BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2487

Length=950
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009763674.1|  PREDICTED: phosphoglycerate kinase, chloropl...    387   3e-128   Nicotiana sylvestris
ref|XP_011086346.1|  PREDICTED: phosphoglycerate kinase, chloropl...    386   5e-128   Sesamum indicum [beniseed]
sp|Q42961.1|PGKH_TOBAC  RecName: Full=Phosphoglycerate kinase, ch...    385   9e-128   Nicotiana tabacum [American tobacco]
gb|AAC26785.1|  phosphoglycerate kinase precursor                       384   6e-127   Solanum tuberosum [potatoes]
ref|XP_009622055.1|  PREDICTED: phosphoglycerate kinase, chloropl...    383   7e-127   Nicotiana tomentosiformis
ref|XP_011095719.1|  PREDICTED: phosphoglycerate kinase, chloropl...    383   1e-126   Sesamum indicum [beniseed]
ref|NP_001275227.1|  phosphoglycerate kinase, chloroplastic-like        380   2e-125   Solanum tuberosum [potatoes]
gb|ADR71054.1|  phosphoglycerate kinase                                 379   4e-125   Nicotiana benthamiana
gb|ABB86255.1|  phosphoglycerate kinase precursor-like                  379   4e-125   Solanum tuberosum [potatoes]
ref|XP_004243968.1|  PREDICTED: phosphoglycerate kinase, chloropl...    377   3e-124   Solanum lycopersicum
gb|EPS66037.1|  phosphoglycerate kinase, chloroplastic                  360   6e-118   Genlisea aurea
gb|EYU33792.1|  hypothetical protein MIMGU_mgv1a005422mg                357   1e-116   Erythranthe guttata [common monkey flower]
ref|XP_011013857.1|  PREDICTED: phosphoglycerate kinase, chloropl...    352   8e-115   Populus euphratica
ref|XP_002315066.1|  PHOSPHOGLYCERATE KINASE 1 family protein           351   3e-114   
ref|XP_002513353.1|  phosphoglycerate kinase, putative                  350   5e-114   Ricinus communis
gb|ABK96267.1|  unknown                                                 347   2e-112   Populus trichocarpa x Populus deltoides
ref|XP_002312238.1|  hypothetical protein POPTR_0008s08410g             346   2e-112   Populus trichocarpa [western balsam poplar]
ref|XP_011016496.1|  PREDICTED: phosphoglycerate kinase, chloropl...    346   3e-112   Populus euphratica
ref|XP_002263796.1|  PREDICTED: phosphoglycerate kinase, chloropl...    344   2e-111   Vitis vinifera
gb|KJB14025.1|  hypothetical protein B456_002G107300                    342   1e-110   Gossypium raimondii
gb|KJB14026.1|  hypothetical protein B456_002G107300                    342   1e-110   Gossypium raimondii
ref|XP_004488763.1|  PREDICTED: phosphoglycerate kinase, chloropl...    341   3e-110   Cicer arietinum [garbanzo]
gb|KHG01489.1|  hypothetical protein F383_22605                         340   6e-110   Gossypium arboreum [tree cotton]
ref|XP_008456300.1|  PREDICTED: phosphoglycerate kinase, chloropl...    337   6e-109   Cucumis melo [Oriental melon]
ref|XP_010060861.1|  PREDICTED: phosphoglycerate kinase, chloropl...    337   9e-109   Eucalyptus grandis [rose gum]
ref|XP_004139904.1|  PREDICTED: phosphoglycerate kinase, chloropl...    337   9e-109   Cucumis sativus [cucumbers]
gb|KDO61595.1|  hypothetical protein CISIN_1g011942mg                   333   1e-108   Citrus sinensis [apfelsine]
ref|XP_009402843.1|  PREDICTED: phosphoglycerate kinase, chloropl...    337   1e-108   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO61594.1|  hypothetical protein CISIN_1g011942mg                   333   2e-107   Citrus sinensis [apfelsine]
ref|XP_006422251.1|  hypothetical protein CICLE_v10004891mg             333   2e-107   Citrus clementina [clementine]
gb|ADV16381.1|  chloroplast phosphoglycerate kinase 3                   333   3e-107   Helianthus annuus
ref|XP_007022578.1|  Phosphoglycerate kinase 1                          332   1e-106   
ref|XP_010269369.1|  PREDICTED: phosphoglycerate kinase, chloropl...    331   2e-106   Nelumbo nucifera [Indian lotus]
ref|XP_010923458.1|  PREDICTED: phosphoglycerate kinase, chloropl...    331   3e-106   Elaeis guineensis
ref|XP_008372155.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    327   3e-106   
ref|XP_008786111.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    330   6e-106   Phoenix dactylifera
ref|XP_009397212.1|  PREDICTED: phosphoglycerate kinase, chloropl...    329   7e-106   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003596091.1|  Phosphoglycerate kinase                            329   8e-106   Medicago truncatula
ref|XP_008805983.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    330   8e-106   Phoenix dactylifera
ref|XP_010936574.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    329   1e-105   Elaeis guineensis
ref|XP_010669994.1|  PREDICTED: phosphoglycerate kinase, chloropl...    329   1e-105   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008226130.1|  PREDICTED: phosphoglycerate kinase, chloropl...    329   1e-105   Prunus mume [ume]
ref|XP_012087352.1|  PREDICTED: phosphoglycerate kinase, chloropl...    329   2e-105   Jatropha curcas
sp|P29409.2|PGKH_SPIOL  RecName: Full=Phosphoglycerate kinase, ch...    327   2e-105   Spinacia oleracea
ref|XP_008371996.1|  PREDICTED: phosphoglycerate kinase, chloropl...    328   2e-105   
ref|XP_008346077.1|  PREDICTED: phosphoglycerate kinase, chloropl...    328   3e-105   
ref|XP_007213965.1|  hypothetical protein PRUPE_ppa005031mg             327   5e-105   Prunus persica
ref|XP_008349091.1|  PREDICTED: phosphoglycerate kinase, chloropl...    327   8e-105   
ref|XP_008383150.1|  PREDICTED: phosphoglycerate kinase, chloropl...    326   1e-104   Malus domestica [apple tree]
ref|XP_003531482.1|  PREDICTED: phosphoglycerate kinase, chloropl...    326   2e-104   Glycine max [soybeans]
ref|NP_187884.1|  phosphoglycerate kinase 1                             325   6e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010094703.1|  Phosphoglycerate kinase                            324   7e-104   Morus notabilis
ref|XP_002891879.1|  hypothetical protein ARALYDRAFT_474689             324   7e-104   
gb|AAF02830.1|AC009894_1  phosphoglycerate kinase                       319   8e-104   Arabidopsis thaliana [mouse-ear cress]
emb|CDY43401.1|  BnaA01g30320D                                          324   1e-103   Brassica napus [oilseed rape]
ref|XP_009124670.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    323   1e-103   Brassica rapa
ref|XP_006407295.1|  hypothetical protein EUTSA_v10020621mg             323   1e-103   Eutrema salsugineum [saltwater cress]
ref|XP_006297559.1|  hypothetical protein CARUB_v10013582mg             323   1e-103   Capsella rubella
ref|XP_002884926.1|  hypothetical protein ARALYDRAFT_478641             323   2e-103   Arabidopsis lyrata subsp. lyrata
emb|CDX73803.1|  BnaA03g32440D                                          323   2e-103   
ref|XP_010487004.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    323   3e-103   Camelina sativa [gold-of-pleasure]
ref|XP_010465058.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    322   5e-103   Camelina sativa [gold-of-pleasure]
ref|XP_009135249.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    322   6e-103   Brassica rapa
emb|CDY24247.1|  BnaC01g38270D                                          322   9e-103   Brassica napus [oilseed rape]
emb|CDY00798.1|  BnaC03g37820D                                          322   1e-102   
ref|XP_009146585.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    321   1e-102   Brassica rapa
ref|XP_004306579.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    321   1e-102   Fragaria vesca subsp. vesca
ref|XP_010499471.1|  PREDICTED: phosphoglycerate kinase 1, chloro...    321   1e-102   Camelina sativa [gold-of-pleasure]
ref|XP_006359791.1|  PREDICTED: uncharacterized protein LOC102577647    335   1e-102   
ref|NP_176015.1|  phosphoglycerate kinase                               320   3e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003546820.1|  PREDICTED: phosphoglycerate kinase, chloropl...    317   6e-101   
ref|XP_010544343.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoglyce...    313   2e-99    Tarenaya hassleriana [spider flower]
ref|XP_003568189.1|  PREDICTED: phosphoglycerate kinase, chloropl...    311   6e-99    
emb|CDP13574.1|  unnamed protein product                                306   9e-98    Coffea canephora [robusta coffee]
ref|XP_006858226.1|  PREDICTED: phosphoglycerate kinase, chloropl...    306   6e-97    Amborella trichopoda
emb|CBI24182.3|  unnamed protein product                                303   2e-96    Vitis vinifera
ref|XP_004961633.1|  PREDICTED: phosphoglycerate kinase, chloropl...    304   5e-96    Setaria italica
ref|XP_007149208.1|  hypothetical protein PHAVU_005G050700g             303   8e-96    Phaseolus vulgaris [French bean]
gb|AFW82396.1|  hypothetical protein ZEAMMB73_945417                    303   9e-96    
gb|AGV54662.1|  phosphoglycerate kinase chloroplastic-like protein      302   4e-95    Phaseolus vulgaris [French bean]
gb|AIZ74346.1|  phosphoglycerate kinase 1                               302   5e-95    Pinus massoniana [Chinese red pine]
emb|CBL95264.1|  phosphoglycerate kinase 1                              300   5e-94    Pinus pinaster [cluster pine]
ref|NP_001117503.1|  phosphoglycerate kinase                            296   1e-93    Arabidopsis thaliana [mouse-ear cress]
sp|P12782.1|PGKH_WHEAT  RecName: Full=Phosphoglycerate kinase, ch...    298   1e-93    Triticum aestivum [Canadian hard winter wheat]
gb|AFW78532.1|  phosphoglycerate kinase                                 296   6e-93    
gb|AFW78533.1|  phosphoglycerate kinase                                 296   6e-93    
ref|XP_008656415.1|  PREDICTED: phosphoglycerate kinase, chloropl...    300   1e-92    
ref|XP_004970259.1|  PREDICTED: phosphoglycerate kinase, chloropl...    294   4e-92    Setaria italica
ref|XP_002441313.1|  hypothetical protein SORBIDRAFT_09g024340          294   6e-92    Sorghum bicolor [broomcorn]
ref|NP_001147628.1|  phosphoglycerate kinase                            293   6e-92    
gb|EAY98560.1|  hypothetical protein OsI_20474                          287   8e-92    Oryza sativa Indica Group [Indian rice]
gb|AGT16255.1|  phosphoglycerate kinase                                 291   5e-91    Saccharum hybrid cultivar R570
gb|AAB60303.1|  phosphoglycerate kinase                                 288   7e-91    Arabidopsis thaliana [mouse-ear cress]
gb|ABR16231.1|  unknown                                                 291   7e-91    Picea sitchensis
gb|ABK24564.1|  unknown                                                 291   2e-90    Picea sitchensis
ref|XP_004970258.1|  PREDICTED: phosphoglycerate kinase, chloropl...    290   3e-90    Setaria italica
ref|XP_006654593.1|  PREDICTED: phosphoglycerate kinase, chloropl...    286   5e-90    Oryza brachyantha
gb|EMS54865.1|  Phosphoglycerate kinase, chloroplastic                  285   1e-88    Triticum urartu
gb|ACN32155.1|  unknown                                                 281   4e-88    Zea mays [maize]
gb|ADV16380.1|  cytosolic phosphoglycerate kinase 2                     281   5e-88    Helianthus annuus
gb|AFW70285.1|  hypothetical protein ZEAMMB73_319281                    273   7e-88    
emb|CDY52872.1|  BnaCnng23600D                                          290   1e-87    Brassica napus [oilseed rape]
ref|NP_001142404.1|  uncharacterized protein LOC100274579               276   3e-86    Zea mays [maize]
gb|AIN39803.1|  hypothetical protein                                    273   3e-86    Zoysia matrella [Japanese carpet grass]
gb|ACJ11718.1|  phosphoglycerate kinase                                 276   4e-86    Gossypium hirsutum [American cotton]
ref|XP_011086347.1|  PREDICTED: phosphoglycerate kinase, cytosolic      275   9e-86    Sesamum indicum [beniseed]
gb|ABI18157.1|  cytosolic phosphoglycerate kinase                       275   2e-85    Helianthus annuus
ref|XP_004139837.1|  PREDICTED: phosphoglycerate kinase, cytosolic      275   2e-85    Cucumis sativus [cucumbers]
ref|XP_006858233.1|  PREDICTED: phosphoglycerate kinase, cytosolic      274   3e-85    Amborella trichopoda
ref|NP_001058317.1|  Os06g0668200                                       274   3e-85    
ref|XP_003570108.1|  PREDICTED: phosphoglycerate kinase, cytosolic      273   5e-85    Brachypodium distachyon [annual false brome]
gb|KJB14019.1|  hypothetical protein B456_002G107200                    273   7e-85    Gossypium raimondii
ref|XP_008447095.1|  PREDICTED: phosphoglycerate kinase, cytosolic      273   7e-85    Cucumis melo [Oriental melon]
ref|XP_010275944.1|  PREDICTED: phosphoglycerate kinase, cytosolic      273   9e-85    Nelumbo nucifera [Indian lotus]
gb|AIZ68220.1|  phosphoglycerate kinase                                 272   1e-84    Ornithogalum longebracteatum [sea-onion]
ref|XP_009417722.1|  PREDICTED: phosphoglycerate kinase, cytosolic      272   1e-84    Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU33791.1|  hypothetical protein MIMGU_mgv1a006853mg                273   1e-84    Erythranthe guttata [common monkey flower]
ref|XP_004966316.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    272   1e-84    Setaria italica
ref|XP_006656354.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    272   1e-84    Oryza brachyantha
ref|XP_009777860.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    272   2e-84    Nicotiana sylvestris
ref|XP_008798227.1|  PREDICTED: phosphoglycerate kinase, cytosolic      272   2e-84    Phoenix dactylifera
gb|EMS46092.1|  Phosphoglycerate kinase, cytosolic                      273   2e-84    Triticum urartu
ref|XP_009399252.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    271   2e-84    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002971814.1|  hypothetical protein SELMODRAFT_267533             274   2e-84    
ref|XP_006646936.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    271   3e-84    Oryza brachyantha
ref|XP_011095716.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    271   4e-84    Sesamum indicum [beniseed]
sp|P12783.1|PGKY_WHEAT  RecName: Full=Phosphoglycerate kinase, cy...    271   4e-84    Triticum aestivum [Canadian hard winter wheat]
gb|ABI74567.1|  phosphoglycerate kinase                                 271   5e-84    Oryza sativa Indica Group [Indian rice]
emb|CDP16886.1|  unnamed protein product                                271   5e-84    Coffea canephora [robusta coffee]
ref|NP_001046020.1|  Os02g0169300                                       271   5e-84    
ref|XP_004951776.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    270   8e-84    Setaria italica
gb|EMT29203.1|  Phosphoglycerate kinase, cytosolic                      273   1e-83    
ref|XP_010324204.1|  PREDICTED: phosphoglycerate kinase, cytosolic      270   1e-83    
gb|ABF69999.1|  phosphoglycerate kinase, putative                       270   1e-83    Musa acuminata [banana]
gb|ACU18322.1|  unknown                                                 263   2e-83    Glycine max [soybeans]
ref|XP_010941661.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    268   4e-83    Elaeis guineensis
ref|XP_010544342.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    268   4e-83    Tarenaya hassleriana [spider flower]
ref|XP_010941660.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    268   5e-83    
gb|ABI74568.1|  phosphoglycerate kinase                                 268   7e-83    Oryza sativa Indica Group [Indian rice]
gb|AFW70281.1|  phosphoglycerate kinase                                 273   7e-83    
ref|XP_010557291.1|  PREDICTED: phosphoglycerate kinase, cytosolic      268   1e-82    Tarenaya hassleriana [spider flower]
ref|XP_010936568.1|  PREDICTED: phosphoglycerate kinase, cytosolic      267   2e-82    Elaeis guineensis
ref|XP_009414502.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    266   2e-82    Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP13576.1|  unnamed protein product                                266   2e-82    Coffea canephora [robusta coffee]
ref|XP_011468861.1|  PREDICTED: phosphoglycerate kinase, cytosolic      266   3e-82    Fragaria vesca subsp. vesca
ref|XP_009791377.1|  PREDICTED: phosphoglycerate kinase, cytosolic      266   3e-82    Nicotiana sylvestris
ref|XP_004488762.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    266   4e-82    Cicer arietinum [garbanzo]
gb|ACJ84593.1|  unknown                                                 260   4e-82    Medicago truncatula
ref|XP_002263950.1|  PREDICTED: phosphoglycerate kinase, cytosolic      266   4e-82    Vitis vinifera
ref|NP_001275451.1|  phosphoglycerate kinase, cytosolic-like            266   4e-82    Solanum tuberosum [potatoes]
gb|KCW71392.1|  hypothetical protein EUGRSUZ_F04463                     262   6e-82    Eucalyptus grandis [rose gum]
ref|XP_007149209.1|  hypothetical protein PHAVU_005G050800g             265   6e-82    Phaseolus vulgaris [French bean]
ref|XP_007022579.1|  Phosphoglycerate kinase isoform 1                  265   6e-82    
ref|XP_008383158.1|  PREDICTED: phosphoglycerate kinase, cytosolic      265   7e-82    Malus domestica [apple tree]
ref|XP_003531483.1|  PREDICTED: phosphoglycerate kinase, cytosolic      265   8e-82    
ref|XP_002972334.1|  hypothetical protein SELMODRAFT_231942             265   9e-82    
gb|EEC71648.1|  hypothetical protein OsI_04088                          266   1e-81    Oryza sativa Indica Group [Indian rice]
ref|XP_009607754.1|  PREDICTED: phosphoglycerate kinase, cytosolic      265   1e-81    Nicotiana tomentosiformis
ref|XP_008805982.1|  PREDICTED: phosphoglycerate kinase, cytosolic      264   2e-81    Phoenix dactylifera
ref|NP_001172606.1|  Os01g0800266                                       263   4e-81    
ref|XP_003546821.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    263   5e-81    Glycine max [soybeans]
ref|XP_002312237.1|  hypothetical protein POPTR_0008s08400g             263   5e-81    
gb|ABK92531.1|  unknown                                                 263   6e-81    Populus trichocarpa [western balsam poplar]
ref|XP_008226131.1|  PREDICTED: phosphoglycerate kinase, cytosolic      263   6e-81    Prunus mume [ume]
gb|KCW71391.1|  hypothetical protein EUGRSUZ_F04463                     262   6e-81    Eucalyptus grandis [rose gum]
ref|XP_010064085.1|  PREDICTED: phosphoglycerate kinase, cytosolic      263   7e-81    Eucalyptus grandis [rose gum]
ref|XP_007213914.1|  hypothetical protein PRUPE_ppa005669mg             264   7e-81    
ref|XP_009106677.1|  PREDICTED: phosphoglycerate kinase, cytosolic      262   9e-81    Brassica rapa
gb|EEE55536.1|  hypothetical protein OsJ_03768                          263   9e-81    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006422250.1|  hypothetical protein CICLE_v10005101mg             262   1e-80    Citrus clementina [clementine]
gb|KDO61597.1|  hypothetical protein CISIN_1g040813mg                   262   1e-80    Citrus sinensis [apfelsine]
emb|CDY70232.1|  BnaC02g46710D                                          262   2e-80    Brassica napus [oilseed rape]
ref|XP_006300323.1|  hypothetical protein CARUB_v10020404mg             261   2e-80    
emb|CDX87375.1|  BnaA07g34980D                                          261   2e-80    
gb|AAO63774.1|  3-phosphoglycerate kinase                               261   2e-80    Populus tremuloides
ref|XP_009128369.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    261   2e-80    Brassica rapa
gb|AAM61185.1|  phosphoglycerate kinase, putative                       261   2e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889253.1|  hypothetical protein ARALYDRAFT_477124             261   3e-80    
ref|NP_178073.1|  phosphoglycerate kinase                               261   3e-80    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003596093.1|  Phosphoglycerate kinase                            261   3e-80    Medicago truncatula
ref|XP_003596092.1|  Phosphoglycerate kinase                            261   3e-80    Medicago truncatula
gb|AFK46712.1|  unknown                                                 261   4e-80    Medicago truncatula
ref|XP_006389877.1|  hypothetical protein EUTSA_v10018657mg             261   4e-80    Eutrema salsugineum [saltwater cress]
dbj|BAA33801.1|  cytosolic phosphoglycerate kinase 1                    260   5e-80    Populus nigra [black poplar]
ref|XP_010417621.1|  PREDICTED: phosphoglycerate kinase, cytosolic      260   5e-80    Camelina sativa [gold-of-pleasure]
ref|XP_010472814.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    259   9e-80    Camelina sativa [gold-of-pleasure]
gb|AAF85975.1|AF275639_1  cytosolic phosphoglycerate kinase             259   1e-79    Pisum sativum [garden pea]
ref|XP_012087351.1|  PREDICTED: phosphoglycerate kinase, cytosolic      259   1e-79    Jatropha curcas
gb|EPS64076.1|  phosphoglycerate kinase                                 259   1e-79    Genlisea aurea
ref|XP_002513352.1|  phosphoglycerate kinase, putative                  259   2e-79    Ricinus communis
ref|XP_009104523.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    259   2e-79    Brassica rapa
dbj|BAJ85222.1|  predicted protein                                      258   3e-79    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011016588.1|  PREDICTED: phosphoglycerate kinase, cytosolic      258   5e-79    Populus euphratica
gb|EMT08517.1|  Phosphoglycerate kinase, cytosolic                      257   1e-78    
ref|XP_009384174.1|  PREDICTED: phosphoglycerate kinase, cytosolic      256   2e-78    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS52006.1|  Phosphoglycerate kinase, cytosolic                      260   2e-78    Triticum urartu
ref|XP_002315067.1|  cytosolic phosphoglycerate kinase family pro...    256   3e-78    
ref|XP_010537804.1|  PREDICTED: phosphoglycerate kinase, cytosolic      255   5e-78    Tarenaya hassleriana [spider flower]
gb|AGL76992.1|  phosphoglycerate kinase                                 254   6e-78    Anisodus luridus
dbj|BAJ88371.1|  predicted protein                                      254   8e-78    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011013882.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    254   1e-77    Populus euphratica
dbj|BAA33802.1|  cytosolic phosphoglycerate kinase 1                    254   1e-77    Populus nigra [black poplar]
ref|XP_010094705.1|  Phosphoglycerate kinase                            253   2e-77    Morus notabilis
ref|XP_011013868.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    254   3e-77    Populus euphratica
gb|AGH55660.1|  phosphoglycerate kinase                                 252   3e-77    Atropa belladonna [deadly nightshade]
ref|XP_010669985.1|  PREDICTED: phosphoglycerate kinase, cytosolic      252   1e-76    Beta vulgaris subsp. vulgaris [field beet]
gb|ABB86242.1|  phosphoglycerate kinase-like                            251   3e-76    Solanum tuberosum [potatoes]
ref|XP_009618219.1|  PREDICTED: phosphoglycerate kinase, cytosoli...    244   7e-74    Nicotiana tomentosiformis
emb|CDP13575.1|  unnamed protein product                                255   8e-74    Coffea canephora [robusta coffee]
gb|AAT07576.1|  putative chloroplast phosphoglycerate kinase            238   1e-72    Oryza sativa Japonica Group [Japonica rice]
ref|XP_001699523.1|  phosphoglycerate kinase                            241   1e-71    Chlamydomonas reinhardtii
ref|XP_002951648.1|  phosphoglycerate kinase                            239   3e-71    Volvox carteri f. nagariensis
gb|KIY97385.1|  phosphoglycerate kinase                                 231   8e-71    Monoraphidium neglectum
sp|P41758.1|PGKH_CHLRE  RecName: Full=Phosphoglycerate kinase, ch...    238   2e-70    Chlamydomonas reinhardtii
ref|WP_015204810.1|  phosphoglycerate kinase                            231   1e-68    Crinalium epipsammum
ref|XP_005791258.1|  phosphoglycerate kinase                            226   2e-68    Emiliania huxleyi CCMP1516
dbj|BAJ87335.1|  predicted protein                                      229   3e-68    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|WP_026719925.1|  phosphoglycerate kinase                            229   5e-68    Fischerella sp. PCC 9431
ref|WP_019495207.1|  phosphoglycerate kinase                            229   5e-68    Calothrix sp. PCC 7103
ref|WP_017323648.1|  phosphoglycerate kinase                            229   7e-68    cyanobacterium PCC 7702
ref|WP_017309094.1|  MULTISPECIES: phosphoglycerate kinase              229   8e-68    Hapalosiphonaceae
gb|AAW79325.1|  phosphoglycerate kinase                                 230   8e-68    Isochrysis galbana
ref|XP_002977295.1|  hypothetical protein SELMODRAFT_107116             228   1e-67    Selaginella moellendorffii
gb|EMT12348.1|  Phosphoglycerate kinase, chloroplastic                  228   1e-67    
ref|WP_026734580.1|  phosphoglycerate kinase                            228   2e-67    Fischerella sp. PCC 9605
ref|WP_016873269.1|  phosphoglycerate kinase                            228   2e-67    Chlorogloeopsis fritschii
gb|ABH10990.1|  phosphoglycerate kinase                                 223   2e-67    Polytomella parva
