ+ DDG+K
Sbjct  150  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQQTDDGDK  209

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             KLKVAACCKHYTAYDVD+WKG  RY+FN+V
Sbjct  210  NKLKVAACCKHYTAYDVDNWKGVDRYHFNAV  240



>ref|XP_009347830.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Pyrus x bretschneideri]
Length=773

 Score =   336 bits (861),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V  Q++PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTTLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTE  149

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KY + +VRGLQ+ DDG+K
Sbjct  150  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQQTDDGDK  209

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             KLKVAACCKHYTAYDVD+WKG  RY+FN+V
Sbjct  210  NKLKVAACCKHYTAYDVDNWKGVDRYHFNAV  240



>ref|XP_008339210.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   336 bits (861),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V  Q++PV+AC+   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACNVASNATLSSFAFCDTSLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTE  149

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KY + +VRGLQ+ DDG+K
Sbjct  150  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQQTDDGDK  209

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             KLKVAACCKHYTAYD+D+WKG  RY+FN+V
Sbjct  210  NKLKVAACCKHYTAYDIDNWKGVDRYHFNAV  240



>ref|XP_012080785.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1 [Jatropha 
curcas]
 gb|KDP30704.1| hypothetical protein JCGZ_16402 [Jatropha curcas]
Length=770

 Score =   335 bits (860),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/211 (71%), Positives = 178/211 (84%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V +Q +PV+ACD  KNP + S  FCN  L +  RV DLV+RLTL EKI+FLVN+AG+VSR
Sbjct  27   VVAQPSPVFACDVSKNPSVASFGFCNVSLGINERVVDLVERLTLQEKISFLVNSAGSVSR  86

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  87   LGIPKYEWWSEALHGVSYVGPGTHFSSLVPGATSFPQVILTAASFNTSLFEAIGKVVSTE  146

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +VRGLQ+RDDG+ 
Sbjct  147  ARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQQRDDGDS  206

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            +KLKVAACCKHYTAYD+D+WKG  RY+FN+V
Sbjct  207  DKLKVAACCKHYTAYDLDNWKGTDRYHFNAV  237



>ref|XP_008344154.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Malus domestica]
Length=773

 Score =   335 bits (860),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V  Q++PV+ACD   N  L S  FC+  L V  RVADLVKRLTLPEKI FLVN+AG+VSR
Sbjct  30   VLGQSSPVFACDVASNATLSSFAFCDTSLGVDARVADLVKRLTLPEKIGFLVNSAGSVSR  89

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTXFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTE  149

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +VRGLQ+ DDG+K
Sbjct  150  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQQTDDGDK  209

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             KLKVAACCKHYTAYDVD+WKG  RY+FN+V
Sbjct  210  NKLKVAACCKHYTAYDVDNWKGVDRYHFNAV  240



>ref|XP_004504774.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cicer arietinum]
Length=774

 Score =   335 bits (858),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 154/213 (72%), Positives = 173/213 (81%), Gaps = 0/213 (0%)
 Frame = +2

Query  137  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  316
            G V SQT+PV+ACD  KNP L +  FCN+ L V  RV+DLV RLTL EKI  LVN+A +V
Sbjct  29   GRVWSQTSPVFACDVGKNPALSNYRFCNKSLGVNARVSDLVSRLTLQEKIGNLVNSAVDV  88

Query  317  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  496
            SRLGIP YEWWSEALHG+S  GPG  F+ VVP +TSFP P+L AASFN +LF TIGKV+S
Sbjct  89   SRLGIPRYEWWSEALHGVSNVGPGTRFSNVVPGSTSFPMPILIAASFNASLFQTIGKVVS  148

Query  497  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDG  676
            TEARAMHN GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ+ DDG
Sbjct  149  TEARAMHNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLASKYAAGYVKGLQQTDDG  208

Query  677  NKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            +  KLKVAACCKHYTAYDVD WKG QRY FN+V
Sbjct  209  DSNKLKVAACCKHYTAYDVDSWKGVQRYTFNAV  241



>ref|XP_010546362.1| PREDICTED: beta-D-xylosidase 4 [Tarenaya hassleriana]
Length=781

 Score =   334 bits (857),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 153/212 (72%), Positives = 176/212 (83%), Gaps = 0/212 (0%)
 Frame = +2

Query  140  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  319
            P ++Q++PV+ACD   NP L    FC++ L+V  RVADLV RLTL EKI FLVN A  VS
Sbjct  23   PSEAQSSPVFACDVSGNPSLAGFGFCDKSLEVNDRVADLVGRLTLQEKIGFLVNRANGVS  82

Query  320  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            RLGIPTYEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  83   RLGIPTYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVTLFQTIGKVVST  142

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGN  679
            EARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYAAA+V+GLQE + GN
Sbjct  143  EARAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYAAAYVKGLQEIEGGN  202

Query  680  KEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
               LKVAACCKHYTAYD+D+WKG +RY+FN+V
Sbjct  203  PNSLKVAACCKHYTAYDLDNWKGIERYSFNAV  234



>ref|XP_009379698.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Pyrus x bretschneideri]
Length=773

 Score =   334 bits (856),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V  Q++PV+ACD   N  L S  FC+  L V  RV DLVKRLTLPEKI FLVN AG+VSR
Sbjct  30   VLGQSSPVFACDVASNATLSSFAFCDTSLGVDARVVDLVKRLTLPEKIGFLVNNAGSVSR  89

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  90   LGIPKYEWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNTSLFEAIGRVVSTE  149

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +VRGLQ+ DDG+K
Sbjct  150  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPVLSSKYGSGYVRGLQQTDDGDK  209

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             KLKVAACCKHYTAYDVD+WKG  RY+FN+V
Sbjct  210  NKLKVAACCKHYTAYDVDNWKGVDRYHFNAV  240



>ref|XP_011015574.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   334 bits (856),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 176/211 (83%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLV RLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVGRLTLQEKILFLVNSAGSVSR  92

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  93   LGIPRYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVVSTE  152

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +V+GLQ+RDDGN 
Sbjct  153  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVKGLQQRDDGNP  212

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            + LKVAACCKHYTAYD+D+WKG  RY+F++V
Sbjct  213  DGLKVAACCKHYTAYDLDNWKGVDRYHFDAV  243



>ref|XP_011046123.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Populus euphratica]
Length=776

 Score =   334 bits (856),  Expect = 7e-105, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 176/211 (83%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLV RLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVGRLTLQEKILFLVNSAGSVSR  92

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  93   LGIPRYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVVSTE  152

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +V+GLQ+RDDGN 
Sbjct  153  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVKGLQQRDDGNP  212

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            + LKVAACCKHYTAYD+D+WKG  RY+F++V
Sbjct  213  DGLKVAACCKHYTAYDLDNWKGVDRYHFDAV  243



>ref|XP_006341844.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Solanum tuberosum]
Length=806

 Score =   335 bits (858),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 153/214 (71%), Positives = 179/214 (84%), Gaps = 0/214 (0%)
 Frame = +2

Query  134  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  313
            + PV +Q +PV+ACD   NP L +L FC+  L V+ RV DLVKRLTL EKI FLV+ A  
Sbjct  60   LKPVLAQNSPVFACDITSNPALGNLTFCDASLTVENRVNDLVKRLTLGEKIGFLVSGASG  119

Query  314  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  493
            VSRLGIP YEWWSEALHG++YTGPGV+F+ +VP ATSFPQ +LTAASFN +LF TIGKV+
Sbjct  120  VSRLGIPKYEWWSEALHGVAYTGPGVHFSSLVPGATSFPQVILTAASFNVSLFQTIGKVV  179

Query  494  STEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDD  673
            STEARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDPTLT  Y  A+V+GLQ+ DD
Sbjct  180  STEARAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLTSTYGVAYVKGLQQTDD  239

Query  674  GNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            G+  KLKVAACCKHYTAYDVD+WKG +RY+FN+V
Sbjct  240  GSTNKLKVAACCKHYTAYDVDNWKGIERYSFNAV  273



>ref|XP_011004967.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Populus euphratica]
Length=775

 Score =   333 bits (855),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 176/211 (83%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V +Q++PV+ACD V+NP L SL FCN    +  RV DLVKRLTL EKI FLVN+AGNVSR
Sbjct  32   VSAQSSPVFACDVVRNPSLASLGFCNTSSGINDRVVDLVKRLTLQEKILFLVNSAGNVSR  91

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+SY GPG +F+  V  ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  92   LGIPKYEWWSEALHGVSYVGPGTHFSNDVAGATSFPQVILTAASFNTSLFEAIGKVVSTE  151

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +V+GLQ+RD G+ 
Sbjct  152  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSCYVKGLQQRDHGDP  211

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            +KLKVAACCKHYTAYDVD+WKG  RY+FN+V
Sbjct  212  DKLKVAACCKHYTAYDVDNWKGSDRYHFNAV  242



>emb|CAJ65922.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=757

 Score =   333 bits (853),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 153/215 (71%), Positives = 177/215 (82%), Gaps = 4/215 (2%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V +Q++PV+ACD V NP L S  FCN  L V  RV DLVKRLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVVSNPSLASFGFCNTSLGVSDRVVDLVKRLTLQEKILFLVNSAGSVSR  92

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS--  496
            LGIP YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKVIS  
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFVAIGKVISQV  152

Query  497  --TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERD  670
              TEARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +V+GLQ+RD
Sbjct  153  VSTEARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVKGLQQRD  212

Query  671  DGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            DGN + LKVAACCKHYTAYD+D+WKG  RY+FN+V
Sbjct  213  DGNPDGLKVAACCKHYTAYDLDNWKGVDRYHFNAV  247



>ref|XP_010065527.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63057.1| hypothetical protein EUGRSUZ_G00649 [Eucalyptus grandis]
Length=790

 Score =   332 bits (850),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 150/205 (73%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            PV+ACD   NP L +  FCN  L V+ RVADLV+RLTL EK+ FLV+ AGNV RLGIP Y
Sbjct  40   PVFACDVDGNPSLAAFGFCNTSLGVEARVADLVQRLTLQEKVGFLVSGAGNVDRLGIPKY  99

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN TLF TIGKV+STEARAMHN
Sbjct  100  EWWSEALHGVSYVGPGTKFSSLVPGATSFPQVILTAASFNATLFETIGKVVSTEARAMHN  159

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KYAA +VRGLQ+ DDGN ++LKVA
Sbjct  160  VGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYAAGYVRGLQKSDDGNADRLKVA  219

Query  701  ACCKHYTAYDVDDWKGYQRYNFNSV  775
            ACCKHYTAYDVD+WKG  R  FN+V
Sbjct  220  ACCKHYTAYDVDNWKGVNRLTFNAV  244



>ref|XP_002513707.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF48654.1| Beta-glucosidase, putative [Ricinus communis]
Length=777

 Score =   331 bits (849),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V +Q++PV+ACD   NP L S  FCN  L +  RV DLV RLTL EKI FLVN+AG+VSR
Sbjct  33   VLAQSSPVFACDVKSNPSLASFGFCNVSLGISDRVTDLVNRLTLQEKIGFLVNSAGSVSR  92

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  93   LGIPKYEWWSEALHGVSYVGPGTHFSNIVPGATSFPQVILTAASFNASLFEAIGKVVSTE  152

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +VRGLQ+ D+G+ 
Sbjct  153  ARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSCYVRGLQQTDNGDS  212

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            E+LKVAACCKHYTAYD+D+WKG  RY+FN+V
Sbjct  213  ERLKVAACCKHYTAYDLDNWKGTDRYHFNAV  243



>emb|CAJ65921.1| xylan 1,4-beta-xylosidase [Populus tremula x Populus alba]
Length=704

 Score =   329 bits (843),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 177/216 (82%), Gaps = 5/216 (2%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V +Q++PV+ACD V NP L SL FCN  + +  RV DLVKRLTL EKI FLVN+AGNVSR
Sbjct  31   VSAQSSPVFACDVVSNPSLASLGFCNTSIGINDRVVDLVKRLTLQEKIVFLVNSAGNVSR  90

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV----  490
            LGIP YEWWSEALHG+SY GPG +F+  V  ATSFPQ +LTAASFN +LF  IGKV    
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFSDDVAGATSFPQVILTAASFNTSLFEAIGKVYYTQ  150

Query  491  -ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQER  667
             +STEARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY + +V+GLQ+R
Sbjct  151  VVSTEARAMYNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSCYVKGLQQR  210

Query  668  DDGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            DDG+ +KLKVAACCKHYTAYD+D+WKG  RY+FN+V
Sbjct  211  DDGDPDKLKVAACCKHYTAYDLDNWKGSDRYHFNAV  246



>ref|XP_007148433.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
 gb|ESW20427.1| hypothetical protein PHAVU_006G208200g [Phaseolus vulgaris]
Length=775

 Score =   330 bits (846),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 150/211 (71%), Positives = 174/211 (82%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V  QT+ V+ACD  KNP L    FC++ L V+ RVADLVKRLTL EKI  LVN+A NVSR
Sbjct  32   VSGQTSAVFACDVAKNPALAGYGFCDKSLSVEDRVADLVKRLTLQEKIGNLVNSAVNVSR  91

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+S  GPG +F+ VVP ATSFP P+LTAASFN +LF  IG+V+STE
Sbjct  92   LGIPKYEWWSEALHGVSNIGPGTHFSSVVPGATSFPMPILTAASFNSSLFEAIGRVVSTE  151

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQ+ DDG+ 
Sbjct  152  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQQTDDGDS  211

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             KLKVAACCKHYTAYD+D+WKG QRY FN+V
Sbjct  212  NKLKVAACCKHYTAYDLDNWKGVQRYTFNAV  242



>ref|XP_010243340.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=771

 Score =   330 bits (845),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 173/208 (83%), Gaps = 0/208 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            S  +PV+ACD  KNPGL +  FCN  LD+  RV DLV+RLTL EKITFLV+ AG V+RLG
Sbjct  30   SGQSPVFACDVGKNPGLAAFGFCNTSLDIAARVNDLVERLTLQEKITFLVSKAGAVNRLG  89

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IP+YEWWSEALHG+SY GPG +F+  VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  90   IPSYEWWSEALHGVSYVGPGTHFSSAVPGATSFPQVILTAASFNTSLFEDIGKVVSTEAR  149

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYAA +V+GLQ+ DDG+  +
Sbjct  150  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYAAGYVQGLQQTDDGDPSR  209

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNS  772
            LKVAACCKHYTAYDVD WKG  RY+FN+
Sbjct  210  LKVAACCKHYTAYDVDAWKGVDRYHFNA  237



>emb|CDY18705.1| BnaA09g06900D [Brassica napus]
Length=776

 Score =   330 bits (845),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 174/209 (83%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +QT PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RLG
Sbjct  34   AQTKPVFACDVDTNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVNKANGVTRLG  93

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IPTYEWWSEALHG+SY GPG +F+G+VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  94   IPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  153

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQE D G+  +
Sbjct  154  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQETDCGDANR  213

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYDVD+WKG +RYNFN+V
Sbjct  214  LKVAACCKHYTAYDVDNWKGVERYNFNAV  242



>ref|XP_009112141.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=776

 Score =   329 bits (844),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 174/209 (83%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +QT PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RLG
Sbjct  34   AQTKPVFACDVDTNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVNKANGVTRLG  93

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IPTYEWWSEALHG+SY GPG +F+G+VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  94   IPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  153

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQE D G+  +
Sbjct  154  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQETDCGDANR  213

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYDVD+WKG +RYNFN+V
Sbjct  214  LKVAACCKHYTAYDVDNWKGVERYNFNAV  242



>ref|XP_010065531.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63059.1| hypothetical protein EUGRSUZ_G00651 [Eucalyptus grandis]
Length=789

 Score =   329 bits (844),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 149/212 (70%), Positives = 174/212 (82%), Gaps = 1/212 (0%)
 Frame = +2

Query  143  VQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  319
            V  QT+ PV+ACD   +P L    FCN  L V+ RVADLV+RLTL EK+ FLVN AGNV 
Sbjct  32   VAGQTSKPVFACDVDSDPSLAGFGFCNASLGVEVRVADLVQRLTLQEKVGFLVNNAGNVD  91

Query  320  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN TLF TIGKV+ST
Sbjct  92   RLGIPKYEWWSEALHGVSYLGPGTKFSSLVPGATSFPQVILTAASFNATLFETIGKVVST  151

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGN  679
            EARAMHN GLA LT+WSPN+NIFRDPRWGRGQE PGEDP L+ KYA+++VRGLQ+ DDG 
Sbjct  152  EARAMHNVGLAELTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASSYVRGLQQSDDGK  211

Query  680  KEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             ++LKVAACCKHYTAYD+D+WKG  R++FN+V
Sbjct  212  TDRLKVAACCKHYTAYDIDNWKGVDRFHFNAV  243



>gb|KFK28148.1| hypothetical protein AALP_AA8G478800 [Arabis alpina]
Length=779

 Score =   328 bits (842),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 149/209 (71%), Positives = 174/209 (83%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +QT+PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLG
Sbjct  33   AQTSPVFACDVTGNPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLG  92

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQE D G+  +
Sbjct  153  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQETDGGDANR  212

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYDVD+WKG +RYNFN+V
Sbjct  213  LKVAACCKHYTAYDVDNWKGVERYNFNAV  241



>ref|XP_002268626.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Vitis 
vinifera]
 emb|CBI39114.3| unnamed protein product [Vitis vinifera]
Length=774

 Score =   328 bits (841),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 174/211 (82%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V  Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI FLVN+A +VSR
Sbjct  31   VLGQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+SY GPG +F  +VP ATSFPQ +LTAASFN +LF  IGKV+STE
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSIVPGATSFPQVILTAASFNASLFEAIGKVVSTE  150

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KYA+A+VRGLQ+ DDG+ 
Sbjct  151  ARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASAYVRGLQQGDDGSP  210

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            ++LKVAACCKHYTAYD+D+WKG  R +FN+V
Sbjct  211  DRLKVAACCKHYTAYDLDNWKGVDRLHFNAV  241



>emb|CBI40687.3| unnamed protein product [Vitis vinifera]
Length=751

 Score =   327 bits (839),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 174/211 (82%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V +Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI FLVN+A +VSR
Sbjct  31   VLAQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+SY GPG +F  VVP ATSFPQ +LTAASFN +LF  IGK +STE
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSVVPGATSFPQVILTAASFNASLFEAIGKAVSTE  150

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +VRGLQ+ DDG+ 
Sbjct  151  ARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVRGLQQSDDGSP  210

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            ++LKVAACCKHYTAYD+D+WKG  R++FN+V
Sbjct  211  DRLKVAACCKHYTAYDLDNWKGVDRFHFNAV  241



>ref|XP_002264183.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Vitis vinifera]
Length=774

 Score =   328 bits (840),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 174/211 (82%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V +Q++PV+ACD   NP L    FCN  L+   RVADLVKRLTL EKI FLVN+A +VSR
Sbjct  31   VLAQSSPVFACDVENNPTLGQFGFCNTSLETAARVADLVKRLTLEEKIGFLVNSAASVSR  90

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+SY GPG +F  VVP ATSFPQ +LTAASFN +LF  IGK +STE
Sbjct  91   LGIPKYEWWSEALHGVSYVGPGTHFNSVVPGATSFPQVILTAASFNASLFEAIGKAVSTE  150

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +VRGLQ+ DDG+ 
Sbjct  151  ARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVRGLQQSDDGSP  210

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            ++LKVAACCKHYTAYD+D+WKG  R++FN+V
Sbjct  211  DRLKVAACCKHYTAYDLDNWKGVDRFHFNAV  241



>ref|XP_006493288.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Citrus sinensis]
Length=773

 Score =   327 bits (839),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKITFLV++AG+VSRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEARAM+N
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILTAASFNASLFQAIGKVVSTEARAMYN  155

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KYA  +V+GLQ+ D G+  +LKVA
Sbjct  156  VGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYATGYVKGLQQTDGGSPNRLKVA  215

Query  701  ACCKHYTAYDVDDWKGYQRYNFNSV  775
            ACCKHYTAYD+D+WKG  RY+FN++
Sbjct  216  ACCKHYTAYDLDNWKGTDRYHFNAM  240



>ref|XP_006432467.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
 gb|ESR45707.1| hypothetical protein CICLE_v10000355mg [Citrus clementina]
Length=773

 Score =   327 bits (838),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 147/205 (72%), Positives = 171/205 (83%), Gaps = 0/205 (0%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            PV+ACD V NP L SL FCN  L +  RV DLVKRLTL EKITFLV++AG+VSRLGIP Y
Sbjct  36   PVFACDVVSNPSLASLGFCNTSLGIDLRVGDLVKRLTLQEKITFLVDSAGSVSRLGIPKY  95

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEARAM+N
Sbjct  96   EWWSEALHGVSYVGPGTHFSNVVPGATSFPQVILTAASFNASLFQAIGKVVSTEARAMYN  155

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KYA  +V+GLQ+ D G+  +LKVA
Sbjct  156  VGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYATGYVKGLQQTDGGSPNRLKVA  215

Query  701  ACCKHYTAYDVDDWKGYQRYNFNSV  775
            ACCKHYTAYD+D+WKG  RY+FN++
Sbjct  216  ACCKHYTAYDLDNWKGTDRYHFNAM  240



>ref|XP_003547598.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   327 bits (838),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V  QT+ V+ACD  KNP L    FC++ L V+ RVADLVKRLTL EKI  LVN+A +VSR
Sbjct  33   VSGQTSAVFACDVAKNPALAGYGFCDKSLSVEDRVADLVKRLTLQEKIGSLVNSATSVSR  92

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF  IG+V+STE
Sbjct  93   LGIPKYEWWSEALHGVSNVGPGTHFSSLVPGATSFPMPILTAASFNASLFEAIGRVVSTE  152

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA  +V+GLQ+ DDG+ 
Sbjct  153  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYATGYVKGLQQTDDGDS  212

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             KLKVAACCKHYTAYD+D+WKG QRY FN+V
Sbjct  213  NKLKVAACCKHYTAYDLDNWKGIQRYTFNAV  243



>emb|CDX81229.1| BnaC09g06400D [Brassica napus]
Length=776

 Score =   327 bits (837),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 173/209 (83%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q+ P +ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RLG
Sbjct  34   AQSKPAFACDVDTNPSLAAYGFCNTDLKMEYRVADLVARLTLQEKIGFLVNKANGVTRLG  93

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IPTYEWWSEALHG+SY GPG +F+G+VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  94   IPTYEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  153

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQE D G+  +
Sbjct  154  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQETDCGDANR  213

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYDVD+WKG +RYNFN+V
Sbjct  214  LKVAACCKHYTAYDVDNWKGVERYNFNAV  242



>ref|XP_003531557.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Glycine max]
Length=776

 Score =   326 bits (836),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V  QT+ V+ACD  KNP L    FC++ L ++ RVADLVKRLTL EKI  LVN+A +VSR
Sbjct  33   VSGQTSSVFACDVAKNPALAGYGFCDKSLSLEDRVADLVKRLTLQEKIGSLVNSATSVSR  92

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF  IG+V+STE
Sbjct  93   LGIPKYEWWSEALHGVSNVGPGTHFSSLVPGATSFPMPILTAASFNASLFEAIGRVVSTE  152

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA  +V+GLQ+ DDG+ 
Sbjct  153  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYATGYVKGLQQTDDGDS  212

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             KLKVAACCKHYTAYD+D+WKG QRY FN+V
Sbjct  213  NKLKVAACCKHYTAYDLDNWKGIQRYTFNAV  243



>ref|XP_010261102.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Nelumbo nucifera]
Length=773

 Score =   326 bits (835),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 148/205 (72%), Positives = 168/205 (82%), Gaps = 0/205 (0%)
 Frame = +2

Query  158  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  337
            +PV+ACD  KN GL +  FCN    +  RV DLVKRLTL EKI FLVN AG V+RLGIP+
Sbjct  35   SPVFACDVGKNSGLAAFGFCNSSWGIAARVDDLVKRLTLQEKIIFLVNKAGAVTRLGIPS  94

Query  338  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  517
            YEWWSEALHG+SY GPG +F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEARAM+
Sbjct  95   YEWWSEALHGVSYVGPGTHFSSVVPGATSFPQVILTAASFNTSLFQAIGKVVSTEARAMY  154

Query  518  NYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKV  697
            N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ+ DDGN  +LKV
Sbjct  155  NVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPILASKYAAGYVQGLQQSDDGNPNRLKV  214

Query  698  AACCKHYTAYDVDDWKGYQRYNFNS  772
            AACCKHYTAYDVD WKG  RY+FN+
Sbjct  215  AACCKHYTAYDVDAWKGVDRYHFNA  239



>ref|XP_006280038.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
 gb|EOA12936.1| hypothetical protein CARUB_v10025915mg [Capsella rubella]
Length=784

 Score =   326 bits (835),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 172/209 (82%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLG
Sbjct  38   AQSSPVFACDVAANPSLAAFGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLG  97

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IPTYEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  98   IPTYEWWSEALHGVSYIGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  157

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYA+ +V+GLQE D G+  +
Sbjct  158  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYASGYVKGLQETDGGDSNR  217

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYDVD+WKG +RY+FN+V
Sbjct  218  LKVAACCKHYTAYDVDNWKGVERYSFNAV  246



>emb|CDY46812.1| BnaC02g43200D [Brassica napus]
Length=778

 Score =   325 bits (834),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 171/209 (82%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q+ PV+ACD   N  L S  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RLG
Sbjct  33   AQSTPVFACDVAGNSSLSSYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKASGVTRLG  92

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQE D G+  +
Sbjct  153  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQETDGGDANR  212

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYDVD+WKG +RY FN+V
Sbjct  213  LKVAACCKHYTAYDVDNWKGVERYTFNAV  241



>ref|XP_007043027.1| Beta-D-xylosidase 4 [Theobroma cacao]
 gb|EOX98858.1| Beta-D-xylosidase 4 [Theobroma cacao]
Length=787

 Score =   325 bits (834),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 175/211 (83%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V  QT+PV+ACD  KNP + S  FCN  L +++RVADLV+RLTL EKI F+V+ AG+VSR
Sbjct  44   VFGQTSPVFACDATKNPEVTSYDFCNASLGIESRVADLVQRLTLQEKILFIVSGAGSVSR  103

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+S  GPG  F+ +VP ATSFPQ +LTAASFN TLF  IG+V+STE
Sbjct  104  LGIPKYEWWSEALHGVSNVGPGTKFSSLVPGATSFPQVILTAASFNTTLFEAIGRVVSTE  163

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP LT KY +++V+GLQ+ D G+ 
Sbjct  164  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLTSKYGSSYVKGLQQSDGGDP  223

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             +LKVAACCKHYTAYD+D+WKG  RY+FN+V
Sbjct  224  SRLKVAACCKHYTAYDLDNWKGVDRYHFNAV  254



>ref|XP_011087838.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   325 bits (832),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/212 (69%), Positives = 173/212 (82%), Gaps = 0/212 (0%)
 Frame = +2

Query  140  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  319
            PV ++  PV+ACD   NPGL +  FC+  LD+KTR+ DLV RLTL EK  +LV+ A  VS
Sbjct  24   PVFAERKPVFACDVTSNPGLMNFSFCDPSLDLKTRMDDLVSRLTLQEKFGWLVSGARGVS  83

Query  320  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            RLGIP YEWWSEALHG+SYTGPG  F   VP ATSFPQ +LTA +FNE+LF  IGKV+ST
Sbjct  84   RLGIPNYEWWSEALHGVSYTGPGTKFASPVPGATSFPQVILTAGTFNESLFELIGKVVST  143

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGN  679
            EARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY AA+VRGLQ+ DD N
Sbjct  144  EARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYGAAYVRGLQQTDDDN  203

Query  680  KEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            +E+LKVAACCKHYTAYD+D+WKG QRY FN++
Sbjct  204  EERLKVAACCKHYTAYDLDNWKGIQRYTFNAL  235



>ref|XP_007225245.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
 gb|EMJ26444.1| hypothetical protein PRUPE_ppa001692mg [Prunus persica]
Length=779

 Score =   325 bits (832),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 172/209 (82%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q++PV+ACD   N  + S  FC+  L +  RVADLVKRLTL EKI FLVN+AG+VSRLG
Sbjct  38   AQSSPVFACDVGSNASVSSFGFCDTSLAIDLRVADLVKRLTLQEKIGFLVNSAGSVSRLG  97

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IP YEWWSEALHG+S  GPG  FT VVP ATSFPQ +LTAASFN +LF  IG+V+STEAR
Sbjct  98   IPKYEWWSEALHGVSNVGPGTKFTNVVPGATSFPQVILTAASFNASLFEAIGRVVSTEAR  157

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KY + +VRGLQ+ D G+K K
Sbjct  158  AMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQQTDGGDKNK  217

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYD+D+WKG  RY+FN+V
Sbjct  218  LKVAACCKHYTAYDLDNWKGVDRYHFNAV  246



>ref|XP_010065529.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
 gb|KCW63058.1| hypothetical protein EUGRSUZ_G00650 [Eucalyptus grandis]
Length=789

 Score =   325 bits (832),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 145/205 (71%), Positives = 170/205 (83%), Gaps = 0/205 (0%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            PV+ACD   +P L    FCN  L V+ RVADLV+RLTL EK+ FLVN AGNV RLGIP Y
Sbjct  39   PVFACDVGSDPSLAGFGFCNTSLGVEARVADLVQRLTLQEKVGFLVNNAGNVDRLGIPNY  98

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            +WWSEALHG+SY G G +F+ +VP ATSFPQ +LTAASFN TLF TIGKV+STEARAMHN
Sbjct  99   KWWSEALHGVSYVGGGTSFSSLVPGATSFPQVILTAASFNATLFETIGKVVSTEARAMHN  158

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             GLAGLT+WSPN+NIFRDPRWGRGQE  GEDP L+ KYA+ +VRGLQ+ DDGN ++LKVA
Sbjct  159  VGLAGLTFWSPNVNIFRDPRWGRGQETRGEDPLLSSKYASGYVRGLQQSDDGNADRLKVA  218

Query  701  ACCKHYTAYDVDDWKGYQRYNFNSV  775
            ACCKHYTAYD+D+WKG  R++FN+V
Sbjct  219  ACCKHYTAYDIDNWKGVDRFHFNAV  243



>gb|KGN43688.1| hypothetical protein Csa_7G058620 [Cucumis sativus]
Length=782

 Score =   324 bits (831),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 170/209 (81%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI FL+N A NV+RLG
Sbjct  41   AQSPTAFACDAETNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRLG  100

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  101  IPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGKVVSTEAR  160

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYAA +VRGLQ+RDDG+ ++
Sbjct  161  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYAAGYVRGLQQRDDGDPDR  220

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYD+D+WKG  RY+FN+V
Sbjct  221  LKVAACCKHYTAYDLDNWKGTDRYHFNAV  249



>ref|XP_006394136.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
 gb|ESQ31422.1| hypothetical protein EUTSA_v10003678mg [Eutrema salsugineum]
Length=780

 Score =   324 bits (830),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 172/209 (82%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q++PV+ACD   NP L +  FCN  L  + RVADLV RLTL EKI FLV+ A  VSRLG
Sbjct  34   AQSSPVFACDVAGNPSLAAYGFCNTALKSEYRVADLVARLTLQEKIGFLVSKANGVSRLG  93

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  94   IPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  153

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQE D G+  +
Sbjct  154  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQETDTGDANR  213

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYDVD+WKG  RY+FN+V
Sbjct  214  LKVAACCKHYTAYDVDNWKGVDRYSFNAV  242



>ref|XP_004136861.2| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Cucumis sativus]
Length=807

 Score =   325 bits (832),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 170/209 (81%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI FL+N A NV+RLG
Sbjct  66   AQSPTAFACDAETNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRLG  125

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  126  IPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGKVVSTEAR  185

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYAA +VRGLQ+RDDG+ ++
Sbjct  186  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYAAGYVRGLQQRDDGDPDR  245

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYD+D+WKG  RY+FN+V
Sbjct  246  LKVAACCKHYTAYDLDNWKGTDRYHFNAV  274



>ref|XP_010444394.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   324 bits (830),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 171/208 (82%), Gaps = 0/208 (0%)
 Frame = +2

Query  152  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  331
             ++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLGI
Sbjct  31   SSSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGI  90

Query  332  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARA  511
            PTYEWWSEALHG+SY GPG +FTG VP ATSFPQ +LTAASFN +LF  IGKV+STEARA
Sbjct  91   PTYEWWSEALHGVSYIGPGTHFTGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARA  150

Query  512  MHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKL  691
            M+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYA+ +V+GLQE D G+  +L
Sbjct  151  MYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYASGYVKGLQETDGGDSNRL  210

Query  692  KVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            KVAACCKHYTAYDVD+WKG +RY+FN+V
Sbjct  211  KVAACCKHYTAYDVDNWKGVERYSFNAV  238



>ref|XP_002866623.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42882.1| beta-xylosidase 4 [Arabidopsis lyrata subsp. lyrata]
Length=784

 Score =   323 bits (829),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 172/209 (82%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLG
Sbjct  38   AQSSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLG  97

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IPTYEWWSEALHG+SY GPG +F+  VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  98   IPTYEWWSEALHGVSYIGPGTHFSSQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  157

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYA+ +V+GLQE D G+  +
Sbjct  158  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYASGYVKGLQETDGGDSNR  217

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYDVD+WKG +RY+FN+V
Sbjct  218  LKVAACCKHYTAYDVDNWKGVERYSFNAV  246



>ref|XP_008455235.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cucumis melo]
Length=791

 Score =   323 bits (829),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 145/209 (69%), Positives = 170/209 (81%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q+   +ACD   NP +    FC+  L  + RV DLVKRLTL EKI FL+N A NV+RLG
Sbjct  50   AQSPTAFACDAGTNPSVSGFAFCDSSLGFEARVEDLVKRLTLQEKIGFLINNARNVTRLG  109

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  110  IPKYEWWSEALHGVSYVGPGTKFSNVVPGATSFPQVILTAASFNASLFEAIGKVVSTEAR  169

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYAA +VRGLQ+RDDG+ ++
Sbjct  170  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYAAGYVRGLQQRDDGDPDR  229

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYD+D+WKG  RY+FN+V
Sbjct  230  LKVAACCKHYTAYDLDNWKGTDRYHFNAV  258



>ref|NP_201262.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
 sp|Q9FLG1.1|BXL4_ARATH RecName: Full=Beta-D-xylosidase 4; Short=AtBXL4; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAB11424.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AED97922.1| beta-D-xylosidase 4 [Arabidopsis thaliana]
Length=784

 Score =   323 bits (828),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/209 (70%), Positives = 172/209 (82%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLG
Sbjct  38   AQSSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLG  97

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IPTYEWWSEALHG+SY GPG +F+  VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  98   IPTYEWWSEALHGVSYIGPGTHFSSQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  157

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYA+ +V+GLQE D G+  +
Sbjct  158  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYASGYVKGLQETDGGDSNR  217

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYDVD+WKG +RY+FN+V
Sbjct  218  LKVAACCKHYTAYDVDNWKGVERYSFNAV  246



>ref|XP_010484241.1| PREDICTED: beta-D-xylosidase 4 [Camelina sativa]
Length=785

 Score =   323 bits (828),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 171/208 (82%), Gaps = 0/208 (0%)
 Frame = +2

Query  152  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  331
             ++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLGI
Sbjct  40   SSSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGI  99

Query  332  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARA  511
            PTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEARA
Sbjct  100  PTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARA  159

Query  512  MHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKL  691
            M+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYA+ +V+GLQE D G+  +L
Sbjct  160  MYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYASGYVKGLQETDGGDSNRL  219

Query  692  KVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            KVAACCKHYTAYDVD+WKG +RY+FN+V
Sbjct  220  KVAACCKHYTAYDVDNWKGVERYSFNAV  247



>emb|CDY31313.1| BnaA02g34280D [Brassica napus]
Length=778

 Score =   322 bits (826),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/210 (70%), Positives = 170/210 (81%), Gaps = 0/210 (0%)
 Frame = +2

Query  146  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  325
             +Q+ P +ACD   N  L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RL
Sbjct  32   NAQSTPAFACDVAGNSSLSAYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKANGVTRL  91

Query  326  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  505
            GIPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEA
Sbjct  92   GIPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEA  151

Query  506  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKE  685
            RAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQE D G+  
Sbjct  152  RAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQETDGGDAN  211

Query  686  KLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            +LKVAACCKHYTAYDVD+WKG +RY FN+V
Sbjct  212  RLKVAACCKHYTAYDVDNWKGIERYTFNAV  241



>ref|XP_010461983.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=776

 Score =   322 bits (826),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 171/208 (82%), Gaps = 0/208 (0%)
 Frame = +2

Query  152  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  331
             ++PV+ACD   NP L +  FCN  L ++ RVADLV RLTL EKI FLV+ A  V+RLGI
Sbjct  31   SSSPVFACDVAANPSLAAYGFCNTVLKIEYRVADLVARLTLQEKIGFLVSKANGVTRLGI  90

Query  332  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARA  511
            PTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEARA
Sbjct  91   PTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARA  150

Query  512  MHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKL  691
            M+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYA+ +V+GLQE D G+  +L
Sbjct  151  MYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYASGYVKGLQETDGGDPNRL  210

Query  692  KVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            KVAACCKHYTAYDVD+WKG +RY+FN+V
Sbjct  211  KVAACCKHYTAYDVDNWKGVERYSFNAV  238



>ref|XP_008218886.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2 [Prunus 
mume]
Length=779

 Score =   322 bits (825),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 172/211 (82%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V +Q++PV+AC+   N    S  FC+  L +  RVADLV+RLTL EKI FLVN+AG+VSR
Sbjct  36   VFAQSSPVFACNVASNASASSFGFCDTSLAIDLRVADLVQRLTLQEKIGFLVNSAGSVSR  95

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+S  GPG  FT VVP ATSFPQ +LTAASFN +LF  IG+V+STE
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTNVVPGATSFPQVILTAASFNASLFEAIGRVVSTE  155

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KY + +VRGLQ+ D G+K
Sbjct  156  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYGSGYVRGLQQTDGGDK  215

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             KLKVAACCKHYTAYD+D+WKG  RY+FN+V
Sbjct  216  NKLKVAACCKHYTAYDLDNWKGVDRYHFNAV  246



>ref|XP_010103839.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
 gb|EXB97280.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Morus notabilis]
Length=778

 Score =   322 bits (824),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 149/214 (70%), Positives = 172/214 (80%), Gaps = 1/214 (0%)
 Frame = +2

Query  137  GPVQSQ-TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  313
            G V+ Q T+P +ACD   NP L    FCN  L +++RV DLVKRLTL EKI FLVN+AG 
Sbjct  30   GGVRGQSTSPPFACDVGANPSLAGFGFCNASLGIESRVGDLVKRLTLQEKIGFLVNSAGA  89

Query  314  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  493
            VSRLGIP YEWWSEALHG+SY GPG  F+ VVP ATSFPQ +LTAASFN +LF  IGKV+
Sbjct  90   VSRLGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQVILTAASFNASLFEVIGKVV  149

Query  494  STEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDD  673
            STEARAM+N GLAGLTYWSPN+NI RDPRWGR QE PGEDP L+ KYA+ +VRGLQ+ D 
Sbjct  150  STEARAMYNVGLAGLTYWSPNVNIVRDPRWGRTQETPGEDPLLSSKYASGYVRGLQQTDG  209

Query  674  GNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            G   +LKVAACCKHYTAYD+D+WKGY RY+FN+V
Sbjct  210  GGPNRLKVAACCKHYTAYDLDNWKGYDRYHFNAV  243



>gb|KJB31995.1| hypothetical protein B456_005G218000 [Gossypium raimondii]
Length=779

 Score =   321 bits (823),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V +QT+PV+ACD  K+P + S  FC+ +L    RVADLV RLTL EKI F+VN+AG+VSR
Sbjct  36   VLAQTSPVFACDATKDPQVASYGFCDTKLGTDARVADLVHRLTLQEKILFIVNSAGSVSR  95

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+S  GPG  FT +VP ATSFPQ +LTAASFN +L+  IGKV+STE
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTSLVPGATSFPQVILTAASFNTSLYEAIGKVVSTE  155

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KY +++V+GLQ+ D G+ 
Sbjct  156  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLASKYGSSYVKGLQQTDGGDP  215

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             +LKVAACCKHYTAYDVD+WKG +RY F++V
Sbjct  216  SRLKVAACCKHYTAYDVDNWKGIERYTFDAV  246



>ref|XP_009401393.1| PREDICTED: beta-D-xylosidase 4-like [Musa acuminata subsp. malaccensis]
Length=770

 Score =   321 bits (822),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 153/211 (73%), Positives = 169/211 (80%), Gaps = 3/211 (1%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V  QT PV+ACD   NP L S  FCN     + RVADLVKRLTL EK+ FLVN A  VSR
Sbjct  28   VAGQT-PVFACDVASNPSLGSYGFCNTSYGTEQRVADLVKRLTLQEKVGFLVNKATAVSR  86

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP+YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN TLF  IGKV+STE
Sbjct  87   LGIPSYEWWSEALHGVSYVGPGTHFSTLVPGATSFPQVILTAASFNTTLFQAIGKVVSTE  146

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAMHN GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYA  +VRGLQE D+   
Sbjct  147  ARAMHNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLASKYATGYVRGLQEADE--P  204

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            EKLKVAACCKHYTAYDVD+WKG +RY FN+V
Sbjct  205  EKLKVAACCKHYTAYDVDNWKGIERYTFNAV  235



>gb|KHG10349.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=779

 Score =   321 bits (823),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 173/211 (82%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V +QT+PV+ACD  K+P + S  FC+ +L    RVADLV RLTL EKI F+VN+AG+VSR
Sbjct  36   VLAQTSPVFACDATKDPKVASYGFCDTKLGTDARVADLVHRLTLQEKILFIVNSAGSVSR  95

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+S  GPG  FT +VP ATSFPQ +LTAASFN +L+  IGKV+STE
Sbjct  96   LGIPKYEWWSEALHGVSNVGPGTKFTSLVPGATSFPQVILTAASFNTSLYEAIGKVVSTE  155

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KY +++V+GLQ+ D G+ 
Sbjct  156  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLASKYGSSYVKGLQQTDGGDP  215

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             +LKVAACCKHYTAYDVD+WKG +RY F++V
Sbjct  216  SRLKVAACCKHYTAYDVDNWKGIERYTFDAV  246



>ref|XP_007159080.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
 gb|ESW31074.1| hypothetical protein PHAVU_002G206800g [Phaseolus vulgaris]
Length=773

 Score =   320 bits (821),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 148/213 (69%), Positives = 169/213 (79%), Gaps = 0/213 (0%)
 Frame = +2

Query  137  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  316
            G V  QT+ ++ACD  KNP L    FC++ L V+ RVADLV RLTL EKI  LVN A +V
Sbjct  28   GGVWGQTSAIFACDVEKNPALGGYAFCDKSLGVEERVADLVGRLTLQEKIGNLVNAAVDV  87

Query  317  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  496
            SRLGIP YEWWSEALHG+S  GPG  F+ VVP ATSFP P+LTAASFN +LF TIG+ +S
Sbjct  88   SRLGIPKYEWWSEALHGVSNVGPGTRFSNVVPGATSFPMPILTAASFNTSLFETIGRAVS  147

Query  497  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDG  676
            TEARAMHN GLAGLTYWSPN+NIFRDPRWGRG E PGEDP L  KYAA +V+GLQ+ D G
Sbjct  148  TEARAMHNVGLAGLTYWSPNINIFRDPRWGRGLETPGEDPVLASKYAAGYVKGLQQTDGG  207

Query  677  NKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            +  +LKVAACCKHYTAYDVD+WKG QRY FN+V
Sbjct  208  DPNRLKVAACCKHYTAYDVDNWKGIQRYTFNAV  240



>ref|XP_010065530.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=789

 Score =   320 bits (821),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 146/205 (71%), Positives = 162/205 (79%), Gaps = 0/205 (0%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            PV+ACD   +P L    FCN  L V+ RV DLV+RLTL EK+ FLVN A NV RLGIP Y
Sbjct  39   PVFACDVDSDPSLAGFGFCNTSLGVEARVVDLVQRLTLQEKVGFLVNNASNVDRLGIPKY  98

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
             WWSEALHG+S  GPG  F  +VP ATSFPQ +LTAASFN TLF TIGKVISTEARAMHN
Sbjct  99   SWWSEALHGVSDVGPGTTFASLVPGATSFPQVILTAASFNATLFETIGKVISTEARAMHN  158

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KYA+  VRGLQ+ DDGN ++LKVA
Sbjct  159  VGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGHVRGLQQSDDGNADRLKVA  218

Query  701  ACCKHYTAYDVDDWKGYQRYNFNSV  775
            ACCKHYTAYDVD WKG  R  FN+V
Sbjct  219  ACCKHYTAYDVDHWKGVDRLTFNAV  243



>ref|XP_009130462.1| PREDICTED: beta-D-xylosidase 4-like [Brassica rapa]
Length=778

 Score =   319 bits (817),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 144/209 (69%), Positives = 169/209 (81%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q+ P +ACD   N  L +  FCN  L ++ RVADLV RLTL EKI FLVN A  V+RLG
Sbjct  33   AQSTPAFACDVAGNSSLSAYGFCNAALKIEARVADLVGRLTLQEKIGFLVNKANGVTRLG  92

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPTYEWWSEALHGVSYIGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQE +  +  +
Sbjct  153  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQETESSDANR  212

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYDVD+WKG +RY FN+V
Sbjct  213  LKVAACCKHYTAYDVDNWKGIERYTFNAV  241



>ref|XP_010520456.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 4 [Tarenaya 
hassleriana]
Length=750

 Score =   318 bits (815),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 170/215 (79%), Gaps = 0/215 (0%)
 Frame = +2

Query  131  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  310
            ++ P  +Q+ PV+ACD   NP L    FCN  L ++ RVADLV RLTLPEKI FLV+ A 
Sbjct  20   VLPPSNAQSTPVFACDVAGNPSLAGFGFCNTSLGIEARVADLVGRLTLPEKIGFLVSGAK  79

Query  311  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  490
             VSRLGIP YEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN +LF  IGK 
Sbjct  80   AVSRLGIPAYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGKA  139

Query  491  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERD  670
            +STEARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ K+  A+V+GLQE +
Sbjct  140  VSTEARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKFGVAYVKGLQETE  199

Query  671  DGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             G+  +LKVAACCKHYTAYD+D+W G+ R+ FN+V
Sbjct  200  GGDPNRLKVAACCKHYTAYDLDNWNGFHRFTFNAV  234



>emb|CDY52884.1| BnaC06g27770D, partial [Brassica napus]
Length=318

 Score =   304 bits (779),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 166/216 (77%), Gaps = 1/216 (0%)
 Frame = +2

Query  131  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  307
            I  P  +Q++ PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKA  86

Query  308  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  487
              VSRLGIP Y WWSEALHG+S  G G +FTG+VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  488  VISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQER  667
            V+STEARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL  KYA A+V+GLQ  
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQGT  206

Query  668  DDGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            D G+  +LKVAACCKHYTAYDVD+WK   RY FNSV
Sbjct  207  DGGDPNRLKVAACCKHYTAYDVDNWKDVNRYTFNSV  242



>ref|XP_004485551.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 1-like 
[Cicer arietinum]
Length=775

 Score =   318 bits (814),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 169/211 (80%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V  QT+ V+ACD  KN  L    FC++ L VK RV DLVKRLTL EKI  L N+A  VSR
Sbjct  32   VYGQTSTVFACDVAKNSSLAGYGFCDKSLSVKERVLDLVKRLTLKEKIGNLGNSAVEVSR  91

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF  IG V+STE
Sbjct  92   LGIPKYEWWSEALHGISNIGPGTHFSTLVPGATSFPMPILTAASFNTSLFQAIGSVVSTE  151

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQ+ DDG+ 
Sbjct  152  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQQTDDGDS  211

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             KLKVAACCKHYTAYD+D+WKG QRY FN+V
Sbjct  212  NKLKVAACCKHYTAYDLDNWKGVQRYTFNAV  242



>ref|XP_003593145.1| Beta-xylosidase/alpha-L-arabinofuranosidase [Medicago truncatula]
 gb|AES63396.1| beta-xylosidase/alpha-L-arabinofuranosidase-like protein [Medicago 
truncatula]
Length=775

 Score =   317 bits (813),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 171/211 (81%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V  QT+ V+ACD  KN  + S  FC++ L V+ RV+DLVKRLTL EKI  L N+A  VSR
Sbjct  32   VYGQTSTVFACDVAKNTNVSSYGFCDKSLSVEDRVSDLVKRLTLQEKIGNLGNSAVEVSR  91

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+S  GPG +F+ +VP ATSFP P+LTAASFN +LF  IG V+S E
Sbjct  92   LGIPKYEWWSEALHGVSNIGPGTHFSSLVPGATSFPMPILTAASFNTSLFQAIGSVVSNE  151

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYAA +V+GLQ+ DDG+ 
Sbjct  152  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYAAGYVKGLQQTDDGDS  211

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            +KLKVAACCKHYTAYDVD+WKG QRY F++V
Sbjct  212  DKLKVAACCKHYTAYDVDNWKGVQRYTFDAV  242



>ref|XP_011087839.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Sesamum indicum]
Length=768

 Score =   317 bits (812),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/213 (67%), Positives = 174/213 (82%), Gaps = 0/213 (0%)
 Frame = +2

Query  137  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  316
            GPV +Q  PV+ACD   NPGLK+  FC+  L +KTRV DLV RLTL EKI +LV+ +  V
Sbjct  23   GPVFAQQKPVFACDVTDNPGLKNFRFCDLSLGLKTRVDDLVSRLTLQEKIGWLVSGSEGV  82

Query  317  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  496
            SRLGIP Y+WWSEALHG+SY GPG  F+  +PAAT FPQ +LTA++FN++LF TI KV+S
Sbjct  83   SRLGIPDYQWWSEALHGVSYGGPGTKFSSPIPAATIFPQVILTASTFNDSLFETIAKVVS  142

Query  497  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDG  676
            TEARAM+N GLAGLT++SPN+NIFRDPRWGRGQE PGEDP L+  Y AA+VRGLQ  DDG
Sbjct  143  TEARAMYNAGLAGLTFFSPNINIFRDPRWGRGQETPGEDPLLSSNYGAAYVRGLQRTDDG  202

Query  677  NKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            ++E+LKVA CCKHY AYD+D+WKG QRY+FN+V
Sbjct  203  DEERLKVAGCCKHYIAYDLDNWKGIQRYSFNAV  235



>ref|XP_008784548.1| PREDICTED: LOW QUALITY PROTEIN: beta-xylosidase/alpha-L-arabinofuranosidase 
2-like [Phoenix dactylifera]
Length=773

 Score =   317 bits (812),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 147/211 (70%), Positives = 171/211 (81%), Gaps = 3/211 (1%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V +QT P++ACDT  N  L S  FCN    ++ RV DLVKRLTL EK+ FLVN A  VSR
Sbjct  31   VLAQT-PIFACDTASNASLASFGFCNTSWGIEARVGDLVKRLTLEEKVGFLVNKAAAVSR  89

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP+YEWWSEALHG+S+ GPG +F+ +VP ATSFPQ +LTAASFN TLF TIGKV+STE
Sbjct  90   LGIPSYEWWSEALHGVSFVGPGTHFSSLVPGATSFPQVILTAASFNTTLFETIGKVVSTE  149

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ+  D   
Sbjct  150  ARAMHNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLASKYAAGYVKGLQQAKD--P  207

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            ++LKVAACCKHYTAYD+D+WKG QRY FN+V
Sbjct  208  DRLKVAACCKHYTAYDLDNWKGIQRYTFNAV  238



>ref|XP_011465594.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=799

 Score =   317 bits (813),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/211 (69%), Positives = 168/211 (80%), Gaps = 2/211 (1%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V S +   +AC    N    S PFC++ L    RVADLV+RLTL EKITFLVN+AG+VSR
Sbjct  58   VSSVSGQSFACGESGNA--SSFPFCDKSLAADARVADLVQRLTLQEKITFLVNSAGSVSR  115

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+SY GPG  F+ VVP ATSFPQP+LTAASFN +LF  IG+V+STE
Sbjct  116  LGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQPILTAASFNNSLFEAIGRVVSTE  175

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLTYW+PN+NIFRDPRWGRGQE PGEDP LT  Y A +VRGLQ+ D  +K
Sbjct  176  ARAMYNVGLAGLTYWAPNINIFRDPRWGRGQETPGEDPLLTSNYGAGYVRGLQQTDSQDK  235

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             +LKVAACCKHYTAYD+D WKGY RY FN+V
Sbjct  236  NRLKVAACCKHYTAYDLDHWKGYDRYTFNAV  266



>sp|A5JTQ2.1|XYL1_MEDSV RecName: Full=Beta-xylosidase/alpha-L-arabinofuranosidase 1; 
AltName: Full=Xylan 1,4-beta-xylosidase/Alpha-L-arabinofuranosidase 
1; Short=MsXyl1; Includes: RecName: Full=Beta-xylosidase; 
AltName: Full=1,4-beta-D-xylan xylohydrolase; AltName: 
Full=Xylan 1,4-beta-xylosidase; Includes: RecName: Full=Alpha-L-arabinofuranosidase; 
Short=Arabinosidase; Flags: Precursor, 
partial [Medicago sativa subsp. x varia]
 gb|ABQ45227.1| beta-xylosidase/alpha-L-arabinosidase [Medicago sativa subsp. 
x varia]
Length=774

 Score =   316 bits (809),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 170/211 (81%), Gaps = 0/211 (0%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V  QT+ V+ACD  KN  + S  FC+  L V+ RV+DLVKRLTL EKI  L N+A  VSR
Sbjct  31   VYGQTSTVFACDVAKNTNVSSYGFCDNSLSVEDRVSDLVKRLTLQEKIGNLGNSAVEVSR  90

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+S  GPG +F+ +VP AT+FP P+LTAASFN +LF  IG V+S E
Sbjct  91   LGIPKYEWWSEALHGVSNIGPGTHFSSLVPGATNFPMPILTAASFNTSLFQAIGSVVSNE  150

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYAA +V+GLQ+ DDG+ 
Sbjct  151  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLSSKYAAGYVKGLQQTDDGDS  210

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            +KLKVAACCKHYTAYDVD+WKG QRY F++V
Sbjct  211  DKLKVAACCKHYTAYDVDNWKGVQRYTFDAV  241



>gb|KHN06823.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Glycine soja]
Length=301

 Score =   301 bits (771),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 161/203 (79%), Gaps = 0/203 (0%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+AG+VSRLGIP YEW
Sbjct  12   FACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAGDVSRLGIPRYEW  71

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  G G  F+ VVP ATSFP P+LTAASFN +LF  IG+V+STEA AM+N G
Sbjct  72   WSEALHGVSNVGLGTRFSNVVPGATSFPMPILTAASFNTSLFEVIGRVVSTEAGAMYNVG  131

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
            LAG TYWSPN+NIFRDPRWGRG E PGEDP LT KYAA +V+GLQ+ D G+  KLKVAAC
Sbjct  132  LAGFTYWSPNINIFRDPRWGRGLETPGEDPVLTSKYAAGYVKGLQQTDGGDPSKLKVAAC  191

Query  707  CKHYTAYDVDDWKGYQRYNFNSV  775
            CKHYTAYDVD WKG QRY FN+V
Sbjct  192  CKHYTAYDVDKWKGIQRYTFNAV  214



>dbj|BAE44362.1| alpha-L-arabinofuranosidase [Raphanus sativus]
Length=780

 Score =   315 bits (807),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 168/209 (80%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RLG
Sbjct  33   AQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVARLG  92

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IPTYEWWSEALHG+SY GPG  F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPTYEWWSEALHGVSYVGPGTRFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +V+GLQE D  +  +
Sbjct  153  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVKGLQETDSSDANR  212

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYDVD+WKG +RY+FN+V
Sbjct  213  LKVAACCKHYTAYDVDNWKGVERYSFNAV  241



>emb|CDY56487.1| BnaCnng30450D [Brassica napus]
Length=791

 Score =   315 bits (808),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 168/209 (80%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RLG
Sbjct  44   AQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVTRLG  103

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  104  IPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  163

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA  +V+GLQE D  +  +
Sbjct  164  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYATGYVKGLQETDSSDANR  223

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYDVD+WKG +RY+FN+V
Sbjct  224  LKVAACCKHYTAYDVDNWKGVERYSFNAV  252



>emb|CDY51290.1| BnaA06g23560D [Brassica napus]
Length=780

 Score =   315 bits (806),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 168/209 (80%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RLG
Sbjct  33   AQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVTRLG  92

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA  +V+GLQE D  +  +
Sbjct  153  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYATGYVKGLQETDSSDANR  212

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYDVD+WKG +RY+FN+V
Sbjct  213  LKVAACCKHYTAYDVDNWKGVERYSFNAV  241