ref|WP_009454679.1|  MULTISPECIES: phosphoglycerate kinase              228   2e-67    Fischerella thermalis
ref|WP_016865730.1|  phosphoglycerate kinase                            227   3e-67    Fischerella muscicola
ref|XP_011396717.1|  Phosphoglycerate kinase, chloroplastic             228   6e-67    Auxenochlorella protothecoides
ref|WP_026098466.1|  phosphoglycerate kinase                            226   9e-67    Oscillatoria sp. PCC 10802
ref|WP_015140688.1|  phosphoglycerate kinase                            226   9e-67    Nostoc sp. PCC 7524
ref|XP_002972143.1|  hypothetical protein SELMODRAFT_96742              226   1e-66    Selaginella moellendorffii
ref|WP_016861411.1|  phosphoglycerate kinase                            225   2e-66    Fischerella muscicola
ref|WP_035157181.1|  phosphoglycerate kinase                            225   2e-66    Calothrix sp. 336/3
ref|WP_006633515.1|  phosphoglycerate kinase                            224   4e-66    Microcoleus vaginatus
ref|WP_015177490.1|  phosphoglycerate kinase                            224   5e-66    Oscillatoria nigro-viridis
ref|WP_015217208.1|  phosphoglycerate kinase                            224   7e-66    Anabaena cylindrica
ref|XP_005851391.1|  hypothetical protein CHLNCDRAFT_48457              224   7e-66    Chlorella variabilis
ref|WP_016949614.1|  phosphoglycerate kinase                            223   9e-66    Anabaena sp. PCC 7108
ref|WP_015149149.1|  phosphoglycerate kinase                            223   1e-65    Oscillatoria acuminata
gb|KIE11439.1|  phosphoglycerate kinase                                 223   2e-65    Tolypothrix bouteillei VB521301
ref|WP_015162225.1|  phosphoglycerate kinase                            223   2e-65    Chamaesiphon minutus
emb|CBY84995.1|  phosphoglycerate kinase                                223   2e-65    Polytomella sp. Pringsheim 198.80
ref|WP_006199298.1|  phosphoglycerate kinase                            222   3e-65    Nodularia spumigena
ref|WP_011317630.1|  phosphoglycerate kinase                            222   3e-65    Trichormus variabilis
ref|WP_010998270.1|  phosphoglycerate kinase                            222   3e-65    Nostocaceae
ref|WP_015153171.1|  phosphoglycerate kinase                            221   4e-65    Cyanobacteria [blue-green bacteria]
ref|WP_039715776.1|  phosphoglycerate kinase                            221   4e-65    
ref|WP_017803962.1|  phosphoglycerate kinase                            221   5e-65    Nodularia spumigena
ref|WP_013192657.1|  phosphoglycerate kinase                            221   6e-65    Trichormus azollae
ref|WP_015190859.1|  phosphoglycerate kinase                            221   7e-65    Gloeocapsa sp. PCC 7428
ref|WP_037220338.1|  phosphoglycerate kinase                            221   9e-65    
ref|WP_009631644.1|  phosphoglycerate kinase                            220   2e-64    Synechocystis sp. PCC 7509
ref|WP_036005350.1|  phosphoglycerate kinase                            220   2e-64    [Leptolyngbya] sp. JSC-1
ref|WP_045868399.1|  phosphoglycerate kinase                            220   2e-64    Nostocales
ref|WP_009628155.1|  phosphoglycerate kinase                            220   2e-64    Pseudanabaena biceps
ref|WP_017317549.1|  phosphoglycerate kinase                            220   2e-64    Mastigocladopsis repens
ref|WP_015119342.1|  phosphoglycerate kinase                            220   2e-64    Rivularia sp. PCC 7116
gb|EWM26407.1|  phosphoglycerate kinase                                 221   4e-64    Nannochloropsis gaditana
ref|WP_029637902.1|  phosphoglycerate kinase [                          219   5e-64    [Scytonema hofmanni] UTEX B 1581
ref|WP_023175125.1|  phosphoglycerate kinase                            219   5e-64    Gloeobacter kilaueensis
ref|WP_028089947.1|  phosphoglycerate kinase                            219   6e-64    Dolichospermum circinale
ref|WP_006278490.1|  phosphoglycerate kinase                            219   6e-64    Cylindrospermopsis raciborskii
ref|WP_039205250.1|  phosphoglycerate kinase                            219   6e-64    Aphanizomenon flos-aquae
ref|WP_009343450.1|  phosphoglycerate kinase                            218   8e-64    Raphidiopsis brookii
ref|WP_015080710.1|  phosphoglycerate kinase                            218   8e-64    Anabaena sp. 90
ref|WP_015111043.1|  phosphoglycerate kinase                            218   9e-64    Nostoc sp. PCC 7107
ref|WP_011142310.1|  phosphoglycerate kinase                            218   1e-63    Gloeobacter violaceus
ref|XP_005646469.1|  phosphoglycerate kinase precursor                  219   1e-63    Coccomyxa subellipsoidea C-169
emb|CBN79775.1|  Phosphoglycerate kinase                                220   1e-63    Ectocarpus siliculosus
ref|WP_015127481.1|  phosphoglycerate kinase                            218   1e-63    Calothrix sp. PCC 7507
ref|WP_039739530.1|  phosphoglycerate kinase                            218   1e-63    
ref|WP_015193656.1|  phosphoglycerate kinase                            218   1e-63    Stanieria cyanosphaera
ref|WP_027404640.1|  phosphoglycerate kinase                            218   2e-63    Aphanizomenon flos-aquae
ref|WP_015205969.1|  phosphoglycerate kinase                            218   2e-63    Cylindrospermum stagnale
ref|WP_019502041.1|  phosphoglycerate kinase                            218   2e-63    Pseudanabaena sp. PCC 6802
ref|WP_041032823.1|  phosphoglycerate kinase                            217   2e-63    Tolypothrix campylonemoides
ref|XP_005855869.1|  phosphoglycerate kinase                            211   2e-63    Nannochloropsis gaditana CCMP526
ref|WP_018397328.1|  phosphoglycerate kinase                            217   2e-63    
ref|WP_007352879.1|  MULTISPECIES: phosphoglycerate kinase              217   3e-63    
gb|KIJ83619.1|  phosphoglycerate kinase                                 216   4e-63    
ref|WP_028085373.1|  phosphoglycerate kinase                            216   4e-63    
ref|WP_026097925.1|  phosphoglycerate kinase                            216   5e-63    
ref|WP_027249107.1|  phosphoglycerate kinase                            216   6e-63    
ref|WP_014829391.1|  phosphoglycerate kinase                            216   7e-63    
ref|WP_026794289.1|  MULTISPECIES: phosphoglycerate kinase              216   8e-63    
ref|WP_042152714.1|  phosphoglycerate kinase                            216   8e-63    
ref|WP_017655761.1|  phosphoglycerate kinase                            215   1e-62    
ref|WP_038547249.1|  phosphoglycerate kinase                            214   2e-62    
ref|WP_026135280.1|  phosphoglycerate kinase                            214   3e-62    
ref|WP_006528046.1|  phosphoglycerate kinase                            214   5e-62    
ref|WP_023076270.1|  phosphoglycerate kinase                            213   6e-62    
ref|WP_036484843.1|  phosphoglycerate kinase                            213   6e-62    
emb|CDX79325.1|  BnaC06g19780D                                          211   7e-62    
ref|WP_024545807.1|  phosphoglycerate kinase                            213   9e-62    
ref|WP_045054377.1|  phosphoglycerate kinase                            213   1e-61    
ref|WP_015198799.1|  phosphoglycerate kinase                            213   1e-61    
ref|XP_001418373.1|  predicted protein                                  214   1e-61    
ref|WP_006456361.1|  phosphoglycerate kinase                            213   1e-61    
ref|WP_017289328.1|  phosphoglycerate kinase                            212   2e-61    
ref|WP_010471014.1|  phosphoglycerate kinase                            212   2e-61    
ref|WP_006716909.1|  phosphoglycerate kinase                            212   2e-61    
ref|WP_012161281.1|  phosphoglycerate kinase                            212   2e-61    
ref|WP_006626244.1|  MULTISPECIES: phosphoglycerate kinase              212   2e-61    
ref|WP_006515662.1|  phosphoglycerate kinase                            212   3e-61    
ref|WP_006173249.1|  phosphoglycerate kinase                            212   3e-61    
ref|WP_015173530.1|  phosphoglycerate kinase                            211   3e-61    
ref|WP_012626442.1|  phosphoglycerate kinase                            211   4e-61    
ref|WP_023068245.1|  phosphoglycerate kinase                            211   6e-61    
ref|WP_026156411.1|  phosphoglycerate kinase                            211   8e-61    
ref|WP_028953033.1|  phosphoglycerate kinase                            211   8e-61    
ref|WP_040940054.1|  phosphoglycerate kinase                            211   8e-61    
ref|WP_016924803.1|  phosphoglycerate kinase                            210   9e-61    
ref|WP_040931032.1|  phosphoglycerate kinase                            210   1e-60    
ref|WP_013276604.1|  phosphoglycerate kinase                            210   1e-60    
ref|WP_015263720.1|  phosphoglycerate kinase                            210   1e-60    
ref|WP_010313479.1|  phosphoglycerate kinase                            210   1e-60    
ref|WP_015167138.1|  phosphoglycerate kinase                            209   2e-60    
ref|WP_039728851.1|  MULTISPECIES: phosphoglycerate kinase              209   2e-60    
ref|WP_019224946.1|  MULTISPECIES: phosphoglycerate kinase              209   2e-60    
ref|WP_006620004.1|  phosphoglycerate kinase                            209   3e-60    
ref|WP_017300589.1|  phosphoglycerate kinase                            209   3e-60    
ref|XP_005821497.1|  phosphoglycerate kinase, plastid-targeted          211   3e-60    
ref|WP_028947361.1|  phosphoglycerate kinase                            209   3e-60    
ref|WP_028051679.1|  phosphoglycerate kinase                            209   3e-60    
ref|WP_015218887.1|  phosphoglycerate kinase                            209   3e-60    
ref|WP_035992253.1|  phosphoglycerate kinase                            209   4e-60    
ref|XP_002500825.1|  phosphoglycerate kinase                            209   4e-60    
ref|WP_018212134.1|  phosphoglycerate kinase                            208   4e-60    
ref|WP_008311068.1|  phosphoglycerate kinase                            209   4e-60    
ref|XP_005822051.1|  hypothetical protein GUITHDRAFT_80135              208   5e-60    
ref|WP_009786889.1|  phosphoglycerate kinase                            208   7e-60    
ref|WP_045575800.1|  phosphoglycerate kinase                            208   7e-60    
ref|WP_035248630.1|  phosphoglycerate kinase                            207   8e-60    
emb|CDX04982.1|  Phosphoglycerate kinase                                207   8e-60    
ref|WP_015124821.1|  phosphoglycerate kinase                            208   8e-60    
ref|WP_011194377.1|  phosphoglycerate kinase                            207   8e-60    
ref|WP_035214477.1|  phosphoglycerate kinase                            207   8e-60    
ref|WP_012583493.1|  phosphoglycerate kinase                            207   8e-60    
gb|EHL05013.1|  phosphoglycerate kinase                                 207   9e-60    
ref|XP_003059407.1|  predicted protein                                  208   9e-60    
ref|WP_030007016.1|  phosphoglycerate kinase                            207   1e-59    
ref|WP_009543708.1|  MULTISPECIES: phosphoglycerate kinase              207   1e-59    
ref|WP_034143280.1|  phosphoglycerate kinase                            207   1e-59    
ref|WP_012307199.1|  phosphoglycerate kinase                            207   1e-59    
ref|WP_013626203.1|  phosphoglycerate kinase                            207   2e-59    
gb|ACB53567.1|  phosphoglycerate kinase                                 207   2e-59    
ref|WP_041765481.1|  phosphoglycerate kinase                            207   2e-59    
ref|WP_010873144.1|  phosphoglycerate kinase                            207   2e-59    
ref|WP_015110302.1|  phosphoglycerate kinase                            207   2e-59    
ref|WP_026789199.1|  phosphoglycerate kinase                            206   3e-59    
ref|WP_017294263.1|  phosphoglycerate kinase                            206   3e-59    
ref|WP_035831895.1|  phosphoglycerate kinase                            206   4e-59    
ref|WP_012546923.1|  phosphoglycerate kinase                            206   4e-59    
ref|WP_041272149.1|  phosphoglycerate kinase                            206   5e-59    
ref|WP_010305334.1|  phosphoglycerate kinase                            206   5e-59    
ref|WP_007099195.1|  phosphoglycerate kinase                            206   5e-59    
ref|WP_041272950.1|  phosphoglycerate kinase                            206   5e-59    
dbj|BAE86630.1|  hypothetical protein                                   206   5e-59    
gb|ACL22713.1|  Phosphoglycerate kinase                                 205   6e-59    
ref|WP_015224558.1|  phosphoglycerate kinase                            206   6e-59    
ref|XP_011401929.1|  Phosphoglycerate kinase, cytosolic                 213   6e-59    
ref|WP_011343229.1|  phosphoglycerate kinase                            205   6e-59    
ref|WP_007304168.1|  phosphoglycerate kinase                            205   7e-59    
ref|WP_008234716.1|  phosphoglycerate kinase                            205   7e-59    
ref|WP_008189591.1|  phosphoglycerate kinase                            205   7e-59    
ref|WP_007309560.1|  phosphoglycerate kinase                            205   8e-59    
sp|P74421.2|PGK_SYNY3  RecName: Full=Phosphoglycerate kinase            205   9e-59    
ref|WP_006105635.1|  phosphoglycerate kinase                            205   1e-58    
gb|KJR41039.1|  3-phosphoglycerate kinase                               204   1e-58    
ref|XP_005535003.1|  phosphoglycerate kinase                            206   1e-58    
ref|WP_015184203.1|  phosphoglycerate kinase                            204   1e-58    
gb|AAP79195.1|  phosphoglycerate kinase 1                               207   1e-58    
ref|WP_019507461.1|  phosphoglycerate kinase                            204   2e-58    
gb|AFY38465.1|  phosphoglycerate kinase                                 205   2e-58    
ref|WP_011612823.1|  phosphoglycerate kinase                            204   2e-58    
ref|WP_022604954.1|  phosphoglycerate kinase                            204   2e-58    
ref|WP_043693415.1|  phosphoglycerate kinase                            204   2e-58    
ref|WP_016482862.1|  phosphoglycerate kinase                            204   2e-58    
ref|WP_018132099.1|  phosphoglycerate kinase                            204   2e-58    
ref|WP_011934238.1|  phosphoglycerate kinase                            204   3e-58    
ref|WP_022483437.1|  phosphoglycerate kinase                            203   3e-58    
ref|WP_011365387.1|  phosphoglycerate kinase                            204   4e-58    
ref|WP_003867203.1|  MULTISPECIES: phosphoglycerate kinase              203   4e-58    
dbj|BAQ65449.1|  phosphoglycerate kinase                                203   4e-58    
ref|XP_001776160.1|  predicted protein                                  205   4e-58    
ref|WP_034613156.1|  phosphoglycerate kinase                            203   5e-58    
ref|WP_014187636.1|  phosphoglycerate kinase                            203   5e-58    
ref|XP_001762684.1|  predicted protein                                  205   5e-58    
ref|WP_008275737.1|  phosphoglycerate kinase                            203   5e-58    
gb|ABH04835.1|  phosphoglycerate kinase                                 203   6e-58    
ref|WP_027842190.1|  phosphoglycerate kinase                            203   6e-58    
ref|WP_015145174.1|  phosphoglycerate kinase                            203   6e-58    
ref|WP_029688634.1|  phosphoglycerate kinase                            202   6e-58    
gb|AAK40345.1|  phosphoglycerate kinase                                 204   6e-58    
ref|WP_012412172.1|  phosphoglycerate kinase                            202   7e-58    
ref|WP_009623623.1|  phosphoglycerate kinase                            202   7e-58    
ref|WP_011124376.1|  MULTISPECIES: phosphoglycerate kinase              202   8e-58    
ref|WP_015166011.1|  phosphoglycerate kinase                            202   9e-58    
ref|WP_015221859.1|  phosphoglycerate kinase                            202   9e-58    
ref|WP_006042911.1|  phosphoglycerate kinase                            202   9e-58    
dbj|BAG09537.1|  phosphoglycerate kinase                                204   1e-57    
ref|WP_006507734.1|  phosphoglycerate kinase                            202   1e-57    
ref|WP_038090335.1|  phosphoglycerate kinase                            202   1e-57    
ref|YP_002049002.1|  Phosphoglycerate kinase                            202   1e-57    
ref|WP_017303631.1|  phosphoglycerate kinase                            202   1e-57    
ref|WP_028992663.1|  phosphoglycerate kinase                            202   1e-57    
ref|WP_012598967.1|  phosphoglycerate kinase                            202   1e-57    
ref|WP_015044861.1|  MULTISPECIES: phosphoglycerate kinase              202   1e-57    
dbj|BAQ61019.1|  phosphoglycerate kinase                                202   1e-57    
ref|WP_012995536.1|  phosphoglycerate kinase                            202   1e-57    
ref|WP_014759315.1|  MULTISPECIES: phosphoglycerate kinase              202   1e-57    
ref|WP_013150545.1|  phosphoglycerate kinase                            202   1e-57    
ref|WP_004402126.1|  MULTISPECIES: phosphoglycerate kinase              202   1e-57    
ref|WP_009788740.1|  phosphoglycerate kinase                            202   2e-57    
ref|WP_003870199.1|  MULTISPECIES: phosphoglycerate kinase              202   2e-57    
ref|WP_024125258.1|  phosphoglycerate kinase                            202   2e-57    
ref|WP_007101320.1|  phosphoglycerate kinase                            202   2e-57    
ref|WP_013779025.1|  phosphoglycerate kinase                            201   3e-57    
ref|XP_005709175.1|  phosphoglycerate kinase                            203   3e-57    
ref|WP_025747855.1|  phosphoglycerate kinase                            201   3e-57    
ref|WP_026487158.1|  phosphoglycerate kinase                            201   3e-57    
ref|WP_045411861.1|  phosphoglycerate kinase                            201   4e-57    
ref|WP_013787604.1|  phosphoglycerate kinase                            201   4e-57    
gb|ACF24541.1|  phosphoglycerate kinase 1                               199   4e-57    
gb|KJU83130.1|  3-Phosphoglycerate kinase                               201   4e-57    
ref|WP_006850489.1|  phosphoglycerate kinase                            201   4e-57    
ref|XP_005715401.1|  unnamed protein product                            202   4e-57    
ref|WP_038552523.1|  phosphoglycerate kinase                            201   5e-57    
ref|WP_006854064.1|  phosphoglycerate kinase                            200   8e-57    
ref|WP_041356046.1|  phosphoglycerate kinase                            200   9e-57    
ref|WP_003540450.1|  phosphoglycerate kinase                            199   1e-56    
ref|WP_013810778.1|  phosphoglycerate kinase                            199   1e-56    
gb|ADI87680.1|  phosphoglycerate kinase                                 199   1e-56    
gb|AFN75153.1|  phosphoglycerate kinase                                 199   1e-56    
ref|WP_011129182.1|  phosphoglycerate kinase                            199   1e-56    
ref|WP_011360883.1|  phosphoglycerate kinase                            199   1e-56    
ref|WP_011058101.1|  phosphoglycerate kinase                            199   1e-56    
ref|WP_014455673.1|  phosphoglycerate kinase                            199   2e-56    
ref|XP_005851590.1|  hypothetical protein CHLNCDRAFT_29609              199   2e-56    
ref|WP_022182979.1|  phosphoglycerate kinase                            199   2e-56    
ref|WP_007503210.1|  phosphoglycerate kinase                            199   2e-56    
ref|WP_022343655.1|  phosphoglycerate kinase                            199   2e-56    
ref|WP_029717435.1|  phosphoglycerate kinase                            199   2e-56    
ref|WP_038288111.1|  phosphoglycerate kinase [                          199   2e-56    
ref|WP_036901530.1|  phosphoglycerate kinase                            199   2e-56    
dbj|GAE88155.1|  phosphoglycerate kinase [ [                            199   3e-56    
ref|WP_014063090.1|  phosphoglycerate kinase                            198   3e-56    
ref|WP_006569976.1|  phosphoglycerate kinase                            198   4e-56    
ref|WP_011936642.1|  phosphoglycerate kinase                            198   5e-56    
ref|WP_015759304.1|  phosphoglycerate kinase                            197   5e-56    
ref|WP_022451887.1|  phosphoglycerate kinase                            197   6e-56    
ref|WP_011879284.1|  phosphoglycerate kinase                            197   7e-56    
ref|WP_042833404.1|  phosphoglycerate kinase                            197   7e-56    
ref|WP_012281799.1|  phosphoglycerate kinase                            197   8e-56    
ref|WP_011131470.1|  phosphoglycerate kinase                            197   8e-56    
ref|WP_011620601.1|  phosphoglycerate kinase                            197   9e-56    
ref|WP_009769345.1|  phosphoglycerate kinase                            197   9e-56    
ref|WP_025980178.1|  phosphoglycerate kinase                            191   1e-55    
ref|WP_011827369.1|  phosphoglycerate kinase                            197   1e-55    
ref|WP_029917892.1|  phosphoglycerate kinase                            197   1e-55    
ref|WP_003540618.1|  MULTISPECIES: phosphoglycerate kinase              196   1e-55    
ref|WP_017872268.1|  phosphoglycerate kinase                            196   1e-55    
ref|WP_013298468.1|  phosphoglycerate kinase                            196   2e-55    
ref|WP_014254443.1|  phosphoglycerate kinase [                          196   2e-55    
ref|WP_011433296.1|  phosphoglycerate kinase                            197   2e-55    
ref|WP_027622719.1|  phosphoglycerate kinase [                          196   2e-55    
gb|AIS52787.1|  phosphoglycerate kinase Pgk                             196   2e-55    
ref|WP_018205058.1|  MULTISPECIES: phosphoglycerate kinase              196   2e-55    
ref|WP_013485438.1|  phosphoglycerate kinase                            196   2e-55    
gb|KGG29033.1|  Phosphoglycerate kinase                                 197   2e-55    
ref|WP_025980855.1|  phosphoglycerate kinase                            190   3e-55    
ref|WP_022412440.1|  phosphoglycerate kinase                            196   3e-55    
ref|WP_036911068.1|  MULTISPECIES: phosphoglycerate kinase              196   3e-55    
ref|WP_017888984.1|  phosphoglycerate kinase                            196   3e-55    
ref|WP_018759096.1|  phosphoglycerate kinase                            196   3e-55    
ref|WP_013321558.1|  phosphoglycerate kinase                            196   4e-55    
ref|WP_014905210.1|  phosphoglycerate kinase                            195   5e-55    
ref|WP_011377868.1|  MULTISPECIES: phosphoglycerate kinase              195   5e-55    
ref|WP_019478026.1|  phosphoglycerate kinase                            195   5e-55    
ref|WP_003517880.1|  phosphoglycerate kinase                            195   6e-55    
gb|EQB63431.1|  Phosphoglycerate kinase                                 195   6e-55    
ref|WP_014560136.1|  phosphoglycerate kinase                            195   6e-55    
ref|WP_011429225.1|  phosphoglycerate kinase                            195   6e-55    
ref|XP_001777571.1|  predicted protein                                  195   7e-55    
emb|CEF98237.1|  Phosphoglycerate kinase, conserved site                195   7e-55    
ref|WP_011025957.1|  phosphoglycerate kinase                            195   7e-55    
ref|WP_032517310.1|  phosphoglycerate kinase                            195   7e-55    
ref|WP_011242745.1|  phosphoglycerate kinase                            195   8e-55    
ref|WP_013843546.1|  phosphoglycerate kinase                            194   8e-55    
ref|WP_028991098.1|  phosphoglycerate kinase                            194   9e-55    
ref|WP_041737991.1|  phosphoglycerate kinase                            194   9e-55    
ref|WP_015785332.1|  MULTISPECIES: phosphoglycerate kinase              194   1e-54    
ref|WP_025951358.1|  phosphoglycerate kinase                            189   1e-54    
ref|WP_026594091.1|  phosphoglycerate kinase                            194   1e-54    
ref|WP_032523967.1|  phosphoglycerate kinase                            194   1e-54    
ref|WP_007290066.1|  phosphoglycerate kinase                            194   1e-54    
emb|CDX79326.1|  BnaC06g19770D                                          193   1e-54    
ref|WP_027714084.1|  phosphoglycerate kinase                            194   2e-54    