>ref|XP_004300692.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=799

 Score =   315 bits (807),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 168/211 (80%), Gaps = 2/211 (1%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V S +   +AC    N    S PFC++ L    RVADLV+RLTL EKITFLVN+AG+VSR
Sbjct  58   VSSVSGQSFACGESGNA--SSFPFCDKSLAADARVADLVQRLTLQEKITFLVNSAGSVSR  115

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+SY GPG  F+ VVP ATSFPQP+LTAASFN +LF  IG+V+STE
Sbjct  116  LGIPKYEWWSEALHGVSYVGPGTRFSSVVPGATSFPQPILTAASFNNSLFEAIGRVVSTE  175

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP LT  Y + +VRGLQ+ D  +K
Sbjct  176  ARAMYNVGLAGLTYWSPNINIFRDPRWGRGQETPGEDPLLTSNYGSGYVRGLQQTDSEDK  235

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             +LKVAACCKHYTAYD+D+WKG  RY FN+V
Sbjct  236  SRLKVAACCKHYTAYDLDNWKGVDRYTFNAV  266



>ref|XP_009150540.1| PREDICTED: beta-D-xylosidase 4 [Brassica rapa]
Length=791

 Score =   315 bits (806),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 168/209 (80%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q+ PV+ACD   NP L +  FCN  + ++ RVADLV RLTL EKI  L +    V+RLG
Sbjct  44   AQSTPVFACDVAGNPSLAAYGFCNTAIKIEYRVADLVARLTLQEKIGVLTSKLHGVTRLG  103

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IPTYEWWSEALHG+SY GPG +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  104  IPTYEWWSEALHGVSYVGPGTHFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  163

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYA  +V+GLQE D  +  +
Sbjct  164  AMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYATRYVKGLQETDSSDANR  223

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYDVD+WKG +RY+FN+V
Sbjct  224  LKVAACCKHYTAYDVDNWKGVERYSFNAV  252



>ref|XP_010068200.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Eucalyptus grandis]
Length=777

 Score =   313 bits (801),  Expect = 9e-97, Method: Compositional matrix adjust.
 Identities = 142/204 (70%), Positives = 167/204 (82%), Gaps = 2/204 (1%)
 Frame = +2

Query  164  VYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  343
            V+ CD   +P L +  FCN    V+ RVADLVKRLTL EK+ FL N AG+V RLGIP Y+
Sbjct  43   VFPCD--GDPSLSTFGFCNMSWGVEARVADLVKRLTLQEKVGFLGNHAGSVDRLGIPEYQ  100

Query  344  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  523
            WWSEALHG+SY G G +F+ +VP ATSFPQ +LTAASFN TLF TIGKV+STEARAMHN 
Sbjct  101  WWSEALHGVSYIGGGTSFSSLVPGATSFPQVILTAASFNATLFETIGKVVSTEARAMHNV  160

Query  524  GLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAA  703
            GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KYA+ +VRGLQ+ DDGN ++LKVAA
Sbjct  161  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYASGYVRGLQQSDDGNADRLKVAA  220

Query  704  CCKHYTAYDVDDWKGYQRYNFNSV  775
            CCKHYTAYD++DWKG  RY+ N+V
Sbjct  221  CCKHYTAYDIEDWKGVDRYHINTV  244



>ref|XP_009403180.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Musa acuminata subsp. malaccensis]
Length=769

 Score =   312 bits (799),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 161/208 (77%), Gaps = 2/208 (1%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            S   P++ACD   N  L    FCN     K RV DLVKRLTL EK+ FLVN A  V RLG
Sbjct  28   SGQGPIFACDVASNRSLAGFGFCNVSWGTKQRVKDLVKRLTLQEKVGFLVNKATAVPRLG  87

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IP+YEWWSEALHG+SY GPG  F+ +VP ATSFPQ +LTAASFN TLF  IGKV+STEAR
Sbjct  88   IPSYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQVILTAASFNATLFKAIGKVVSTEAR  147

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AMHN GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYA  +VRGLQE DD   +K
Sbjct  148  AMHNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLASKYATGYVRGLQEADD--PDK  205

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNS  772
            LKVAACCKHYTAYDVD+WKG +RY FN+
Sbjct  206  LKVAACCKHYTAYDVDNWKGIERYTFNA  233



>ref|XP_010937054.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Elaeis guineensis]
Length=772

 Score =   310 bits (795),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 169/211 (80%), Gaps = 3/211 (1%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V +QT P++ACD   NP L +  FCN       RV DLV+RLTL EK+ FLVN A  VSR
Sbjct  30   VLAQT-PIFACDIASNPSLANFGFCNTSWGTAARVDDLVERLTLDEKVGFLVNKATAVSR  88

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP+YEWWSEALHG+SY GPG +F+ +VP ATSFPQ +LTAASFN TLF TIGKV+STE
Sbjct  89   LGIPSYEWWSEALHGVSYVGPGTHFSSLVPGATSFPQVILTAASFNTTLFETIGKVVSTE  148

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ+    N 
Sbjct  149  ARAMHNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLASKYAAGYVKGLQKAS--NP  206

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            ++LKVAACCKHYTAYD+D+WKG QRY F++V
Sbjct  207  DRLKVAACCKHYTAYDLDNWKGIQRYTFDAV  237



>ref|XP_003524073.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=613

 Score =   305 bits (782),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/211 (68%), Positives = 166/211 (79%), Gaps = 3/211 (1%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V+ QT   +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+AG+VSR
Sbjct  25   VRGQT---FACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAGDVSR  81

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGIP YEWWSEALHG+S  G G  F+ VVP ATSFP P+LTAASFN +LF  IG+V+STE
Sbjct  82   LGIPRYEWWSEALHGVSNVGLGTRFSNVVPGATSFPMPILTAASFNTSLFEVIGRVVSTE  141

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            A AM+N GLAGLTYWSPN+NIFRDPRWGRG E PGEDP LT KYAA +V+GLQ+ D G+ 
Sbjct  142  AGAMYNVGLAGLTYWSPNINIFRDPRWGRGLETPGEDPVLTSKYAAGYVKGLQQTDGGDP  201

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             KLKVAACCKHYTAYDVD WKG QRY FN+V
Sbjct  202  NKLKVAACCKHYTAYDVDKWKGIQRYTFNAV  232



>ref|XP_003531047.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Glycine max]
Length=765

 Score =   309 bits (791),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 164/203 (81%), Gaps = 0/203 (0%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  K+P +    FC++ L V+ RV DLV RLTL EKI  LVN+A +VSRLGIP YEW
Sbjct  30   FACDVGKSPAVAGYGFCDKSLGVEARVKDLVGRLTLQEKIGNLVNSAVDVSRLGIPKYEW  89

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F+ V+P ATSFP P+LTAASFN +LF  IG+V+STEARAM+N G
Sbjct  90   WSEALHGVSNVGPGTRFSNVIPGATSFPMPILTAASFNTSLFEVIGRVVSTEARAMYNVG  149

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
            LAGLTYWSPN+NIFRDPRWGRG E PGEDP LT KYAA +V+GLQ+ D G+  KLKVAAC
Sbjct  150  LAGLTYWSPNINIFRDPRWGRGLETPGEDPVLTSKYAAGYVKGLQQTDGGDPNKLKVAAC  209

Query  707  CKHYTAYDVDDWKGYQRYNFNSV  775
            CKHYTAYDVD+WKG QRY FN+V
Sbjct  210  CKHYTAYDVDNWKGIQRYTFNAV  232



>ref|XP_010687471.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
[Beta vulgaris subsp. vulgaris]
Length=777

 Score =   309 bits (792),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 164/206 (80%), Gaps = 0/206 (0%)
 Frame = +2

Query  158  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  337
            +P +ACDT  N  L SL FC+    V+ RVADL+ RLTL EKI +L++ A +V+RLGIP 
Sbjct  39   SPAFACDTTSNASLSSLGFCDTSKSVEARVADLIGRLTLTEKIGYLISGAASVNRLGIPK  98

Query  338  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  517
            YEWWSEALHG+S  GPG  FT VVP ATSFPQ + TAASFN TLF  IGKV+S EARAM+
Sbjct  99   YEWWSEALHGVSNVGPGTRFTSVVPGATSFPQVITTAASFNTTLFQAIGKVVSNEARAMY  158

Query  518  NYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKV  697
            N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KY +A+VRGLQ+ DD +  KLKV
Sbjct  159  NTGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLSSKYGSAYVRGLQQTDDADPNKLKV  218

Query  698  AACCKHYTAYDVDDWKGYQRYNFNSV  775
            AACCKHYTAYDVD+WK   RY+FN++
Sbjct  219  AACCKHYTAYDVDNWKSVDRYHFNAL  244



>ref|XP_002873418.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49677.1| beta-xylosidase 3 [Arabidopsis lyrata subsp. lyrata]
Length=780

 Score =   309 bits (791),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 142/209 (68%), Positives = 167/209 (80%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q++PV+ACD   NP L  L FCN  L++K+RV DLV RLTL EKI FL + A  VSRLG
Sbjct  33   AQSSPVFACDVTGNPSLAGLRFCNTGLNIKSRVTDLVGRLTLEEKIGFLGSNAIGVSRLG  92

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IP Y+WWSEALHG+S  G G +F+G VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPAYKWWSEALHGVSNVGGGSSFSGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KYA A+VRGLQE D G+  +
Sbjct  153  AMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPELSSKYAVAYVRGLQETDGGDPNR  212

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYDVD+WK   R+ FN+V
Sbjct  213  LKVAACCKHYTAYDVDNWKDVHRFTFNAV  241



>ref|XP_010452969.1| PREDICTED: beta-D-xylosidase 3-like [Camelina sativa]
Length=779

 Score =   308 bits (789),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 166/209 (79%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q++PV+ACD  +NP L +L FCN  L +K RV DLV RLTL EKI FL + A  VSRLG
Sbjct  33   AQSSPVFACDVTRNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRLG  92

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IP Y WWSEALHG+S  G G NF+G +  ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPDYNWWSEALHGVSNVGSGTNFSGQIRGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDPTL+ KYA A+V+GLQE D G+  +
Sbjct  153  AMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQEADGGDPNR  212

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYDVD+W    R+ FN+V
Sbjct  213  LKVAACCKHYTAYDVDNWTDVHRFTFNAV  241



>ref|XP_004301992.1| PREDICTED: beta-xylosidase/alpha-L-arabinofuranosidase 2-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=774

 Score =   308 bits (789),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 168/212 (79%), Gaps = 3/212 (1%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V S +   YAC    N   +S PFC++ L V  RVADLV+RLTL EKITFLV+ AGNVSR
Sbjct  32   VSSVSGQSYACGDGFNA--RSFPFCDKSLAVDARVADLVQRLTLQEKITFLVDAAGNVSR  89

Query  323  LGIPTYEWWSEALHGLSYTGPG-VNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            LGIPTY+WWSEALHG+S  G G   FT +VP ATSFPQP+LTAASFN +LF  IG+V+ST
Sbjct  90   LGIPTYQWWSEALHGVSKVGRGGTKFTELVPGATSFPQPILTAASFNNSLFEAIGRVVST  149

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGN  679
            EARAM+N GLAGLTYW+PN+NIFRDPRWGRGQE PGEDP LT  Y A +VRGLQ+ D  +
Sbjct  150  EARAMYNVGLAGLTYWAPNINIFRDPRWGRGQETPGEDPLLTSNYGAGYVRGLQQTDSQD  209

Query  680  KEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            K +LKVAACCKHYTAYD+D WKGY RY FN+V
Sbjct  210  KNRLKVAACCKHYTAYDLDHWKGYDRYTFNAV  241



>ref|NP_196535.1| beta-xylosidase 3 [Arabidopsis thaliana]
 sp|Q9LXD6.1|BXL3_ARATH RecName: Full=Beta-D-xylosidase 3; Short=AtBXL3; AltName: Full=Alpha-L-arabinofuranosidase; 
Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB89357.1| beta-xylosidase-like protein [Arabidopsis thaliana]
 dbj|BAB09531.1| beta-xylosidase [Arabidopsis thaliana]
 gb|AAK96639.1| AT5g09730/F17I14_80 [Arabidopsis thaliana]
 gb|AED91439.1| beta-xylosidase 3 [Arabidopsis thaliana]
Length=773

 Score =   308 bits (788),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 165/209 (79%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q++PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI FL + A  VSRLG
Sbjct  28   NQSSPVFACDVTGNPSLAGLRFCNAGLSIKARVTDLVGRLTLEEKIGFLTSKAIGVSRLG  87

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IP+Y+WWSEALHG+S  G G  FTG VP ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  88   IPSYKWWSEALHGVSNVGGGSRFTGQVPGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  147

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL+ KYA A+V+GLQE D G+  +
Sbjct  148  AMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQETDGGDPNR  207

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYD+D+W+   R  FN+V
Sbjct  208  LKVAACCKHYTAYDIDNWRNVNRLTFNAV  236



>ref|XP_006827121.1| PREDICTED: beta-D-xylosidase 4 [Amborella trichopoda]
 gb|ERM94358.1| hypothetical protein AMTR_s00010p00246460 [Amborella trichopoda]
Length=769

 Score =   308 bits (788),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 165/205 (80%), Gaps = 0/205 (0%)
 Frame = +2

Query  158  APVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPT  337
            +PV+ACDT K+P + S  FCN  L +  RV DLV+RLTL EKI FLVN    VSRLGIP 
Sbjct  29   SPVFACDTSKDPSVGSYGFCNGSLGLSERVQDLVQRLTLSEKIGFLVNKGVGVSRLGIPA  88

Query  338  YEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  517
            YEWWSEALHG+SY GPG +F+G+VP ATSFPQ + + ASFN +L+  IGKV+STEARAM+
Sbjct  89   YEWWSEALHGVSYVGPGTHFSGLVPGATSFPQVIHSVASFNSSLWEAIGKVVSTEARAMY  148

Query  518  NYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKV  697
            N GLAGLT+WSPN+NIFRDPRWGRGQE  GEDP LT KYA  +V+GLQ  DDG+  +LKV
Sbjct  149  NVGLAGLTFWSPNINIFRDPRWGRGQETAGEDPLLTSKYAVGYVKGLQSSDDGDPNRLKV  208

Query  698  AACCKHYTAYDVDDWKGYQRYNFNS  772
            AACCKHYTAYD+D+WKG  R++FN+
Sbjct  209  AACCKHYTAYDLDNWKGVDRFHFNA  233



>emb|CDY01780.1| BnaC06g28200D [Brassica napus]
Length=776

 Score =   308 bits (788),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 162/207 (78%), Gaps = 0/207 (0%)
 Frame = +2

Query  155  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  334
            ++P +ACD  +NP L    FCN  L  + RV DLV RLTL EKI FLV+ A  VSRLGIP
Sbjct  36   SSPEFACDITRNPSLAGYGFCNTGLKAEARVTDLVGRLTLEEKIGFLVSKATGVSRLGIP  95

Query  335  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAM  514
             Y WWSEALHG+S  G G NFTG VP ATSFPQ +LTAASFN +LF  IGKV+STEARAM
Sbjct  96   DYNWWSEALHGVSDVGGGSNFTGPVPGATSFPQVILTAASFNLSLFQAIGKVVSTEARAM  155

Query  515  HNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLK  694
            +N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTLT KYA A+V+GLQ  D G+  +LK
Sbjct  156  YNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLTSKYAVAYVKGLQGTDGGDPNRLK  215

Query  695  VAACCKHYTAYDVDDWKGYQRYNFNSV  775
            VAACCKHYTAYDVD+WKG  RY FNSV
Sbjct  216  VAACCKHYTAYDVDNWKGVHRYTFNSV  242



>gb|EYU18508.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=770

 Score =   306 bits (784),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 166/205 (81%), Gaps = 1/205 (0%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P +ACD  KNP LKS  FCN  LD+ TRVADLV +LTL EKI ++V+ +  V+RLGIP Y
Sbjct  33   PPFACDVSKNPDLKSFTFCNPSLDIDTRVADLVNKLTLKEKIGWVVSGSEGVTRLGIPGY  92

Query  341  EWWSEALHGLSYTGPGVNF-TGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  517
            EWWSEALHG+   GPGV F    VPAATSFPQ +LTAASFN +LFH IGK +STEARAMH
Sbjct  93   EWWSEALHGIGSNGPGVVFDQNNVPAATSFPQVILTAASFNVSLFHLIGKAVSTEARAMH  152

Query  518  NYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKV  697
            N G AGLT+WSPN+NIFRDPRWGRGQE PGEDP L+G+YA A+V+ LQ+RDDG++ +LKV
Sbjct  153  NVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSGQYAVAYVKALQQRDDGDQTRLKV  212

Query  698  AACCKHYTAYDVDDWKGYQRYNFNS  772
            AACCKHYTAYD+D WKG+ R  F++
Sbjct  213  AACCKHYTAYDLDHWKGFDRLTFDA  237



>gb|EYU18507.1| hypothetical protein MIMGU_mgv1a001685mg [Erythranthe guttata]
Length=773

 Score =   306 bits (784),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 140/205 (68%), Positives = 166/205 (81%), Gaps = 1/205 (0%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P +ACD  KNP LKS  FCN  LD+ TRVADLV +LTL EKI ++V+ +  V+RLGIP Y
Sbjct  33   PPFACDVSKNPDLKSFTFCNPSLDIDTRVADLVNKLTLKEKIGWVVSGSEGVTRLGIPGY  92

Query  341  EWWSEALHGLSYTGPGVNF-TGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMH  517
            EWWSEALHG+   GPGV F    VPAATSFPQ +LTAASFN +LFH IGK +STEARAMH
Sbjct  93   EWWSEALHGIGSNGPGVVFDQNNVPAATSFPQVILTAASFNVSLFHLIGKAVSTEARAMH  152

Query  518  NYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKV  697
            N G AGLT+WSPN+NIFRDPRWGRGQE PGEDP L+G+YA A+V+ LQ+RDDG++ +LKV
Sbjct  153  NVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSGQYAVAYVKALQQRDDGDQTRLKV  212

Query  698  AACCKHYTAYDVDDWKGYQRYNFNS  772
            AACCKHYTAYD+D WKG+ R  F++
Sbjct  213  AACCKHYTAYDLDHWKGFDRLTFDA  237



>ref|XP_006399455.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
 gb|ESQ40908.1| hypothetical protein EUTSA_v10012739mg [Eutrema salsugineum]
Length=779

 Score =   306 bits (783),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 142/215 (66%), Positives = 166/215 (77%), Gaps = 0/215 (0%)
 Frame = +2

Query  131  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  310
            I  P  +Q++PV+ACD   NP L    FCN  L  + RV DLV RLTL EKI FL + A 
Sbjct  27   ISEPSNAQSSPVFACDITGNPSLAGFGFCNTELKAEDRVTDLVGRLTLEEKIGFLGSRAN  86

Query  311  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  490
             VSRLGIP Y WWSEALHG+S  G G NF+G VP ATSFPQ +LTAASFN +LF  IGKV
Sbjct  87   GVSRLGIPPYNWWSEALHGVSDVGHGTNFSGQVPGATSFPQVILTAASFNVSLFEAIGKV  146

Query  491  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERD  670
            +STEARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDPTLT KYA A+V+GLQ+ +
Sbjct  147  VSTEARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLTSKYAVAYVKGLQDTE  206

Query  671  DGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
              +  +LKVAACCKHYTAYDVD+W+  QRY F++V
Sbjct  207  GEDPNRLKVAACCKHYTAYDVDNWQNVQRYTFDAV  241



>ref|XP_010422951.1| PREDICTED: beta-D-xylosidase 3 isoform X2 [Camelina sativa]
Length=752

 Score =   304 bits (779),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 164/209 (78%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q++PV+ACD   NP L +L FCN  L +K RV DLV RLTL EKI FL + A  VSRLG
Sbjct  48   AQSSPVFACDVTGNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRLG  107

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  108  IPAYNWWSEALHGVSYIGGGSGFSGQVHGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  167

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL+ KYA A+V+GLQE D G+  +
Sbjct  168  AMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQETDGGDPNR  227

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYDVD+W    R+ FN+V
Sbjct  228  LKVAACCKHYTAYDVDNWTDVHRFTFNAV  256



>gb|KFK25272.1| hypothetical protein AALP_AA8G090500 [Arabis alpina]
Length=772

 Score =   304 bits (779),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 140/212 (66%), Positives = 165/212 (78%), Gaps = 0/212 (0%)
 Frame = +2

Query  140  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  319
            P+ ++++PV+ACD  K+       FCN  LDV++RV+DLV RLTL EKI FLV+ A  VS
Sbjct  27   PLNAKSSPVFACDVDKDISFSGFRFCNTELDVQSRVSDLVGRLTLEEKIGFLVSRAKGVS  86

Query  320  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            RLGIP Y WWSEALHG+S  GPG  F+G VP ATSFPQ +LTAASFN +LF  IGK +ST
Sbjct  87   RLGIPDYNWWSEALHGVSNVGPGSYFSGQVPGATSFPQVILTAASFNVSLFQAIGKAVST  146

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGN  679
            EARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDP LT KYA A+V+GLQE D  +
Sbjct  147  EARAMYNVGQAGLTFWSPNVNIFRDPRWGRGQETPGEDPMLTSKYAVAYVKGLQEADGED  206

Query  680  KEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
              +LKVAACCKHYTAYDVD+WK   R  FN+V
Sbjct  207  PNRLKVAACCKHYTAYDVDNWKNVNRLTFNAV  238



>ref|XP_010422950.1| PREDICTED: beta-D-xylosidase 3 isoform X1 [Camelina sativa]
Length=794

 Score =   305 bits (780),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 164/209 (78%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q++PV+ACD   NP L +L FCN  L +K RV DLV RLTL EKI FL + A  VSRLG
Sbjct  48   AQSSPVFACDVTGNPSLAALGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSKAVGVSRLG  107

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  108  IPAYNWWSEALHGVSYIGGGSGFSGQVHGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  167

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL+ KYA A+V+GLQE D G+  +
Sbjct  168  AMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQETDGGDPNR  227

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYDVD+W    R+ FN+V
Sbjct  228  LKVAACCKHYTAYDVDNWTDVHRFTFNAV  256



>ref|XP_010491611.1| PREDICTED: beta-D-xylosidase 3-like isoform X2 [Camelina sativa]
Length=765

 Score =   303 bits (776),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 163/209 (78%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q++PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI FL + A  VSRLG
Sbjct  33   AQSSPVFACDVTGNPSLAVLGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSRAVGVSRLG  92

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPDYNWWSEALHGVSYIGGGSGFSGQVRGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL+ KYA A+V+GLQE D G+  +
Sbjct  153  AMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQEADGGDPNR  212

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYDVD+W    R+ FN+V
Sbjct  213  LKVAACCKHYTAYDVDNWTDVHRFTFNAV  241



>ref|XP_010491610.1| PREDICTED: beta-D-xylosidase 3-like isoform X1 [Camelina sativa]
Length=779

 Score =   303 bits (777),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/209 (67%), Positives = 163/209 (78%), Gaps = 0/209 (0%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +Q++PV+ACD   NP L  L FCN  L +K RV DLV RLTL EKI FL + A  VSRLG
Sbjct  33   AQSSPVFACDVTGNPSLAVLGFCNTGLKIKARVTDLVGRLTLEEKIGFLGSRAVGVSRLG  92

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            IP Y WWSEALHG+SY G G  F+G V  ATSFPQ +LTAASFN +LF  IGKV+STEAR
Sbjct  93   IPDYNWWSEALHGVSYIGGGSGFSGQVRGATSFPQVILTAASFNVSLFQAIGKVVSTEAR  152

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL+ KYA A+V+GLQE D G+  +
Sbjct  153  AMYNVGSAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQEADGGDPNR  212

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            LKVAACCKHYTAYDVD+W    R+ FN+V
Sbjct  213  LKVAACCKHYTAYDVDNWTDVHRFTFNAV  241



>gb|KJB77499.1| hypothetical protein B456_012G140300 [Gossypium raimondii]
Length=776

 Score =   303 bits (776),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 141/213 (66%), Positives = 169/213 (79%), Gaps = 2/213 (1%)
 Frame = +2

Query  143  VQSQTAP-VYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  319
            V  Q +P V+ACD  K+  +    FCN  L    RVADLV+RLTL EKI  +VN AGN+S
Sbjct  29   VVGQVSPAVFACDATKDRKVVHYGFCNASLGRDARVADLVRRLTLQEKILNIVNGAGNIS  88

Query  320  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            RLGIP YEWWSEALHG+S  GPG NF+ +VP ATSFPQ +LTAASFN +LF  IGKV+ST
Sbjct  89   RLGIPKYEWWSEALHGVSNVGPGTNFSSLVPGATSFPQVILTAASFNTSLFEAIGKVVST  148

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDD-G  676
            EARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY +++V+GLQ+ DD  
Sbjct  149  EARAMYNVGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYGSSYVKGLQQTDDNA  208

Query  677  NKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            +  +LKVAACCKHYTAYD+D+WKG  RY+FN+V
Sbjct  209  DPSRLKVAACCKHYTAYDLDNWKGVDRYHFNAV  241



>ref|XP_009105246.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   303 bits (775),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 165/216 (76%), Gaps = 1/216 (0%)
 Frame = +2

Query  131  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  307
            I  P  +Q++ PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI FLV+ +
Sbjct  27   ISKPSNAQSSSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKS  86

Query  308  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  487
              VSRLGIP Y WWSEALHG+S  G G +FTG+VP ATSFPQ  LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVKLTAASFNASLFQAIGK  146

Query  488  VISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQER  667
            V+STEARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL  KYA A+V+GLQ  
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQGT  206

Query  668  DDGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            D G+  +LKVAACCKHYTAYDVD+WK   RY FNSV
Sbjct  207  DGGDPNRLKVAACCKHYTAYDVDNWKDVSRYTFNSV  242



>emb|CDY35825.1| BnaC09g37570D [Brassica napus]
Length=774

 Score =   302 bits (774),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 145/216 (67%), Positives = 164/216 (76%), Gaps = 1/216 (0%)
 Frame = +2

Query  131  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  307
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  308  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  487
              VSRLGIP Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  488  VISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQER  667
            V+STEARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL  KYA A+V+GLQ  
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQGT  206

Query  668  DDGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            D G+   LKVAACCKHYTAYDVD+WKG  RY FNSV
Sbjct  207  DGGDPNLLKVAACCKHYTAYDVDNWKGVSRYTFNSV  242



>emb|CDY21595.1| BnaC09g46970D [Brassica napus]
Length=942

 Score =   306 bits (783),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 165/216 (76%), Gaps = 1/216 (0%)
 Frame = +2

Query  131  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  307
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPKFACDVTKNPSLTGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  308  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  487
              VSRLGIP Y WWSEALHG+S  G G NFTG VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSNFTGPVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  488  VISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQER  667
            V+STEARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL  KYA A+V+GLQ  
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQGT  206

Query  668  DDGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            D G+   LKVAACCKHYTAYDVD+WKG  RY FNSV
Sbjct  207  DGGDPNLLKVAACCKHYTAYDVDNWKGVHRYTFNSV  242



>emb|CDX97115.1| BnaC09g45100D [Brassica napus]
Length=695

 Score =   300 bits (769),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 144/215 (67%), Positives = 163/215 (76%), Gaps = 1/215 (0%)
 Frame = +2

Query  131  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  307
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ITKPSNAQSSSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  308  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  487
              VSRLGIP Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  488  VISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQER  667
            V+STEARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL  KYA A+V+GLQ  
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQGT  206

Query  668  DDGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
            D G+   LKVAACCKHYTAYDVD+WKG  RY FNS
Sbjct  207  DGGDPNLLKVAACCKHYTAYDVDNWKGVSRYTFNS  241



>emb|CDX69892.1| BnaA10g22410D [Brassica napus]
Length=774

 Score =   301 bits (771),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 164/216 (76%), Gaps = 1/216 (0%)
 Frame = +2

Query  131  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  307
            I  P  +Q++ P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A
Sbjct  27   ISKPSNAQSSSPKFACDVTKNPSLAGYGFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKA  86

Query  308  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  487
              VSRLGIP Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  488  VISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQER  667
            V+STEARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL  KYA A+V+GLQ  
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQGT  206

Query  668  DDGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            D G+   LKVAACCKHYTAYDVD+WKG  RY FNS+
Sbjct  207  DGGDPNLLKVAACCKHYTAYDVDNWKGVSRYTFNSL  242



>gb|KHG02719.1| Beta-xylosidase/alpha-L-arabinofuranosidase 2 [Gossypium arboreum]
Length=776

 Score =   301 bits (770),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 138/205 (67%), Positives = 165/205 (80%), Gaps = 1/205 (0%)
 Frame = +2

Query  164  VYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  343
            V+ACD  K+  +    FCN  L    RVADLV+RLTL EKI  +VN AGN+SRLGIP YE
Sbjct  37   VFACDATKDRKVVHYGFCNASLGRDARVADLVRRLTLQEKILNIVNGAGNISRLGIPKYE  96

Query  344  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  523
            WWSEALHG+S  GPG NF+ +VP ATSFPQ +LTAASFN +LF  IGKV+STEARAM+N 
Sbjct  97   WWSEALHGVSNIGPGTNFSSLVPGATSFPQVILTAASFNTSLFEAIGKVVSTEARAMYNV  156

Query  524  GLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDD-GNKEKLKVA  700
            GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ KY +++V+GLQ+ DD  +  +LKVA
Sbjct  157  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSKYGSSYVKGLQQPDDNADPSRLKVA  216

Query  701  ACCKHYTAYDVDDWKGYQRYNFNSV  775
            ACCKHYTAYD+D+WKG  RY+FN+V
Sbjct  217  ACCKHYTAYDLDNWKGVDRYHFNAV  241



>ref|XP_010491609.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   301 bits (770),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/212 (63%), Positives = 164/212 (77%), Gaps = 0/212 (0%)
 Frame = +2

Query  140  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  319
            P  +Q+ P +AC+   N  L    FCN ++ +++RVADLV RLTL EKI FL ++    S
Sbjct  28   PSNAQSLPAFACNVAGNNSLAGFGFCNTKIKIESRVADLVGRLTLQEKIKFLGSSGNGAS  87

Query  320  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            RLGIPTYEWW+EALHG+S+ GP   F+ +VP+AT FPQ +LTAASFN +LF  IGK +ST
Sbjct  88   RLGIPTYEWWAEALHGVSFIGPATRFSKLVPSATCFPQVILTAASFNVSLFKAIGKAVST  147

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGN  679
            EARAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDPTL+ KYA A+V+GLQE D G+
Sbjct  148  EARAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQETDGGD  207

Query  680  KEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
              +LKV ACCKH TAYD++ WKG  RY FN+V
Sbjct  208  PNRLKVGACCKHSTAYDLEKWKGVSRYTFNAV  239



>ref|XP_009122535.1| PREDICTED: beta-D-xylosidase 3-like [Brassica rapa]
Length=774

 Score =   300 bits (768),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 160/207 (77%), Gaps = 0/207 (0%)
 Frame = +2

Query  155  TAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIP  334
            ++P +ACD  KNP L    FCN  L+ + RV DLV RLTL EKI FLV+ A  VSRLGIP
Sbjct  36   SSPKFACDDTKNPSLAGYRFCNTGLNAEARVTDLVGRLTLEEKIGFLVSKATGVSRLGIP  95

Query  335  TYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAM  514
             Y WWSEALHG+S  G G +F G VP ATSFPQ +LTAASFN +LF  IGKV+STEARAM
Sbjct  96   DYNWWSEALHGVSDVGDGSSFKGPVPGATSFPQVILTAASFNVSLFQAIGKVVSTEARAM  155

Query  515  HNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLK  694
            +N G AGLT+W+PN+NIFRDPRWGRGQE PGEDPTL  KYA A+V+GLQ  D G+   LK
Sbjct  156  YNVGAAGLTFWAPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQGTDGGDPNLLK  215

Query  695  VAACCKHYTAYDVDDWKGYQRYNFNSV  775
            VAACCKHYTAYDVD+WKG  RY FNSV
Sbjct  216  VAACCKHYTAYDVDNWKGVSRYTFNSV  242



>ref|XP_010424711.1| PREDICTED: beta-D-xylosidase 4-like [Camelina sativa]
Length=780

 Score =   300 bits (768),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 135/205 (66%), Positives = 160/205 (78%), Gaps = 0/205 (0%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P +AC+   N  L    FCN +L ++ RVADLV RLTL EK+ FL ++    SRLGIPTY
Sbjct  35   PAFACNVAGNNSLARFGFCNTKLKIERRVADLVGRLTLQEKVRFLGSSGNGASRLGIPTY  94

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWW+EALHG+S+ GP   FT +VP+AT FPQ +LTAASFN +LF  IGK +STEARAM+N
Sbjct  95   EWWAEALHGVSFIGPATRFTKLVPSATCFPQVILTAASFNVSLFKAIGKAVSTEARAMYN  154

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             GLAGLTYWSPN+NIFRDPRWGRGQE PGEDPTL+ KYA A+V+GLQE D GN  +LKVA
Sbjct  155  VGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLSSKYAVAYVKGLQETDSGNPNRLKVA  214

Query  701  ACCKHYTAYDVDDWKGYQRYNFNSV  775
            ACCKH TAYD++ WKG  RY FN+V
Sbjct  215  ACCKHSTAYDLEKWKGVSRYTFNAV  239



>emb|CDX96113.1| BnaA07g26180D [Brassica napus]
Length=1013

 Score =   304 bits (778),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 144/216 (67%), Positives = 166/216 (77%), Gaps = 1/216 (0%)
 Frame = +2

Query  131  IIGPVQSQTA-PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  307
            I  P  +Q++ PV+ACD + NP L    FCN  L  + RV DLV RLTL EKI FLV+ +
Sbjct  27   ISKPSNAQSSSPVFACDVITNPSLAGYGFCNTGLKAEARVTDLVGRLTLVEKIGFLVSKS  86

Query  308  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  487
              VSRLGIP Y WWSEALHG+S  G G +FTG+VP ATSFPQ +LTAASFN +LF  IGK
Sbjct  87   TGVSRLGIPDYNWWSEALHGVSDVGGGSSFTGLVPGATSFPQVILTAASFNVSLFQAIGK  146

Query  488  VISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQER  667
            V+STEARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDPTL  KYA A+V+GLQ  
Sbjct  147  VVSTEARAMYNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPTLVSKYAVAYVKGLQGT  206

Query  668  DDGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            D G+  +LKVAACCKHYTAYDVD+WK   RY FNSV
Sbjct  207  DGGDPNRLKVAACCKHYTAYDVDNWKDVSRYTFNSV  242


 Score = 58.9 bits (141),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  686  KLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            +LKVAACCKHYTAYDVD+WK   RY FNSV
Sbjct  452  RLKVAACCKHYTAYDVDNWKDVSRYTFNSV  481


 Score = 30.8 bits (68),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 14/21 (67%), Gaps = 0/21 (0%)
 Frame = +3

Query  783  FLS*VTAQDMADTYQPPFEYC  845
            F S V  QDM DT+QPPF  C
Sbjct  478  FNSVVNQQDMDDTFQPPFRSC  498



>dbj|BAJ89945.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=525

 Score =   291 bits (745),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/214 (64%), Positives = 161/214 (75%), Gaps = 4/214 (2%)
 Frame = +2

Query  137  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  316
            G  ++Q APV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    +
Sbjct  28   GTAEAQ-APVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  317  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  496
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVS  145

Query  497  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDG  676
            TEARAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP LT KYA  +V GLQ+   G
Sbjct  146  TEARAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLTSKYAVGYVTGLQDAGAG  205

Query  677  --NKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
                  LKVAACCKHYTAYDVD+WKG +RY F++
Sbjct  206  GVTDGALKVAACCKHYTAYDVDNWKGVERYTFDA  239



>ref|XP_002448619.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
 gb|EES12947.1| hypothetical protein SORBIDRAFT_06g030270 [Sorghum bicolor]
Length=767

 Score =   291 bits (746),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 162/210 (77%), Gaps = 3/210 (1%)
 Frame = +2

Query  146  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  325
            ++QT PV+ACD   N  L S  FCN+      R ADLV RLTL EK+ FLV+    + RL
Sbjct  28   RAQT-PVFACDA-SNATLASYGFCNRSASASARAADLVSRLTLAEKVGFLVDKQAALPRL  85

Query  326  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  505
            GIP YEWWSEALHG+SY GPG  F+ +VPAATSFPQP+LTAASFN TLF  IG+V+S EA
Sbjct  86   GIPLYEWWSEALHGVSYVGPGTRFSSLVPAATSFPQPILTAASFNATLFRAIGEVVSNEA  145

Query  506  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKE  685
            RAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP LT KYA  +V GLQ+   G+  
Sbjct  146  RAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLTSKYAVGYVTGLQDAGSGSGS  205

Query  686  KLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             LKVAACCKHYTAYDVD+WKG +RY FN+V
Sbjct  206  -LKVAACCKHYTAYDVDNWKGVERYTFNAV  234



>ref|XP_010657638.1| PREDICTED: beta-D-xylosidase 4-like [Vitis vinifera]
Length=242

 Score =   276 bits (706),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 145/168 (86%), Gaps = 0/168 (0%)
 Frame = +2

Query  245  VADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATS  424
            VADLVKRLTL EKI FLVN+A  VSRLGIP YEWWS+ALHG+SY GPG +F  VVP ATS
Sbjct  71   VADLVKRLTLEEKIGFLVNSAARVSRLGIPKYEWWSQALHGVSYVGPGTHFNSVVPGATS  130

Query  425  FPQPLLTAASFNETLFHTIGKVISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVP  604
            FPQ +L AASF  +LF  IGKV+STEARAM+N GLAGLT+WSPN+NIF+DPRWGRGQE P
Sbjct  131  FPQVILPAASFYASLFEAIGKVVSTEARAMYNVGLAGLTFWSPNVNIFQDPRWGRGQETP  190

Query  605  GEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAACCKHYTAYDVDDWKG  748
            GEDP L+ KYA+ +VRGLQ+ DDG+ ++LKVAACCKHYTAYD+D+WKG
Sbjct  191  GEDPLLSSKYASGYVRGLQQSDDGSPDRLKVAACCKHYTAYDLDNWKG  238



>gb|EYU18509.1| hypothetical protein MIMGU_mgv1a001665mg [Erythranthe guttata]
Length=777

 Score =   291 bits (745),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 138/215 (64%), Positives = 167/215 (78%), Gaps = 2/215 (1%)
 Frame = +2

Query  134  IGPVQSQTAP-VYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  310
            I PV S   P  +ACD  KNP L+S  FCN  LD++TRVADLV +LTL EKI ++++ + 
Sbjct  27   ITPVFSAGKPGPFACDVSKNPDLESFTFCNPSLDIETRVADLVNKLTLKEKIGWVISGSE  86

Query  311  NVSRLGIPTYEWWSEALHGLSYTGPGVNFT-GVVPAATSFPQPLLTAASFNETLFHTIGK  487
             VSRLGIP Y WWSEALHG+   GPG  F    V AATSFPQ +LTAASFN +LFH IGK
Sbjct  87   GVSRLGIPGYWWWSEALHGIGSNGPGSKFEPDNVRAATSFPQVILTAASFNVSLFHLIGK  146

Query  488  VISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQER  667
             ISTEARAMHN G AGLT+WSPN+NIFRDPRWGRGQE PGEDP L+ +YA A+V+ LQ+R
Sbjct  147  AISTEARAMHNVGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLSSQYAVAYVKALQQR  206

Query  668  DDGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
            DDG++ +LKVAACCKHYTAYD++ WK + R+ F++
Sbjct  207  DDGDQTRLKVAACCKHYTAYDLEHWKEFDRFTFDA  241



>ref|XP_004976989.1| PREDICTED: beta-D-xylosidase 4-like isoform X2 [Setaria italica]
Length=770

 Score =   291 bits (744),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 156/206 (76%), Gaps = 2/206 (1%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            PV+ACD   N  L +  FCN+      R ADLV RL L EK+ FLV+    + RLGIP Y
Sbjct  33   PVFACDA-SNATLAAYGFCNRSATPAARAADLVSRLKLAEKVGFLVDKQAALPRLGIPAY  91

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF  IG+V+S EARAMHN
Sbjct  92   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNVTLFRAIGEVVSNEARAMHN  151

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDG-NKEKLKV  697
             GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP LT KYA  +V GLQ+   G   + LKV
Sbjct  152  VGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLTSKYAVGYVTGLQDAGSGAGGDSLKV  211

Query  698  AACCKHYTAYDVDDWKGYQRYNFNSV  775
            AACCKHYTAYDVD+WKG +RY FN+V
Sbjct  212  AACCKHYTAYDVDNWKGVERYTFNAV  237



>gb|AFW59619.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=451

 Score =   282 bits (722),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 155/211 (73%), Gaps = 2/211 (1%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V     P +ACD   N  L S  FCN+      R ADLV RLTL EK+ FLV+    + R
Sbjct  32   VARAQTPAFACD-ASNATLASYGFCNRSAAAAARAADLVSRLTLAEKVGFLVDKQAALPR  90

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LG+P YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF  IG+V+S E
Sbjct  91   LGVPLYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNATLFRAIGEVVSNE  150

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP LT KYA  +V GLQ    G  
Sbjct  151  ARAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLTSKYAVGYVTGLQGAVSG-A  209

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
              LKVAACCKHYTAYDVD+WKG +RY F++V
Sbjct  210  GALKVAACCKHYTAYDVDNWKGVERYTFDAV  240



>dbj|BAJ90315.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   290 bits (741),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 160/214 (75%), Gaps = 4/214 (2%)
 Frame = +2

Query  137  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  316
            G  ++Q APV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    +
Sbjct  28   GTAEAQ-APVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  317  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  496
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVS  145

Query  497  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDG  676
            TEARAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KYA  +V GLQ+   G
Sbjct  146  TEARAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYAVGYVTGLQDAGAG  205

Query  677  N--KEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
                  LKVAACCKHYTAYDVD+WKG +RY F++
Sbjct  206  GVTDGALKVAACCKHYTAYDVDNWKGVERYTFDA  239



>dbj|BAJ90420.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96778.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK08165.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=775

 Score =   290 bits (741),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 137/214 (64%), Positives = 160/214 (75%), Gaps = 4/214 (2%)
 Frame = +2

Query  137  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  316
            G  ++Q APV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    +
Sbjct  28   GTAEAQ-APVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPAL  85

Query  317  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  496
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S
Sbjct  86   GRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVS  145

Query  497  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDG  676
            TEARAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KYA  +V GLQ+   G
Sbjct  146  TEARAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYAVGYVTGLQDAGAG  205

Query  677  N--KEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
                  LKVAACCKHYTAYDVD+WKG +RY F++
Sbjct  206  GVTDGALKVAACCKHYTAYDVDNWKGVERYTFDA  239



>ref|NP_001054038.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAE02971.2| OSJNBb0079B02.3 [Oryza sativa Japonica Group]
 dbj|BAF15952.1| Os04g0640700 [Oryza sativa Japonica Group]
 emb|CAH67823.1| OSIGBa0138H21-OSIGBa0138E01.14 [Oryza sativa Indica Group]
 gb|EEC78109.1| hypothetical protein OsI_17615 [Oryza sativa Indica Group]
Length=765

 Score =   289 bits (739),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 160/210 (76%), Gaps = 3/210 (1%)
 Frame = +2

Query  146  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  325
            ++QT PV+ACD   N  +    FC++      R ADL+ RLTL EK+ FLVN    + RL
Sbjct  25   RAQT-PVFACDA-SNATVSGYGFCDRTKSSAARAADLLGRLTLAEKVGFLVNKQAALPRL  82

Query  326  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  505
            GIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+STEA
Sbjct  83   GIPAYEWWSEALHGVSYVGPGTRFSTLVPGATSFPQPILTAASFNASLFRAIGEVVSTEA  142

Query  506  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKE  685
            RAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KYA  +V GLQ+   G  +
Sbjct  143  RAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYAVGYVTGLQDA-GGGSD  201

Query  686  KLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             LKVAACCKHYTAYDVD+WKG +RY F++V
Sbjct  202  ALKVAACCKHYTAYDVDNWKGVERYTFDAV  231



>emb|CDO97479.1| unnamed protein product [Coffea canephora]
Length=706

 Score =   287 bits (735),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 149/170 (88%), Gaps = 0/170 (0%)
 Frame = +2

Query  266  LTLPEKITFLVNTAGNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLT  445
            LTL EK+  LV+ A  VSRLGIP YEWWSE LHG+S TGPGV+FT +VP ATSFPQ +LT
Sbjct  2    LTLQEKVANLVDGAAGVSRLGIPKYEWWSEILHGVSNTGPGVHFTSLVPGATSFPQVILT  61

Query  446  AASFNETLFHTIGKVISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLT  625
            AASFN++LF  IGKV+STE RAM+N GLAGLTYWSPN+NIFRDPRWGRGQE PGEDPTLT
Sbjct  62   AASFNKSLFEIIGKVVSTEGRAMYNVGLAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLT  121

Query  626  GKYAAAFVRGLQERDDGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
              YAAAFVRGLQ+RDDG+K++LKVA+CCKHYTAYD+D+WKG QRY FN++
Sbjct  122  SNYAAAFVRGLQQRDDGDKDRLKVASCCKHYTAYDLDNWKGIQRYTFNAL  171



>gb|AAK38481.1| alpha-L-arabinofuranosidase/beta-D-xylosidase isoenzyme ARA-I 
[Hordeum vulgare]
Length=777

 Score =   288 bits (736),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 134/206 (65%), Positives = 155/206 (75%), Gaps = 3/206 (1%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            PV+ACD   N  L +  FCN++     R  DLV RLTL EK+ FLVN    + RLGIP Y
Sbjct  37   PVFACD-ASNATLAAYGFCNRKATASARARDLVSRLTLAEKVGFLVNKQPALGRLGIPAY  95

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+STEARAMHN
Sbjct  96   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVSTEARAMHN  155

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDG--NKEKLK  694
             GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KYA  +V GLQ+   G      LK
Sbjct  156  VGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYAVGYVTGLQDAGAGGVTDGALK  215

Query  695  VAACCKHYTAYDVDDWKGYQRYNFNS  772
            VAACCKHYTAYDVD+WKG +RY F++
Sbjct  216  VAACCKHYTAYDVDNWKGVERYTFDA  241



>gb|KHG24361.1| Beta-D-xylosidase 1 -like protein [Gossypium arboreum]
Length=244

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 131/204 (64%), Positives = 154/204 (75%), Gaps = 4/204 (2%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P +ACD  +N   +SL FC   L +  RV DL+ RLTLPEKI  LVN A +V RLGI  Y
Sbjct  30   PPFACDP-RNGLTRSLRFCRTNLPIHVRVRDLLGRLTLPEKIRLLVNNAIDVPRLGIRGY  88

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N
Sbjct  89   EWWSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNESLWERIGQVVSDEARAMYN  148

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++V GLQ        +LKVA
Sbjct  149  GGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVSGLQS---ATGNRLKVA  205

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            ACCKHYTAYD+D+WKG  R++FN+
Sbjct  206  ACCKHYTAYDLDNWKGVDRFHFNA  229



>ref|XP_004976988.1| PREDICTED: beta-D-xylosidase 4-like isoform X1 [Setaria italica]
Length=833

 Score =   287 bits (735),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/206 (66%), Positives = 156/206 (76%), Gaps = 2/206 (1%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            PV+ACD   N  L +  FCN+      R ADLV RL L EK+ FLV+    + RLGIP Y
Sbjct  33   PVFACDA-SNATLAAYGFCNRSATPAARAADLVSRLKLAEKVGFLVDKQAALPRLGIPAY  91

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF  IG+V+S EARAMHN
Sbjct  92   EWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNVTLFRAIGEVVSNEARAMHN  151

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDG-NKEKLKV  697
             GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP LT KYA  +V GLQ+   G   + LKV
Sbjct  152  VGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLTSKYAVGYVTGLQDAGSGAGGDSLKV  211

Query  698  AACCKHYTAYDVDDWKGYQRYNFNSV  775
            AACCKHYTAYDVD+WKG +RY FN+V
Sbjct  212  AACCKHYTAYDVDNWKGVERYTFNAV  237



>ref|XP_008661822.1| PREDICTED: uncharacterized protein LOC100279996 isoform X1 [Zea 
mays]
 gb|AFW59620.1| putative O-Glycosyl hydrolase superfamily protein [Zea mays]
Length=773

 Score =   282 bits (722),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 137/210 (65%), Positives = 158/210 (75%), Gaps = 3/210 (1%)
 Frame = +2

Query  146  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  325
            ++QT P +ACD   N  L S  FCN+      R ADLV RLTL EK+ FLV+    + RL
Sbjct  34   RAQT-PAFACDA-SNATLASYGFCNRSAAAAARAADLVSRLTLAEKVGFLVDKQAALPRL  91

Query  326  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  505
            G+P YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN TLF  IG+V+S EA
Sbjct  92   GVPLYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNATLFRAIGEVVSNEA  151

Query  506  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKE  685
            RAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP LT KYA  +V GLQ    G   
Sbjct  152  RAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLTSKYAVGYVTGLQGAVSG-AG  210

Query  686  KLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
             LKVAACCKHYTAYDVD+WKG +RY F++V
Sbjct  211  ALKVAACCKHYTAYDVDNWKGVERYTFDAV  240



>ref|XP_006855294.1| PREDICTED: probable beta-D-xylosidase 2 [Amborella trichopoda]
 gb|ERN16761.1| hypothetical protein AMTR_s00057p00049120 [Amborella trichopoda]
Length=768

 Score =   281 bits (720),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 161/212 (76%), Gaps = 5/212 (2%)
 Frame = +2

Query  140  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  319
            P   +  P +ACD      + S PFC++ L +  RV+DL++RLTLPEK   LVN A  ++
Sbjct  20   PAIVEPGPSFACDG----QMGSFPFCDRSLPINARVSDLIRRLTLPEKTRLLVNNAEGLA  75

Query  320  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            RLG+P YEWWSEALHG+S  GPG  F G VP ATSFPQ +LTAASFN +L+  IG+ +ST
Sbjct  76   RLGVPHYEWWSEALHGVSNVGPGTRFGGNVPGATSFPQVILTAASFNSSLWEEIGQAVST  135

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDG-  676
            EARAM+N GLAGLT+WSPN+NIFRDPRWGRGQE PGEDPT+ G+YA  +VRGLQ   D  
Sbjct  136  EARAMYNEGLAGLTFWSPNVNIFRDPRWGRGQETPGEDPTVVGRYAGRYVRGLQNAFDAK  195

Query  677  NKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
            +  +LKVAACCKHYTAYD+D+WKG  R++F++
Sbjct  196  DPNRLKVAACCKHYTAYDLDNWKGVDRFHFDA  227



>gb|KJB38536.1| hypothetical protein B456_006G259500 [Gossypium raimondii]
Length=589

 Score =   277 bits (708),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 155/204 (76%), Gaps = 4/204 (2%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P +ACD  +N   +SL FC   L +  RV DL+ RLTLPEKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNGLTRSLRFCRTNLPIHVRVRDLLGRLTLPEKIRLLVNNAIDVPRLGIRGY  89

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N
Sbjct  90   EWWSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNESLWERIGQVVSDEARAMYN  149

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ        +LKVA
Sbjct  150  GGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQS---ATGNRLKVA  206

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            ACCKHYTAYD+D+WKG  R++FN+
Sbjct  207  ACCKHYTAYDLDNWKGVDRFHFNA  230



>ref|XP_006653810.1| PREDICTED: beta-D-xylosidase 4-like [Oryza brachyantha]
Length=776

 Score =   280 bits (715),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 135/214 (63%), Positives = 157/214 (73%), Gaps = 2/214 (1%)
 Frame = +2

Query  137  GPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNV  316
            G V     PV+ACD   N  +    FC++      R ADL+ RLTL EK+ FLVN    +
Sbjct  25   GNVARAQTPVFACDA-SNATVAGYGFCDRSKSAAARAADLLGRLTLAEKVGFLVNKQAAL  83

Query  317  SRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIS  496
             RLGIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S
Sbjct  84   PRLGIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVS  143

Query  497  TEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQE-RDD  673
            TEARAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KYA  +V GLQ+    
Sbjct  144  TEARAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASKYAVGYVTGLQDAGGG  203

Query  674  GNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNSV  775
            G    LKVAACCKHYTAYDVD+WKG +RY F++V
Sbjct  204  GGGGALKVAACCKHYTAYDVDNWKGVERYTFDAV  237



>ref|XP_002515300.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF47284.1| Beta-glucosidase, putative [Ricinus communis]
Length=768

 Score =   279 bits (714),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD+ K+   K+LPFC  +L ++ RV DL+ RLTL EK+  LVN AG VSRLGI  YEW
Sbjct  28   FACDS-KDGTTKNLPFCQVKLPIQDRVKDLIGRLTLAEKVGLLVNNAGAVSRLGIKGYEW  86

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNSTLWEAIGRVVSDEARAMYNGG  146

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
             AGLTYWSPN+NI RDPRWGRGQE PGEDP L GKYAA++V+GLQ  D    E+LKVAAC
Sbjct  147  AAGLTYWSPNVNILRDPRWGRGQETPGEDPLLVGKYAASYVKGLQGNDG---ERLKVAAC  203

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  204  CKHFTAYDLDNWNGVDRFHFNA  225



>ref|XP_003580652.1| PREDICTED: beta-D-xylosidase 4-like [Brachypodium distachyon]
Length=774

 Score =   278 bits (712),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 131/209 (63%), Positives = 157/209 (75%), Gaps = 2/209 (1%)
 Frame = +2

Query  146  QSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRL  325
            ++QT PV+ACD   N  +    FC++      R ADLV RLTL +K+ FLVN    ++RL
Sbjct  32   RAQT-PVFACDAA-NSTVAGYAFCDRAKSASARAADLVSRLTLADKVGFLVNKQPALARL  89

Query  326  GIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEA  505
            GIP YEWWSEALHG+SY GPG  F+ +VP ATSFPQP+LTAASFN +LF  IG+V+S EA
Sbjct  90   GIPAYEWWSEALHGVSYVGPGTRFSPLVPGATSFPQPILTAASFNASLFRAIGEVVSNEA  149

Query  506  RAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKE  685
            RAMHN GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L  +YA  +V GLQ+       
Sbjct  150  RAMHNVGLAGLTFWSPNINIFRDPRWGRGQETPGEDPLLASRYAVGYVSGLQDAGADADG  209

Query  686  KLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
             LKVAACCKHYTAYDVD+WKG +RY F++
Sbjct  210  PLKVAACCKHYTAYDVDNWKGVERYTFDA  238



>ref|XP_003625957.1| Beta-xylosidase [Medicago truncatula]
 gb|AES82175.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=771

 Score =   278 bits (710),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 159/203 (78%), Gaps = 4/203 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  K+   K+LPFCN +L +  RV DL+ RLT+ EK+  LVN A  V R+G+ +YEW
Sbjct  28   FACDA-KDAATKNLPFCNVKLAIPERVKDLIGRLTMQEKVNLLVNNAPAVPRVGMKSYEW  86

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F GV PAATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTRFGGVFPAATSFPQVITTAASFNASLWEAIGRVVSDEARAMYNGG  146

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L G+YAA++V+GLQ   DGN  KLKVAAC
Sbjct  147  AAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGRYAASYVKGLQGT-DGN--KLKVAAC  203

Query  707  CKHYTAYDVDDWKGYQRYNFNSV  775
            CKH+TAYDVD+W G  R++FN++
Sbjct  204  CKHFTAYDVDNWNGVDRFHFNAL  226



>gb|KDO87027.1| hypothetical protein CISIN_1g0041902mg, partial [Citrus sinensis]
 gb|KDO87028.1| hypothetical protein CISIN_1g0041902mg, partial [Citrus sinensis]
Length=226

 Score =   262 bits (669),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 152/202 (75%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  K+   ++LPFC   L +  RV DL+ RL+L EK+  L++ A  V RLGI  YEW
Sbjct  28   FACDP-KDATTRTLPFCQVSLPIPQRVNDLIGRLSLQEKVKLLISGAAAVPRLGIKGYEW  86

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  P ATSFPQ + TA+SFN TL+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGDFPGATSFPQVITTASSFNATLWEAIGRVVSDEARAMYNGG  146

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L+GKYAA++VRGLQ  D    ++LKVAA 
Sbjct  147  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLSGKYAASYVRGLQGSDG---DRLKVAAS  203

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  204  CKHFTAYDLDNWNGVDRFHFNA  225



>ref|XP_010113184.1| putative beta-D-xylosidase 5 [Morus notabilis]
 gb|EXC72717.1| putative beta-D-xylosidase 5 [Morus notabilis]
Length=293

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 120/219 (55%), Positives = 159/219 (73%), Gaps = 9/219 (4%)
 Frame = +2

Query  134  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  313
            I P+ +Q    +ACD    P     PFC+  L    R  D++ RLTL EK+  LV+ +  
Sbjct  20   ILPIATQK---HACDVTSFPQASQFPFCDTSLSYDIRAKDIISRLTLQEKVQQLVSGSAG  76