>ref|XP_009763674.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Nicotiana 
sylvestris]
Length=481

 Score =   387 bits (993),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 194/234 (83%), Positives = 213/234 (91%), Gaps = 3/234 (1%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A A+AS+T CGIP TSSS  + + +   A   RFL +TPLR LGFA AAAD  F++HVAT
Sbjct  2    ASATASHTLCGIPATSSSTTNKAIAPSSA---RFLVKTPLRRLGFAGAAADSLFTNHVAT  58

Query  428  QLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  607
            +LRSLK+S+KP+RGV SMAKKSVGDLTAA+LKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  59   KLRSLKSSSKPIRGVASMAKKSVGDLTAAELKGKKVFVRADLNVPLDDNQNITDDTRIRA  118

Query  608  AIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVE  787
            A+PTIKHL++NGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKA+DCIGPEVE
Sbjct  119  AVPTIKHLMANGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKAEDCIGPEVE  178

Query  788  KLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            KLVASLP+GGVLLLENVRFYKEEEKNEPEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  179  KLVASLPEGGVLLLENVRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHA  232



>ref|XP_011086346.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Sesamum indicum]
Length=481

 Score =   386 bits (992),  Expect = 5e-128, Method: Compositional matrix adjust.
 Identities = 201/235 (86%), Positives = 213/235 (91%), Gaps = 4/235 (2%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A ++AS  FCGIP  S++AA +S +   A  TRFL +TPLR LGFAAAAADP  SHHVAT
Sbjct  2    ASSAASPAFCGIPKASTAAARASLT---APTTRFLSKTPLRRLGFAAAAADPLLSHHVAT  58

Query  428  QLRSLK-ASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIR  604
            +L S K ASAKPVRGV SMAKKSVGDL+ ADLKGKKVFVRADLNVPLDD+Q ITDDTRIR
Sbjct  59   KLVSFKNASAKPVRGVASMAKKSVGDLSGADLKGKKVFVRADLNVPLDDSQNITDDTRIR  118

Query  605  AAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEV  784
            AA+PTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEV
Sbjct  119  AAVPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEV  178

Query  785  EKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            EKLVASLP+GGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA
Sbjct  179  EKLVASLPEGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  233



>sp|Q42961.1|PGKH_TOBAC RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Nicotiana tabacum]
 emb|CAA88841.1| phosphoglycerate kinase [Nicotiana tabacum]
Length=481

 Score =   385 bits (990),  Expect = 9e-128, Method: Compositional matrix adjust.
 Identities = 193/234 (82%), Positives = 212/234 (91%), Gaps = 3/234 (1%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A A+AS+T CGIP TSSS  + + +   A   RFL +TPLR LGFA AAAD  F++HVAT
Sbjct  2    ASATASHTLCGIPATSSSTTNKAIAPSSA---RFLAKTPLRRLGFAGAAADSLFTNHVAT  58

Query  428  QLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  607
            +LRSLK+S+KP+RGV SMAKKSVGDLTAA+LKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  59   KLRSLKSSSKPIRGVASMAKKSVGDLTAAELKGKKVFVRADLNVPLDDNQNITDDTRIRA  118

Query  608  AIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVE  787
            A+PTIKHL++NGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVK +DCIGPEVE
Sbjct  119  AVPTIKHLMANGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKVEDCIGPEVE  178

Query  788  KLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            KLVASLP+GGVLLLENVRFYKEEEKNEPEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  179  KLVASLPEGGVLLLENVRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHA  232



>gb|AAC26785.1| phosphoglycerate kinase precursor [Solanum tuberosum]
Length=482

 Score =   384 bits (985),  Expect = 6e-127, Method: Compositional matrix adjust.
 Identities = 198/234 (85%), Positives = 216/234 (92%), Gaps = 2/234 (1%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A A+AS+TFCGIPTTSSS+ ++ S++  +   RFL +TPLR LGFA A ADP F++HVAT
Sbjct  2    ASATASHTFCGIPTTSSSSTTNRSTTHSS--ARFLLKTPLRRLGFAGAVADPLFTNHVAT  59

Query  428  QLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  607
            +LRSLKAS+ PVR VVSMAKKSVGDL+++DLKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  60   KLRSLKASSNPVRAVVSMAKKSVGDLSSSDLKGKKVFVRADLNVPLDDAQNITDDTRIRA  119

Query  608  AIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVE  787
            AIPTIKHLI+NGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVE
Sbjct  120  AIPTIKHLIANGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVE  179

Query  788  KLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            KLV SLP+GGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA
Sbjct  180  KLVDSLPEGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  233



>ref|XP_009622055.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Nicotiana 
tomentosiformis]
Length=481

 Score =   383 bits (984),  Expect = 7e-127, Method: Compositional matrix adjust.
 Identities = 193/234 (82%), Positives = 211/234 (90%), Gaps = 3/234 (1%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A A+AS+T CGIP TSSS  + + +   A   RFL +TPLR LGFA AAAD  F++HVA 
Sbjct  2    ASATASHTLCGIPATSSSTTNKAIAPSSA---RFLAKTPLRRLGFAGAAADSLFTNHVAA  58

Query  428  QLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  607
            +LRSLK S+KPVRGV SMAKKSVGDLTAA+LKGKKVFVRADLNVPLDD+Q ITDDTRIRA
Sbjct  59   KLRSLKGSSKPVRGVASMAKKSVGDLTAAELKGKKVFVRADLNVPLDDSQNITDDTRIRA  118

Query  608  AIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVE  787
            A+PTIKHL++NGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKA+DCIGPEVE
Sbjct  119  AVPTIKHLMANGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKAEDCIGPEVE  178

Query  788  KLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            KLVASLP+G VLLLENVRFYKEEEKNEPEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  179  KLVASLPEGSVLLLENVRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHA  232



>ref|XP_011095719.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Sesamum indicum]
Length=481

 Score =   383 bits (983),  Expect = 1e-126, Method: Compositional matrix adjust.
 Identities = 197/237 (83%), Positives = 211/237 (89%), Gaps = 8/237 (3%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVI--TRFLPRTPLRSLGFAAAAADPFFSHHV  421
            A  +AS  FCGIP  S+S +++     RA I  TRFL + PLR LGF+AAAA+P  SHHV
Sbjct  2    ASTAASPAFCGIPKASTSTSAA-----RASIPATRFLAKNPLRGLGFSAAAAEPLLSHHV  56

Query  422  ATQLRSL-KASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTR  598
            AT+LRS   +SAKPVRGV SMAKKSVGDLTAADLKGKKVFVRADLNVPLDD Q ITDDTR
Sbjct  57   ATKLRSFGSSSAKPVRGVASMAKKSVGDLTAADLKGKKVFVRADLNVPLDDNQNITDDTR  116

Query  599  IRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGP  778
            IRAA+PTIKHLISNGAKVILS+HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGP
Sbjct  117  IRAAVPTIKHLISNGAKVILSTHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGP  176

Query  779  EVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            EVEKLVASLP+GGVLLLENVRFYKEEEKNEPEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  177  EVEKLVASLPEGGVLLLENVRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHA  233



>ref|NP_001275227.1| phosphoglycerate kinase, chloroplastic-like [Solanum tuberosum]
 gb|ABB72817.1| phosphoglycerate kinase precursor-like protein [Solanum tuberosum]
Length=482

 Score =   380 bits (975),  Expect = 2e-125, Method: Compositional matrix adjust.
 Identities = 195/234 (83%), Positives = 215/234 (92%), Gaps = 2/234 (1%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A A+AS+TFCGIPTTSSS+ ++ S++  +   RFL +TPLR LGFA A ADP F++HVAT
Sbjct  2    ASATASHTFCGIPTTSSSSTTNRSTTHSS--ARFLLKTPLRRLGFAGAVADPLFTNHVAT  59

Query  428  QLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  607
            +LRSLKAS+ PVR VVSMAKKSVGDL+++DLKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  60   KLRSLKASSNPVRAVVSMAKKSVGDLSSSDLKGKKVFVRADLNVPLDDAQNITDDTRIRA  119

Query  608  AIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVE  787
            AIPTIKHLI+NGAKVILS+HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVE
Sbjct  120  AIPTIKHLIANGAKVILSTHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVE  179

Query  788  KLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            KLV SLP+GGVLLLENVRFYKEEEKNEPEF KKLASLADL+VNDAFGTAHRAHA
Sbjct  180  KLVDSLPEGGVLLLENVRFYKEEEKNEPEFXKKLASLADLYVNDAFGTAHRAHA  233



>gb|ADR71054.1| phosphoglycerate kinase [Nicotiana benthamiana]
Length=481

 Score =   379 bits (973),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 191/234 (82%), Positives = 210/234 (90%), Gaps = 3/234 (1%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A A+AS++ CGIP TSSS  + S +   A   RFL +TP R LGFA AAAD  F++HVAT
Sbjct  2    ASATASHSLCGIPATSSSTTNKSIAPSSA---RFLAKTPPRGLGFAGAAADSLFTNHVAT  58

Query  428  QLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  607
            +LRSLK+S+KPVRGV SMAKKSVGDLTAA+LKGK VFVRADLNVPLDD Q ITDDTRIRA
Sbjct  59   KLRSLKSSSKPVRGVASMAKKSVGDLTAAELKGKNVFVRADLNVPLDDNQNITDDTRIRA  118

Query  608  AIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVE  787
            A+PTIKHL++NGAKVILS+HLGRPKGVTPKYSLAPLVPRLSELLGIQVVK +DCIGPEVE
Sbjct  119  AVPTIKHLMANGAKVILSTHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKVEDCIGPEVE  178

Query  788  KLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            KLVASLP+GGVLLLENVRFYKEEEKNEPEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  179  KLVASLPEGGVLLLENVRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHA  232



>gb|ABB86255.1| phosphoglycerate kinase precursor-like [Solanum tuberosum]
Length=482

 Score =   379 bits (973),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 195/234 (83%), Positives = 213/234 (91%), Gaps = 2/234 (1%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A A+AS+TFCGIPT SSS+ ++ S++  +   RFL +TPLR LGFA A ADP F+ HVAT
Sbjct  2    ASATASHTFCGIPTKSSSSTTNRSTTPSS--ARFLLKTPLRRLGFAGAVADPLFTSHVAT  59

Query  428  QLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  607
            +LRSLKAS+ PVR VVSMAKKSVGDL++ADLKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  60   KLRSLKASSNPVRAVVSMAKKSVGDLSSADLKGKKVFVRADLNVPLDDAQNITDDTRIRA  119

Query  608  AIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVE  787
            AIPTIKHLI+NGAKVILS+HLGRPKGVTPKYSLAPLVPRLSELLGIQ VKADDCIGPEVE
Sbjct  120  AIPTIKHLIANGAKVILSTHLGRPKGVTPKYSLAPLVPRLSELLGIQGVKADDCIGPEVE  179

Query  788  KLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            KLV SLP+GGVLLLENVRFYKEEEKNEPEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  180  KLVDSLPEGGVLLLENVRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHA  233



>ref|XP_004243968.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Solanum lycopersicum]
Length=482