Query  314  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  493
            +SRLG+P+YEWWSEALHG+S  GPG  F   VP ATSFP  +L+AA+FN +L++ +G+ +
Sbjct  77   ISRLGVPSYEWWSEALHGVSNVGPGTTFNATVPGATSFPAVILSAAAFNASLWYKMGQAV  136

Query  494  STEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDD  673
            STEARAM+N GLAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  KYA  +V+GLQE  +
Sbjct  137  STEARAMYNAGLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQEVSN  196

Query  674  -----GNK-EKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
                 GN+ ++LKV++CCKHYTAYDVD+WKG  R++F++
Sbjct  197  EEGSGGNQGDRLKVSSCCKHYTAYDVDNWKGVDRFHFDA  235



>gb|KJB38535.1| hypothetical protein B456_006G259500 [Gossypium raimondii]
Length=774

 Score =   277 bits (708),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 132/204 (65%), Positives = 155/204 (76%), Gaps = 4/204 (2%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P +ACD  +N   +SL FC   L +  RV DL+ RLTLPEKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNGLTRSLRFCRTNLPIHVRVRDLLGRLTLPEKIRLLVNNAIDVPRLGIRGY  89

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N
Sbjct  90   EWWSEALHGVSNVGPGTKFGGSFPGATSFPQVITTAASFNESLWERIGQVVSDEARAMYN  149

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ        +LKVA
Sbjct  150  GGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQS---ATGNRLKVA  206

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            ACCKHYTAYD+D+WKG  R++FN+
Sbjct  207  ACCKHYTAYDLDNWKGVDRFHFNA  230



>dbj|BAF00595.1| xylosidase [Arabidopsis thaliana]
Length=303

 Score =   263 bits (673),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 152/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P++ACD   N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  33   PLFACDPA-NGLTRTLRFCRANVPIHVRVQDLLGRLTLQEKIRNLVNNAAAVPRLGIGGY  91

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  92   EWWSEALHGISDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  151

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP +  KYAA++VRGLQ    GN  +LKVA
Sbjct  152  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPIVAAKYAASYVRGLQGTAAGN--RLKVA  209

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            ACCKHYTAYD+D+W G  R++FN+
Sbjct  210  ACCKHYTAYDLDNWNGVDRFHFNA  233



>ref|XP_010094323.1| Beta-D-xylosidase 1 [Morus notabilis]
 gb|EXB55743.1| Beta-D-xylosidase 1 [Morus notabilis]
Length=783

 Score =   276 bits (705),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/203 (67%), Positives = 154/203 (76%), Gaps = 5/203 (2%)
 Frame = +2

Query  167  YACDTVKNPGL-KSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  343
            +ACD     GL +SL FC   L V  RV+DL+ RLTL EKI  LVN A  V RLGI  YE
Sbjct  39   FACD--PRSGLTRSLRFCRTTLPVHVRVSDLIGRLTLQEKIRLLVNNAIEVPRLGIQGYE  96

Query  344  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  523
            WWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N 
Sbjct  97   WWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYNG  156

Query  524  GLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAA  703
            GLAGLT+WSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ    GN  KLKVAA
Sbjct  157  GLAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQGNGAGN--KLKVAA  214

Query  704  CCKHYTAYDVDDWKGYQRYNFNS  772
            CCKHYTAYD+D+W G  RY+FN+
Sbjct  215  CCKHYTAYDLDNWNGVDRYHFNA  237



>gb|KHN30647.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=582

 Score =   271 bits (693),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 152/202 (75%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  85

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGG  145

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQE  DGN  +LKVAA 
Sbjct  146  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGKYAASYVRGLQE-TDGN--RLKVAAS  202

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  203  CKHFTAYDLDNWNGVDRFHFNA  224



>ref|XP_002974833.1| hypothetical protein SELMODRAFT_101733 [Selaginella moellendorffii]
 gb|EFJ24353.1| hypothetical protein SELMODRAFT_101733 [Selaginella moellendorffii]
Length=784

 Score =   275 bits (703),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 127/218 (58%), Positives = 161/218 (74%), Gaps = 5/218 (2%)
 Frame = +2

Query  131  IIGPVQSQTAPV-YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTA  307
            I+   ++ TA + YACD   N  L S PFC+ +L +  RV DLV RLTL EK+  +VN A
Sbjct  23   ILSNARASTAQLRYACDVSSNASLGSFPFCDTKLGIDVRVQDLVSRLTLDEKVDEMVNAA  82

Query  308  GNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGK  487
              + RLG+P+Y+WW EALHG++ + PGV F G+ PAATSFP P+ TAASFN TLF++IG+
Sbjct  83   QGIPRLGVPSYQWWQEALHGVA-SSPGVQFGGLAPAATSFPMPIATAASFNSTLFYSIGE  141

Query  488  VISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQE-  664
             +S+EARA+HN G AGLT+WSPN+NIFRDPRWGRGQE PGEDP L  K+A+ +VRGLQ  
Sbjct  142  AVSSEARALHNLGRAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLASKFASLYVRGLQGG  201

Query  665  --RDDGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
                  +   LKV+ACCKH TAYDVD+WKG  RY+FN+
Sbjct  202  AYEGSASDGFLKVSACCKHLTAYDVDNWKGMDRYHFNA  239



>ref|XP_011041424.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  K+   ++LPFC  +L ++TRV DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KDGTKRNLPFCQVKLPIQTRVKDLIGRMTLQEKVGLLVNNAAAVPRLGIKRYEW  85

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM N G
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAASFNATLWEAIGQVVSDEARAMFNGG  145

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
            +AGLTYWSPN+NIFRDPRWGRGQE PGEDP + GKYAA++VRGLQ   DGN  +LKVAAC
Sbjct  146  VAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVVGKYAASYVRGLQG-SDGN--RLKVAAC  202

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  203  CKHFTAYDLDNWNGVDRFHFNA  224



>ref|XP_011015623.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  K+   ++LPFC  +L ++TRV DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KDGTKRNLPFCQVKLPIQTRVKDLIGRMTLQEKVGLLVNNAAAVPRLGIKRYEW  85

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM N G
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAASFNATLWEAIGQVVSDEARAMFNGG  145

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
            +AGLTYWSPN+NIFRDPRWGRGQE PGEDP + GKYAA++VRGLQ   DGN  +LKVAAC
Sbjct  146  VAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVVGKYAASYVRGLQG-SDGN--RLKVAAC  202

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  203  CKHFTAYDLDNWNGVDRFHFNA  224



>ref|XP_010259348.1| PREDICTED: putative beta-D-xylosidase [Nelumbo nucifera]
Length=775

 Score =   275 bits (702),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 132/214 (62%), Positives = 158/214 (74%), Gaps = 4/214 (2%)
 Frame = +2

Query  131  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  310
             + P      P +ACD  +N   ++LPFC   L +  RV DL+ RLTL EKI  LVN A 
Sbjct  21   FVSPRTGDARPAFACDP-RNGLTRNLPFCRPSLPIPNRVRDLIGRLTLQEKIRLLVNNAA  79

Query  311  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  490
             V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V
Sbjct  80   PVPRLGIRGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNASLWEQIGRV  139

Query  491  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERD  670
            +S EARAM+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ  +
Sbjct  140  VSDEARAMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPLLAGKYAASYVRGLQG-N  198

Query  671  DGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
            +GN  +LKVAACCKHYTAYD+D+W G  R++FN+
Sbjct  199  EGN--RLKVAACCKHYTAYDLDNWNGVDRFHFNA  230



>ref|XP_002963750.1| hypothetical protein SELMODRAFT_80102 [Selaginella moellendorffii]
 gb|EFJ35621.1| hypothetical protein SELMODRAFT_80102 [Selaginella moellendorffii]
Length=785

 Score =   275 bits (702),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/211 (60%), Positives = 155/211 (73%), Gaps = 4/211 (2%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            S   P YACD   N  L S PFC+ +L V  RV DLV RLTL EK+  +VN A  + RLG
Sbjct  31   STAQPRYACDVSSNASLGSFPFCDTKLGVDVRVQDLVSRLTLDEKVDEMVNAAQGIPRLG  90

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            +P+Y+WW EALHG++ + PGV F G+ PAATSFP P+  AASFN TLF++IG+ +S+EAR
Sbjct  91   VPSYQWWQEALHGVA-SSPGVQFGGLAPAATSFPMPIAMAASFNSTLFYSIGEAVSSEAR  149

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            A+HN G AGLT+WSPN+NIFRDPRWGRGQE PGEDP L  K+A+ +VRGLQ    G    
Sbjct  150  ALHNLGRAGLTFWSPNVNIFRDPRWGRGQETPGEDPLLASKFASLYVRGLQGGAYGGSAS  209

Query  689  ---LKVAACCKHYTAYDVDDWKGYQRYNFNS  772
               LKV+ACCKH TAYD+D+WKG  RY+FN+
Sbjct  210  DGFLKVSACCKHLTAYDMDNWKGMDRYHFNA  240



>emb|CDP17081.1| unnamed protein product [Coffea canephora]
Length=643

 Score =   271 bits (694),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 152/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P +ACD  ++   K   FC   L +  RV+DL+ RLTL EK+  LVN A  V+RLGI  Y
Sbjct  96   PAFACDA-RDARTKGWGFCGTNLGIAERVSDLIGRLTLQEKVRLLVNNAAEVARLGIKGY  154

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G  PAATSFPQ + TAA+FN +L+  IG+V+S E RAM+N
Sbjct  155  EWWSEALHGVSNVGPGTKFGGEFPAATSFPQVITTAAAFNASLWEEIGRVVSDEGRAMYN  214

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             GL GLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ   DG   +LKVA
Sbjct  215  GGLGGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQGNLDGG--RLKVA  272

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            ACCKH+TAYD+D+W G  R++FN+
Sbjct  273  ACCKHFTAYDLDNWSGVDRFHFNA  296



>ref|XP_002519194.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
 gb|EEF43058.1| Periplasmic beta-glucosidase precursor, putative [Ricinus communis]
Length=782

 Score =   275 bits (702),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 152/202 (75%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  +N   ++L FC   L +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  42   FACDP-RNGVTRNLKFCRANLPIHVRVRDLISRLTLQEKIRLLVNNAAAVPRLGIQGYEW  100

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPGV F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N G
Sbjct  101  WSEALHGVSNVGPGVKFGGAFPGATSFPQVITTAASFNQSLWEQIGRVVSDEARAMYNGG  160

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
            LAGLTYWSPN+N+FRDPRWGRGQE PGEDP L GKYAA++VRGLQ        KLKVAAC
Sbjct  161  LAGLTYWSPNVNVFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQS---STGLKLKVAAC  217

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKHYTAYD+D+W G  RY+FN+
Sbjct  218  CKHYTAYDLDNWNGVDRYHFNA  239



>ref|XP_002980053.1| hypothetical protein SELMODRAFT_112087 [Selaginella moellendorffii]
 gb|EFJ18923.1| hypothetical protein SELMODRAFT_112087 [Selaginella moellendorffii]
Length=772

 Score =   274 bits (701),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 155/203 (76%), Gaps = 3/203 (1%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            YACD   N  L + PFCN  L +  RV D V RLTL EKI+ L+NTA  + RLG+P Y+W
Sbjct  30   YACDQ-SNATLAAFPFCNTSLAITDRVEDYVARLTLEEKISQLINTATGIPRLGVPKYQW  88

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            W EALHG++ + PGV F G VPAATSFP P+ TAASFN +LF+ IG+ +STEARAMHN G
Sbjct  89   WQEALHGVA-SSPGVQFGGSVPAATSFPMPITTAASFNTSLFYGIGQAVSTEARAMHNLG  147

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
             +GLT+WSPN+NI+RDPRWGRGQE PGEDP L+  +A  +VRGLQE   G+ +KLKV+AC
Sbjct  148  QSGLTFWSPNINIYRDPRWGRGQETPGEDPLLSSNFATYYVRGLQESQAGS-DKLKVSAC  206

Query  707  CKHYTAYDVDDWKGYQRYNFNSV  775
            CKH TAYDVD+W G  RY+FN++
Sbjct  207  CKHMTAYDVDNWLGTDRYHFNAI  229



>ref|XP_002987446.1| hypothetical protein SELMODRAFT_426206 [Selaginella moellendorffii]
 gb|EFJ11533.1| hypothetical protein SELMODRAFT_426206 [Selaginella moellendorffii]
Length=772

 Score =   274 bits (701),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 155/203 (76%), Gaps = 3/203 (1%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            YACD   N  L + PFCN  L +  RV D V RLTL EKI+ L+NTA  + RLG+P Y+W
Sbjct  30   YACDQ-SNATLAAFPFCNTSLPITDRVEDYVARLTLEEKISQLINTATGIPRLGVPKYQW  88

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            W EALHG++ + PGV F G VPAATSFP P+ TAASFN +LF+ IG+ +STEARAMHN G
Sbjct  89   WQEALHGVA-SSPGVQFGGSVPAATSFPMPITTAASFNTSLFYGIGQAVSTEARAMHNLG  147

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
             +GLT+WSPN+NI+RDPRWGRGQE PGEDP L+  +A  +VRGLQE   G+ +KLKV+AC
Sbjct  148  QSGLTFWSPNINIYRDPRWGRGQETPGEDPLLSSNFATYYVRGLQESQAGS-DKLKVSAC  206

Query  707  CKHYTAYDVDDWKGYQRYNFNSV  775
            CKH TAYDVD+W G  RY+FN++
Sbjct  207  CKHMTAYDVDNWLGTDRYHFNAI  229



>ref|XP_002885319.1| beta-1,4-xylosidase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61578.1| beta-1,4-xylosidase [Arabidopsis lyrata subsp. lyrata]
Length=865

 Score =   275 bits (704),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/203 (62%), Positives = 154/203 (76%), Gaps = 2/203 (1%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD   +P      FCN  L  + R  DLV RL+L EK+  LVN A  VSRLG+P YEW
Sbjct  27   FACDR-NDPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNKATGVSRLGVPPYEW  85

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSDVGPGVRFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNVG  145

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQE-RDDGNKEKLKVAA  703
            LAGLTYWSPN+NIFRDPRWGRGQE PGEDP +  KYA  +V+GLQ+ +D G   +LKV++
Sbjct  146  LAGLTYWSPNVNIFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQDVQDAGKSRRLKVSS  205

Query  704  CCKHYTAYDVDDWKGYQRYNFNS  772
            CCKHYTAYD+D+WKG  R++F++
Sbjct  206  CCKHYTAYDLDNWKGIDRFHFDA  228



>ref|XP_008384517.1| PREDICTED: probable beta-D-xylosidase 5 [Malus domestica]
Length=802

 Score =   274 bits (701),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 123/205 (60%), Positives = 157/205 (77%), Gaps = 4/205 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  +       PFCN  L  +TR  DLV RLTL EK+  LV+ +  ++RLG+P YEW
Sbjct  32   FACDN-RASATSQFPFCNTSLPYETRAKDLVSRLTLQEKVIQLVDKSTGIARLGVPAYEW  90

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG +F G VP ATSFP  +L+AASFN++L+  +G+V+STEARAM+N G
Sbjct  91   WSEALHGVSNVGPGTSFNGTVPGATSFPAVILSAASFNQSLWLKMGQVVSTEARAMYNVG  150

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK---EKLKV  697
            LAGLTYWSPN+N+FRDPRWGRGQE PGEDP +   YA  +VRGLQE  +GNK   ++LKV
Sbjct  151  LAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSDYAVNYVRGLQEVSEGNKTGGDRLKV  210

Query  698  AACCKHYTAYDVDDWKGYQRYNFNS  772
            ++CCKHYTAYDVD+WKG  R++F++
Sbjct  211  SSCCKHYTAYDVDNWKGVDRFHFDA  235



>ref|XP_002320310.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
 gb|EEE98625.2| hypothetical protein POPTR_0014s11730g [Populus trichocarpa]
Length=765

 Score =   273 bits (699),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  K+   + LPFC  +L ++TRV DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KDGTTRDLPFCQVKLPIQTRVNDLIGRMTLQEKVGLLVNNAAAVPRLGIKGYEW  85

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  P ATSFPQ + TAA+FN TL+  IG+V+S EARAM N G
Sbjct  86   WSEALHGVSNVGPGTKFGGAFPVATSFPQVITTAAAFNATLWEAIGQVVSDEARAMFNGG  145

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
            +AGLTYWSPN+NIFRDPRWGRGQE PGEDP + GKYAA++VRGLQ   DGN  +LKVAAC
Sbjct  146  VAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVVGKYAASYVRGLQG-SDGN--RLKVAAC  202

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  203  CKHFTAYDLDNWNGVDRFHFNA  224



>gb|KJB77632.1| hypothetical protein B456_012G147500 [Gossypium raimondii]
Length=788

 Score =   274 bits (700),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/214 (59%), Positives = 158/214 (74%), Gaps = 3/214 (1%)
 Frame = +2

Query  131  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  310
            ++ P  +Q  P +ACD   +P     PFC+  L  + R  DLV RLTL EK+  LVNTA 
Sbjct  18   VLVPYNTQAQP-FACDK-NDPNTSKFPFCDTTLSYQDRTKDLVSRLTLQEKVQQLVNTAS  75

Query  311  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  490
             + RLG+P Y+WWSEALHG+S  GPG  F   VP ATSFP  +L+AASFNE L+  +G+V
Sbjct  76   GIPRLGVPAYQWWSEALHGVSDLGPGTRFNATVPGATSFPAVILSAASFNEMLWLEMGRV  135

Query  491  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERD  670
            +STEARAM+N GLAGLTYWSPN+N+FRDPRWGRGQE PGEDPT+  KYA  +VRGLQE  
Sbjct  136  VSTEARAMYNVGLAGLTYWSPNVNVFRDPRWGRGQETPGEDPTVVSKYAVNYVRGLQEVG  195

Query  671  DGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
                +KLKV++CCKHYTAYDVD+WKG  R++F++
Sbjct  196  SVG-DKLKVSSCCKHYTAYDVDNWKGVDRFHFDA  228



>ref|XP_007035744.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
 gb|EOY06670.1| Periplasmic beta-glucosidase, putative [Theobroma cacao]
Length=776

 Score =   273 bits (699),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 134/214 (63%), Positives = 158/214 (74%), Gaps = 6/214 (3%)
 Frame = +2

Query  131  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  310
            +I  V+S+  P +ACD  +N   +SL FC   L +  RV DL+ RLTL EKI  LVN A 
Sbjct  26   VISLVESR--PPFACDP-RNGLTRSLRFCRVNLPLHVRVRDLLGRLTLQEKIRLLVNNAA  82

Query  311  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  490
             V RLGI  YEWWSEALHG+S  GPG  F G VP ATSFPQ + TAASFNE+L+  IG+V
Sbjct  83   AVPRLGIQGYEWWSEALHGVSNVGPGAKFGGAVPGATSFPQVITTAASFNESLWEQIGRV  142

Query  491  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERD  670
            +S EARAM+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA +V+GLQ   
Sbjct  143  VSDEARAMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAARYVQGLQS--  200

Query  671  DGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
                 +LKVAACCKHYTAYD+D+W G  RY+FN+
Sbjct  201  -ATGNRLKVAACCKHYTAYDLDNWNGVDRYHFNA  233



>ref|XP_011100796.1| PREDICTED: beta-D-xylosidase 1 [Sesamum indicum]
Length=770

 Score =   273 bits (699),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 154/202 (76%), Gaps = 3/202 (1%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD   N    +LPFC+  L ++ RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  28   FACDPT-NHITTTLPFCSVSLHIRDRVKDLIGRLTLQEKIRLLVNNAAPVDRLGIRGYEW  86

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S TGPGV F G  P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNTGPGVKFGGQFPGATSFPQVITTAASFNSSLWEAIGQVVSDEARAMYNGG  146

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
            +AGLTYWSPN+NIFRDPRWGRGQE PGEDPT+  KYAA++VRGLQ    GN  +LKVAAC
Sbjct  147  VAGLTYWSPNVNIFRDPRWGRGQETPGEDPTVAAKYAASYVRGLQGNAAGN--RLKVAAC  204

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKHYTAYD+D W G  R++FN+
Sbjct  205  CKHYTAYDLDFWNGMDRFHFNA  226



>emb|CDY67410.1| BnaCnng54810D [Brassica napus]
Length=525

 Score =   268 bits (684),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 151/204 (74%), Gaps = 3/204 (1%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD   +P      FC   L  + R  DLV RL+L EK+  LVN A  V RLG+P YEW
Sbjct  27   FACDR-NDPATVKYTFCKASLSYEARAKDLVSRLSLTEKVQQLVNKATGVPRLGVPPYEW  85

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSNVGPGVRFNGTVPGATSFPAVILTAASFNTSLWLKMGEVVSTEARAMHNVG  145

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDD--GNKEKLKVA  700
            LAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  KYA  +V+GLQ+  D  G   +LKV+
Sbjct  146  LAGLTYWSPNINVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQDVHDAGGKSRRLKVS  205

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            +CCKHYTAYD+D+WKG  R++F++
Sbjct  206  SCCKHYTAYDLDNWKGIDRFHFDA  229



>gb|KHG14371.1| Beta-D-xylosidase 1 -like protein [Gossypium arboreum]
Length=772

 Score =   273 bits (698),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 153/208 (74%), Gaps = 4/208 (2%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +++ P +ACD  +N   +SL FC   L +  R  DL+ RLTL EKI  LVN A  V RLG
Sbjct  25   AESRPPFACDP-RNGLTRSLKFCRANLPIHVRARDLIGRLTLAEKIRLLVNNAAAVPRLG  83

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+S EAR
Sbjct  84   IQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWEQIGRVVSDEAR  143

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA +VRGLQ        +
Sbjct  144  AMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAANYVRGLQST---TGIR  200

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNS  772
            LKVAACCKHYTAYD+D+W G  RY+FN+
Sbjct  201  LKVAACCKHYTAYDLDNWNGVDRYHFNA  228



>gb|AAS17751.2| beta xylosidase [Fragaria x ananassa]
Length=772

 Score =   273 bits (698),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 153/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P +ACD  +NP  +   FC  R+ V  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  30   PPFACDP-RNPLTRGFKFCRTRVPVHVRVQDLIGRLTLQEKIRLLVNNAIAVPRLGIQGY  88

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  89   EWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNQSLWQEIGQVVSDEARAMYN  148

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             G AGLTYWSPN+NIFRDPRWGRGQE PGEDP L+ KYAA++V+GLQ   DG   +LKVA
Sbjct  149  GGQAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLSAKYAASYVKGLQ--GDGAGNRLKVA  206

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            ACCKHYTAYD+D+W G  R++FN+
Sbjct  207  ACCKHYTAYDLDNWNGVDRFHFNA  230



>ref|XP_012082876.1| PREDICTED: probable beta-D-xylosidase 2 [Jatropha curcas]
 gb|KDP28242.1| hypothetical protein JCGZ_14013 [Jatropha curcas]
Length=772

 Score =   273 bits (698),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 127/203 (63%), Positives = 157/203 (77%), Gaps = 6/203 (3%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  K    ++LPFC  +L ++ RV DL+ RLTL EK+  LVN A +VSRLGI  YEW
Sbjct  30   FACDP-KEETTRNLPFCQVKLPIQDRVKDLIGRLTLQEKVVLLVNNAASVSRLGIKGYEW  88

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM+N G
Sbjct  89   WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNATLWEAIGRVVSDEARAMYNGG  148

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK-EKLKVAA  703
            + GLTYWSPN+NIFRDPRWGRGQE PGEDP + GKYAA++V+GLQ    GN+ ++LKVAA
Sbjct  149  MGGLTYWSPNVNIFRDPRWGRGQETPGEDPLVVGKYAASYVKGLQ----GNEGDRLKVAA  204

Query  704  CCKHYTAYDVDDWKGYQRYNFNS  772
            CCKH+TAYD+D+W G  R++FN+
Sbjct  205  CCKHFTAYDLDNWNGVDRFHFNA  227



>emb|CDY15255.1| BnaC05g01340D [Brassica napus]
Length=762

 Score =   273 bits (697),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 156/210 (74%), Gaps = 4/210 (2%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            +   +   +ACDT K+    +L FC Q + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  16   IHVHSRETFACDT-KDAATATLRFCQQSVPIPERVKDLIGRLTLAEKVSLLGNTAAAIPR  74

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+ +IG+V+S E
Sbjct  75   LGIKGYEWWSEALHGVSNVGPGTKFGGTFPAATSFPQVITTAASFNASLWESIGRVVSNE  134

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N G+ GLTYWSPN+NI RDPRWGRGQE PGEDP L GKYAA++VRGLQ  D   +
Sbjct  135  ARAMYNGGVGGLTYWSPNVNILRDPRWGRGQETPGEDPVLAGKYAASYVRGLQGND---R  191

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
             +LKVAACCKH+TAYD+D+W G  R++FN+
Sbjct  192  SRLKVAACCKHFTAYDLDNWNGVDRFHFNA  221



>ref|XP_012093115.1| PREDICTED: probable beta-D-xylosidase 5 isoform X1 [Jatropha 
curcas]
 gb|KDP44489.1| hypothetical protein JCGZ_16322 [Jatropha curcas]
Length=796

 Score =   273 bits (698),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 155/205 (76%), Gaps = 4/205 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            YACD  KNP      FCN  L  + R  DL+ RLTL EK+  LVN A  +SRLGIP YEW
Sbjct  27   YACDQ-KNPETSQYAFCNTTLPYQDRAKDLISRLTLQEKVQQLVNHAAGISRLGIPAYEW  85

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  G GV+F   VP ATSFP  +L+AASFNETL+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSNVGYGVHFNETVPGATSFPAVILSAASFNETLWLKMGQVVSTEARAMHNVG  145

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ---ERDDGNKEKLKV  697
            LAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  +YA  +V+GLQ   E  D + ++LKV
Sbjct  146  LAGLTYWSPNVNVFRDPRWGRGQETPGEDPFVVSRYAVNYVKGLQQVGESGDEDDDRLKV  205

Query  698  AACCKHYTAYDVDDWKGYQRYNFNS  772
            ++CCKHYTAYD+D+WKG  R++F++
Sbjct  206  SSCCKHYTAYDIDNWKGVDRFHFDA  230



>ref|XP_010457247.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score =   272 bits (696),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACDT K+    +L FC   + ++ RV DL+ RLTLPEK++ L NTA  + RLGI  YEW
Sbjct  31   FACDT-KDAATATLRFCQLSVPIQERVKDLIGRLTLPEKVSLLGNTAAAIPRLGIKGYEW  89

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S EARAM+N G
Sbjct  90   WSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNEARAMYNGG  149

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
            + GLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ  D   + +LKVAAC
Sbjct  150  VGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGND---RSRLKVAAC  206

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  207  CKHFTAYDLDNWNGVDRFHFNA  228



>emb|CDX89954.1| BnaA10g01280D [Brassica napus]
Length=767

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 156/210 (74%), Gaps = 4/210 (2%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            +   +   +ACDT K+    +L FC Q + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  21   IHVHSRETFACDT-KDAATATLRFCQQSVPIPERVKDLIGRLTLAEKVSLLGNTAAAIPR  79

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+ +IG+V+S E
Sbjct  80   LGIKGYEWWSEALHGVSNVGPGTKFAGPFPAATSFPQVITTAASFNASLWESIGRVVSNE  139

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N G+ GLTYWSPN+NI RDPRWGRGQE PGEDP L GKYAA++VRGLQ  D   +
Sbjct  140  ARAMYNGGVGGLTYWSPNVNILRDPRWGRGQETPGEDPVLAGKYAASYVRGLQGND---R  196

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
             +LKVAACCKH+TAYD+D+W G  R++FN+
Sbjct  197  SRLKVAACCKHFTAYDLDNWNGVDRFHFNA  226



>ref|XP_004295104.1| PREDICTED: putative beta-D-xylosidase [Fragaria vesca subsp. 
vesca]
Length=772

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 152/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P +ACD  +NP  +   FC  R+ V  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  30   PPFACDP-RNPLTRGFKFCRTRVPVHVRVQDLIGRLTLQEKIRLLVNNAIAVPRLGIQGY  88

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  89   EWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNQSLWQEIGQVVSDEARAMYN  148

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             G AGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYAA++V+GLQ   DG   +LKVA
Sbjct  149  GGQAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAAKYAASYVKGLQ--GDGAGNRLKVA  206

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            ACCKHYTAYD+D+W G  R++FN+
Sbjct  207  ACCKHYTAYDLDNWNGVDRFHFNA  230



>ref|XP_009119616.1| PREDICTED: probable beta-D-xylosidase 2 [Brassica rapa]
Length=767

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 156/210 (74%), Gaps = 4/210 (2%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            +   +   +ACDT K+    +L FC Q + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  21   IHVHSRETFACDT-KDAATATLRFCQQSVPIPERVKDLIGRLTLAEKVSLLGNTAAAIPR  79