 Score =   377 bits (967),  Expect = 3e-124, Method: Compositional matrix adjust.
 Identities = 193/234 (82%), Positives = 215/234 (92%), Gaps = 2/234 (1%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A A+AS+T CGIPTTSSS+ ++ S++  +   RFL +TPLR LGFA   ADP F++HVAT
Sbjct  2    ASATASHTLCGIPTTSSSSTTNKSTTYSS--ARFLLKTPLRRLGFAGTVADPLFTNHVAT  59

Query  428  QLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  607
            +LRS+KAS+ PVR VVSMAKKSVGDL+++DLKGKKVFVRADLNVPLDD+Q ITDDTRIRA
Sbjct  60   KLRSVKASSNPVRAVVSMAKKSVGDLSSSDLKGKKVFVRADLNVPLDDSQNITDDTRIRA  119

Query  608  AIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVE  787
            AIPTIKHLI+NGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEV+
Sbjct  120  AIPTIKHLIANGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVD  179

Query  788  KLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            KLV SLP+GGVLLLENVRFYKEEEKNEPEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  180  KLVDSLPEGGVLLLENVRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHA  233



>gb|EPS66037.1| phosphoglycerate kinase, chloroplastic [Genlisea aurea]
Length=487

 Score =   360 bits (925),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 189/235 (80%), Positives = 205/235 (87%), Gaps = 3/235 (1%)
 Frame = +2

Query  254  ASASYTFCGIPTTsssaassssssKRAV-ITRFLPRTPLRSLGFAAAAADPFFSHHVATQ  430
            A+AS   CG+P  S+  A+SS S+   V  +RFL RTPLR LGF+AAA DP  +HHVA +
Sbjct  5    AAASPALCGVPKASTGGAASSRSASPCVPGSRFLGRTPLRRLGFSAAAVDPILAHHVAAR  64

Query  431  LRSLKASA--KPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIR  604
              S   SA  KP RGVVSMAKKSVGDL+AADLKG++VFVRADLNVPLDD Q ITDDTRIR
Sbjct  65   SASFIRSAGKKPARGVVSMAKKSVGDLSAADLKGRRVFVRADLNVPLDDNQNITDDTRIR  124

Query  605  AAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEV  784
            AA+PTIKHLI+NGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADD IGPEV
Sbjct  125  AAVPTIKHLINNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDVIGPEV  184

Query  785  EKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            EKLVASLP+GGVLLLENVRFYKEEEKNEPEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  185  EKLVASLPEGGVLLLENVRFYKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHA  239



>gb|EYU33792.1| hypothetical protein MIMGU_mgv1a005422mg [Erythranthe guttata]
Length=484

 Score =   357 bits (917),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/227 (80%), Positives = 201/227 (89%), Gaps = 3/227 (1%)
 Frame = +2

Query  272  FCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLK-A  448
            FCGIP  S++ A+ +S   +   TRFL +TP R LGFAAAAADP  S HVA ++ SLK  
Sbjct  12   FCGIPKASTATAARASL--KTPTTRFLSKTPTRGLGFAAAAADPLLSRHVAVKMASLKRG  69

Query  449  SAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKH  628
            S+  VRGV SM KKSVGDLTAA+LKGK+VFVRADLNVPLDD+Q ITDDTRIRAAIPTIKH
Sbjct  70   SSAAVRGVASMVKKSVGDLTAAELKGKRVFVRADLNVPLDDSQNITDDTRIRAAIPTIKH  129

Query  629  LISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLP  808
            LISNGAKV+LSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGP+VE LVA+LP
Sbjct  130  LISNGAKVLLSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPDVEALVAALP  189

Query  809  DGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            +GGVLLLENVRFYKEEEKN+PEFA+KLASLADL+VNDAFGTAHRAHA
Sbjct  190  EGGVLLLENVRFYKEEEKNDPEFAQKLASLADLYVNDAFGTAHRAHA  236



>ref|XP_011013857.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Populus euphratica]
Length=481

 Score =   352 bits (904),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 177/205 (86%), Positives = 185/205 (90%), Gaps = 2/205 (1%)
 Frame = +2

Query  335  VITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAA  514
            V T  L  T LR LGF+AA  D  FS HV +++RS K++ K  R VVSMAKKSVGDLTAA
Sbjct  31   VSTSGLRTTSLRGLGFSAA--DTLFSSHVVSKIRSFKSNGKAPRAVVSMAKKSVGDLTAA  88

Query  515  DLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTP  694
            DLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTP
Sbjct  89   DLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTP  148

Query  695  KYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPE  874
            K+SLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPE
Sbjct  149  KFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPE  208

Query  875  FAKKLASLADLFVNDAFGTAHRAHA  949
            FAKKLASLADL+VNDAFGTAHRAHA
Sbjct  209  FAKKLASLADLYVNDAFGTAHRAHA  233



>ref|XP_002315066.1| PHOSPHOGLYCERATE KINASE 1 family protein [Populus trichocarpa]
 gb|EEF01237.1| PHOSPHOGLYCERATE KINASE 1 family protein [Populus trichocarpa]
Length=481

 Score =   351 bits (901),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 176/205 (86%), Positives = 185/205 (90%), Gaps = 2/205 (1%)
 Frame = +2

Query  335  VITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAA  514
            V T  L  T LR LGF+AA  D  FS HV +++RS K++ K  R VVSMAKKSVGDLTAA
Sbjct  31   VSTSGLRTTSLRGLGFSAA--DTLFSSHVVSKIRSFKSNGKAPRAVVSMAKKSVGDLTAA  88

Query  515  DLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTP  694
            DLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK+LISNGAKVILSSHLGRPKGVTP
Sbjct  89   DLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKYLISNGAKVILSSHLGRPKGVTP  148

Query  695  KYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPE  874
            K+SLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPE
Sbjct  149  KFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPE  208

Query  875  FAKKLASLADLFVNDAFGTAHRAHA  949
            FAKKLASLADL+VNDAFGTAHRAHA
Sbjct  209  FAKKLASLADLYVNDAFGTAHRAHA  233



>ref|XP_002513353.1| phosphoglycerate kinase, putative [Ricinus communis]
 gb|EEF48756.1| phosphoglycerate kinase, putative [Ricinus communis]
Length=479

 Score =   350 bits (899),  Expect = 5e-114, Method: Compositional matrix adjust.
 Identities = 176/197 (89%), Positives = 183/197 (93%), Gaps = 3/197 (2%)
 Frame = +2

Query  359  TPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVF  538
            T LR LGFAAA  DP FSHHVA+++RS   S K  R VVSMAKKSVGDLTAADLKGKKVF
Sbjct  38   TTLRRLGFAAA--DPAFSHHVASKIRSF-GSGKASRAVVSMAKKSVGDLTAADLKGKKVF  94

Query  539  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLV  718
            VRADLNVPLDD QKITDDTRIRAAIPT+KHLI NGAKVILSSHLGRPKGVTPK+SLAPLV
Sbjct  95   VRADLNVPLDDNQKITDDTRIRAAIPTVKHLIQNGAKVILSSHLGRPKGVTPKFSLAPLV  154

Query  719  PRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASL  898
            PRLSELLGIQVVKADDCIGPEVEKLVASLP+GGVLLLENVRFYKEEEKNEPEFAKKLASL
Sbjct  155  PRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRFYKEEEKNEPEFAKKLASL  214

Query  899  ADLFVNDAFGTAHRAHA  949
            ADL+VNDAFGTAHRAHA
Sbjct  215  ADLYVNDAFGTAHRAHA  231



>gb|ABK96267.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96531.1| unknown [Populus trichocarpa x Populus deltoides]
Length=481

 Score =   347 bits (889),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/205 (84%), Positives = 186/205 (91%), Gaps = 2/205 (1%)
 Frame = +2

Query  335  VITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAA  514
            V T  L  T LR LGF+AA  DP FS HV +++RS K++ +  R VVSMAKKSVGDLTAA
Sbjct  31   VSTSGLRTTSLRGLGFSAA--DPLFSSHVVSKIRSFKSNGRAPRAVVSMAKKSVGDLTAA  88

Query  515  DLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTP  694
            DLKGKKVFVRADLNVPLD+ QKITDDTRIRAA+PTIK+LIS GAKVILSSHLGRPKGVTP
Sbjct  89   DLKGKKVFVRADLNVPLDENQKITDDTRIRAAVPTIKYLISKGAKVILSSHLGRPKGVTP  148

Query  695  KYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPE  874
            K+SLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLP+GGVLLLENVRFYKEEEKNEPE
Sbjct  149  KFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRFYKEEEKNEPE  208

Query  875  FAKKLASLADLFVNDAFGTAHRAHA  949
            FAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  209  FAKKLASMADLYVNDAFGTAHRAHA  233



>ref|XP_002312238.1| hypothetical protein POPTR_0008s08410g [Populus trichocarpa]
 dbj|BAA33803.1| chloroplast phosphoglycerate kinase [Populus nigra]
 gb|EEE89605.1| hypothetical protein POPTR_0008s08410g [Populus trichocarpa]
Length=481

 Score =   346 bits (888),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 172/205 (84%), Positives = 186/205 (91%), Gaps = 2/205 (1%)
 Frame = +2

Query  335  VITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAA  514
            V T  L  T LR LGF+AA  DP FS HV +++RS K++ +  R VVSMAKKSVGDLTAA
Sbjct  31   VSTSGLRTTSLRGLGFSAA--DPLFSSHVVSKIRSFKSNGRAPRAVVSMAKKSVGDLTAA  88

Query  515  DLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTP  694
            DLKGKKVFVRADLNVPLD+ QKITDDTRIRAA+PTIK+LIS GAKVILSSHLGRPKGVTP
Sbjct  89   DLKGKKVFVRADLNVPLDENQKITDDTRIRAAVPTIKYLISKGAKVILSSHLGRPKGVTP  148

Query  695  KYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPE  874
            K+SLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLP+GGVLLLENVRFYKEEEKNEPE
Sbjct  149  KFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRFYKEEEKNEPE  208

Query  875  FAKKLASLADLFVNDAFGTAHRAHA  949
            FAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  209  FAKKLASMADLYVNDAFGTAHRAHA  233



>ref|XP_011016496.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Populus euphratica]
Length=481

 Score =   346 bits (887),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 172/205 (84%), Positives = 186/205 (91%), Gaps = 2/205 (1%)
 Frame = +2

Query  335  VITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAA  514
            V T  L  T LR LGF+AA  DP FS HV +++RS K++ +  R VVSMAKKSVGDLTAA
Sbjct  31   VSTSGLRTTSLRGLGFSAA--DPLFSSHVVSKIRSFKSNGRAPRAVVSMAKKSVGDLTAA  88

Query  515  DLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTP  694
            DLKGKKVFVRADLNVPLD+ QKITDDTRIRAA+PTIK+LISNGAKVILSSHLGRPKGVTP
Sbjct  89   DLKGKKVFVRADLNVPLDENQKITDDTRIRAAVPTIKYLISNGAKVILSSHLGRPKGVTP  148

Query  695  KYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPE  874
            K+SLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLP+G VLLLENVRFYKEEEKNEPE
Sbjct  149  KFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGSVLLLENVRFYKEEEKNEPE  208

Query  875  FAKKLASLADLFVNDAFGTAHRAHA  949
            FAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  209  FAKKLASMADLYVNDAFGTAHRAHA  233



>ref|XP_002263796.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Vitis vinifera]
 emb|CAN81990.1| hypothetical protein VITISV_000725 [Vitis vinifera]
Length=478

 Score =   344 bits (882),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 169/200 (85%), Positives = 180/200 (90%), Gaps = 2/200 (1%)
 Frame = +2

Query  350  LPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGK  529
            LP  PLR LGFA AAAD   + HVA++ RS +  A   RGVVSMAKKSVGDLT ADLKGK
Sbjct  33   LPTLPLRRLGFAGAAADSLLTLHVASRTRSFRGKAS--RGVVSMAKKSVGDLTGADLKGK  90

Query  530  KVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLA  709
            KVFVR DLNVPLDD QKITDDTR+RAAIPTIK+LI NGAKVILSSHLGRPKGVTPK+SLA
Sbjct  91   KVFVRVDLNVPLDDNQKITDDTRVRAAIPTIKYLIDNGAKVILSSHLGRPKGVTPKFSLA  150

Query  710  PLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKL  889
            PLVPRLSELLGIQ+VKADDCIGPEVEKLV +LPDGGVLLLENVRFYKEEEKNEPEFAKKL
Sbjct  151  PLVPRLSELLGIQIVKADDCIGPEVEKLVTALPDGGVLLLENVRFYKEEEKNEPEFAKKL  210

Query  890  ASLADLFVNDAFGTAHRAHA  949
            AS+ADL+VNDAFGTAHRAHA
Sbjct  211  ASIADLYVNDAFGTAHRAHA  230



>gb|KJB14025.1| hypothetical protein B456_002G107300 [Gossypium raimondii]
Length=491

 Score =   342 bits (878),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 186/204 (91%), Gaps = 4/204 (2%)
 Frame = +2

Query  344  RFLPRTPL-RSLGFAAAAA-DPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAAD  517
            R L  +PL  SLGF++AA+ D   S HV++++RS K   K  RGVVSMAKKSVGDLTAAD
Sbjct  39   RHLKSSPLIHSLGFSSAASGDSLLSLHVSSKVRSFKG--KGSRGVVSMAKKSVGDLTAAD  96

Query  518  LKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPK  697
            LKGKKVFVRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI NGAKVILSSHLGRPKGVTPK
Sbjct  97   LKGKKVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLIQNGAKVILSSHLGRPKGVTPK  156

Query  698  YSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEF  877
            +SLAPLVPRLSELLGIQVVKADDCIGPEVEKLVA+LP+GGVLLLENVRFYKEEEKNEPEF
Sbjct  157  FSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVAALPEGGVLLLENVRFYKEEEKNEPEF  216

Query  878  AKKLASLADLFVNDAFGTAHRAHA  949
            AKKLASLADLFVNDAFGTAHRAHA
Sbjct  217  AKKLASLADLFVNDAFGTAHRAHA  240



>gb|KJB14026.1| hypothetical protein B456_002G107300 [Gossypium raimondii]
Length=488

 Score =   342 bits (877),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 174/204 (85%), Positives = 186/204 (91%), Gaps = 4/204 (2%)
 Frame = +2

Query  344  RFLPRTPL-RSLGFAAAAA-DPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAAD  517
            R L  +PL  SLGF++AA+ D   S HV++++RS K   K  RGVVSMAKKSVGDLTAAD
Sbjct  39   RHLKSSPLIHSLGFSSAASGDSLLSLHVSSKVRSFKG--KGSRGVVSMAKKSVGDLTAAD  96

Query  518  LKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPK  697
            LKGKKVFVRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI NGAKVILSSHLGRPKGVTPK
Sbjct  97   LKGKKVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLIQNGAKVILSSHLGRPKGVTPK  156

Query  698  YSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEF  877
            +SLAPLVPRLSELLGIQVVKADDCIGPEVEKLVA+LP+GGVLLLENVRFYKEEEKNEPEF
Sbjct  157  FSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVAALPEGGVLLLENVRFYKEEEKNEPEF  216

Query  878  AKKLASLADLFVNDAFGTAHRAHA  949
            AKKLASLADLFVNDAFGTAHRAHA
Sbjct  217  AKKLASLADLFVNDAFGTAHRAHA  240



>ref|XP_004488763.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cicer 
arietinum]
Length=479

 Score =   341 bits (874),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 182/234 (78%), Positives = 201/234 (86%), Gaps = 4/234 (2%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A A+A  T   +PTT SS+ S+S SS R  ++ FL   PLR LGFAAA  DP  +  VA+
Sbjct  2    ASATAPTTLSLLPTTKSSSPSASPSSSRVHLSSFLGARPLRRLGFAAA--DPLLAVQVAS  59

Query  428  QLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  607
            +LR++  S +  RGVVSMAKKSVGDL+AA+LKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  60   KLRTV--SGRGARGVVSMAKKSVGDLSAAELKGKKVFVRADLNVPLDDNQNITDDTRIRA  117

Query  608  AIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVE  787
            AIPTIKHLI NGAKVILSSHLGRPKGVTPKYSLAPLVPRLSEL+GIQV+KADD IGPEVE
Sbjct  118  AIPTIKHLIQNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELIGIQVIKADDSIGPEVE  177

Query  788  KLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            KLVASLP+GGVLLLENVRFYKEEEKN+PE AKKLASLADL+VNDAFGTAHRAHA
Sbjct  178  KLVASLPEGGVLLLENVRFYKEEEKNDPEHAKKLASLADLYVNDAFGTAHRAHA  231



>gb|KHG01489.1| hypothetical protein F383_22605 [Gossypium arboreum]
Length=488

 Score =   340 bits (872),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 170/196 (87%), Positives = 182/196 (93%), Gaps = 3/196 (2%)
 Frame = +2

Query  365  LRSLGFAAAAA-DPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFV  541
            + SLGF++AA+ D   S HV++++RS K   K  RGVVSMAKKSVGDLTAADLKGKKVFV
Sbjct  47   IHSLGFSSAASGDSLLSLHVSSKVRSFKG--KGSRGVVSMAKKSVGDLTAADLKGKKVFV  104

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVP  721
            RADLNVPLDD+Q ITDDTRIRAAIPTIKHLI NGAKVILSSHLGRPKGVTPK+SLAPLVP
Sbjct  105  RADLNVPLDDSQNITDDTRIRAAIPTIKHLIQNGAKVILSSHLGRPKGVTPKFSLAPLVP  164

Query  722  RLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLA  901
            RLSELLGIQVVKADDCIGPEVEKLVA+LP+GGVLLLENVRFYKEEEKNEPEFAKKLASLA
Sbjct  165  RLSELLGIQVVKADDCIGPEVEKLVAALPEGGVLLLENVRFYKEEEKNEPEFAKKLASLA  224

Query  902  DLFVNDAFGTAHRAHA  949
            DLFVNDAFGTAHRAHA
Sbjct  225  DLFVNDAFGTAHRAHA  240



>ref|XP_008456300.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Cucumis melo]
Length=485

 Score =   337 bits (865),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 171/192 (89%), Positives = 175/192 (91%), Gaps = 4/192 (2%)
 Frame = +2

Query  374  LGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADL  553
            LGFAAA  DP FS HVA+++RS     K  RGVVSMAKKSVGDLTAADLKGKKVFVRADL
Sbjct  50   LGFAAA--DPLFSLHVASKIRSF--GGKASRGVVSMAKKSVGDLTAADLKGKKVFVRADL  105

Query  554  NVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSE  733
            NVPLDD Q ITDDTRIRAAIPTIKHL   GAKVILSSHLGRPKGVTPKYSLAPLVPRLSE
Sbjct  106  NVPLDDNQNITDDTRIRAAIPTIKHLTEKGAKVILSSHLGRPKGVTPKYSLAPLVPRLSE  165

Query  734  LLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFV  913
            LLG QVVKADDCIGPEVEKLVASLP+GGVLLLENVRFYKEEEKNEPEFAKKLASLADLFV
Sbjct  166  LLGFQVVKADDCIGPEVEKLVASLPEGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFV  225

Query  914  NDAFGTAHRAHA  949
            NDAFGTAHRAHA
Sbjct  226  NDAFGTAHRAHA  237



>ref|XP_010060861.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Eucalyptus 
grandis]
 gb|KCW67742.1| hypothetical protein EUGRSUZ_F01476 [Eucalyptus grandis]
Length=484

 Score =   337 bits (864),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 170/200 (85%), Positives = 181/200 (91%), Gaps = 4/200 (2%)
 Frame = +2

Query  350  LPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGK  529
            L  + LR LGFAAA  DPF + HVA++LRSL+   K  RGVVSMAKKSVGDLT   LKGK
Sbjct  41   LRSSGLRRLGFAAA--DPFLAAHVASKLRSLRG--KGSRGVVSMAKKSVGDLTGPALKGK  96

Query  530  KVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLA  709
            KVFVRADLNVPLDD Q ITDDTR+RAA+PTIK+LI NGA+VILSSHLGRPKGVTPKYSLA
Sbjct  97   KVFVRADLNVPLDDNQNITDDTRVRAAVPTIKYLIQNGARVILSSHLGRPKGVTPKYSLA  156

Query  710  PLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKL  889
            PLVPRLSELLGIQVVKADDCIGPEVEKLVASLP+GGVLLLENVRFYKEEEKNEPEFAKKL
Sbjct  157  PLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRFYKEEEKNEPEFAKKL  216