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+ +IG+V+S E
Sbjct  80   LGIKGYEWWSEALHGVSNVGPGTKFAGPFPAATSFPQVITTAASFNASLWESIGRVVSNE  139

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N G+ GLTYWSPN+NI RDPRWGRGQE PGEDP L GKYAA++VRGLQ  D   +
Sbjct  140  ARAMYNGGVGGLTYWSPNVNILRDPRWGRGQETPGEDPVLAGKYAASYVRGLQGND---R  196

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
             +LKVAACCKH+TAYD+D+W G  R++FN+
Sbjct  197  SRLKVAACCKHFTAYDLDNWNGVDRFHFNA  226



>ref|XP_008223305.1| PREDICTED: putative beta-D-xylosidase [Prunus mume]
Length=775

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 156/213 (73%), Gaps = 5/213 (2%)
 Frame = +2

Query  134  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  313
            IG V ++  P +ACD   NP  + L FC   + +  RV DL+ RLTL EKI  LVN A  
Sbjct  23   IGVVHAR--PPFACDP-HNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIA  79

Query  314  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  493
            V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+
Sbjct  80   VPRLGIQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRVV  139

Query  494  STEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDD  673
            S EARAM+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ   D
Sbjct  140  SDEARAMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAAKYAARYVKGLQ--GD  197

Query  674  GNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
            G   +LKVAACCKHYTAYD+D+W G  R++FN+
Sbjct  198  GAGSRLKVAACCKHYTAYDLDNWNGVNRFHFNA  230



>ref|XP_007225668.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
 gb|EMJ26867.1| hypothetical protein PRUPE_ppa001718mg [Prunus persica]
Length=775

 Score =   272 bits (696),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/213 (62%), Positives = 156/213 (73%), Gaps = 5/213 (2%)
 Frame = +2

Query  134  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  313
            IG V ++  P +ACD   NP  + L FC   + +  RV DL+ RLTL EKI  LVN A  
Sbjct  23   IGVVHAR--PPFACDP-HNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIA  79

Query  314  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  493
            V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+
Sbjct  80   VPRLGIQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRVV  139

Query  494  STEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDD  673
            S EARAM+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ   D
Sbjct  140  SDEARAMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAAKYAARYVKGLQ--GD  197

Query  674  GNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
            G   +LKVAACCKHYTAYD+D+W G  R++FN+
Sbjct  198  GAGNRLKVAACCKHYTAYDLDNWNGVNRFHFNA  230



>ref|XP_009339788.1| PREDICTED: probable beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=788

 Score =   272 bits (695),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 130/202 (64%), Positives = 156/202 (77%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +AC+  K+   K LPFC   L V+ RV DL+ RLTL EK+  LVNTA  V RLGI  YEW
Sbjct  37   FACNP-KDAATKDLPFCRATLPVQDRVRDLLGRLTLQEKVKLLVNTALPVPRLGIKGYEW  95

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F GV P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  96   WSEALHGVSNVGPGTKFGGVFPGATSFPQVITTAASFNASLWEAIGRVVSDEARAMYNGG  155

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
            +AGLTYWSPN+NI RDPRWGR QE PGEDPT+ G+YAA++VRGLQ  DDGN  +LKVAAC
Sbjct  156  VAGLTYWSPNVNILRDPRWGRAQETPGEDPTVVGRYAASYVRGLQG-DDGN--RLKVAAC  212

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  213  CKHFTAYDLDNWNGVDRFHFNA  234



>ref|NP_188596.1| putative beta-D-xylosidase 5 [Arabidopsis thaliana]
 sp|Q9LJN4.2|BXL5_ARATH RecName: Full=Probable beta-D-xylosidase 5; Short=AtBXL5; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AEE76268.1| putative beta-D-xylosidase 5 [Arabidopsis thaliana]
Length=781

 Score =   272 bits (695),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/203 (61%), Positives = 153/203 (75%), Gaps = 2/203 (1%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD +  P      FCN  L  + R  DLV RL+L EK+  LVN A  V RLG+P YEW
Sbjct  27   FACD-ISAPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNKATGVPRLGVPPYEW  85

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPGV+F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSDVGPGVHFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNVG  145

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQE-RDDGNKEKLKVAA  703
            LAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  KYA  +V+GLQ+  D G   +LKV++
Sbjct  146  LAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQDVHDAGKSRRLKVSS  205

Query  704  CCKHYTAYDVDDWKGYQRYNFNS  772
            CCKHYTAYD+D+WKG  R++F++
Sbjct  206  CCKHYTAYDLDNWKGIDRFHFDA  228



>gb|KJB72795.1| hypothetical protein B456_011G198200 [Gossypium raimondii]
Length=772

 Score =   271 bits (694),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 153/208 (74%), Gaps = 4/208 (2%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            +++ P +ACD  +N   +SL FC   L +  R  DL+ RLTL EKI  LVN A  V RLG
Sbjct  25   AESRPPFACDP-RNGLTRSLKFCRANLPIHVRARDLIGRLTLAEKIRLLVNNAAAVPRLG  83

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            I  YEWWSEALHG+S  GPG  F G  P ATSFPQ + +AASFNE+L+  IG+V+S EAR
Sbjct  84   IQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITSAASFNESLWEQIGRVVSDEAR  143

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA +VRGLQ        +
Sbjct  144  AMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAANYVRGLQSP---TGIR  200

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNS  772
            LKVAACCKHYTAYD+D+W G  RY+FN+
Sbjct  201  LKVAACCKHYTAYDLDNWNGVDRYHFNA  228



>gb|ACD93208.1| beta xylosidase [Camellia sinensis]
Length=767

 Score =   271 bits (693),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 155/208 (75%), Gaps = 7/208 (3%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            S++ P +ACD       ++LPFC   L ++ RV DL+ RLTL EKI  LVN A  V RLG
Sbjct  25   SESRPAFACDGAT----RNLPFCRVSLPIQDRVRDLIGRLTLQEKIRLLVNNAAAVPRLG  80

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            I  YEWWSEALHG+S   PGV F G  P ATSFPQ + TAASFN +L+  IG+V+S EAR
Sbjct  81   IKGYEWWSEALHGVSNADPGVKFGGAFPGATSFPQVISTAASFNASLWEHIGRVVSDEAR  140

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ  + GN  +
Sbjct  141  AMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQG-NSGN--Q  197

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNS  772
            LKVAACCKHYTAYD+D+W    RY FN+
Sbjct  198  LKVAACCKHYTAYDLDNWNSVDRYRFNA  225



>ref|XP_012093116.1| PREDICTED: probable beta-D-xylosidase 5 isoform X2 [Jatropha 
curcas]
Length=915

 Score =   274 bits (700),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 155/205 (76%), Gaps = 4/205 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            YACD  KNP      FCN  L  + R  DL+ RLTL EK+  LVN A  +SRLGIP YEW
Sbjct  27   YACDQ-KNPETSQYAFCNTTLPYQDRAKDLISRLTLQEKVQQLVNHAAGISRLGIPAYEW  85

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  G GV+F   VP ATSFP  +L+AASFNETL+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSNVGYGVHFNETVPGATSFPAVILSAASFNETLWLKMGQVVSTEARAMHNVG  145

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQ---ERDDGNKEKLKV  697
            LAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  +YA  +V+GLQ   E  D + ++LKV
Sbjct  146  LAGLTYWSPNVNVFRDPRWGRGQETPGEDPFVVSRYAVNYVKGLQQVGESGDEDDDRLKV  205

Query  698  AACCKHYTAYDVDDWKGYQRYNFNS  772
            ++CCKHYTAYD+D+WKG  R++F++
Sbjct  206  SSCCKHYTAYDIDNWKGVDRFHFDA  230



>ref|XP_002302758.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
 gb|EEE82031.2| hypothetical protein POPTR_0002s19830g [Populus trichocarpa]
Length=770

 Score =   271 bits (693),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 155/202 (77%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  ++   ++ PFC  +L +++RV+DL+ R+TL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-EDGTSRNFPFCQVKLPIQSRVSDLIGRMTLQEKVGLLVNDAAAVPRLGIKGYEW  85

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM N G
Sbjct  86   WSEALHGVSNVGPGTQFGGAFPGATSFPQVITTAASFNATLWEAIGRVVSDEARAMFNGG  145

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
            +AGLTYWSPN+NIFRDPRWGRGQE PGEDP + GKYAA++VRGLQ  D    ++LKVAAC
Sbjct  146  VAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGNDG---DRLKVAAC  202

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  203  CKHFTAYDLDNWNGVDRFHFNA  224



>ref|XP_006419427.1| hypothetical protein CICLE_v10004369mg [Citrus clementina]
 gb|ESR32667.1| hypothetical protein CICLE_v10004369mg [Citrus clementina]
Length=777

 Score =   271 bits (693),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 153/203 (75%), Gaps = 6/203 (3%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  +N   +SL FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  28   FACDP-RNGLTRSLRFCRTSVPIHVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  86

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  P ATSFPQ + TAA+FNE+L+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAAAFNESLWEEIGRVVSDEARAMYNGG  146

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK-EKLKVAA  703
            +AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ    GN   +LKVAA
Sbjct  147  MAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQ----GNTGSRLKVAA  202

Query  704  CCKHYTAYDVDDWKGYQRYNFNS  772
            CCKHYTAYD+D+W G  RY+FN+
Sbjct  203  CCKHYTAYDLDNWNGVDRYHFNA  225



>ref|XP_010466113.1| PREDICTED: probable beta-D-xylosidase 5 [Camelina sativa]
Length=781

 Score =   271 bits (693),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 153/204 (75%), Gaps = 4/204 (2%)
 Frame = +2

Query  167  YACDTVKN-PGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  343
            +ACD  KN P      FCN  L  + R  DL+ RL+L EK+  LVN A  V RLG+P YE
Sbjct  27   FACD--KNAPATAKYGFCNVSLSYEARAKDLISRLSLTEKVQQLVNKATGVPRLGVPPYE  84

Query  344  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  523
            WWSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN 
Sbjct  85   WWSEALHGVSDVGPGVRFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  524  GLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQE-RDDGNKEKLKVA  700
            GLAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  KYA  +V+GLQ+  D G   +LKV+
Sbjct  145  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQDVHDAGKSRRLKVS  204

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            +CCKHYTAYDVD+WKG  R++F++
Sbjct  205  SCCKHYTAYDVDNWKGIDRFHFDA  228



>gb|KFK26586.1| hypothetical protein AALP_AA8G267600 [Arabis alpina]
Length=772

 Score =   271 bits (692),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 154/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P++ACD   N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  33   PLFACDPA-NGLTRTLRFCRVNVPIHVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  91

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  92   EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  151

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ    GN  +LKVA
Sbjct  152  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGTAAGN--RLKVA  209

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            ACCKHYTAYD+D+W G+ R++FN+
Sbjct  210  ACCKHYTAYDLDNWNGFDRFHFNA  233



>ref|XP_011042236.1| PREDICTED: probable beta-D-xylosidase 2 [Populus euphratica]
Length=770

 Score =   271 bits (692),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 124/208 (60%), Positives = 157/208 (75%), Gaps = 4/208 (2%)
 Frame = +2

Query  149  SQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLG  328
            S+    +ACD  ++   ++ PFC  +L +++RV DL+ R+TL EK+  LVN A  V RLG
Sbjct  21   SEALDAFACDP-EDGTSRNFPFCQVKLPIQSRVGDLIGRMTLQEKVGLLVNDAAAVPRLG  79

Query  329  IPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEAR  508
            I  YEWWSEALHG+S  GPG  F GV P ATSFPQ + T+ASFN TL+  IG+V+S EAR
Sbjct  80   IKGYEWWSEALHGVSNVGPGTQFGGVFPGATSFPQVITTSASFNATLWEAIGQVVSDEAR  139

Query  509  AMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEK  688
            AM N G+AGLT+WSPN+NIFRDPRWGRGQE PGEDP + GKYAA++VRGLQ  D    ++
Sbjct  140  AMFNGGVAGLTFWSPNVNIFRDPRWGRGQETPGEDPVVVGKYAASYVRGLQGNDG---DR  196

Query  689  LKVAACCKHYTAYDVDDWKGYQRYNFNS  772
            LKVAACCKH+TAYD+D+W G  R++FN+
Sbjct  197  LKVAACCKHFTAYDLDNWNGVDRFHFNA  224



>dbj|BAB02547.1| beta-1,4-xylosidase [Arabidopsis thaliana]
Length=876

 Score =   272 bits (696),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 159/217 (73%), Gaps = 4/217 (2%)
 Frame = +2

Query  131  IIGPVQS--QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNT  304
            II  V S  ++   +ACD +  P      FCN  L  + R  DLV RL+L EK+  LVN 
Sbjct  13   IIALVSSLCESQKNFACD-ISAPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNK  71

Query  305  AGNVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIG  484
            A  V RLG+P YEWWSEALHG+S  GPGV+F G VP ATSFP  +LTAASFN +L+  +G
Sbjct  72   ATGVPRLGVPPYEWWSEALHGVSDVGPGVHFNGTVPGATSFPATILTAASFNTSLWLKMG  131

Query  485  KVISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQE  664
            +V+STEARAMHN GLAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  KYA  +V+GLQ+
Sbjct  132  EVVSTEARAMHNVGLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQD  191

Query  665  -RDDGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
              D G   +LKV++CCKHYTAYD+D+WKG  R++F++
Sbjct  192  VHDAGKSRRLKVSSCCKHYTAYDLDNWKGIDRFHFDA  228



>ref|XP_006306829.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
 gb|EOA39727.1| hypothetical protein CARUB_v10008371mg [Capsella rubella]
Length=768

 Score =   270 bits (691),  Expect = 8e-81, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 155/210 (74%), Gaps = 4/210 (2%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V+      +ACDT K+    +L FC   + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  22   VRVHCRETFACDT-KDAATATLRFCQMSVPIPERVRDLIGRLTLAEKVSLLGNTAAAIPR  80

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGI  YEWWSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S E
Sbjct  81   LGIKGYEWWSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNE  140

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N G+ GLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAAA+VRGLQ  D   +
Sbjct  141  ARAMYNGGVGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAAAYVRGLQGND---R  197

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
             +LKVAACCKH+TAYD+D+W G  R++FN+
Sbjct  198  SRLKVAACCKHFTAYDLDNWNGVDRFHFNA  227



>ref|XP_003535953.1| PREDICTED: probable beta-D-xylosidase 2 [Glycine max]
Length=771

 Score =   270 bits (691),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 152/202 (75%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  85

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGG  145

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQE  DGN  +LKVAA 
Sbjct  146  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGKYAASYVRGLQE-TDGN--RLKVAAS  202

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  203  CKHFTAYDLDNWNGVDRFHFNA  224



>ref|XP_012084033.1| PREDICTED: putative beta-D-xylosidase [Jatropha curcas]
 gb|KDP27887.1| hypothetical protein JCGZ_18967 [Jatropha curcas]
Length=775

 Score =   270 bits (691),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 154/202 (76%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  +N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  34   FACDP-RNGLTRNLIFCRVNVPIHVRVRDLLGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  92

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPGV F G  P ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N G
Sbjct  93   WSEALHGVSNVGPGVKFGGAFPGATSFPQVITTAASFNESLWEQIGRVVSDEARAMYNGG  152

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
            LAGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ    GN  +LKVAAC
Sbjct  153  LAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQS-ITGN--RLKVAAC  209

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKHYTAYD+D+W G  R++FN+
Sbjct  210  CKHYTAYDLDNWNGVDRFHFNA  231



>ref|XP_006406478.1| hypothetical protein EUTSA_v10022061mg [Eutrema salsugineum]
 gb|ESQ47931.1| hypothetical protein EUTSA_v10022061mg [Eutrema salsugineum]
Length=749

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 126/205 (61%), Positives = 155/205 (76%), Gaps = 5/205 (2%)
 Frame = +2

Query  167  YACDTVKN-PGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  343
            +ACD  KN P      FCN  L  + R  DLV RL+L EK+  LVN A  V RLG+P YE
Sbjct  27   FACD--KNAPATAKYGFCNVSLSYEARAKDLVSRLSLKEKVQQLVNRATGVPRLGVPPYE  84

Query  344  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  523
            WWSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN 
Sbjct  85   WWSEALHGVSDVGPGVRFNGTVPGATSFPAVILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  524  GLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKE--KLKV  697
            GLAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  KYA  +V+GLQ+  DG ++  +LKV
Sbjct  145  GLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQDVHDGGRKSRRLKV  204

Query  698  AACCKHYTAYDVDDWKGYQRYNFNS  772
            ++CCKHYTAYD+D+WKG  R++F++
Sbjct  205  SSCCKHYTAYDLDNWKGIDRFHFDA  229



>ref|XP_003592512.1| Xylosidase [Medicago truncatula]
 gb|AES62763.1| beta-D-xylosidase-like protein [Medicago truncatula]
Length=781

 Score =   270 bits (691),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 127/217 (59%), Positives = 159/217 (73%), Gaps = 7/217 (3%)
 Frame = +2

Query  131  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  310
             I P+ SQ    +ACD   +P   + PFCN  L  +TR  DLV RLTL EK   LVN + 
Sbjct  15   FILPITSQK---HACDK-GSPKTSNFPFCNTSLSYETRAKDLVSRLTLQEKAQQLVNPST  70

Query  311  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  490
             +SRLG+P YEWWSEALHG+S  GPG  F   VP ATSFP  +L+AASFNETL++T+G+V
Sbjct  71   GISRLGVPAYEWWSEALHGVSNVGPGTRFDSRVPGATSFPAVILSAASFNETLWYTMGQV  130

Query  491  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERD  670
            +S EARAM+N  LAGLT+WSPN+N+FRDPRWGRGQE PGEDP +  +YA  +VRGLQE  
Sbjct  131  VSNEARAMYNVDLAGLTFWSPNVNVFRDPRWGRGQETPGEDPLVVSRYAVNYVRGLQEVG  190

Query  671  D---GNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
            D      ++LKV++CCKHYTAYDVD+WKG  R++F++
Sbjct  191  DEASAKGDRLKVSSCCKHYTAYDVDNWKGVDRFHFDA  227



>ref|XP_002527511.1| Beta-glucosidase, putative [Ricinus communis]
 gb|EEF34909.1| Beta-glucosidase, putative [Ricinus communis]
Length=810

 Score =   271 bits (692),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/217 (59%), Positives = 159/217 (73%), Gaps = 7/217 (3%)
 Frame = +2

Query  131  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  310
            +I P+ SQ    +ACD   +P      FCN  L  + R  DL+ RLTL EK+  +VN A 
Sbjct  16   VIFPIASQN---FACDK-NSPQTNDYSFCNTSLSYQDRAKDLISRLTLQEKVQQVVNHAA  71

Query  311  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  490
             + RLGIP YEWWSEALHG+S  G GV F G VP ATSFP  +L+AASFNETL+  +G+V
Sbjct  72   GIPRLGIPAYEWWSEALHGVSNVGFGVRFNGTVPGATSFPAMILSAASFNETLWLKMGQV  131

Query  491  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQER-  667
            +STEAR MH+ GLAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  +YA  +VRGLQE  
Sbjct  132  VSTEARTMHSVGLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSRYAVNYVRGLQEVG  191

Query  668  DDGNK--EKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
            D+GN   +KLKV++CCKHYTAYD+D WKG  R++F++
Sbjct  192  DEGNSTADKLKVSSCCKHYTAYDLDKWKGVDRFHFDA  228



>emb|CDY33913.1| BnaA02g30740D [Brassica napus]
Length=772

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 153/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P++ACD   N   ++L FC   + V  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  33   PLFACDPA-NGLTRTLRFCRVNVPVHARVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  91

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  92   EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  151

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ    GN  +LKVA
Sbjct  152  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGNGAGN--RLKVA  209

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            ACCKHYTAYD+D+W G  R++FN+
Sbjct  210  ACCKHYTAYDLDNWNGVDRFHFNA  233



>emb|CDY05634.1| BnaC02g39030D [Brassica napus]
Length=772

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 153/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P++ACD   N   ++L FC   + V  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  33   PLFACDPA-NGLTRTLRFCRVNVPVHARVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  91

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  92   EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEDIGRVVSDEARAMYN  151

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ    GN  +LKVA
Sbjct  152  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGNGAGN--RLKVA  209

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            ACCKHYTAYD+D+W G  R++FN+
Sbjct  210  ACCKHYTAYDLDNWNGVDRFHFNA  233



>ref|XP_010481135.1| PREDICTED: probable beta-D-xylosidase 2 [Camelina sativa]
Length=769

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 154/202 (76%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACDT K+    +L FC   + ++ RV DL+ RLTL EK++ L NTA  + RLGI  YEW
Sbjct  31   FACDT-KDAATATLRFCQLSVAIQERVKDLIGRLTLAEKVSLLGNTAAAIPRLGIKGYEW  89

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S EARAM+N G
Sbjct  90   WSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNEARAMYNGG  149

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
            + GLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ  D   + +LKVAAC
Sbjct  150  VGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGND---RSRLKVAAC  206

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  207  CKHFTAYDLDNWNGVDRFHFNA  228



>gb|AFU54452.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Prunus salicina]
Length=775

 Score =   270 bits (690),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 131/213 (62%), Positives = 155/213 (73%), Gaps = 5/213 (2%)
 Frame = +2

Query  134  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  313
            IG V ++  P +ACD   NP  + L FC   + +  RV DL+ RLTL EKI  LVN A  
Sbjct  23   IGVVHAR--PPFACDP-HNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIA  79

Query  314  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  493
            V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+V+
Sbjct  80   VPRLGIQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRVV  139

Query  494  STEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDD  673
              EARAM+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ   D
Sbjct  140  PDEARAMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLASKYAARYVKGLQ--GD  197

Query  674  GNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
            G   +LKVAACCKHYTAYD+D+W G  R++FN+
Sbjct  198  GAGNRLKVAACCKHYTAYDLDNWNGVNRFHFNA  230



>ref|XP_006488872.1| PREDICTED: LOW QUALITY PROTEIN: beta-D-xylosidase 1-like [Citrus 
sinensis]
Length=826

 Score =   271 bits (692),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/203 (64%), Positives = 153/203 (75%), Gaps = 6/203 (3%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  +N   +SL FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  68   FACDP-RNGLTRSLRFCRTSVPIHVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  126

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  P ATSFPQ + TAA+FNE+L+  IG+V+S EARAM+N G
Sbjct  127  WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAAAFNESLWEEIGRVVSDEARAMYNGG  186

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK-EKLKVAA  703
            +AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ    GN   +LKVAA
Sbjct  187  MAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQ----GNTGSRLKVAA  242

Query  704  CCKHYTAYDVDDWKGYQRYNFNS  772
            CCKHYTAYD+D+W G  RY+FN+
Sbjct  243  CCKHYTAYDLDNWNGVDRYHFNA  265



>ref|XP_009779847.1| PREDICTED: probable beta-D-xylosidase 5 [Nicotiana sylvestris]
Length=794

 Score =   270 bits (690),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/215 (60%), Positives = 152/215 (71%), Gaps = 8/215 (4%)
 Frame = +2

Query  140  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  319
            P  SQ    Y  D    P   +  FCN  L    R  DLV RLTL EK+  LVN+A  + 
Sbjct  19   PCNSQIHACYKSD----PNTSTYGFCNISLAYTDRAKDLVSRLTLQEKVGQLVNSASGIP  74

Query  320  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            RLG+P YEWWSEALHG+S TGPGV F   VP ATS P  +L+AASFN  L++T+GKV+ST
Sbjct  75   RLGVPAYEWWSEALHGVSNTGPGVRFNATVPGATSLPAVILSAASFNVLLWYTLGKVVST  134

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDD--  673
            EARAMHN GLAGLTYWSPN+N+ RDPRWGR QE PGEDP +  KYA  +VRGLQE D   
Sbjct  135  EARAMHNVGLAGLTYWSPNVNVLRDPRWGRAQETPGEDPLVVSKYAVNYVRGLQEVDGEE  194

Query  674  --GNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
               ++ KLKV++CCKHYTAYD+DDWKG  RY+F++
Sbjct  195  YFSSQNKLKVSSCCKHYTAYDLDDWKGIDRYHFDA  229



>gb|KHN19223.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=681

 Score =   268 bits (684),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 152/202 (75%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  KN   +++PFC   L +  RV DLV RLTL EK+  LVN A  V RLG+  YEW
Sbjct  31   FACDP-KNGATENMPFCKASLAIPERVKDLVGRLTLQEKVRLLVNNAAAVPRLGMKGYEW  89

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPGV F    P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  90   WSEALHGVSNVGPGVKFNAQFPGATSFPQVITTAASFNASLWEAIGQVVSDEARAMYNGG  149

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L G YAA++VRGLQ   DGN  +LKVAAC
Sbjct  150  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGTYAASYVRGLQG-TDGN--RLKVAAC  206

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  207  CKHFTAYDLDNWNGMDRFHFNA  228



>ref|XP_008386729.1| PREDICTED: probable beta-D-xylosidase 2 [Malus domestica]
Length=788

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 130/211 (62%), Positives = 157/211 (74%), Gaps = 4/211 (2%)
 Frame = +2

Query  140  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  319
            P   +    +AC+  K+   K LPFC   L V+ RV DL+ RLTL EK+  LVNTA  V 
Sbjct  28   PKTCEGGESFACNP-KDAATKDLPFCRATLPVQDRVRDLLGRLTLQEKVKLLVNTALPVP  86

Query  320  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            RLGI  YEWWSEALHG+S  GPG  F GV P ATSFPQ + TAASFN +L+  IG+V+S 
Sbjct  87   RLGIKGYEWWSEALHGVSNVGPGTKFGGVFPGATSFPQVITTAASFNASLWEAIGRVVSD  146

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGN  679
            EARAM+N G+AGLTYWSPN+NI RDPRWGR QE PGEDPT+ G+YAA++VRGLQ  DD N
Sbjct  147  EARAMYNGGVAGLTYWSPNVNILRDPRWGRAQETPGEDPTVVGRYAASYVRGLQG-DDSN  205

Query  680  KEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
              +LKVAACCKH+TAYD+D+W G  R++FN+
Sbjct  206  --RLKVAACCKHFTAYDLDNWNGVDRFHFNA  234



>ref|XP_004487789.1| PREDICTED: beta-D-xylosidase 1-like [Cicer arietinum]
Length=776

 Score =   270 bits (689),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 129/202 (64%), Positives = 153/202 (76%), Gaps = 3/202 (1%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  KN   +   FCN+ + +  RV DL+ RLTL EKI  +VN A  V RLGI  YEW
Sbjct  31   FACDP-KNGLTRGYIFCNKNVPIHVRVQDLIGRLTLAEKIRLVVNNAIEVQRLGIQGYEW  89

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN++L+  IG+V+S EARAM+N G
Sbjct  90   WSEALHGVSNVGPGTKFGGPFPAATSFPQVITTAASFNQSLWLQIGRVVSDEARAMYNGG  149

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
             AGLTYWSPN+NIFRDPRWGRGQE PGEDPTL GKYAA +V+GLQ   DG   +LKVAAC
Sbjct  150  AAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLAGKYAANYVQGLQ--GDGAGNRLKVAAC  207

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKHYTAYD+D+W G  R++FN+
Sbjct  208  CKHYTAYDLDNWNGVDRFHFNA  229



>ref|XP_003519750.1| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=772

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 151/202 (75%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  28   FACDP-KNTATKNLPFCKASLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  86

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGG  146

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ   DGN  +LKVAA 
Sbjct  147  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGKYAASYVRGLQG-TDGN--RLKVAAS  203

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  204  CKHFTAYDLDNWNGVDRFHFNA  225



>gb|KFK42620.1| hypothetical protein AALP_AA1G019000 [Arabis alpina]
Length=766

 Score =   269 bits (687),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/214 (59%), Positives = 156/214 (73%), Gaps = 4/214 (2%)
 Frame = +2

Query  131  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  310
            I   V   +   +ACDT  N   K+L FC   + +  RV DL+ RLTL EK++ L NTA 
Sbjct  17   ITSSVCVHSRETFACDT-NNAATKTLRFCQVSVPLPERVRDLIGRLTLAEKVSLLGNTAA  75

Query  311  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  490
             + RLGI  YEWWSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V
Sbjct  76   AIPRLGIKGYEWWSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNTSLWESIGRV  135

Query  491  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERD  670
            +S EARAM+N G+ GLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ  D
Sbjct  136  VSNEARAMYNGGVGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGND  195

Query  671  DGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
               + +LKVAACCKH+TAYD+D+W G  R++FN+
Sbjct  196  ---RNRLKVAACCKHFTAYDLDNWNGVDRFHFNA  226