Query  890  ASLADLFVNDAFGTAHRAHA  949
            ASLADL+VNDAFGTAHRAHA
Sbjct  217  ASLADLYVNDAFGTAHRAHA  236



>ref|XP_004139904.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Cucumis 
sativus]
 gb|KGN46797.1| hypothetical protein Csa_6G136020 [Cucumis sativus]
Length=485

 Score =   337 bits (864),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 171/192 (89%), Positives = 175/192 (91%), Gaps = 4/192 (2%)
 Frame = +2

Query  374  LGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADL  553
            LGFAAA  DP FS HVA+++RS     K  RGVVSMAKKSVGDL+AADLKGKKVFVRADL
Sbjct  50   LGFAAA--DPLFSLHVASKIRSF--GGKASRGVVSMAKKSVGDLSAADLKGKKVFVRADL  105

Query  554  NVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSE  733
            NVPLDD Q ITDDTRIRAAIPTIKHL   GAKVILSSHLGRPKGVTPKYSLAPLVPRLSE
Sbjct  106  NVPLDDNQNITDDTRIRAAIPTIKHLTEKGAKVILSSHLGRPKGVTPKYSLAPLVPRLSE  165

Query  734  LLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFV  913
            LL IQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFV
Sbjct  166  LLSIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFV  225

Query  914  NDAFGTAHRAHA  949
            NDAFGTAHRAHA
Sbjct  226  NDAFGTAHRAHA  237



>gb|KDO61595.1| hypothetical protein CISIN_1g011942mg [Citrus sinensis]
 gb|KDO61596.1| hypothetical protein CISIN_1g011942mg [Citrus sinensis]
Length=360

 Score =   333 bits (853),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 180/200 (90%), Gaps = 4/200 (2%)
 Frame = +2

Query  350  LPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGK  529
            +P +  R LGF+AA  DP  + HVA++L S+K   K  R VVSMAKKSVG+L+ ADLKGK
Sbjct  31   MPTSASRRLGFSAA--DPLLTCHVASRLSSIKT--KGTRAVVSMAKKSVGELSGADLKGK  86

Query  530  KVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLA  709
            KVFVRADLNVPLDD Q ITDDTRIRAA+PTIKHLI NGAKVILSSHLGRPKGVTPK+SLA
Sbjct  87   KVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLIQNGAKVILSSHLGRPKGVTPKFSLA  146

Query  710  PLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKL  889
            PLVPRLSELLGIQVVKADDCIGPEVEKLVASLP+GGVLLLENVRFYKEEEKN+PEFAKKL
Sbjct  147  PLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRFYKEEEKNDPEFAKKL  206

Query  890  ASLADLFVNDAFGTAHRAHA  949
            ASLADL+VNDAFGTAHRAHA
Sbjct  207  ASLADLYVNDAFGTAHRAHA  226



>ref|XP_009402843.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Musa acuminata 
subsp. malaccensis]
Length=480

 Score =   337 bits (863),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 164/199 (82%), Positives = 180/199 (90%), Gaps = 1/199 (1%)
 Frame = +2

Query  356  RTPLRSLGFAAAAADPFFSHHVATQLRSLKA-SAKPVRGVVSMAKKSVGDLTAADLKGKK  532
            R+PLR LGFA AAADP  + HVA ++RS+   S K  RGV SMAKKSVGDLTAADLKGKK
Sbjct  34   RSPLRRLGFAGAAADPLLAAHVAAKIRSVAGRSGKGSRGVASMAKKSVGDLTAADLKGKK  93

Query  533  VFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAP  712
            VFVRADLNVPLD+ + ITDDTRIRAA+PTIKHLISNGAKVILSSHLGRPKGVTPK+SL P
Sbjct  94   VFVRADLNVPLDENRNITDDTRIRAAVPTIKHLISNGAKVILSSHLGRPKGVTPKFSLNP  153

Query  713  LVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLA  892
            +VPRLSELLGI+V KADDCIGPEVEKLV +LP+GGVLLLENVRFYKEEEKN+PEFAKKL 
Sbjct  154  IVPRLSELLGIKVEKADDCIGPEVEKLVNALPEGGVLLLENVRFYKEEEKNDPEFAKKLG  213

Query  893  SLADLFVNDAFGTAHRAHA  949
            +LADL+VNDAFGTAHRAHA
Sbjct  214  ALADLYVNDAFGTAHRAHA  232



>gb|KDO61594.1| hypothetical protein CISIN_1g011942mg [Citrus sinensis]
Length=474

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 180/200 (90%), Gaps = 4/200 (2%)
 Frame = +2

Query  350  LPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGK  529
            +P +  R LGF+AA  DP  + HVA++L S+K   K  R VVSMAKKSVG+L+ ADLKGK
Sbjct  31   MPTSASRRLGFSAA--DPLLTCHVASRLSSIKT--KGTRAVVSMAKKSVGELSGADLKGK  86

Query  530  KVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLA  709
            KVFVRADLNVPLDD Q ITDDTRIRAA+PTIKHLI NGAKVILSSHLGRPKGVTPK+SLA
Sbjct  87   KVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLIQNGAKVILSSHLGRPKGVTPKFSLA  146

Query  710  PLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKL  889
            PLVPRLSELLGIQVVKADDCIGPEVEKLVASLP+GGVLLLENVRFYKEEEKN+PEFAKKL
Sbjct  147  PLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRFYKEEEKNDPEFAKKL  206

Query  890  ASLADLFVNDAFGTAHRAHA  949
            ASLADL+VNDAFGTAHRAHA
Sbjct  207  ASLADLYVNDAFGTAHRAHA  226



>ref|XP_006422251.1| hypothetical protein CICLE_v10004891mg [Citrus clementina]
 ref|XP_006493789.1| PREDICTED: phosphoglycerate kinase 2, chloroplastic-like [Citrus 
sinensis]
 gb|ESR35491.1| hypothetical protein CICLE_v10004891mg [Citrus clementina]
Length=474

 Score =   333 bits (854),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 166/200 (83%), Positives = 180/200 (90%), Gaps = 4/200 (2%)
 Frame = +2

Query  350  LPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGK  529
            +P +  R LGF+AA  DP  + HVA++L S+K   K  R VVSMAKKSVG+L+ ADLKGK
Sbjct  31   MPTSASRRLGFSAA--DPLLTCHVASRLSSIKT--KGTRAVVSMAKKSVGELSGADLKGK  86

Query  530  KVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLA  709
            KVFVRADLNVPLDD Q ITDDTRIRAA+PTIKHLI NGAKVILSSHLGRPKGVTPK+SLA
Sbjct  87   KVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLIQNGAKVILSSHLGRPKGVTPKFSLA  146

Query  710  PLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKL  889
            PLVPRLSELLGIQVVKADDCIGPEVEKLVASLP+GGVLLLENVRFYKEEEKN+PEFAKKL
Sbjct  147  PLVPRLSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRFYKEEEKNDPEFAKKL  206

Query  890  ASLADLFVNDAFGTAHRAHA  949
            ASLADL+VNDAFGTAHRAHA
Sbjct  207  ASLADLYVNDAFGTAHRAHA  226



>gb|ADV16381.1| chloroplast phosphoglycerate kinase 3 [Helianthus annuus]
Length=481

 Score =   333 bits (854),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 167/203 (82%), Positives = 183/203 (90%), Gaps = 3/203 (1%)
 Frame = +2

Query  341  TRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADL  520
            +RFL R+PLR LGFAAA  D  FS HVA++LRS   S KP+   V  AKKSVGDL+ A+L
Sbjct  33   SRFL-RSPLRGLGFAAA--DTAFSAHVASKLRSCSTSVKPISRGVFAAKKSVGDLSPAEL  89

Query  521  KGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKY  700
            KGKKVFVRADLNVPLDD Q ITDDTRIRAA+PTIKHLISNGAKVILSSHLGRPKGVTPKY
Sbjct  90   KGKKVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLISNGAKVILSSHLGRPKGVTPKY  149

Query  701  SLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFA  880
            SLAPLVPRL+EL+G++VVKADDCIGP+VEKLVASLPDGGVLLLENVRFYKEEEKN+P FA
Sbjct  150  SLAPLVPRLTELIGVEVVKADDCIGPDVEKLVASLPDGGVLLLENVRFYKEEEKNDPGFA  209

Query  881  KKLASLADLFVNDAFGTAHRAHA  949
            +KLASLADL+VNDAFGTAHRAHA
Sbjct  210  EKLASLADLYVNDAFGTAHRAHA  232



>ref|XP_007022578.1| Phosphoglycerate kinase 1 [Theobroma cacao]
 gb|EOY14103.1| Phosphoglycerate kinase 1 [Theobroma cacao]
Length=491

 Score =   332 bits (851),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 166/195 (85%), Positives = 178/195 (91%), Gaps = 3/195 (2%)
 Frame = +2

Query  368  RSLGFAAAAA-DPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVR  544
            +SLGF+AAA+ D   S HV++++RS K   K  RGVVSMAKKSVGDL+ ADLKGKKVFVR
Sbjct  48   QSLGFSAAASGDSLLSLHVSSKVRSFKG--KGSRGVVSMAKKSVGDLSGADLKGKKVFVR  105

Query  545  ADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPR  724
            AD NVPLDD Q ITDDTR+RAAIPTIKHLI NGAKVILSSHLGRPKGVTPK+SLAPLV R
Sbjct  106  ADFNVPLDDNQNITDDTRVRAAIPTIKHLIQNGAKVILSSHLGRPKGVTPKFSLAPLVSR  165

Query  725  LSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLAD  904
            LSELLGIQVVKADDCIGPEVEKLVASLP+GGVLLLENVRFYKEEEKNEPEFAKKLASLAD
Sbjct  166  LSELLGIQVVKADDCIGPEVEKLVASLPEGGVLLLENVRFYKEEEKNEPEFAKKLASLAD  225

Query  905  LFVNDAFGTAHRAHA  949
            L+VNDAFGTAHRAHA
Sbjct  226  LYVNDAFGTAHRAHA  240



>ref|XP_010269369.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Nelumbo 
nucifera]
Length=486

 Score =   331 bits (849),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 164/198 (83%), Positives = 178/198 (90%), Gaps = 4/198 (2%)
 Frame = +2

Query  356  RTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKV  535
            R PLR LGF+A   DP  S HVA ++R++  + K VRGVVSMAKKSVGDLTAADLKGKKV
Sbjct  45   RAPLRRLGFSAV--DPLLSLHVAAKVRAV--NGKGVRGVVSMAKKSVGDLTAADLKGKKV  100

Query  536  FVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPL  715
            FVRADLNVPLD  Q ITDDTR+RAA+PTIKHLI NGAKVILSSHLGRPKGVTPKYSL PL
Sbjct  101  FVRADLNVPLDGNQNITDDTRVRAAVPTIKHLIGNGAKVILSSHLGRPKGVTPKYSLKPL  160

Query  716  VPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLAS  895
            VPRLSELLG+ VVKA+DCIGPEVEK VA+LP+GGVLLLENVRFYKEEEKN+PEFAKKLAS
Sbjct  161  VPRLSELLGVTVVKAEDCIGPEVEKQVAALPEGGVLLLENVRFYKEEEKNDPEFAKKLAS  220

Query  896  LADLFVNDAFGTAHRAHA  949
            LADL+VNDAFGTAHRAHA
Sbjct  221  LADLYVNDAFGTAHRAHA  238



>ref|XP_010923458.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Elaeis 
guineensis]
Length=492

 Score =   331 bits (848),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 161/199 (81%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = +2

Query  356  RTPLRSLGFAAAAADPFFSHHVATQLRSLKA-SAKPVRGVVSMAKKSVGDLTAADLKGKK  532
            R+P R LGFA AAADP  + HVA ++R++   S +  RGV  MAKKSVGDLTAADLKGK+
Sbjct  46   RSPFRRLGFAGAAADPLLALHVAARIRAVAGRSGRGPRGVAVMAKKSVGDLTAADLKGKR  105

Query  533  VFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAP  712
            VFVRADLNVPLD+ Q ITDDTRIRAA+PTIKHLI NGAKVILSSHLGRPKGVTPK+SL P
Sbjct  106  VFVRADLNVPLDENQNITDDTRIRAAVPTIKHLIGNGAKVILSSHLGRPKGVTPKFSLNP  165

Query  713  LVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLA  892
            LVPRLSELLG++V KADDCIGPEVEK+VA+LP+GGVLLLENVRFYK+EEKNEPEFAKKLA
Sbjct  166  LVPRLSELLGVKVEKADDCIGPEVEKMVAALPEGGVLLLENVRFYKDEEKNEPEFAKKLA  225

Query  893  SLADLFVNDAFGTAHRAHA  949
            SLADL+VNDAFGTAHRAHA
Sbjct  226  SLADLYVNDAFGTAHRAHA  244



>ref|XP_008372155.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Malus 
domestica]
Length=396

 Score =   327 bits (839),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 180/197 (91%), Gaps = 3/197 (2%)
 Frame = +2

Query  359  TPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVF  538
            T LR LGF+AA  DP  +  VA+++RS   S K VRGVV+MAKKSVGDL+AA+LKGKKVF
Sbjct  39   TALRRLGFSAA--DPLLALQVASKVRSF-GSGKGVRGVVAMAKKSVGDLSAAELKGKKVF  95

Query  539  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLV  718
            VRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI NGAKVILSSHLGRPKGVTPK+SLAPLV
Sbjct  96   VRADLNVPLDDSQNITDDTRIRAAIPTIKHLIENGAKVILSSHLGRPKGVTPKFSLAPLV  155

Query  719  PRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASL  898
            PRLSELLGIQVVKA+D IGPEVEKLVASLP+GGVLLLENVRFYKEEEKN+PE AKKLA+L
Sbjct  156  PRLSELLGIQVVKAEDSIGPEVEKLVASLPEGGVLLLENVRFYKEEEKNDPEHAKKLAAL  215

Query  899  ADLFVNDAFGTAHRAHA  949
            ADL+VNDAFGTAHRAHA
Sbjct  216  ADLYVNDAFGTAHRAHA  232



>ref|XP_008786111.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
Length=491

 Score =   330 bits (846),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = +2

Query  356  RTPLRSLGFAAAAADPFFSHHVATQLRSLKA-SAKPVRGVVSMAKKSVGDLTAADLKGKK  532
            R+P R LGF  AAADP  + HVA ++R++   S +  RGV +MAKKSVGDLTA+DLKGK+
Sbjct  45   RSPFRRLGFTGAAADPLLALHVAAKIRAVAGRSGRGPRGVAAMAKKSVGDLTASDLKGKR  104

Query  533  VFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAP  712
            VFVRADLNVPLD+ Q ITDDTRIRAA+PTIKHL+  GAKVILSSHLGRPKGVTPKYSL+P
Sbjct  105  VFVRADLNVPLDENQNITDDTRIRAAVPTIKHLMGKGAKVILSSHLGRPKGVTPKYSLSP  164

Query  713  LVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLA  892
            LVPRLSELLGI+V KADDCIGPEVEK+VA+LP+GGVLLLENVRFYKEEEKNEPEFAKKLA
Sbjct  165  LVPRLSELLGIKVEKADDCIGPEVEKMVAALPEGGVLLLENVRFYKEEEKNEPEFAKKLA  224

Query  893  SLADLFVNDAFGTAHRAHA  949
            SLADL+VNDAFGTAHRAHA
Sbjct  225  SLADLYVNDAFGTAHRAHA  243



>ref|XP_009397212.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
 gb|ABF70168.1| phosphoglycerate kinase, chloroplast, putative [Musa acuminata]
Length=479

 Score =   329 bits (844),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 163/204 (80%), Positives = 180/204 (88%), Gaps = 1/204 (0%)
 Frame = +2

Query  341  TRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKA-SAKPVRGVVSMAKKSVGDLTAAD  517
            +R   R+P R LGFA  AAD   + HVA ++R++   S K  RGV  MAKKSVGDLTAAD
Sbjct  28   SRLTLRSPSRRLGFAGVAADSLLAAHVAAKIRTVAGRSGKGPRGVAVMAKKSVGDLTAAD  87

Query  518  LKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPK  697
            LKGKKVFVRADLNVPLD+ + ITDDTRIRAA+PTIKHLISNGAKVILSSHLGRPKGVTPK
Sbjct  88   LKGKKVFVRADLNVPLDEDRNITDDTRIRAAVPTIKHLISNGAKVILSSHLGRPKGVTPK  147

Query  698  YSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEF  877
            +SL+PLVPRLSELLGI+V KADDCIGPEVEKLV +LP+GGVLLLENVRFYKEEEKNEPEF
Sbjct  148  FSLSPLVPRLSELLGIKVEKADDCIGPEVEKLVNALPEGGVLLLENVRFYKEEEKNEPEF  207

Query  878  AKKLASLADLFVNDAFGTAHRAHA  949
            AKKLA+LADL+VNDAFGTAHRAHA
Sbjct  208  AKKLAALADLYVNDAFGTAHRAHA  231



>ref|XP_003596091.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66342.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=479

 Score =   329 bits (844),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 165/207 (80%), Positives = 184/207 (89%), Gaps = 4/207 (2%)
 Frame = +2

Query  329  RAVITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLT  508
            R  ++ FL   PLR LGFAAA  DP  +  VA+++R++  S + VRGVVSMAKKSVGDL+
Sbjct  29   RIHLSSFLGARPLRRLGFAAA--DPLLAVQVASKVRTV--SGRGVRGVVSMAKKSVGDLS  84

Query  509  AADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGV  688
             A+LKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILSSHLGRPKGV
Sbjct  85   GAELKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKYLIQNGAKVILSSHLGRPKGV  144

Query  689  TPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNE  868
            TPKYSLAPLVPRLSEL+GI+V+KA+D IGPEVEKLVASLPDGGVLLLENVRFYKEEEKN+
Sbjct  145  TPKYSLAPLVPRLSELIGIEVIKAEDSIGPEVEKLVASLPDGGVLLLENVRFYKEEEKND  204

Query  869  PEFAKKLASLADLFVNDAFGTAHRAHA  949
            PE AKKLA+LADL+VNDAFGTAHRAHA
Sbjct  205  PEHAKKLAALADLYVNDAFGTAHRAHA  231



>ref|XP_008805983.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
 ref|XP_008776889.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Phoenix dactylifera]
Length=488

 Score =   330 bits (845),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = +2

Query  356  RTPLRSLGFAAAAADPFFSHHVATQLRSLKA-SAKPVRGVVSMAKKSVGDLTAADLKGKK  532
            R+PL  LGFA AAADP  + HVA ++ ++   S +  RGV +MAKKSVGDLTAADLKGK+
Sbjct  42   RSPLHRLGFAGAAADPLLAVHVAERIWAVAGRSGRGPRGVATMAKKSVGDLTAADLKGKR  101

Query  533  VFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAP  712
            VFVRADLNVPLD+ Q ITDDTRIRAA+PTIKHL+ NGAKVILSSHLGRPKGVTPKYSL+P
Sbjct  102  VFVRADLNVPLDENQNITDDTRIRAAVPTIKHLMGNGAKVILSSHLGRPKGVTPKYSLSP  161

Query  713  LVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLA  892
            LV RLSELLGI+V KADDCIGPEVEK+VA++P+GGVLLLENVRFYKEEEKNEPEFAKKLA
Sbjct  162  LVARLSELLGIKVEKADDCIGPEVEKMVAAIPEGGVLLLENVRFYKEEEKNEPEFAKKLA  221

Query  893  SLADLFVNDAFGTAHRAHA  949
            SLADL+VNDAFGTAHRAHA
Sbjct  222  SLADLYVNDAFGTAHRAHA  240



>ref|XP_010936574.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Elaeis guineensis]
Length=490

 Score =   329 bits (844),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 160/199 (80%), Positives = 179/199 (90%), Gaps = 1/199 (1%)
 Frame = +2

Query  356  RTPLRSLGFAAAAADPFFSHHVATQLRSLKA-SAKPVRGVVSMAKKSVGDLTAADLKGKK  532
            R+ +  LGFA AAADP  + HVA ++R++   S +  RGV +MAKKSVGDLTAADLKGK+
Sbjct  44   RSAVHRLGFAGAAADPLLAIHVAAKIRAVTGQSGRGPRGVAAMAKKSVGDLTAADLKGKR  103

Query  533  VFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAP  712
            VFVRADLNVPLD+ Q ITDDTRIRAA+PTIKHL+  GAKVILSSHLGRPKGVTPKYSL+P
Sbjct  104  VFVRADLNVPLDENQNITDDTRIRAAVPTIKHLMGKGAKVILSSHLGRPKGVTPKYSLSP  163