>ref|XP_002889410.1| hypothetical protein ARALYDRAFT_470222 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65669.1| hypothetical protein ARALYDRAFT_470222 [Arabidopsis lyrata subsp. 
lyrata]
Length=763

 Score =   269 bits (687),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/210 (59%), Positives = 156/210 (74%), Gaps = 4/210 (2%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            V  Q+   +ACD +K+    +L FC   + +  RV DL+ RLTL EK++ L NTA  + R
Sbjct  17   VCVQSRETFACD-IKDAATATLRFCQLSVPITERVKDLIGRLTLVEKVSLLGNTAAAIPR  75

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGI  YEWWSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S E
Sbjct  76   LGIKGYEWWSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNE  135

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N G+ GLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ  D   +
Sbjct  136  ARAMYNGGVGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGND---R  192

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
             +LKVAACCKH+TAYD+D+W G  R++FN+
Sbjct  193  SRLKVAACCKHFTAYDLDNWNGVDRFHFNA  222



>ref|XP_002316021.1| beta-D-xylosidase family protein [Populus trichocarpa]
 gb|EEF02192.1| beta-D-xylosidase family protein [Populus trichocarpa]
Length=768

 Score =   269 bits (687),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 152/203 (75%), Gaps = 6/203 (3%)
 Frame = +2

Query  167  YACDTVKNPGL-KSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  343
            +ACD     GL +SL FC   L +  RV DL+ RLTL EKI  LVN A  V RLGI  YE
Sbjct  28   FACD--PKLGLTRSLKFCRVNLPIHVRVRDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYE  85

Query  344  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  523
            WWSEALHG+S  GPG  F G  P AT+FPQ + TAASFNE+L+  IG+V+S EARAM+N 
Sbjct  86   WWSEALHGVSNVGPGTKFGGAFPGATAFPQVITTAASFNESLWEEIGRVVSDEARAMYNG  145

Query  524  GLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAA  703
            G+AGLTYWSPN+N+FRDPRWGRGQE PGEDP + GKYAA++VRGLQ     N  +LKVAA
Sbjct  146  GMAGLTYWSPNVNVFRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ---GNNGLRLKVAA  202

Query  704  CCKHYTAYDVDDWKGYQRYNFNS  772
            CCKHYTAYD+D+W G  RY+FN+
Sbjct  203  CCKHYTAYDLDNWNGVDRYHFNA  225



>ref|XP_009111875.1| PREDICTED: beta-D-xylosidase 1-like [Brassica rapa]
Length=787

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 129/205 (63%), Positives = 154/205 (75%), Gaps = 6/205 (3%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P++ACD   N   ++L FC   L V+ RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  49   PLFACDPA-NELTRTLRFCQVNLPVRVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  107

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  108  EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  167

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK-EKLKV  697
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ    GN   +LKV
Sbjct  168  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVVGKYAASYVRGLQ----GNGPSRLKV  223

Query  698  AACCKHYTAYDVDDWKGYQRYNFNS  772
            AACCKHYTAYD+D+W G  R++FN+
Sbjct  224  AACCKHYTAYDLDNWNGVDRFHFNA  248



>ref|XP_009804071.1| PREDICTED: beta-D-xylosidase 1 isoform X2 [Nicotiana sylvestris]
Length=665

 Score =   267 bits (682),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 153/207 (74%), Gaps = 1/207 (0%)
 Frame = +2

Query  152  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  331
            ++ P +ACD   N G ++LPFC   L +  RV DL++RLTL EKI  LVN A  V RLG+
Sbjct  27   ESRPAFACDPA-NAGTRNLPFCKTSLPIHVRVQDLIQRLTLQEKIRLLVNNAAPVERLGV  85

Query  332  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARA  511
              YEWWSEALHG+S TGPGV F G  P+ATSFPQ + TAASFN +L+  IG+V+S E RA
Sbjct  86   NGYEWWSEALHGVSSTGPGVKFGGAFPSATSFPQVITTAASFNASLWEQIGQVVSDEGRA  145

Query  512  MHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKL  691
            M+N G AGLT+WSPN+NI RDPRWGR QE PGEDP L  +YA ++V+GLQ        +L
Sbjct  146  MYNGGAAGLTFWSPNVNILRDPRWGRCQETPGEDPHLVAQYAISYVKGLQGGGGRGTSRL  205

Query  692  KVAACCKHYTAYDVDDWKGYQRYNFNS  772
            KVAACCKHYTAYD+DDW G+ RY+FN+
Sbjct  206  KVAACCKHYTAYDLDDWNGFDRYHFNA  232



>ref|XP_003594795.1| Beta xylosidase [Medicago truncatula]
 gb|AES65046.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=762

 Score =   269 bits (687),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 154/202 (76%), Gaps = 3/202 (1%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  KN   +S  FCN R+ +  RV DL+ RL LPEKI  +VN A  V RLGI  YEW
Sbjct  27   FACDP-KNGLTRSYKFCNTRVPIHARVQDLIGRLALPEKIRLVVNNAIAVPRLGIQGYEW  85

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G   AATSFPQ + TAASFN++L+  IG+++S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTKFGGAFSAATSFPQVITTAASFNQSLWLEIGRIVSDEARAMYNGG  145

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
             AGLT+WSPN+NIFRDPRWGRGQE PGEDPT+ GKYAA++V+GLQ    GN  +LKVAAC
Sbjct  146  AAGLTFWSPNVNIFRDPRWGRGQETPGEDPTVAGKYAASYVQGLQGNGAGN--RLKVAAC  203

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKHYTAYD+D+W G  R++FN+
Sbjct  204  CKHYTAYDLDNWNGVDRFHFNA  225



>ref|XP_009129779.1| PREDICTED: beta-D-xylosidase 1-like [Brassica rapa]
Length=772

 Score =   269 bits (687),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 153/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P++ACD   N   ++L FC   + V  RV DL+ RL+L EKI  LVN A  V RLGI  Y
Sbjct  33   PLFACDPA-NGLTRTLRFCRVNVPVHARVQDLIGRLSLQEKIRLLVNNAAAVPRLGIGGY  91

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  92   EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  151

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ    GN  +LKVA
Sbjct  152  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGNGAGN--RLKVA  209

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            ACCKHYTAYD+D+W G  R++FN+
Sbjct  210  ACCKHYTAYDLDNWNGVDRFHFNA  233



>emb|CDY00033.1| BnaC09g02680D [Brassica napus]
Length=788

 Score =   269 bits (688),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/205 (62%), Positives = 155/205 (76%), Gaps = 6/205 (3%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P++ACD+  N   ++L FC   + V+ RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  49   PLFACDSA-NELTRTLRFCQVNIPVRMRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  107

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  108  EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  167

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK-EKLKV  697
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ    GN   +LKV
Sbjct  168  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVVGKYAASYVRGLQ----GNGPNRLKV  223

Query  698  AACCKHYTAYDVDDWKGYQRYNFNS  772
            AACCKHYTAYD+D+W G  R++FN+
Sbjct  224  AACCKHYTAYDLDNWNGVDRFHFNA  248



>ref|XP_010546993.1| PREDICTED: beta-D-xylosidase 1-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010546994.1| PREDICTED: beta-D-xylosidase 1-like isoform X2 [Tarenaya hassleriana]
 ref|XP_010546995.1| PREDICTED: beta-D-xylosidase 1-like isoform X3 [Tarenaya hassleriana]
Length=775

 Score =   269 bits (687),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/204 (63%), Positives = 154/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P +ACD   N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  31   PPFACDPA-NGLTRTLRFCRVNVPLHLRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  89

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPGV F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  90   EWWSEALHGVSDVGPGVRFGGQFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  149

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             G+AGL+YWSPN+NIFRDPRWGRGQE PGEDP + GKYAA++VRGLQ    GN  +LKVA
Sbjct  150  GGMAGLSYWSPNVNIFRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGNAVGN--RLKVA  207

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            ACCKHYTAYD+D+W G  R++FN+
Sbjct  208  ACCKHYTAYDLDNWNGVDRFHFNA  231



>ref|XP_009603126.1| PREDICTED: probable beta-D-xylosidase 5 [Nicotiana tomentosiformis]
Length=790

 Score =   269 bits (688),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/215 (59%), Positives = 153/215 (71%), Gaps = 8/215 (4%)
 Frame = +2

Query  140  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  319
            P  SQ    Y  D    P   +  FCN  L    R  D+V RLTL EK+  LVN+A  + 
Sbjct  19   PCNSQIHACYKSD----PNTSTYGFCNTSLAYTDRAKDIVSRLTLQEKVRQLVNSASGIP  74

Query  320  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            RLG+P YEWWSEALHG+S TGPGV F   VP ATS P  +L+AASFN +L++T+GKV+ST
Sbjct  75   RLGVPAYEWWSEALHGVSNTGPGVRFNATVPGATSLPAVILSAASFNVSLWYTLGKVVST  134

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDD--  673
            EARAMHN GLAGLTYWSPN+N+ RDPRWGR QE PGEDP +  KYA  +VRGLQE D   
Sbjct  135  EARAMHNVGLAGLTYWSPNVNVLRDPRWGRAQETPGEDPLVVSKYAVNYVRGLQEVDGEE  194

Query  674  --GNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
               ++ KLKV++CCKHYTAYD+D+WKG  RY+F++
Sbjct  195  YFSSQNKLKVSSCCKHYTAYDLDNWKGIDRYHFDA  229



>ref|XP_010679361.1| PREDICTED: probable beta-D-xylosidase 2 [Beta vulgaris subsp. 
vulgaris]
Length=765

 Score =   268 bits (686),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 152/202 (75%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +AC+  K+ G ++ PFC   L V  RV DL+ RLTL EK+  LV+ A  V RLGI  YEW
Sbjct  26   FACNP-KHAGFRAFPFCKTTLPVGDRVRDLIGRLTLQEKVKLLVDNAAAVPRLGIQDYEW  84

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  85   WSEALHGVSNVGPGTKFGGKFPTATSFPQVITTAASFNASLWEEIGRVVSDEARAMYNGG  144

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
            +AGLTYWSPN+NI RDPRWGRGQE PGEDP L GKYAA++VRGLQ  D    ++LKVAAC
Sbjct  145  MAGLTYWSPNVNILRDPRWGRGQETPGEDPVLAGKYAASYVRGLQGTDG---DRLKVAAC  201

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKHYTAYD+D+W G  R++FN+
Sbjct  202  CKHYTAYDLDNWGGVDRFHFNA  223



>emb|CDY58860.1| BnaCnng33860D [Brassica napus]
Length=771

 Score =   269 bits (687),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 151/204 (74%), Gaps = 3/204 (1%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD   +P      FC   L  + R  DLV RL+L EK+  LVN A  V RLG+P YEW
Sbjct  27   FACDR-NDPATAKYTFCKASLSYEARAKDLVSRLSLKEKVQQLVNKATGVPRLGVPPYEW  85

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSNVGPGVRFNGTVPGATSFPAVILTAASFNTSLWLKMGEVVSTEARAMHNVG  145

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDD--GNKEKLKVA  700
            LAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  KYA  +V+GLQ+  D  G   +LKV+
Sbjct  146  LAGLTYWSPNINVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQDVHDAGGKSRRLKVS  205

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            +CCKHYTAYD+D+WKG  R++F++
Sbjct  206  SCCKHYTAYDLDNWKGIDRFHFDA  229



>gb|KHG05051.1| putative beta-D-xylosidase 2 -like protein [Gossypium arboreum]
Length=776

 Score =   269 bits (687),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 151/202 (75%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD+ K+    SLPFC   + +  RV DL+ RLT+ EK+  LVN A  V RLGI  YEW
Sbjct  34   FACDS-KDAKTSSLPFCKVSMPIPNRVTDLLGRLTMQEKVRLLVNNAAAVPRLGIKGYEW  92

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM+N G
Sbjct  93   WSEALHGVSNVGPGTKFGGAFPGATSFPQVISTAASFNATLWEAIGRVVSDEARAMYNGG  152

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L G YAA++V+GLQ     N ++LKVAAC
Sbjct  153  AAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGTYAASYVKGLQ---GNNGDRLKVAAC  209

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  210  CKHFTAYDLDNWNGVDRFHFNA  231



>ref|XP_008808663.1| PREDICTED: beta-D-xylosidase 1-like [Phoenix dactylifera]
Length=772

 Score =   268 bits (686),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 128/213 (60%), Positives = 155/213 (73%), Gaps = 5/213 (2%)
 Frame = +2

Query  140  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  319
            P  +   P +AC      GL   PFC   L ++ RVADL+ RLTL EKI  LVN A  V 
Sbjct  20   PGGAAARPAFACGGGPAVGL---PFCRAALPIRARVADLIGRLTLDEKIRLLVNNAAGVP  76

Query  320  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            RLGI  YEWWSEALHG+S  GPGV+F G  P ATSFPQ + +AASFN TL+  IGK +S 
Sbjct  77   RLGIGGYEWWSEALHGVSNVGPGVHFGGAYPGATSFPQVISSAASFNATLWELIGKAVSD  136

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDG-  676
            EARAM+N G AGLT+WSPN+NIFRDPRWGRGQE PGEDP + G+YA ++VRGLQ+   G 
Sbjct  137  EARAMYNGGQAGLTFWSPNVNIFRDPRWGRGQETPGEDPGVAGRYAVSYVRGLQQPYGGP  196

Query  677  -NKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
             +  +LK+AACCKHYTAYD+D+W+G  RY+FN+
Sbjct  197  HDHSRLKLAACCKHYTAYDLDNWRGVDRYHFNA  229



>ref|XP_004151112.1| PREDICTED: beta-D-xylosidase 1-like [Cucumis sativus]
 gb|KGN47391.1| hypothetical protein Csa_6G309980 [Cucumis sativus]
Length=770

 Score =   268 bits (686),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 152/200 (76%), Gaps = 3/200 (2%)
 Frame = +2

Query  173  CDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEWWS  352
            CD  +N G +++ FC + L ++ RV DL+ RLTL EKI  LVN A  V RLGI  YEWWS
Sbjct  34   CDK-RNVGTRNMGFCQESLGIEERVKDLIGRLTLGEKIRLLVNNAIAVPRLGIRGYEWWS  92

Query  353  EALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYGLA  532
            EALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N G A
Sbjct  93   EALHGVSNVGPGTKFGGTFPGATSFPQVITTAASFNQSLWLLIGRVVSDEARAMYNGGTA  152

Query  533  GLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAACCK  712
            GLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ  D   K++LKVAACCK
Sbjct  153  GLTYWSPNVNIFRDPRWGRGQETPGEDPILAAKYAANYVQGLQGND--GKKRLKVAACCK  210

Query  713  HYTAYDVDDWKGYQRYNFNS  772
            HYTAYD+D+W G  RY+FN+
Sbjct  211  HYTAYDLDNWNGVDRYHFNA  230



>ref|XP_009145766.1| PREDICTED: probable beta-D-xylosidase 5 [Brassica rapa]
Length=782

 Score =   268 bits (686),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 151/204 (74%), Gaps = 3/204 (1%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD   +P      FC   L  + R  DLV RL+L EK+  LVN A  V RLG+P YEW
Sbjct  27   FACDR-NDPATVKYTFCKASLSYEARAKDLVSRLSLTEKVQQLVNKATGVPRLGVPPYEW  85

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN G
Sbjct  86   WSEALHGVSNVGPGVRFNGTVPGATSFPAVILTAASFNTSLWLKMGEVVSTEARAMHNVG  145

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDD--GNKEKLKVA  700
            LAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  KYA  +V+GLQ+  D  G   +LKV+
Sbjct  146  LAGLTYWSPNINVFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQDVHDAGGKSRRLKVS  205

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            +CCKHYTAYD+D+WKG  R++F++
Sbjct  206  SCCKHYTAYDLDNWKGIDRFHFDA  229



>ref|XP_007042636.1| Glycosyl hydrolase family protein [Theobroma cacao]
 gb|EOX98467.1| Glycosyl hydrolase family protein [Theobroma cacao]
Length=852

 Score =   270 bits (689),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 124/217 (57%), Positives = 157/217 (72%), Gaps = 7/217 (3%)
 Frame = +2

Query  131  IIGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAG  310
            ++ P  +Q    +ACD   +P     PFC+  L  + R  DLV  LTL EK+  LVNTA 
Sbjct  76   LVVPCNTQQ---FACDK-NDPNTSQFPFCDYALSYEDRAKDLVSHLTLQEKVQQLVNTAS  131

Query  311  NVSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKV  490
             +SRLG+P YEWWSEALHG+S  GPG  F   VP ATSFP  +L+AASFN TL+  +G+V
Sbjct  132  GISRLGVPAYEWWSEALHGVSDLGPGTRFNATVPGATSFPAVILSAASFNATLWFKMGQV  191

Query  491  ISTEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQE--  664
            +STEARAM+N GLAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  +YA  +VRGLQE  
Sbjct  192  VSTEARAMYNVGLAGLTYWSPNVNVFRDPRWGRGQETPGEDPLVVSRYAVNYVRGLQEVG  251

Query  665  -RDDGNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
               +   +KLKV++CCKHYTAYD+D+WKG  R++F++
Sbjct  252  GESNSTHDKLKVSSCCKHYTAYDLDNWKGVDRFHFDA  288



>gb|KJB09457.1| hypothetical protein B456_001G143600 [Gossypium raimondii]
Length=797

 Score =   268 bits (686),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 151/202 (75%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD+ K+    SLPFC   + +  RV DL+ RLT+ EK+  LVN A  V RLGI  YEW
Sbjct  55   FACDS-KDAKTSSLPFCKVSMPIPNRVTDLLGRLTMQEKVRLLVNNAAAVPRLGIKGYEW  113

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN TL+  IG+V+S EARAM+N G
Sbjct  114  WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNATLWEAIGRVVSDEARAMYNGG  173

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L G YAA++V+GLQ     N ++LKVAAC
Sbjct  174  AAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGTYAASYVKGLQ---GNNGDRLKVAAC  230

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  231  CKHFTAYDLDNWNGVDRFHFNA  252



>ref|NP_563659.1| probable beta-D-xylosidase 2 [Arabidopsis thaliana]
 sp|Q94KD8.1|BXL2_ARATH RecName: Full=Probable beta-D-xylosidase 2; Short=AtBXL2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAK56255.1|AF367266_1 At1g02640/T14P4_11 [Arabidopsis thaliana]
 gb|AAN28891.1| At1g02640/T14P4_11 [Arabidopsis thaliana]
 gb|AEE27453.1| probable beta-D-xylosidase 2 [Arabidopsis thaliana]
Length=768

 Score =   268 bits (685),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 153/202 (76%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACDT K+    +L FC   + +  RV DL+ RLTL EK++ L NTA  + RLGI  YEW
Sbjct  30   FACDT-KDAATATLRFCQLSVPIPERVRDLIGRLTLAEKVSLLGNTAAAIPRLGIKGYEW  88

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S EARAM+N G
Sbjct  89   WSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNEARAMYNGG  148

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
            + GLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ  D   + +LKVAAC
Sbjct  149  VGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGND---RSRLKVAAC  205

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  206  CKHFTAYDLDNWNGVDRFHFNA  227



>gb|AAG10624.1|AC022521_2 Similar to xylosidase [Arabidopsis thaliana]
Length=763

 Score =   268 bits (685),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 123/202 (61%), Positives = 153/202 (76%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACDT K+    +L FC   + +  RV DL+ RLTL EK++ L NTA  + RLGI  YEW
Sbjct  25   FACDT-KDAATATLRFCQLSVPIPERVRDLIGRLTLAEKVSLLGNTAAAIPRLGIKGYEW  83

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+S EARAM+N G
Sbjct  84   WSEALHGVSNVGPGTKFGGVYPAATSFPQVITTVASFNASLWESIGRVVSNEARAMYNGG  143

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
            + GLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ  D   + +LKVAAC
Sbjct  144  VGGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGND---RSRLKVAAC  200

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  201  CKHFTAYDLDNWNGVDRFHFNA  222



>ref|XP_009383731.1| PREDICTED: probable beta-D-xylosidase 2 [Musa acuminata subsp. 
malaccensis]
Length=781

 Score =   268 bits (685),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/190 (63%), Positives = 150/190 (79%), Gaps = 1/190 (1%)
 Frame = +2

Query  206  LPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEWWSEALHGLSYTGP  385
            LPFC +   ++ R  DLV RLT+ EK+  LVNTA  V RLGIP Y+WWSEALHG+S +GP
Sbjct  48   LPFCQRGQPIRARARDLVGRLTVAEKVALLVNTAAGVPRLGIPGYQWWSEALHGVSNSGP  107

Query  386  GVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYGLAGLTYWSPNMNI  565
            GV F G  P ATSFPQ + +AASFN TL+  +G+V+S EARAM+N G AGLT+WSPN+NI
Sbjct  108  GVRFGGAFPGATSFPQVISSAASFNATLWELMGQVVSDEARAMYNGGQAGLTFWSPNVNI  167

Query  566  FRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKE-KLKVAACCKHYTAYDVDDW  742
            +RDPRWGRGQE PGEDP ++ +YAAA+VRGLQ+ + G    +LKVAACCKHYTAYD+D+W
Sbjct  168  YRDPRWGRGQETPGEDPAVSARYAAAYVRGLQQANGGTSHARLKVAACCKHYTAYDLDNW  227

Query  743  KGYQRYNFNS  772
            KG  R++FN+
Sbjct  228  KGVDRFHFNA  237



>ref|XP_006395069.1| hypothetical protein EUTSA_v10003681mg [Eutrema salsugineum]
 gb|ESQ32355.1| hypothetical protein EUTSA_v10003681mg [Eutrema salsugineum]
Length=773

 Score =   268 bits (685),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 153/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P++AC+   N   ++L FC   + V  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  34   PLFACNPA-NGLTRTLRFCRVNVPVHVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  92

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  93   EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  152

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ    GN  +LKVA
Sbjct  153  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGNGAGN--RLKVA  210

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            ACCKHYTAYD+D+W G  R++FN+
Sbjct  211  ACCKHYTAYDLDNWNGVDRFHFNA  234



>ref|XP_002311398.2| beta-D-xylosidase family protein [Populus trichocarpa]
 gb|EEE88765.2| beta-D-xylosidase family protein [Populus trichocarpa]
Length=771

 Score =   268 bits (685),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 152/203 (75%), Gaps = 6/203 (3%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  KN   +SL FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  31   FACDA-KNGLTRSLKFCRVNMPLHVRVRDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  89

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM N G
Sbjct  90   WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNKSLWEEIGRVVSDEARAMFNGG  149

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKE-KLKVAA  703
            +AGLTYWSPN+N+FRDPRWGRGQE PGEDP + GKYAA++VRGLQ    GN   +LKVAA
Sbjct  150  MAGLTYWSPNVNVFRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ----GNSGFRLKVAA  205

Query  704  CCKHYTAYDVDDWKGYQRYNFNS  772
            CCKHYTAYD+D+W G  RY+FN+
Sbjct  206  CCKHYTAYDLDNWNGVDRYHFNA  228



>gb|KHN08645.1| Putative beta-D-xylosidase 2 [Glycine soja]
Length=749

 Score =   267 bits (683),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 131/202 (65%), Positives = 151/202 (75%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  KN   K+LPFC   L    RV DL+ RLTL EK+  LVN A  V RLGI  YEW
Sbjct  28   FACDP-KNTATKNLPFCKAWLATGARVKDLIGRLTLQEKVNLLVNNAAAVPRLGIKGYEW  86

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGG  146

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ   DGN  +LKVAA 
Sbjct  147  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGKYAASYVRGLQG-TDGN--RLKVAAS  203

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  204  CKHFTAYDLDNWNGVDRFHFNA  225



>dbj|BAG28345.1| arabinofuranosidase [Citrus unshiu]
Length=769

 Score =   268 bits (684),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 129/203 (64%), Positives = 152/203 (75%), Gaps = 6/203 (3%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  +N   +SL FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  28   FACDP-RNGLTRSLRFCRTSVPIHVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  86

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  P ATSFPQ + TAA+FNE+L+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAAAFNESLWEEIGRVVSDEARAMYNGG  146

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK-EKLKVAA  703
            +AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VR LQ    GN   +LKVAA
Sbjct  147  MAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRRLQ----GNTGSRLKVAA  202

Query  704  CCKHYTAYDVDDWKGYQRYNFNS  772
            CCKHYTAYD+D+W G  RY+FN+
Sbjct  203  CCKHYTAYDLDNWNGVDRYHFNA  225



>ref|XP_006280043.1| hypothetical protein CARUB_v10025920mg [Capsella rubella]
 gb|EOA12941.1| hypothetical protein CARUB_v10025920mg [Capsella rubella]
Length=776

 Score =   268 bits (685),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 153/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P++ACD   N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  35   PLFACDPA-NGLTRTLRFCRVNVPIHVRVQDLIGRLTLQEKIRNLVNNAAAVPRLGIGGY  93

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  94   EWWSEALHGVSDVGPGARFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  153

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ    GN  +LKVA
Sbjct  154  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGTAAGN--RLKVA  211

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            ACCKHYTAYD+D+W G  R++FN+
Sbjct  212  ACCKHYTAYDLDNWNGVDRFHFNA  235



>ref|XP_009151303.1| PREDICTED: beta-D-xylosidase 1 [Brassica rapa]
Length=772

 Score =   268 bits (684),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 153/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P++AC+   N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  33   PLFACNPA-NGLTRTLRFCRVNVPIHVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  91

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  92   EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  151

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ    GN  +LKVA
Sbjct  152  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGNGAGN--RLKVA  209

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            ACCKHYTAYD+D+W G  R++FN+
Sbjct  210  ACCKHYTAYDLDNWNGVDRFHFNA  233



>emb|CDX85405.1| BnaC07g27160D [Brassica napus]
Length=772

 Score =   268 bits (684),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 153/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P++AC+   N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  33   PLFACNPA-NGLTRTLRFCRVNVPIHVRVQDLIGRLTLQEKIRLLVNNAAAVPRLGIGGY  91

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  92   EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  151

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ    GN  +LKVA
Sbjct  152  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPVVAGKYAASYVRGLQGNGAGN--RLKVA  209

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            ACCKHYTAYD+D+W G  R++FN+
Sbjct  210  ACCKHYTAYDLDNWNGVDRFHFNA  233



>ref|XP_006298950.1| hypothetical protein CARUB_v10015075mg [Capsella rubella]
 gb|EOA31848.1| hypothetical protein CARUB_v10015075mg [Capsella rubella]
Length=762

 Score =   268 bits (684),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 126/204 (62%), Positives = 153/204 (75%), Gaps = 4/204 (2%)
 Frame = +2

Query  167  YACDTVKN-PGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  343
            +ACD  KN P      FCN  L  + R  DLV RL+L EK+  LVN A  V RLG+P YE
Sbjct  27   FACD--KNAPATAKYGFCNVSLSYEARAKDLVLRLSLNEKVQQLVNKATGVPRLGVPPYE  84

Query  344  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  523
            WWSEALHG+S  GPGV F G VP ATSFP  +LTAASFN +L+  +G+V+STEARAMHN 
Sbjct  85   WWSEALHGVSNVGPGVRFNGTVPGATSFPATILTAASFNTSLWLKMGEVVSTEARAMHNV  144

Query  524  GLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQE-RDDGNKEKLKVA  700
            GLAGLTYWSPN+NIFRDPRWGRGQE PGEDP +  KYA  +V+GLQ+  + G   +LKV+
Sbjct  145  GLAGLTYWSPNVNIFRDPRWGRGQETPGEDPLVVSKYAVNYVKGLQDVHEAGKSRRLKVS  204

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            +CCKHYTAYD+D+WKG  R++F++
Sbjct  205  SCCKHYTAYDLDNWKGIDRFHFDA  228



>ref|XP_008390557.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score =   268 bits (684),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 151/204 (74%), Gaps = 3/204 (1%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P +ACD  +NP  + L FC  R+ +  RV DL+ RLTL EKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNPITRXLKFCRVRVPIXDRVHDLIGRLTLQEKIRLLVNNAIDVPRLGIQGY  89

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G    ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N
Sbjct  90   EWWSEALHGVSNVGPGTKFGGTFLGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYN  149

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             G AGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KY A +V+GLQ   DG   +LKVA
Sbjct  150  GGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLAAKYGARYVKGLQ--GDGXGNRLKVA  207

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            ACCKHYTAYD+D+W G  R++FN+
Sbjct  208  ACCKHYTAYDLDNWNGVDRFHFNA  231



>ref|XP_010440503.1| PREDICTED: beta-D-xylosidase 1 [Camelina sativa]
Length=775

 Score =   268 bits (684),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 153/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P++ACD   N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  34   PLFACDPA-NGLTRTLRFCRVNVPIHVRVQDLIGRLTLQEKIRNLVNNAAAVPRLGIGGY  92