Query  713  LVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLA  892
            LVPRLSELLGI+V KADDCIGPEVEK+VA+LP+GGVLLLENVRFYKEEEKNEPEFAKKLA
Sbjct  164  LVPRLSELLGIKVEKADDCIGPEVEKMVAALPEGGVLLLENVRFYKEEEKNEPEFAKKLA  223

Query  893  SLADLFVNDAFGTAHRAHA  949
            SLADL+VNDAFGTAHRAHA
Sbjct  224  SLADLYVNDAFGTAHRAHA  242



>ref|XP_010669994.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=482

 Score =   329 bits (843),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 163/201 (81%), Positives = 176/201 (88%), Gaps = 3/201 (1%)
 Frame = +2

Query  356  RTPLRSLGFAAAAADPFFSHHVATQLRSLKASAK---PVRGVVSMAKKSVGDLTAADLKG  526
            R PLR LGFA   AD   S HV  ++ S   S     P+RGV +M KKSVGDLT+A+LKG
Sbjct  34   RPPLRRLGFAGVVADSALSQHVNYKIHSSFKSLSSSKPIRGVATMVKKSVGDLTSAELKG  93

Query  527  KKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSL  706
            K+VFVRADLNVPLDD+Q ITDDTRIRAAIPTIKHL++NGAKVILSSHLGRPKGVTPKYSL
Sbjct  94   KRVFVRADLNVPLDDSQNITDDTRIRAAIPTIKHLMNNGAKVILSSHLGRPKGVTPKYSL  153

Query  707  APLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKK  886
            APLVPRLSELLGIQVVKADDCIGP+VEKLV  LP+GGVLLLENVRFYKEEEKNEPEFAKK
Sbjct  154  APLVPRLSELLGIQVVKADDCIGPDVEKLVGGLPEGGVLLLENVRFYKEEEKNEPEFAKK  213

Query  887  LASLADLFVNDAFGTAHRAHA  949
            LASLADL+VNDAFGTAHRAHA
Sbjct  214  LASLADLYVNDAFGTAHRAHA  234



>ref|XP_008226130.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Prunus mume]
Length=480

 Score =   329 bits (843),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 166/197 (84%), Positives = 179/197 (91%), Gaps = 3/197 (2%)
 Frame = +2

Query  359  TPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVF  538
            T LR LGF+AA  DP F+  VA+++RS   S K VRGVVSMAK+SVGDL+AADLKGK+VF
Sbjct  39   TTLRRLGFSAA--DPLFALQVASKIRSF-GSGKAVRGVVSMAKRSVGDLSAADLKGKRVF  95

Query  539  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLV  718
            VRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI  GAKVILSSHLGRPKGVTPK+SLAPLV
Sbjct  96   VRADLNVPLDDSQNITDDTRIRAAIPTIKHLIEKGAKVILSSHLGRPKGVTPKFSLAPLV  155

Query  719  PRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASL  898
            PRLSELLGIQVVKA+D IGPEVEKLVASLPDG VLLLENVRFYKEEEKN+PE AKKLASL
Sbjct  156  PRLSELLGIQVVKAEDSIGPEVEKLVASLPDGSVLLLENVRFYKEEEKNDPEHAKKLASL  215

Query  899  ADLFVNDAFGTAHRAHA  949
            ADL+VNDAFGTAHRAHA
Sbjct  216  ADLYVNDAFGTAHRAHA  232



>ref|XP_012087352.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Jatropha curcas]
 gb|KDP25067.1| hypothetical protein JCGZ_22602 [Jatropha curcas]
Length=487

 Score =   329 bits (843),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/192 (86%), Positives = 174/192 (91%), Gaps = 3/192 (2%)
 Frame = +2

Query  374  LGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADL  553
            LGFA A  DP FSHHVA+++RS     K  R VVSMAKKSVGDLT ADLKGK+VFVRADL
Sbjct  51   LGFAPA--DPLFSHHVASKIRSF-GFGKASRAVVSMAKKSVGDLTGADLKGKRVFVRADL  107

Query  554  NVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSE  733
            NVPLDD Q ITDDTRIRAAIPTIKHLI NGAKVILS+HLGRPKGVTPK+SLAPLVPRLSE
Sbjct  108  NVPLDDNQNITDDTRIRAAIPTIKHLIQNGAKVILSTHLGRPKGVTPKFSLAPLVPRLSE  167

Query  734  LLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFV  913
            LLGIQVVKADD IGPEVEKLVASLP+GGVLLLENVRFYKEEEKN+PE AKKLASLADL+V
Sbjct  168  LLGIQVVKADDSIGPEVEKLVASLPEGGVLLLENVRFYKEEEKNDPEHAKKLASLADLYV  227

Query  914  NDAFGTAHRAHA  949
            NDAFGTAHRAHA
Sbjct  228  NDAFGTAHRAHA  239



>sp|P29409.2|PGKH_SPIOL RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor, partial [Spinacia oleracea]
 emb|CAA48479.1| phosphoglycerate kinase [Spinacia oleracea]
Length=433

 Score =   327 bits (838),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 173/182 (95%), Gaps = 1/182 (1%)
 Frame = +2

Query  407  FSHHVATQLRSLKA-SAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKI  583
            FS HV +++ S K+ S KP+RGV SMAKKSVGDLT+ADLKGKKVFVRADLNVPLDD+Q I
Sbjct  4    FSLHVLSKINSYKSQSTKPIRGVASMAKKSVGDLTSADLKGKKVFVRADLNVPLDDSQNI  63

Query  584  TDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKAD  763
            TDDTRIRAAIPTIKHLI+NGAKVILSSHLGRPKGVTPK+SLAPLVPRLSELLG+QVVKAD
Sbjct  64   TDDTRIRAAIPTIKHLINNGAKVILSSHLGRPKGVTPKFSLAPLVPRLSELLGLQVVKAD  123

Query  764  DCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRA  943
            DCIGP+VEKLVA LP+GGVLLLENVRFYKEEEKN+PEFAKKLASLADL+VNDAFGTAHRA
Sbjct  124  DCIGPDVEKLVAELPEGGVLLLENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRA  183

Query  944  HA  949
            HA
Sbjct  184  HA  185



>ref|XP_008371996.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   328 bits (842),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 180/197 (91%), Gaps = 3/197 (2%)
 Frame = +2

Query  359  TPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVF  538
            T LR LGF+AA  DP  +  VA+++RS   S K VRGVV+MAKKSVGDL+AA+LKGKKVF
Sbjct  39   TALRRLGFSAA--DPLLALQVASKVRSF-GSGKGVRGVVAMAKKSVGDLSAAELKGKKVF  95

Query  539  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLV  718
            VRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI NGAKVILSSHLGRPKGVTPK+SLAPLV
Sbjct  96   VRADLNVPLDDSQNITDDTRIRAAIPTIKHLIENGAKVILSSHLGRPKGVTPKFSLAPLV  155

Query  719  PRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASL  898
            PRLSELLGIQVVKA+D IGPEVEKLVASLP+GGVLLLENVRFYKEEEKN+PE AKKLA+L
Sbjct  156  PRLSELLGIQVVKAEDSIGPEVEKLVASLPEGGVLLLENVRFYKEEEKNDPEHAKKLAAL  215

Query  899  ADLFVNDAFGTAHRAHA  949
            ADL+VNDAFGTAHRAHA
Sbjct  216  ADLYVNDAFGTAHRAHA  232



>ref|XP_008346077.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Malus domestica]
Length=480

 Score =   328 bits (841),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 180/197 (91%), Gaps = 3/197 (2%)
 Frame = +2

Query  359  TPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVF  538
            T LR LGF+AA  DP  +  VA+++RS   S K VRGVV+MAKKSVGDL+AA+LKGKKVF
Sbjct  39   TALRRLGFSAA--DPLLALQVASKVRSF-GSGKGVRGVVAMAKKSVGDLSAAELKGKKVF  95

Query  539  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLV  718
            VRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI NGAKVILSSHLGRPKGVTPK+SLAPLV
Sbjct  96   VRADLNVPLDDSQNITDDTRIRAAIPTIKHLIENGAKVILSSHLGRPKGVTPKFSLAPLV  155

Query  719  PRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASL  898
            PRLSELLGIQVVKA+D IGPEVEKLVASLP+GGVLLLENVRFYKEEEKN+PE AKKLA+L
Sbjct  156  PRLSELLGIQVVKAEDSIGPEVEKLVASLPEGGVLLLENVRFYKEEEKNDPEHAKKLAAL  215

Query  899  ADLFVNDAFGTAHRAHA  949
            ADL+VNDAFGTAHRAHA
Sbjct  216  ADLYVNDAFGTAHRAHA  232



>ref|XP_007213965.1| hypothetical protein PRUPE_ppa005031mg [Prunus persica]
 gb|EMJ15164.1| hypothetical protein PRUPE_ppa005031mg [Prunus persica]
Length=480

 Score =   327 bits (839),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 165/195 (85%), Positives = 178/195 (91%), Gaps = 3/195 (2%)
 Frame = +2

Query  365  LRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVR  544
            LR LGF+AA  DP F+  VA+++RS   S K VRGVVSMAK+SVGDL+AADLKGK+VFVR
Sbjct  41   LRRLGFSAA--DPLFALQVASKVRSF-GSGKAVRGVVSMAKRSVGDLSAADLKGKRVFVR  97

Query  545  ADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPR  724
            ADLNVPLDD+Q ITDDTRIRAAIPTIKHLI  GAKVILSSHLGRPKGVTPK+SLAPLVPR
Sbjct  98   ADLNVPLDDSQNITDDTRIRAAIPTIKHLIEKGAKVILSSHLGRPKGVTPKFSLAPLVPR  157

Query  725  LSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLAD  904
            LSELLGIQVVKA+D IGPEVEKLVASLPDG VLLLENVRFYKEEEKN+PE AKKLASLAD
Sbjct  158  LSELLGIQVVKAEDSIGPEVEKLVASLPDGSVLLLENVRFYKEEEKNDPEHAKKLASLAD  217

Query  905  LFVNDAFGTAHRAHA  949
            L+VNDAFGTAHRAHA
Sbjct  218  LYVNDAFGTAHRAHA  232



>ref|XP_008349091.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   327 bits (837),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 179/197 (91%), Gaps = 3/197 (2%)
 Frame = +2

Query  359  TPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVF  538
            T LR LGF+AA  DP  +  VA+++RS   S K VRGVV+MAKKSVGDLTAA+LKGKKVF
Sbjct  39   TALRRLGFSAA--DPLLALQVASKVRSF-GSGKGVRGVVAMAKKSVGDLTAAELKGKKVF  95

Query  539  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLV  718
            VRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI  GAKVILSSHLGRPKGVTPK+SLAPLV
Sbjct  96   VRADLNVPLDDSQNITDDTRIRAAIPTIKHLIEKGAKVILSSHLGRPKGVTPKFSLAPLV  155

Query  719  PRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASL  898
            PRLSELLGIQVVKA+D IGPEVEKLVASLP+GGVLLLENVRFYKEEEKN+PE AKKLA+L
Sbjct  156  PRLSELLGIQVVKAEDSIGPEVEKLVASLPEGGVLLLENVRFYKEEEKNDPEHAKKLAAL  215

Query  899  ADLFVNDAFGTAHRAHA  949
            ADL+VNDAFGTAHRAHA
Sbjct  216  ADLYVNDAFGTAHRAHA  232



>ref|XP_008383150.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Malus 
domestica]
Length=480

 Score =   326 bits (836),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 179/197 (91%), Gaps = 3/197 (2%)
 Frame = +2

Query  359  TPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVF  538
            T LR LGF+AA  DP  +  VA+++RS   S K VRGVV+MAKKSVGDLTAA+LKGKKVF
Sbjct  39   TALRRLGFSAA--DPLLALQVASKVRSF-GSGKGVRGVVAMAKKSVGDLTAAELKGKKVF  95

Query  539  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLV  718
            VRADLNVPLDD+Q ITDDTRIRAAIPTIKHLI  GAKVILSSHLGRPKGVTPK+SLAPLV
Sbjct  96   VRADLNVPLDDSQNITDDTRIRAAIPTIKHLIEKGAKVILSSHLGRPKGVTPKFSLAPLV  155

Query  719  PRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASL  898
            PRLSELLGIQVVKA+D IGPEVEKLVASLP+GGVLLLENVRFYKEEEKN+PE AKKLA+L
Sbjct  156  PRLSELLGIQVVKAEDSIGPEVEKLVASLPEGGVLLLENVRFYKEEEKNDPEHAKKLAAL  215

Query  899  ADLFVNDAFGTAHRAHA  949
            ADL+VNDAFGTAHRAHA
Sbjct  216  ADLYVNDAFGTAHRAHA  232



>ref|XP_003531482.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Glycine 
max]
Length=485

 Score =   326 bits (835),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 168/207 (81%), Positives = 181/207 (87%), Gaps = 2/207 (1%)
 Frame = +2

Query  329  RAVITRFLPRTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLT  508
            R  +T  L   PLR LGFAAA  DP  +  VA ++ +++   K  RGVVSMAKKSVGDL+
Sbjct  33   RVQLTSSLRARPLRRLGFAAA--DPLLAASVAARVAAVRGGGKGARGVVSMAKKSVGDLS  90

Query  509  AADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGV  688
            AADLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIKHLI NGAKVILSSHLGRPKGV
Sbjct  91   AADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKHLIQNGAKVILSSHLGRPKGV  150

Query  689  TPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNE  868
            TPKYSLAPLVPRLSEL+GIQ+VKA+D IGPEVEKLVASLPDGGVLLLENVRFYKEEEKN+
Sbjct  151  TPKYSLAPLVPRLSELIGIQIVKAEDSIGPEVEKLVASLPDGGVLLLENVRFYKEEEKND  210

Query  869  PEFAKKLASLADLFVNDAFGTAHRAHA  949
            PE AKKLASLADL+VNDAFGTAHRAHA
Sbjct  211  PEHAKKLASLADLYVNDAFGTAHRAHA  237



>ref|NP_187884.1| phosphoglycerate kinase 1 [Arabidopsis thaliana]
 sp|Q9LD57.1|PGKH1_ARATH RecName: Full=Phosphoglycerate kinase 1, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF70258.1|AF247558_1 phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK25944.1|AF360234_1 putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL16186.1|AF428418_1 AT3g12780/MBK21_14 [Arabidopsis thaliana]
 dbj|BAB02423.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK73981.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gb|AAL24323.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL33785.1| putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM16259.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 gb|AAM47957.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM83218.1| AT3g12780/MBK21_14 [Arabidopsis thaliana]
 dbj|BAE99262.1| phosphoglycerate kinase like protein [Arabidopsis thaliana]
 dbj|BAH19627.1| AT3G12780 [Arabidopsis thaliana]
 gb|AEE75246.1| phosphoglycerate kinase 1 [Arabidopsis thaliana]
Length=481

 Score =   325 bits (832),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 163/202 (81%), Positives = 179/202 (89%), Gaps = 4/202 (2%)
 Frame = +2

Query  350  LPRTPL--RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLK  523
            +P T +  R LGF+A      FS HVA+++ S++   K  RGVVSMAKKSVGDLT+ADLK
Sbjct  34   IPSTSVSARPLGFSATLDSRRFSLHVASKVESVRG--KGSRGVVSMAKKSVGDLTSADLK  91

Query  524  GKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYS  703
            GKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLGRPKGVTPK+S
Sbjct  92   GKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLGRPKGVTPKFS  151

Query  704  LAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAK  883
            LAPLVPRLSELLGI+V KADDCIGPEVE LVASLP+GGVLLLENVRFYKEEEKN+PEFAK
Sbjct  152  LAPLVPRLSELLGIEVTKADDCIGPEVESLVASLPEGGVLLLENVRFYKEEEKNDPEFAK  211

Query  884  KLASLADLFVNDAFGTAHRAHA  949
            KLASLADL+VNDAFGTAHRAHA
Sbjct  212  KLASLADLYVNDAFGTAHRAHA  233



>ref|XP_010094703.1| Phosphoglycerate kinase [Morus notabilis]
 gb|EXB56749.1| Phosphoglycerate kinase [Morus notabilis]
Length=478

 Score =   324 bits (831),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 165/197 (84%), Positives = 175/197 (89%), Gaps = 3/197 (2%)
 Frame = +2

Query  359  TPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVF  538
            T LR LGF+AA  DP  +  V +++RS     K VRGVVSMAKKS GDLTAADLKGKKVF
Sbjct  37   TVLRRLGFSAA--DPLLALTVNSRVRSF-GGKKAVRGVVSMAKKSGGDLTAADLKGKKVF  93

Query  539  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLV  718
            VRADLNVPL D Q ITDDTR+RAA+PTIKHLI NGAKVILSSHLGRPKGVTPK+SLAPLV
Sbjct  94   VRADLNVPLGDNQNITDDTRVRAAVPTIKHLIQNGAKVILSSHLGRPKGVTPKFSLAPLV  153

Query  719  PRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASL  898
            PRLSELLGIQVVKADD IGPEVEKLVASLPDG VLLLENVRFYKEEEKN+PEFAKKLASL
Sbjct  154  PRLSELLGIQVVKADDVIGPEVEKLVASLPDGSVLLLENVRFYKEEEKNDPEFAKKLASL  213

Query  899  ADLFVNDAFGTAHRAHA  949
            ADL+VNDAFGTAHRAHA
Sbjct  214  ADLYVNDAFGTAHRAHA  230



>ref|XP_002891879.1| hypothetical protein ARALYDRAFT_474689 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68138.1| hypothetical protein ARALYDRAFT_474689 [Arabidopsis lyrata subsp. 
lyrata]
Length=478

 Score =   324 bits (831),  Expect = 7e-104, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 177/194 (91%), Gaps = 3/194 (2%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A   D  FS HVA++++S++   K  RGV++MAKKSVGDLT+ADLKGKKVFVRA
Sbjct  40   RRLGFSAFV-DSRFSVHVASKVQSVRG--KGTRGVITMAKKSVGDLTSADLKGKKVFVRA  96

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRL  727
            DLNVPLDD Q ITDDTRIRAAIPTIK LI NGAKVILS+HLGRPKGVTPK+SLAPLVPRL
Sbjct  97   DLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKVILSTHLGRPKGVTPKFSLAPLVPRL  156

Query  728  SELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADL  907
            SELLGI+VVKADDCIGP+VE LVASLP+GGVLLLENVRFYKEEEKNEPEFAKKLASLADL
Sbjct  157  SELLGIEVVKADDCIGPQVESLVASLPEGGVLLLENVRFYKEEEKNEPEFAKKLASLADL  216

Query  908  FVNDAFGTAHRAHA  949
            +VNDAFGTAHRAHA
Sbjct  217  YVNDAFGTAHRAHA  230



>gb|AAF02830.1|AC009894_1 phosphoglycerate kinase [Arabidopsis thaliana]
Length=320

 Score =   319 bits (817),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 178/202 (88%), Gaps = 5/202 (2%)
 Frame = +2

Query  350  LPRTPL--RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLK  523
            +P T +  R LGF+A   D  FS HVA+++ S++   K  RGV++MAKKSVGDL + DLK
Sbjct  32   IPSTSVSARRLGFSAVV-DSRFSVHVASKVHSVRG--KGARGVITMAKKSVGDLNSVDLK  88

Query  524  GKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYS  703
            GKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK LI NGAKVILS+HLGRPKGVTPK+S
Sbjct  89   GKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKVILSTHLGRPKGVTPKFS  148

Query  704  LAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAK  883
            LAPLVPRLSELLGI+VVKADDCIGPEVE LVASLP+GGVLLLENVRFYKEEEKNEP+FAK
Sbjct  149  LAPLVPRLSELLGIEVVKADDCIGPEVETLVASLPEGGVLLLENVRFYKEEEKNEPDFAK  208

Query  884  KLASLADLFVNDAFGTAHRAHA  949
            KLASLADL+VNDAFGTAHRAHA
Sbjct  209  KLASLADLYVNDAFGTAHRAHA  230



>emb|CDY43401.1| BnaA01g30320D [Brassica napus]
Length=480

 Score =   324 bits (830),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 176/194 (91%), Gaps = 3/194 (2%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A   D  F+ HVA++++S +   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  42   RPLGFSAVL-DSRFTVHVASKVQSFRG--KGTRGVVSMAKKSVGDLTSADLKGKKVFVRA  98

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRL  727
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLGRPKGVTPK+SLAPLVPRL
Sbjct  99   DLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLGRPKGVTPKFSLAPLVPRL  158

Query  728  SELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADL  907
            SELLGI+V KADDCIGPEVE LVASLP+GGVLLLENVRFYKEEEKN+PEFAKKLASLADL
Sbjct  159  SELLGIEVKKADDCIGPEVESLVASLPEGGVLLLENVRFYKEEEKNDPEFAKKLASLADL  218

Query  908  FVNDAFGTAHRAHA  949
            +VNDAFGTAHRAHA
Sbjct  219  YVNDAFGTAHRAHA  232



>ref|XP_009124670.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Brassica 
rapa]
Length=480

 Score =   323 bits (829),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 176/194 (91%), Gaps = 3/194 (2%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A   D  F+ HVA++++S +   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  42   RPLGFSAVL-DSRFTVHVASKVQSFRG--KGTRGVVSMAKKSVGDLTSADLKGKKVFVRA  98

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRL  727
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLGRPKGVTPK+SLAPLVPRL
Sbjct  99   DLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLGRPKGVTPKFSLAPLVPRL  158

Query  728  SELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADL  907
            SELLGI+V KADDCIGPEVE LVASLP+GGVLLLENVRFYKEEEKN+PEFAKKLASLADL
Sbjct  159  SELLGIEVKKADDCIGPEVESLVASLPEGGVLLLENVRFYKEEEKNDPEFAKKLASLADL  218

Query  908  FVNDAFGTAHRAHA  949
            +VNDAFGTAHRAHA
Sbjct  219  YVNDAFGTAHRAHA  232



>ref|XP_006407295.1| hypothetical protein EUTSA_v10020621mg [Eutrema salsugineum]
 gb|ESQ48748.1| hypothetical protein EUTSA_v10020621mg [Eutrema salsugineum]
Length=481

 Score =   323 bits (829),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 176/194 (91%), Gaps = 2/194 (1%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A      FS HVA++++S++   K  RGVVSMAKKSVGDL++ADLKGKKVFVRA
Sbjct  42   RPLGFSAVLESRRFSLHVASKVQSVRG--KGSRGVVSMAKKSVGDLSSADLKGKKVFVRA  99

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRL  727
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLGRPKGVTPK+SLAPLVPRL
Sbjct  100  DLNVPLDDNQTITDDTRIRAAIPTIKYLIDNGAKVILSTHLGRPKGVTPKFSLAPLVPRL  159

Query  728  SELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADL  907
            SELLGI+V KADDCIGPEVE LVASLP+GGVLLLENVRFYKEEEKN+PEFAKKLASLADL
Sbjct  160  SELLGIEVKKADDCIGPEVESLVASLPEGGVLLLENVRFYKEEEKNDPEFAKKLASLADL  219

Query  908  FVNDAFGTAHRAHA  949
            +VNDAFGTAHRAHA
Sbjct  220  YVNDAFGTAHRAHA  233



>ref|XP_006297559.1| hypothetical protein CARUB_v10013582mg [Capsella rubella]
 gb|EOA30457.1| hypothetical protein CARUB_v10013582mg [Capsella rubella]
Length=481

 Score =   323 bits (829),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 179/202 (89%), Gaps = 4/202 (2%)
 Frame = +2

Query  350  LPRTPL--RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLK  523
            +P T +  R LGF+A      FS HVA+++ S++   K  +GVVSMAKKSVGDLT+ADLK
Sbjct  34   IPSTSVSARPLGFSATLDSRRFSLHVASKVESVRG--KGSKGVVSMAKKSVGDLTSADLK  91

Query  524  GKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYS  703
            GKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLGRPKGVTPK+S
Sbjct  92   GKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLGRPKGVTPKFS  151

Query  704  LAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAK  883
            LAPLVPRLSELLGIQV KADDCIGPEVE LVASLP+GGVLLLENVRFYKEEEKN+PEFAK
Sbjct  152  LAPLVPRLSELLGIQVTKADDCIGPEVESLVASLPEGGVLLLENVRFYKEEEKNDPEFAK  211

Query  884  KLASLADLFVNDAFGTAHRAHA  949
            KLA+LADL+VNDAFGTAHRAHA
Sbjct  212  KLAALADLYVNDAFGTAHRAHA  233



>ref|XP_002884926.1| hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61185.1| hypothetical protein ARALYDRAFT_478641 [Arabidopsis lyrata subsp. 
lyrata]
Length=481

 Score =   323 bits (829),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A      F+ HVA+++ S++   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  42   RPLGFSATLDSRRFTLHVASKVESVRG--KGSRGVVSMAKKSVGDLTSADLKGKKVFVRA  99

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRL  727
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLGRPKGVTPK+SLAPLVPRL
Sbjct  100  DLNVPLDDNQTITDDTRIRAAIPTIKYLIDNGAKVILSTHLGRPKGVTPKFSLAPLVPRL  159

Query  728  SELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADL  907
            SELLGI+V KADDCIGPEVE LVASLP+GGVLLLENVRFYKEEEKN+PEFAKKLASLADL
Sbjct  160  SELLGIEVTKADDCIGPEVESLVASLPEGGVLLLENVRFYKEEEKNDPEFAKKLASLADL  219

Query  908  FVNDAFGTAHRAHA  949
            +VNDAFGTAHRAHA
Sbjct  220  YVNDAFGTAHRAHA  233



>emb|CDX73803.1| BnaA03g32440D [Brassica napus]
Length=484

 Score =   323 bits (829),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 179/207 (86%), Gaps = 8/207 (4%)
 Frame = +2

Query  347  FLPRTPL------RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLT  508
             LP TP       R LGF+A      FS HVA+++ S++   +  RGVVSMAKKSVGDLT
Sbjct  32   LLPITPSSKSISPRPLGFSAVLDSHRFSLHVASKVHSVRG--RGTRGVVSMAKKSVGDLT  89

Query  509  AADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGV  688
            +ADLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLGRPKGV
Sbjct  90   SADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLGRPKGV  149

Query  689  TPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNE  868
            TPK+SLAPLVPRLSELLGI+V KADDCIGPEVE LVASLP+GGVLLLENVRFYKEEEKN+
Sbjct  150  TPKFSLAPLVPRLSELLGIEVKKADDCIGPEVESLVASLPEGGVLLLENVRFYKEEEKND  209

Query  869  PEFAKKLASLADLFVNDAFGTAHRAHA  949
            PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  210  PEFAKKLASLADLYVNDAFGTAHRAHA  236



>ref|XP_010487004.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Camelina 
sativa]
Length=481

 Score =   323 bits (827),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 179/202 (89%), Gaps = 4/202 (2%)
 Frame = +2

Query  350  LPRTPL--RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLK  523
            +P T +  R LGF+A      FS HVA+++ S++   K  RGVVSMAKKSVGDLT+ADLK
Sbjct  34   IPSTSVSARPLGFSATLDARRFSLHVASKVESVRG--KGSRGVVSMAKKSVGDLTSADLK  91

Query  524  GKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYS  703
            GKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLGRPKGVTPK+S
Sbjct  92   GKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLGRPKGVTPKFS  151

Query  704  LAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAK  883
            LAPLVPRLSELLGIQV KADDCIGPEVE LVA+LP+GGVLLLENVRFYKEEEKN+PEFAK
Sbjct  152  LAPLVPRLSELLGIQVTKADDCIGPEVESLVAALPEGGVLLLENVRFYKEEEKNDPEFAK  211

Query  884  KLASLADLFVNDAFGTAHRAHA  949
            KLA+LADL+VNDAFGTAHRAHA
Sbjct  212  KLAALADLYVNDAFGTAHRAHA  233



>ref|XP_010465058.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic-like [Camelina 
sativa]
Length=481

 Score =   322 bits (825),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 162/202 (80%), Positives = 179/202 (89%), Gaps = 4/202 (2%)
 Frame = +2

Query  350  LPRTPL--RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLK  523
            +P T +  R LGF+A      FS HVA+++ S++   K  RGVVSMAKKSVGDLT+ADLK
Sbjct  34   IPSTSVSARPLGFSATLDARRFSLHVASKVESVRG--KGSRGVVSMAKKSVGDLTSADLK  91

Query  524  GKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYS  703
            GKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLGRPKGVTPK+S
Sbjct  92   GKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIDNGAKVILSTHLGRPKGVTPKFS  151

Query  704  LAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAK  883
            LAPLVPRLSELLGIQV KADDCIGPEVE LVA+LP+GGVLLLENVRFYKEEEKN+PEFAK
Sbjct  152  LAPLVPRLSELLGIQVTKADDCIGPEVESLVAALPEGGVLLLENVRFYKEEEKNDPEFAK  211

Query  884  KLASLADLFVNDAFGTAHRAHA  949
            KLA+LADL+VNDAFGTAHRAHA
Sbjct  212  KLAALADLYVNDAFGTAHRAHA  233



>ref|XP_009135249.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Brassica 
rapa]
Length=484

 Score =   322 bits (825),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 164/207 (79%), Positives = 178/207 (86%), Gaps = 8/207 (4%)
 Frame = +2

Query  347  FLPRTPL------RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLT  508
             LP TP       R LGF+A      FS HVA+++ S++      RGVVSMAKKSVGDLT
Sbjct  32   LLPITPSPKSTSPRPLGFSAVLDSHRFSLHVASKVHSVRGRGS--RGVVSMAKKSVGDLT  89

Query  509  AADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGV  688
            +ADLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLGRPKGV
Sbjct  90   SADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLGRPKGV  149

Query  689  TPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNE  868
            TPK+SLAPLVPRLSELLGI+V KADDCIGPEVE LVASLP+GGVLLLENVRFYKEEEKN+
Sbjct  150  TPKFSLAPLVPRLSELLGIEVKKADDCIGPEVESLVASLPEGGVLLLENVRFYKEEEKND  209

Query  869  PEFAKKLASLADLFVNDAFGTAHRAHA  949
            PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  210  PEFAKKLASLADLYVNDAFGTAHRAHA  236



>emb|CDY24247.1| BnaC01g38270D [Brassica napus]
Length=481

 Score =   322 bits (824),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 176/194 (91%), Gaps = 3/194 (2%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A   D  F+ HVA++++S +   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  43   RPLGFSAVL-DSRFTVHVASKVQSFRG--KGTRGVVSMAKKSVGDLTSADLKGKKVFVRA  99

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRL  727
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLGRPKGVTPK+SLAPLVPRL
Sbjct  100  DLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLGRPKGVTPKFSLAPLVPRL  159

Query  728  SELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADL  907
            SELLGI+V KADDCIGPEVE LVASLP+GGVLLLENVRFYKEEEKN+P+FAKKLASLADL
Sbjct  160  SELLGIEVKKADDCIGPEVESLVASLPEGGVLLLENVRFYKEEEKNDPDFAKKLASLADL  219

Query  908  FVNDAFGTAHRAHA  949
            +VNDAFGTAHRAHA
Sbjct  220  YVNDAFGTAHRAHA  233



>emb|CDY00798.1| BnaC03g37820D [Brassica napus]
Length=482

 Score =   322 bits (824),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/194 (81%), Positives = 175/194 (90%), Gaps = 2/194 (1%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A      FS HV+++++S++      RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  43   RPLGFSAVLDSRRFSLHVSSKVQSVRGRGS--RGVVSMAKKSVGDLTSADLKGKKVFVRA  100

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRL  727
            DLNVPLDD Q ITDDTRIRAA+PTIK+LI NGAKVILS+HLGRPKGVTPK+SLAPLVPRL
Sbjct  101  DLNVPLDDNQTITDDTRIRAAVPTIKYLIENGAKVILSTHLGRPKGVTPKFSLAPLVPRL  160

Query  728  SELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADL  907
            SELLGI+V KADDCIGPEVE LVASLP+GGVLLLENVRFYKEEEKN+PEFAKKLASLADL
Sbjct  161  SELLGIEVKKADDCIGPEVESLVASLPEGGVLLLENVRFYKEEEKNDPEFAKKLASLADL  220

Query  908  FVNDAFGTAHRAHA  949
            +VNDAFGTAHRAHA
Sbjct  221  YVNDAFGTAHRAHA  234



>ref|XP_009146585.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Brassica 
rapa]
Length=477

 Score =   321 bits (823),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/194 (82%), Positives = 175/194 (90%), Gaps = 3/194 (2%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A   D  F+ HVA++++S +   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  44   RPLGFSAVL-DSRFTVHVASKVQSFRG--KGTRGVVSMAKKSVGDLTSADLKGKKVFVRA  100

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRL  727
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLGRPKGVTPK+SLAPLVPRL
Sbjct  101  DLNVPLDDNQTITDDTRIRAAIPTIKYLIDNGAKVILSTHLGRPKGVTPKFSLAPLVPRL  160

Query  728  SELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADL  907
            SELLGI+V KADDCIGPEVE LV SLP+GGVLLLENVRFYKEEEKN+PEFAKKLASLADL
Sbjct  161  SELLGIEVKKADDCIGPEVESLVGSLPEGGVLLLENVRFYKEEEKNDPEFAKKLASLADL  220

Query  908  FVNDAFGTAHRAHA  949
            +VNDAFGTAHRAHA
Sbjct  221  YVNDAFGTAHRAHA  234



>ref|XP_004306579.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Fragaria 
vesca subsp. vesca]
Length=480

 Score =   321 bits (823),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/194 (83%), Positives = 175/194 (90%), Gaps = 3/194 (2%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGFA A  DP  + HVA ++RS   SAKPVRGVV+MAKKSVGDL+ ADLKGKKVFVRA
Sbjct  42   RRLGFAPA--DPLLALHVAAKVRSF-GSAKPVRGVVAMAKKSVGDLSEADLKGKKVFVRA  98

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRL  727
            DLNVPLDD+Q ITDDTRIRAA+PTIK+L+  GAKVILSSHLGRPKGVTPK+SLAPLVPRL
Sbjct  99   DLNVPLDDSQNITDDTRIRAAVPTIKYLMDKGAKVILSSHLGRPKGVTPKFSLAPLVPRL  158

Query  728  SELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADL  907
            SELLGIQ+VKA+D IGPEVEKL  SLPDGGVLLLENVRFYKEEEKN+PE AKKLAS+ADL
Sbjct  159  SELLGIQIVKAEDSIGPEVEKLATSLPDGGVLLLENVRFYKEEEKNDPEHAKKLASVADL  218

Query  908  FVNDAFGTAHRAHA  949
            FVNDAFGTAHRAHA
Sbjct  219  FVNDAFGTAHRAHA  232



>ref|XP_010499471.1| PREDICTED: phosphoglycerate kinase 1, chloroplastic [Camelina 
sativa]
Length=481

 Score =   321 bits (823),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 179/202 (89%), Gaps = 4/202 (2%)
 Frame = +2

Query  350  LPRTPL--RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLK  523
            +P T +  R LGF+A      FS HVA+++ S++   K  RGVVSMAKKSVGDLT+ADLK
Sbjct  34   IPSTSVSARPLGFSATLDARRFSLHVASKVESVRG--KGSRGVVSMAKKSVGDLTSADLK  91

Query  524  GKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYS  703
            GKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLGRPKGVTPK+S
Sbjct  92   GKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLGRPKGVTPKFS  151

Query  704  LAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAK  883
            LAPLVPRLSELLGIQV KADDCIGPEVE LV++LP+GGVLLLENVRFYKEEEKN+PEFAK
Sbjct  152  LAPLVPRLSELLGIQVTKADDCIGPEVESLVSALPEGGVLLLENVRFYKEEEKNDPEFAK  211

Query  884  KLASLADLFVNDAFGTAHRAHA  949
            KLA+LADL+VNDAFGTAHRAHA
Sbjct  212  KLAALADLYVNDAFGTAHRAHA  233



>ref|XP_006359791.1| PREDICTED: uncharacterized protein LOC102577647 [Solanum tuberosum]
Length=1046

 Score =   335 bits (859),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 173/210 (82%), Positives = 192/210 (91%), Gaps = 2/210 (1%)
 Frame = +2

Query  248  AMASASYTFCGIPTTsssaassssssKRAVITRFLPRTPLRSLGFAAAAADPFFSHHVAT  427
            A A+AS+TFCGIPTTSSS+ ++ S++  +   RFL +TPLR LGFA A ADP F++HVAT
Sbjct  2    ASATASHTFCGIPTTSSSSTTNRSTTHSSA--RFLLKTPLRRLGFAGAVADPLFTNHVAT  59

Query  428  QLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRA  607
            +LRSLKAS+ PVR VVSMAKKSVGDL+++DLKGKKVFVRADLNVPLDD Q ITDDTRIRA
Sbjct  60   KLRSLKASSNPVRAVVSMAKKSVGDLSSSDLKGKKVFVRADLNVPLDDAQNITDDTRIRA  119

Query  608  AIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVE  787
            AIPTIKHLI+NGAKVILS+HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVE
Sbjct  120  AIPTIKHLIANGAKVILSTHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVE  179

Query  788  KLVASLPDGGVLLLENVRFYKEEEKNEPEF  877
            KLV SLP+GGVLLLENVRFYKEEEKNEPEF
Sbjct  180  KLVDSLPEGGVLLLENVRFYKEEEKNEPEF  209



>ref|NP_176015.1| phosphoglycerate kinase [Arabidopsis thaliana]
 sp|P50318.3|PGKH2_ARATH RecName: Full=Phosphoglycerate kinase 2, chloroplastic; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAG50920.1|AC069159_21 phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AAL07140.1| putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAM20449.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AAN15569.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
 gb|AEE33356.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=478

 Score =   320 bits (820),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 161/202 (80%), Positives = 178/202 (88%), Gaps = 5/202 (2%)
 Frame = +2

Query  350  LPRTPL--RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLK  523
            +P T +  R LGF+A   D  FS HVA+++ S++   K  RGV++MAKKSVGDL + DLK
Sbjct  32   IPSTSVSARRLGFSAVV-DSRFSVHVASKVHSVRG--KGARGVITMAKKSVGDLNSVDLK  88

Query  524  GKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYS  703
            GKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK LI NGAKVILS+HLGRPKGVTPK+S
Sbjct  89   GKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKVILSTHLGRPKGVTPKFS  148

Query  704  LAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAK  883
            LAPLVPRLSELLGI+VVKADDCIGPEVE LVASLP+GGVLLLENVRFYKEEEKNEP+FAK
Sbjct  149  LAPLVPRLSELLGIEVVKADDCIGPEVETLVASLPEGGVLLLENVRFYKEEEKNEPDFAK  208

Query  884  KLASLADLFVNDAFGTAHRAHA  949
            KLASLADL+VNDAFGTAHRAHA
Sbjct  209  KLASLADLYVNDAFGTAHRAHA  230



>ref|XP_003546820.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Glycine max]
Length=483

 Score =   317 bits (812),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 168/208 (81%), Positives = 180/208 (87%), Gaps = 4/208 (2%)
 Frame = +2

Query  329  RAVITRFLPRTPL-RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDL  505
            R  ++  L   PL R LGFAAA  DP  + +VA ++ +     K  RGVVSMAKKSVG+L
Sbjct  31   RVQLSSSLRSRPLARRLGFAAA--DPLLAANVAARVAA-VRGGKGARGVVSMAKKSVGEL  87

Query  506  TAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKG  685
            +AADLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIKHLI NGAKVILSSHLGRPKG
Sbjct  88   SAADLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKHLIQNGAKVILSSHLGRPKG  147

Query  686  VTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKN  865
            VTPKYSLAPLVPRLSEL+GIQVVKA+D IGPEVEKLVASLPDGGVLLLENVRFYKEEEKN
Sbjct  148  VTPKYSLAPLVPRLSELIGIQVVKAEDSIGPEVEKLVASLPDGGVLLLENVRFYKEEEKN  207

Query  866  EPEFAKKLASLADLFVNDAFGTAHRAHA  949
            +PE AKKLASLADLFVNDAFGTAHRAHA
Sbjct  208  DPEHAKKLASLADLFVNDAFGTAHRAHA  235



>ref|XP_010544343.1| PREDICTED: LOW QUALITY PROTEIN: phosphoglycerate kinase 1, chloroplastic-like 
[Tarenaya hassleriana]
Length=480