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  93   EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  152

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ    GN  +LKVA
Sbjct  153  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPIVAGKYAASYVRGLQGTAAGN--RLKVA  210

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            ACCKHYTAYD+D+W G  R++FN+
Sbjct  211  ACCKHYTAYDLDNWNGVDRFHFNA  234



>ref|XP_006830079.1| PREDICTED: probable beta-D-xylosidase 5 [Amborella trichopoda]
 gb|ERM97495.1| hypothetical protein AMTR_s00125p00113140 [Amborella trichopoda]
Length=801

 Score =   268 bits (685),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 123/204 (60%), Positives = 153/204 (75%), Gaps = 5/204 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            YACD  +      LPFCN  L +  R  DLV RL L EK+  LVN A  V+RLG+P YEW
Sbjct  38   YACDKGE---AAPLPFCNISLPIHDRAQDLVSRLNLTEKVQQLVNKAAGVARLGVPPYEW  94

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GP V+F G +P ATSFP  +L+ ASFNETL+  +G+V+STEARAM+N G
Sbjct  95   WSEALHGVSNVGPAVHFNGTIPGATSFPAVILSGASFNETLWFVMGQVVSTEARAMYNTG  154

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDD--GNKEKLKVA  700
            LAGLTYWSPN+N+FRDPRWGRGQE PGEDP +  +YA  +VRGLQ+ D+   +   LKV+
Sbjct  155  LAGLTYWSPNVNVFRDPRWGRGQETPGEDPVVVSRYAVNYVRGLQDPDNEATSSNSLKVS  214

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            +CCKHYTAYDVD+WKG  R++F++
Sbjct  215  SCCKHYTAYDVDNWKGVDRFHFDA  238



>ref|XP_008341125.1| PREDICTED: putative beta-D-xylosidase [Malus domestica]
Length=776

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 151/204 (74%), Gaps = 3/204 (1%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P +ACD  +NP  + L FC  R+ +  RV DL+ RLTL EKI  LVN A +V RLGI  Y
Sbjct  31   PPFACDP-RNPITRXLKFCRVRVPIXDRVHDLIGRLTLQEKIRLLVNNAIDVPRLGIQGY  89

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G    ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N
Sbjct  90   EWWSEALHGVSNVGPGTKFGGTFLGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYN  149

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             G AGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KY A +V+GLQ   DG   +LKVA
Sbjct  150  GGAAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLAAKYGARYVKGLQ--GDGXGNRLKVA  207

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            ACCKHYTAYD+D+W G  R++FN+
Sbjct  208  ACCKHYTAYDLDNWNGVDRFHFNA  231



>ref|XP_003520749.2| PREDICTED: probable beta-D-xylosidase 2-like [Glycine max]
Length=802

 Score =   268 bits (685),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 152/202 (75%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  KN   +++PFC   L +  RV DLV RLTL EK+  LVN A  V RLG+  YEW
Sbjct  58   FACDP-KNGATENMPFCKASLAIPERVKDLVGRLTLQEKVRLLVNNAAAVPRLGMKGYEW  116

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPGV F    P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  117  WSEALHGVSNVGPGVKFNAQFPGATSFPQVITTAASFNASLWEAIGQVVSDEARAMYNGG  176

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L G YAA++VRGLQ   DGN  +LKVAAC
Sbjct  177  TAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGTYAASYVRGLQG-TDGN--RLKVAAC  233

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  234  CKHFTAYDLDNWNGMDRFHFNA  255



>ref|XP_010482214.1| PREDICTED: beta-D-xylosidase 1-like [Camelina sativa]
Length=775

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/204 (62%), Positives = 153/204 (75%), Gaps = 3/204 (1%)
 Frame = +2

Query  161  PVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTY  340
            P++ACD   N   ++L FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  Y
Sbjct  34   PLFACDPA-NGLTRTLRFCRVNVPIHVRVQDLIGRLTLQEKIRNLVNNAAAVPRLGIGGY  92

Query  341  EWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHN  520
            EWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM+N
Sbjct  93   EWWSEALHGVSDVGPGAKFGGAFPGATSFPQVITTAASFNQSLWEEIGRVVSDEARAMYN  152

Query  521  YGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVA  700
             G+AGLTYWSPN+NI RDPRWGRGQE PGEDP + GKYAA++VRGLQ    GN  +LKVA
Sbjct  153  GGVAGLTYWSPNVNILRDPRWGRGQETPGEDPIVAGKYAASYVRGLQGTAAGN--RLKVA  210

Query  701  ACCKHYTAYDVDDWKGYQRYNFNS  772
            ACCKHYTAYD+D+W G  R++FN+
Sbjct  211  ACCKHYTAYDLDNWNGVDRFHFNA  234



>ref|XP_007145157.1| hypothetical protein PHAVU_007G215100g [Phaseolus vulgaris]
 gb|ESW17151.1| hypothetical protein PHAVU_007G215100g [Phaseolus vulgaris]
Length=767

 Score =   267 bits (683),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 127/202 (63%), Positives = 149/202 (74%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  KN    SLPFC   L +  RV DL+ RLT+ EK+  LVN A  V RLGI  YEW
Sbjct  27   FACDP-KNAATSSLPFCKASLAIAERVKDLIGRLTMEEKVGLLVNNAAAVPRLGIKGYEW  85

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  PAATSFPQ + TAASFN +L+  IG+V S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTKFGGQFPAATSFPQVITTAASFNASLWEAIGRVASDEARAMYNGG  145

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
              GLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYA ++VRGLQ  D    ++LKVAA 
Sbjct  146  TGGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGKYAGSYVRGLQGSDG---KRLKVAAS  202

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+WKG  R++FN+
Sbjct  203  CKHFTAYDLDNWKGVDRFHFNA  224



>ref|XP_003546334.1| PREDICTED: beta-D-xylosidase 1-like [Glycine max]
Length=775

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 150/202 (74%), Gaps = 3/202 (1%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  +N   +   FCN  + +  RV DL+ RLTLPEKI  +VN A  V RLGI  YEW
Sbjct  37   FACDP-RNGLTRGFKFCNTHVPIHVRVQDLIARLTLPEKIRLVVNNAIAVPRLGIQGYEW  95

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  P AT FPQ + TAASFN++L+  IG+V+S EARAM+N G
Sbjct  96   WSEALHGVSNVGPGTKFGGAFPGATMFPQVISTAASFNQSLWQEIGRVVSDEARAMYNGG  155

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
             AGLTYWSPN+NIFRDPRWGRGQE PGEDPTL  KYAA++V+GLQ    GN   LKVAAC
Sbjct  156  QAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLAAKYAASYVKGLQGDSAGN--HLKVAAC  213

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKHYTAYD+D+W G  R++FN+
Sbjct  214  CKHYTAYDLDNWNGVDRFHFNA  235



>ref|XP_009378701.1| PREDICTED: probable beta-D-xylosidase 2 [Pyrus x bretschneideri]
Length=789

 Score =   268 bits (684),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 157/211 (74%), Gaps = 4/211 (2%)
 Frame = +2

Query  140  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  319
            P   +    +AC+  K+   K LPFC   L V+ RV DL+ RLTL EK+  LVNTA  V 
Sbjct  28   PKTCEAGESFACNP-KDAATKDLPFCRATLPVQDRVRDLLGRLTLQEKVKLLVNTALPVP  86

Query  320  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S 
Sbjct  87   RLGIKGYEWWSEALHGVSNVGPGTKFGGDFPGATSFPQVITTAASFNASLWEAIGRVVSD  146

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGN  679
            EARAM+N G+AGLTYWSPN+N+ RDPRWGR QE PGEDPT+ G+YAA++VRGLQ  +DGN
Sbjct  147  EARAMYNGGVAGLTYWSPNVNVLRDPRWGRAQETPGEDPTVVGRYAASYVRGLQG-NDGN  205

Query  680  KEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
              +LKVAACCKH+TAYD+D+W G  R++FN+
Sbjct  206  --RLKVAACCKHFTAYDLDNWNGVDRFHFNA  234



>ref|XP_009369955.1| PREDICTED: putative beta-D-xylosidase [Pyrus x bretschneideri]
Length=776

 Score =   267 bits (683),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 150/202 (74%), Gaps = 3/202 (1%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  +NP  ++L FC  R  +  RV DL+ RLTL EKI  LVN A +V RLGI  YEW
Sbjct  33   FACDP-RNPITRTLKFCRVRASIHVRVQDLIGRLTLQEKIRLLVNNAIDVPRLGIQGYEW  91

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G    ATSFPQ + TAASFNE+L+  IG+V+S EARAM+N G
Sbjct  92   WSEALHGVSNVGPGTKFGGAFLGATSFPQVITTAASFNESLWEEIGRVVSDEARAMYNGG  151

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
             AGLT+WSPN+NIFRDPRWGRGQE PGEDP L  KY A +V+GLQ   DG   +LKVAAC
Sbjct  152  AAGLTFWSPNVNIFRDPRWGRGQETPGEDPVLAAKYGARYVKGLQ--GDGAGNRLKVAAC  209

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKHYTAYD+D+W G  R++FN+
Sbjct  210  CKHYTAYDLDNWNGVDRFHFNA  231



>ref|XP_011079568.1| PREDICTED: probable beta-D-xylosidase 2 [Sesamum indicum]
Length=771

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 150/202 (74%), Gaps = 3/202 (1%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  ++    +LPFC   L ++ RV DL+ RLTL EK+  L N A  V RLGI  YEW
Sbjct  28   FACDP-RDSATHTLPFCTTGLRIEERVKDLIGRLTLQEKVKLLANNAAAVPRLGIKEYEW  86

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  87   WSEALHGVSNVGPGTKFGGEFPGATSFPQVITTAASFNVSLWEKIGEVVSDEARAMYNGG  146

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
            + GLTYWSPN+NIFRDPRWGRGQE PGEDP +  KYAA++VRGLQ  D G   +LKVAAC
Sbjct  147  MGGLTYWSPNVNIFRDPRWGRGQETPGEDPVVAAKYAASYVRGLQGTDAGG--RLKVAAC  204

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKHYTAYD+D+W G  R++FN+
Sbjct  205  CKHYTAYDLDNWAGVDRFHFNA  226



>ref|XP_006418321.1| hypothetical protein EUTSA_v10006876mg [Eutrema salsugineum]
 gb|ESQ36674.1| hypothetical protein EUTSA_v10006876mg [Eutrema salsugineum]
Length=766

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 123/213 (58%), Positives = 156/213 (73%), Gaps = 4/213 (2%)
 Frame = +2

Query  134  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  313
            I  V+  +   +ACDT K+    +L FC   + +  RV DL+ RLTL EK+  L NTA  
Sbjct  17   ISSVRVHSRETFACDT-KDAATATLRFCQLSVPIPERVKDLIGRLTLVEKVGLLGNTAAA  75

Query  314  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  493
            + RLGI  YEWWSEALHG+S  GPG  F GV PAATSFPQ + T ASFN +L+ +IG+V+
Sbjct  76   IPRLGIKGYEWWSEALHGVSNVGPGTKFDGVYPAATSFPQVITTVASFNASLWESIGRVV  135

Query  494  STEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDD  673
            S EARAM+N G+ GLTYWSPN+N+ RDPRWGRGQE PGEDP + G+YAA++VRGLQ  D 
Sbjct  136  SNEARAMYNGGVGGLTYWSPNVNVLRDPRWGRGQETPGEDPVVAGRYAASYVRGLQGND-  194

Query  674  GNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
              + +LKVAACCKH+TAYD+D+W G  R++FN+
Sbjct  195  --RSRLKVAACCKHFTAYDLDNWNGVDRFHFNA  225



>ref|XP_010687347.1| PREDICTED: probable beta-D-xylosidase 5 [Beta vulgaris subsp. 
vulgaris]
Length=790

 Score =   267 bits (683),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/203 (60%), Positives = 155/203 (76%), Gaps = 2/203 (1%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            YAC+  +   + +L FCN+ L    R  DLV RLTL EK   LVN A  + RLG+P YEW
Sbjct  24   YACNK-REVDINNLSFCNKSLPYHDRAKDLVSRLTLDEKARQLVNAARGIPRLGVPAYEW  82

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S TGPGV+F   VP ATSFP  +L+AASFN +L++ +G+V+STEARAM+N G
Sbjct  83   WSEALHGVSNTGPGVHFNATVPGATSFPAVILSAASFNTSLWYMMGQVVSTEARAMYNVG  142

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQER-DDGNKEKLKVAA  703
            LAGLTYWSPN+N++RDPRWGRGQE PGEDP +  KY   +VRGLQE    G+K+ LKV++
Sbjct  143  LAGLTYWSPNVNVYRDPRWGRGQETPGEDPLVVSKYGVNYVRGLQEVGSHGSKDMLKVSS  202

Query  704  CCKHYTAYDVDDWKGYQRYNFNS  772
            CCKHYTAYD+D+WKG  R++F++
Sbjct  203  CCKHYTAYDIDNWKGVDRFHFDA  225



>ref|XP_010087253.1| putative beta-D-xylosidase 2 [Morus notabilis]
 gb|EXB28603.1| putative beta-D-xylosidase 2 [Morus notabilis]
Length=779

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/211 (60%), Positives = 156/211 (74%), Gaps = 4/211 (2%)
 Frame = +2

Query  140  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  319
            P  S +   +ACD   +   + LPFC   L ++ RV DL+ RL L EK+  LVN A  V+
Sbjct  25   PSSSASREPFACDPT-DKTTRGLPFCRTSLPIQERVKDLIGRLALQEKVRLLVNNAAAVT  83

Query  320  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S 
Sbjct  84   RLGIKGYEWWSEALHGVSNVGPGSKFGGDFPGATSFPQVITTAASFNASLWEAIGRVVSD  143

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGN  679
            EARAM+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP + G YAA++V+GLQ  +DGN
Sbjct  144  EARAMYNGGVAGLTYWSPNVNIFRDPRWGRGQETPGEDPVVVGTYAASYVKGLQG-NDGN  202

Query  680  KEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
              +LKVAACCKH+TAYD+D+W G  R++FN+
Sbjct  203  --RLKVAACCKHFTAYDLDNWNGVDRFHFNA  231



>gb|AFU54451.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Prunus salicina]
Length=775

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/213 (61%), Positives = 154/213 (72%), Gaps = 5/213 (2%)
 Frame = +2

Query  134  IGPVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGN  313
            IG V ++  P +ACD   NP  + L FC   + +  RV DL+ RLTL EKI  LVN A  
Sbjct  23   IGVVHAR--PPFACDP-HNPITRGLKFCRVTVPIHVRVQDLIGRLTLQEKIRLLVNNAIA  79

Query  314  VSRLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVI  493
            V RLGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFNE+L+  IG+ +
Sbjct  80   VPRLGIQGYEWWSEALHGVSNVGPGTKFGGAFPGATSFPQVITTAASFNESLWQEIGRGV  139

Query  494  STEARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDD  673
              EARAM+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L  KYAA +V+GLQ   D
Sbjct  140  PDEARAMYNGGMAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLASKYAARYVKGLQ--GD  197

Query  674  GNKEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
            G   +LKVAACCKHYTAYD+D+W G  R++FN+
Sbjct  198  GAGNRLKVAACCKHYTAYDLDNWNGVNRFHFNA  230



>ref|XP_003533205.2| PREDICTED: beta-D-xylosidase 1-like [Glycine max]
Length=823

 Score =   268 bits (684),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 151/202 (75%), Gaps = 3/202 (1%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  +N   +   FCN  + +  RV DL+ RLTLPEKI  +VN A  V RLGI  YEW
Sbjct  85   FACDP-RNGLTRGFKFCNTHVPIHVRVQDLIARLTLPEKIRLVVNNAIAVPRLGIQGYEW  143

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F G  P AT FPQ + TAASFN++L+  IG+V+S EARAM+N G
Sbjct  144  WSEALHGVSNVGPGTKFGGAFPGATMFPQVISTAASFNQSLWQEIGRVVSDEARAMYNGG  203

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
             AGLTYWSPN+NIFRDPRWGRGQE PGEDPTL  KYAA++V+GLQ   DG   +LKVAAC
Sbjct  204  QAGLTYWSPNVNIFRDPRWGRGQETPGEDPTLAAKYAASYVKGLQ--GDGAGNRLKVAAC  261

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKHYTAYD+D+W G  R++FN+
Sbjct  262  CKHYTAYDLDNWNGVDRFHFNA  283



>ref|XP_011020382.1| PREDICTED: putative beta-D-xylosidase [Populus euphratica]
Length=768

 Score =   267 bits (682),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 152/203 (75%), Gaps = 6/203 (3%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  KN   +SL FC   + +  RV DL+ RLTL EKI  LVN A  V RLGI  YEW
Sbjct  28   FACDA-KNGLTRSLKFCRVNVPLHVRVRDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYEW  86

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F+G  P ATSFPQ + TAASFN++L+  IG+V+S EARAM N G
Sbjct  87   WSEALHGVSNVGPGTKFSGAFPGATSFPQVITTAASFNKSLWEEIGRVVSDEARAMFNGG  146

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKE-KLKVAA  703
             AGLT+WSPN+N+FRDPRWGRGQE PGEDP + GKYAA++VRGLQ    GN   +LKVAA
Sbjct  147  TAGLTFWSPNVNVFRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ----GNSGFRLKVAA  202

Query  704  CCKHYTAYDVDDWKGYQRYNFNS  772
            CCKHYTAYD+D+W G  RY+FN+
Sbjct  203  CCKHYTAYDLDNWNGVDRYHFNA  225



>ref|XP_009804070.1| PREDICTED: beta-D-xylosidase 1 isoform X1 [Nicotiana sylvestris]
Length=774

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 125/207 (60%), Positives = 153/207 (74%), Gaps = 1/207 (0%)
 Frame = +2

Query  152  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  331
            ++ P +ACD   N G ++LPFC   L +  RV DL++RLTL EKI  LVN A  V RLG+
Sbjct  27   ESRPAFACDPA-NAGTRNLPFCKTSLPIHVRVQDLIQRLTLQEKIRLLVNNAAPVERLGV  85

Query  332  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARA  511
              YEWWSEALHG+S TGPGV F G  P+ATSFPQ + TAASFN +L+  IG+V+S E RA
Sbjct  86   NGYEWWSEALHGVSSTGPGVKFGGAFPSATSFPQVITTAASFNASLWEQIGQVVSDEGRA  145

Query  512  MHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKL  691
            M+N G AGLT+WSPN+NI RDPRWGR QE PGEDP L  +YA ++V+GLQ        +L
Sbjct  146  MYNGGAAGLTFWSPNVNILRDPRWGRCQETPGEDPHLVAQYAISYVKGLQGGGGRGTSRL  205

Query  692  KVAACCKHYTAYDVDDWKGYQRYNFNS  772
            KVAACCKHYTAYD+DDW G+ RY+FN+
Sbjct  206  KVAACCKHYTAYDLDDWNGFDRYHFNA  232



>ref|XP_011009934.1| PREDICTED: putative beta-D-xylosidase [Populus euphratica]
Length=767

 Score =   266 bits (681),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 128/203 (63%), Positives = 150/203 (74%), Gaps = 6/203 (3%)
 Frame = +2

Query  167  YACDTVKNPGL-KSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYE  343
            +ACD     GL +S  FC   L +  RV DL+ RLTL EKI  LVN A  V RLGI  YE
Sbjct  28   FACD--PKLGLTRSFKFCRVNLPIHVRVRDLIGRLTLQEKIRLLVNNAAAVPRLGIQGYE  85

Query  344  WWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNY  523
            WWSEALHG+S  GPG  F G  P AT FPQ + TAASFNE+L+  IG+V+S EARAM+N 
Sbjct  86   WWSEALHGVSNVGPGTKFGGAFPGATGFPQVITTAASFNESLWEEIGRVVSDEARAMYNG  145

Query  524  GLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAA  703
            G+AGLTYWSPN+N+FRDPRWGRGQE PGEDP + GKYAA++VRGLQ     N  +LKVAA
Sbjct  146  GMAGLTYWSPNVNVFRDPRWGRGQETPGEDPVVAGKYAASYVRGLQ---GNNGIRLKVAA  202

Query  704  CCKHYTAYDVDDWKGYQRYNFNS  772
            CCKHYTAYD+D+W G  RY+FN+
Sbjct  203  CCKHYTAYDLDNWNGVDRYHFNA  225



>ref|XP_003591420.1| Beta xylosidase [Medicago truncatula]
 gb|AES61671.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Medicago truncatula]
Length=765

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/210 (60%), Positives = 152/210 (72%), Gaps = 4/210 (2%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            + S+    +ACD  KN    + PFC   L + TRV DL+ RLTL EK++ LVN A  V R
Sbjct  15   MSSEARDPFACDP-KNTSTNNFPFCKASLPIPTRVNDLIGRLTLQEKVSMLVNNAAAVPR  73

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            +GI  YEWWSEALHG+S  GPG  F G  PAATSFPQ + T ASFN +L+  IG+V S E
Sbjct  74   VGIKGYEWWSEALHGVSNVGPGTKFAGQFPAATSFPQVITTVASFNASLWEAIGRVASDE  133

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N G AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ  D    
Sbjct  134  ARAMYNGGTAGLTYWSPNVNIFRDPRWGRGQETPGEDPILAGKYAASYVRGLQGTD---S  190

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
             +LKVAA CKH+TAYD+D+W G  R++FN+
Sbjct  191  SRLKVAASCKHFTAYDLDNWNGVDRFHFNA  220



>dbj|BAQ19511.1| alpha-L-arabinofuranosidase/beta-D-xylosidase [Persea americana]
Length=777

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 128/207 (62%), Positives = 152/207 (73%), Gaps = 7/207 (3%)
 Frame = +2

Query  152  QTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGI  331
             + P +AC   K    ++LPFC   L +  RV DL+ RLTL EKI  LVN A  V RLGI
Sbjct  31   HSRPAFACVGNK----RNLPFCRTNLPISHRVNDLIGRLTLAEKIRLLVNNAAPVPRLGI  86

Query  332  PTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARA  511
              YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S EARA
Sbjct  87   AGYEWWSEALHGVSNWGPGTRFGGQFPGATSFPQVISTAASFNASLWEEIGRVVSDEARA  146

Query  512  MHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKL  691
            M+N G+AGLTYWSPN+NIFRDPRWGRGQE PGEDP L GKYAA++VRGLQ+       +L
Sbjct  147  MYNGGIAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGKYAASYVRGLQQ---AQGNRL  203

Query  692  KVAACCKHYTAYDVDDWKGYQRYNFNS  772
            KVAACCKHYTAYD+D+W G  R++FN+
Sbjct  204  KVAACCKHYTAYDLDNWGGIDRFHFNA  230



>ref|XP_004494414.1| PREDICTED: probable beta-D-xylosidase 2-like [Cicer arietinum]
Length=771

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/202 (62%), Positives = 152/202 (75%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  K+   K LPFC+ +L +  RV D++ RLTL EK+  LVN A  V R GI  YEW
Sbjct  27   FACDP-KDGTTKKLPFCSVKLAIPERVKDIIGRLTLQEKVNLLVNNAAAVPRFGIKGYEW  85

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPG  F  + P ATSFPQ + TAASFN +L+  IG+V+S EARAM+N G
Sbjct  86   WSEALHGVSNVGPGTKFGALFPGATSFPQVITTAASFNASLWEAIGRVVSDEARAMYNGG  145

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
             AGLTYWSPN+NIFRDPRWGRGQE PGEDP L G YAA++V+GLQ   DGN  +LKVAAC
Sbjct  146  AAGLTYWSPNVNIFRDPRWGRGQETPGEDPVLAGSYAASYVKGLQGT-DGN--RLKVAAC  202

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  203  CKHFTAYDIDNWNGVDRFHFNA  224



>ref|XP_007138975.1| hypothetical protein PHAVU_009G254300g [Phaseolus vulgaris]
 gb|ESW10969.1| hypothetical protein PHAVU_009G254300g [Phaseolus vulgaris]
Length=772

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 152/211 (72%), Gaps = 3/211 (1%)
 Frame = +2

Query  140  PVQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVS  319
            P  SQ    +ACD   N   +   FC  R+ +  RV DL+ RLTLPEKI  +VN A  + 
Sbjct  23   PRTSQGRVPFACDPA-NGLTRGFKFCRTRVPIHVRVQDLIARLTLPEKIRLVVNNAIALP  81

Query  320  RLGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVIST  499
            RLGI  YEWWSEALHG+S  GPG  F G  P AT FPQ + TAASFN++L+  IG+V+S 
Sbjct  82   RLGIQGYEWWSEALHGVSNVGPGTKFGGAFPGATMFPQVITTAASFNQSLWRQIGRVVSD  141

Query  500  EARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGN  679
            EARAM+N G  GLTYWSPN+NIFRDPRWGRGQE PGEDPTL  KYAA++V+GLQ   DG 
Sbjct  142  EARAMYNGGQGGLTYWSPNVNIFRDPRWGRGQETPGEDPTLAAKYAASYVQGLQ--GDGA  199

Query  680  KEKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
              +LKVAACCKHYTAYD+D+W G  R++FN+
Sbjct  200  GNRLKVAACCKHYTAYDLDNWNGVDRFHFNA  230



>ref|XP_007163167.1| hypothetical protein PHAVU_001G212100g [Phaseolus vulgaris]
 gb|ESW35161.1| hypothetical protein PHAVU_001G212100g [Phaseolus vulgaris]
Length=775

 Score =   266 bits (681),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 126/202 (62%), Positives = 152/202 (75%), Gaps = 4/202 (2%)
 Frame = +2

Query  167  YACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSRLGIPTYEW  346
            +ACD  KN   K+LPFC   + +  RV DL+ RLTL EK+  LVN A  V RLG+  YEW
Sbjct  31   FACDP-KNAVTKNLPFCKVSVAITERVKDLIGRLTLEEKVRLLVNNAAAVPRLGMKGYEW  89

Query  347  WSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTEARAMHNYG  526
            WSEALHG+S  GPGV F    P ATSFPQ + TAASFN +L+ +IG+V+S EARAM+N G
Sbjct  90   WSEALHGVSNVGPGVKFNAQFPGATSFPQVITTAASFNASLWESIGRVVSDEARAMYNGG  149

Query  527  LAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNKEKLKVAAC  706
            +AGLTYWSPN+NIFRDPRWGRGQE PGEDP L G YA ++VRGLQ    GN  +LKVAAC
Sbjct  150  VAGLTYWSPNINIFRDPRWGRGQETPGEDPVLAGTYAVSYVRGLQG-THGN--RLKVAAC  206

Query  707  CKHYTAYDVDDWKGYQRYNFNS  772
            CKH+TAYD+D+W G  R++FN+
Sbjct  207  CKHFTAYDLDNWNGVDRFHFNA  228



>ref|XP_009757165.1| PREDICTED: probable beta-D-xylosidase 2 [Nicotiana sylvestris]
Length=770

 Score =   266 bits (680),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 125/210 (60%), Positives = 153/210 (73%), Gaps = 3/210 (1%)
 Frame = +2

Query  143  VQSQTAPVYACDTVKNPGLKSLPFCNQRLDVKTRVADLVKRLTLPEKITFLVNTAGNVSR  322
            +  Q  P +ACD  ++   K+ PFC   L +  RV DL+ RLTL EK+  L NTA  VSR
Sbjct  22   ISVQARPPFACDP-RDRATKNFPFCQTNLAIGDRVRDLIGRLTLQEKVKLLGNTAAAVSR  80

Query  323  LGIPTYEWWSEALHGLSYTGPGVNFTGVVPAATSFPQPLLTAASFNETLFHTIGKVISTE  502
            LGI  YEWWSEALHG+S  GPG  F G  P ATSFPQ + TAASFN +L+  IG+V+S E
Sbjct  81   LGIKGYEWWSEALHGVSNVGPGTKFGGDFPGATSFPQVISTAASFNASLWEEIGRVVSDE  140

Query  503  ARAMHNYGLAGLTYWSPNMNIFRDPRWGRGQEVPGEDPTLTGKYAAAFVRGLQERDDGNK  682
            ARAM+N  + GLTYWSPN+NIFRDPRWGRGQE PGEDP + G YA  +VRGLQ  ++G  
Sbjct  141  ARAMYNGEMGGLTYWSPNVNIFRDPRWGRGQETPGEDPVVAGIYAERYVRGLQGNEEG--  198

Query  683  EKLKVAACCKHYTAYDVDDWKGYQRYNFNS  772
            ++LKVAACCKHYTAYD+D+W G  R++FN+
Sbjct  199  DRLKVAACCKHYTAYDLDNWSGVDRFHFNA  228



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1840026230422