 Score =   313 bits (802),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 172/194 (89%), Gaps = 8/194 (4%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF++   D  FS HVA+++RS++   K  RGVVS      GDLT+ADLKGKKVFVRA
Sbjct  45   RRLGFSSVV-DSRFSVHVASKVRSVRG--KGTRGVVSX-----GDLTSADLKGKKVFVRA  96

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRL  727
            DLNVPLDD+Q ITDDTRIRAAIPTIK+LI NGAKVILSSHLGRPKGVTPKYSLAPLVPRL
Sbjct  97   DLNVPLDDSQNITDDTRIRAAIPTIKYLIENGAKVILSSHLGRPKGVTPKYSLAPLVPRL  156

Query  728  SELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADL  907
            SELLGIQVVKADDCIGPEVE L+ SLP+GGVLLLENVRFYKEEEKNEPEFAKKLASLADL
Sbjct  157  SELLGIQVVKADDCIGPEVESLLDSLPEGGVLLLENVRFYKEEEKNEPEFAKKLASLADL  216

Query  908  FVNDAFGTAHRAHA  949
            +VNDAFGTAHRAHA
Sbjct  217  YVNDAFGTAHRAHA  230



>ref|XP_003568189.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Brachypodium 
distachyon]
Length=482

 Score =   311 bits (798),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 157/197 (80%), Positives = 175/197 (89%), Gaps = 2/197 (1%)
 Frame = +2

Query  362  PLRSLGFAAAA-ADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVF  538
            P RSL FAA   ADP  + HVA++ R+  +SA+  R V +MAKKSVGDL  ADL+GK+V 
Sbjct  36   PARSLAFAAGGGADPRLAIHVASRCRA-ASSARGTRAVATMAKKSVGDLGPADLEGKRVL  94

Query  539  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLV  718
            VRADLNVPLDD+Q ITDDTRIRAAIPTIK+L+SNGAKVIL+SHLGRPKGVTPK+SLAPLV
Sbjct  95   VRADLNVPLDDSQNITDDTRIRAAIPTIKYLLSNGAKVILTSHLGRPKGVTPKFSLAPLV  154

Query  719  PRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASL  898
            PRLSELLGIQV KADD IGPEVEKLVA+LP+G VLLLENVRFYKEEEKNEPEFAKKLA+L
Sbjct  155  PRLSELLGIQVQKADDVIGPEVEKLVAALPNGAVLLLENVRFYKEEEKNEPEFAKKLAAL  214

Query  899  ADLFVNDAFGTAHRAHA  949
            ADL+VNDAFGTAHRAHA
Sbjct  215  ADLYVNDAFGTAHRAHA  231



>emb|CDP13574.1| unnamed protein product [Coffea canephora]
Length=405

 Score =   306 bits (784),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 148/157 (94%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            MAKKSVGDL AADLKGK VFVRAD NVPLDD Q ITDDTRIRAAIPTIKHLISNGAKV+L
Sbjct  1    MAKKSVGDLAAADLKGKNVFVRADFNVPLDDNQNITDDTRIRAAIPTIKHLISNGAKVVL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            SSHLGRPKGVTPK+SLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV
Sbjct  61   SSHLGRPKGVTPKFSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKNEPEFAKKLASLAD++VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNEPEFAKKLASLADIYVNDAFGTAHRAHA  157



>ref|XP_006858226.1| PREDICTED: phosphoglycerate kinase, chloroplastic [Amborella 
trichopoda]
 gb|ERN19693.1| hypothetical protein AMTR_s00062p00189550 [Amborella trichopoda]
Length=481

 Score =   306 bits (785),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 160/202 (79%), Positives = 170/202 (84%), Gaps = 5/202 (2%)
 Frame = +2

Query  356  RTPL--RSLGFAAAAADPFFSHHV--ATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLK  523
            R PL  R LGF+   A    S  +  A ++       +  RGVVSM KKSVGDLTA+DLK
Sbjct  33   RMPLDARRLGFSGNGAS-IASQRLLKACEMVCGGRRGRGPRGVVSMVKKSVGDLTASDLK  91

Query  524  GKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYS  703
            GKKVFVRADLNVPLDD Q ITDDTRIRAA+PTIKHLI NGAKVILSSHLGRPKGVTPKYS
Sbjct  92   GKKVFVRADLNVPLDDNQNITDDTRIRAAVPTIKHLIGNGAKVILSSHLGRPKGVTPKYS  151

Query  704  LAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAK  883
            L PLVPRLSELLG+ VVKADDCIG EVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAK
Sbjct  152  LKPLVPRLSELLGVTVVKADDCIGEEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAK  211

Query  884  KLASLADLFVNDAFGTAHRAHA  949
            KLASLAD++VNDAFGTAHRAHA
Sbjct  212  KLASLADIYVNDAFGTAHRAHA  233



>emb|CBI24182.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   303 bits (775),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 145/157 (92%), Positives = 152/157 (97%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            MAKKSVGDLT ADLKGKKVFVR DLNVPLDD QKITDDTR+RAAIPTIK+LI NGAKVIL
Sbjct  1    MAKKSVGDLTGADLKGKKVFVRVDLNVPLDDNQKITDDTRVRAAIPTIKYLIDNGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            SSHLGRPKGVTPK+SLAPLVPRLSELLGIQ+VKADDCIGPEVEKLV +LPDGGVLLLENV
Sbjct  61   SSHLGRPKGVTPKFSLAPLVPRLSELLGIQIVKADDCIGPEVEKLVTALPDGGVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKNEPEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNEPEFAKKLASIADLYVNDAFGTAHRAHA  157



>ref|XP_004961633.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Setaria 
italica]
Length=480

 Score =   304 bits (779),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 151/196 (77%), Positives = 172/196 (88%), Gaps = 3/196 (2%)
 Frame = +2

Query  362  PLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFV  541
            P RSL FAA   D   + HVA++ R   +SA+  R V +MAKKSVGDLT ADL+GK+VFV
Sbjct  41   PARSLAFAAG--DARLAVHVASRCRQ-ASSARGTRAVATMAKKSVGDLTEADLEGKRVFV  97

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVP  721
            RADLNVPLD+ Q ITDDTR+RAA+PTI++LI  GAKVILSSHLGRPKGVTPK+SLAP+VP
Sbjct  98   RADLNVPLDENQNITDDTRVRAAVPTIQYLIGKGAKVILSSHLGRPKGVTPKFSLAPIVP  157

Query  722  RLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLA  901
            RLSELLGIQV KADD IGPEVEKLV++LP+GGVLLLENVRFYKEEEKN+PEFA+KLASLA
Sbjct  158  RLSELLGIQVQKADDVIGPEVEKLVSALPNGGVLLLENVRFYKEEEKNDPEFAQKLASLA  217

Query  902  DLFVNDAFGTAHRAHA  949
            DL+VNDAFGTAHRAHA
Sbjct  218  DLYVNDAFGTAHRAHA  233



>ref|XP_007149208.1| hypothetical protein PHAVU_005G050700g [Phaseolus vulgaris]
 gb|ESW21202.1| hypothetical protein PHAVU_005G050700g [Phaseolus vulgaris]
Length=477

 Score =   303 bits (777),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 170/194 (88%), Gaps = 3/194 (2%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF AA  DP  + +VA ++ +     +  RGVVSMAKKSVGDL+AADLKGKKVFVRA
Sbjct  39   RRLGFTAA--DPLLAANVAARVAA-VKVGRGRRGVVSMAKKSVGDLSAADLKGKKVFVRA  95

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRL  727
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILSSHLGRPKGVTPKYSL PLVPRL
Sbjct  96   DLNVPLDDNQNITDDTRIRAAIPTIKYLIQNGAKVILSSHLGRPKGVTPKYSLGPLVPRL  155

Query  728  SELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADL  907
            SEL+G  VVKA+D IGPEVEKLVASLPDGGVLLLENVRFYKEEEKN+PE AKKLASLADL
Sbjct  156  SELIGFPVVKAEDSIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNDPEHAKKLASLADL  215

Query  908  FVNDAFGTAHRAHA  949
            FVNDAFGTAHRAHA
Sbjct  216  FVNDAFGTAHRAHA  229



>gb|AFW82396.1| hypothetical protein ZEAMMB73_945417 [Zea mays]
Length=477

 Score =   303 bits (777),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 171/198 (86%), Gaps = 3/198 (2%)
 Frame = +2

Query  356  RTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKV  535
            R P RSL FAA   D   + HVA++ R   +SA+  R + +MAKKSVGDLT ADLKGK+V
Sbjct  35   RQPARSLAFAAG--DARLAVHVASRCRQ-ASSARGTRAMATMAKKSVGDLTEADLKGKRV  91

Query  536  FVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPL  715
            FVRADLNVPLD+ Q ITDDTRIRAAIPTI++L+  GAKVILSSHLGRPKG TPK+SLAPL
Sbjct  92   FVRADLNVPLDENQNITDDTRIRAAIPTIQYLLGKGAKVILSSHLGRPKGFTPKFSLAPL  151

Query  716  VPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLAS  895
            V RLSELLGIQV KADD IGPEVEKLVA+LP+GGVLLLENVRFYKEEEKN+PEFA+KLAS
Sbjct  152  VARLSELLGIQVQKADDVIGPEVEKLVAALPNGGVLLLENVRFYKEEEKNDPEFAQKLAS  211

Query  896  LADLFVNDAFGTAHRAHA  949
            +ADL+VNDAFGTAHRAHA
Sbjct  212  VADLYVNDAFGTAHRAHA  229



>gb|AGV54662.1| phosphoglycerate kinase chloroplastic-like protein [Phaseolus 
vulgaris]
Length=477

 Score =   302 bits (773),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 159/194 (82%), Positives = 170/194 (88%), Gaps = 3/194 (2%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF AA  DP  + +VA ++ +     +  RGVVSMAKKSVGDL+AADLKGKKVFVRA
Sbjct  39   RRLGFTAA--DPLLAANVAARVAA-VKVGRGRRGVVSMAKKSVGDLSAADLKGKKVFVRA  95

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRL  727
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILSSHLGRPKGVTPKYSL PLVPRL
Sbjct  96   DLNVPLDDNQNITDDTRIRAAIPTIKYLIQNGAKVILSSHLGRPKGVTPKYSLGPLVPRL  155

Query  728  SELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADL  907
            SEL+G  VVKA+D IGPEVEKLVASLPDGGVLLLENVRFYKEEEKN+PE AKKLASLADL
Sbjct  156  SELIGFPVVKAEDSIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNDPEHAKKLASLADL  215

Query  908  FVNDAFGTAHRAHA  949
            FVNDAFGTAHRAHA
Sbjct  216  FVNDAFGTAHRAHA  229



>gb|AIZ74346.1| phosphoglycerate kinase 1 [Pinus massoniana]
Length=507

 Score =   302 bits (774),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 150/196 (77%), Positives = 166/196 (85%), Gaps = 7/196 (4%)
 Frame = +2

Query  380  FAAAAADPFFSHH------VATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFV  541
            F   AA   F+        VA Q+     + +  RGVVSMAK+SVGDL  +DLKGKKVFV
Sbjct  65   FGLGAASNLFASENDLASAVAAQVGGAN-NGRGCRGVVSMAKRSVGDLKESDLKGKKVFV  123

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVP  721
            RADLNVPLD+ Q ITDDTRIRAA+PTIK+LISNGAKVIL+SHLGRPKGVTPKYSL PLVP
Sbjct  124  RADLNVPLDENQNITDDTRIRAAVPTIKYLISNGAKVILTSHLGRPKGVTPKYSLKPLVP  183

Query  722  RLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLA  901
            RL+ELLG+ VVKADDCIGPEVEK VASLP+GGVLLLENVRFYKEEEKN+PEFAKKLAS+A
Sbjct  184  RLTELLGVNVVKADDCIGPEVEKAVASLPNGGVLLLENVRFYKEEEKNDPEFAKKLASIA  243

Query  902  DLFVNDAFGTAHRAHA  949
            DL+VNDAFGTAHRAHA
Sbjct  244  DLYVNDAFGTAHRAHA  259



>emb|CBL95264.1| phosphoglycerate kinase 1 [Pinus pinaster]
Length=507

 Score =   300 bits (768),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 165/196 (84%), Gaps = 7/196 (4%)
 Frame = +2

Query  380  FAAAAADPFFSHH------VATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFV  541
            F   AA   F+        VA Q+     + +  RGVVSMAK+SVGDL  +DLKGKKVFV
Sbjct  65   FGLGAASNLFASENDLASAVAAQVGGAN-NGRGCRGVVSMAKRSVGDLKESDLKGKKVFV  123

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVP  721
            RADLNVPLD+ Q ITDDTRIRAA+PTIK+LISNGAKVIL+SHLGRPKGVTPKYSL PLVP
Sbjct  124  RADLNVPLDENQNITDDTRIRAAVPTIKYLISNGAKVILTSHLGRPKGVTPKYSLKPLVP  183

Query  722  RLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLA  901
            RL+ELLG+ VVKADDCIG EVEK VASLP+GGVLLLENVRFYKEEEKN+PEFAKKLAS+A
Sbjct  184  RLTELLGVNVVKADDCIGAEVEKAVASLPNGGVLLLENVRFYKEEEKNDPEFAKKLASIA  243

Query  902  DLFVNDAFGTAHRAHA  949
            DL+VNDAFGTAHRAHA
Sbjct  244  DLYVNDAFGTAHRAHA  259



>ref|NP_001117503.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AEE33357.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=405

 Score =   296 bits (757),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 143/157 (91%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            MAKKSVGDL + DLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK LI NGAKVIL
Sbjct  1    MAKKSVGDLNSVDLKGKKVFVRADLNVPLDDNQNITDDTRIRAAIPTIKFLIENGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            S+HLGRPKGVTPK+SLAPLVPRLSELLGI+VVKADDCIGPEVE LVASLP+GGVLLLENV
Sbjct  61   STHLGRPKGVTPKFSLAPLVPRLSELLGIEVVKADDCIGPEVETLVASLPEGGVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKNEP+FAKKLASLADL+VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNEPDFAKKLASLADLYVNDAFGTAHRAHA  157



>sp|P12782.1|PGKH_WHEAT RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Triticum aestivum]
 emb|CAA33303.1| unnamed protein product [Triticum aestivum]
 emb|CAA51931.1| phosphoglycerate kinase [Triticum aestivum]
Length=480

 Score =   298 bits (763),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 156/196 (80%), Positives = 172/196 (88%), Gaps = 2/196 (1%)
 Frame = +2

Query  362  PLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFV  541
            P RSL FAA A DP  + HVA++ R+  A+    R V +MAKKSVGDLTAADL+GK+V V
Sbjct  36   PARSLAFAAGA-DPRLAVHVASRCRAASAARG-TRAVATMAKKSVGDLTAADLEGKRVLV  93

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVP  721
            RADLNVPLDD Q ITDDTRIRAAIPTIK+L+SNGAKVIL+SHLGRPKGVTPK+SLAPLVP
Sbjct  94   RADLNVPLDDNQNITDDTRIRAAIPTIKYLLSNGAKVILTSHLGRPKGVTPKFSLAPLVP  153

Query  722  RLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLA  901
            RLSELLGI+V KA+D IGPEVEKLVA L +G VLLLENVRFYKEEEKN+PEFAKKLASLA
Sbjct  154  RLSELLGIEVKKAEDVIGPEVEKLVADLANGAVLLLENVRFYKEEEKNDPEFAKKLASLA  213

Query  902  DLFVNDAFGTAHRAHA  949
            DLFVNDAFGTAHRAHA
Sbjct  214  DLFVNDAFGTAHRAHA  229



>gb|AFW78532.1| phosphoglycerate kinase [Zea mays]
Length=480

 Score =   296 bits (758),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 169/196 (86%), Gaps = 3/196 (2%)
 Frame = +2

Query  362  PLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFV  541
            P RSL FAA   D   + HVA++ R    S +  R + +MAKKSVG+LT ADL+GK+VFV
Sbjct  40   PARSLAFAAG--DARLAVHVASRCRQ-AFSGRGTRAMATMAKKSVGELTEADLEGKRVFV  96

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVP  721
            RADLNVPLD+ Q ITDDTRIRAAIPTI++++S GAKVILSSHLGRPKG TPK+SLAPLV 
Sbjct  97   RADLNVPLDENQNITDDTRIRAAIPTIQYILSKGAKVILSSHLGRPKGFTPKFSLAPLVG  156

Query  722  RLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLA  901
            RLSELLGIQV KADD IGPEVEKLVA+LP+GGVLLLENVRFYKEEEKN+PEFA+KLASLA
Sbjct  157  RLSELLGIQVQKADDVIGPEVEKLVAALPNGGVLLLENVRFYKEEEKNDPEFAQKLASLA  216

Query  902  DLFVNDAFGTAHRAHA  949
            DL+VNDAFGTAHRAHA
Sbjct  217  DLYVNDAFGTAHRAHA  232



>gb|AFW78533.1| phosphoglycerate kinase [Zea mays]
Length=483

 Score =   296 bits (758),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 149/196 (76%), Positives = 169/196 (86%), Gaps = 3/196 (2%)
 Frame = +2

Query  362  PLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFV  541
            P RSL FAA   D   + HVA++ R    S +  R + +MAKKSVG+LT ADL+GK+VFV
Sbjct  40   PARSLAFAAG--DARLAVHVASRCRQ-AFSGRGTRAMATMAKKSVGELTEADLEGKRVFV  96

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVP  721
            RADLNVPLD+ Q ITDDTRIRAAIPTI++++S GAKVILSSHLGRPKG TPK+SLAPLV 
Sbjct  97   RADLNVPLDENQNITDDTRIRAAIPTIQYILSKGAKVILSSHLGRPKGFTPKFSLAPLVG  156

Query  722  RLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLA  901
            RLSELLGIQV KADD IGPEVEKLVA+LP+GGVLLLENVRFYKEEEKN+PEFA+KLASLA
Sbjct  157  RLSELLGIQVQKADDVIGPEVEKLVAALPNGGVLLLENVRFYKEEEKNDPEFAQKLASLA  216

Query  902  DLFVNDAFGTAHRAHA  949
            DL+VNDAFGTAHRAHA
Sbjct  217  DLYVNDAFGTAHRAHA  232



>ref|XP_008656415.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Zea mays]
Length=627

 Score =   300 bits (768),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 152/198 (77%), Positives = 171/198 (86%), Gaps = 3/198 (2%)
 Frame = +2

Query  356  RTPLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKV  535
            R P RSL FAA   D   + HVA++ R   +SA+  R + +MAKKSVGDLT ADLKGK+V
Sbjct  185  RQPARSLAFAAG--DARLAVHVASRCRQ-ASSARGTRAMATMAKKSVGDLTEADLKGKRV  241

Query  536  FVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPL  715
            FVRADLNVPLD+ Q ITDDTRIRAAIPTI++L+  GAKVILSSHLGRPKG TPK+SLAPL
Sbjct  242  FVRADLNVPLDENQNITDDTRIRAAIPTIQYLLGKGAKVILSSHLGRPKGFTPKFSLAPL  301

Query  716  VPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLAS  895
            V RLSELLGIQV KADD IGPEVEKLVA+LP+GGVLLLENVRFYKEEEKN+PEFA+KLAS
Sbjct  302  VARLSELLGIQVQKADDVIGPEVEKLVAALPNGGVLLLENVRFYKEEEKNDPEFAQKLAS  361

Query  896  LADLFVNDAFGTAHRAHA  949
            +ADL+VNDAFGTAHRAHA
Sbjct  362  VADLYVNDAFGTAHRAHA  379



>ref|XP_004970259.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X2 [Setaria italica]
Length=484

 Score =   294 bits (753),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 149/198 (75%), Positives = 166/198 (84%), Gaps = 2/198 (1%)
 Frame = +2

Query  362  PLRSLG-FAAA-AADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKV  535
            P RSLG F+    AD     HV  + RS  ++ +  R   +MAKKSVGDL AADL+GK+V
Sbjct  44   PARSLGSFSLGDGADRRLPIHVPPRCRSESSAGREARAAATMAKKSVGDLAAADLEGKRV  103

Query  536  FVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPL  715
             VRADLNVPLDD Q ITDDTR+RAAIPTIKHL++NGAKVIL SHLGRPKGVT K+SLAPL
Sbjct  104  LVRADLNVPLDDRQNITDDTRVRAAIPTIKHLVTNGAKVILCSHLGRPKGVTAKFSLAPL  163

Query  716  VPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLAS  895
            VPRLSELLGIQV KADD IGPEVEKLV+ LP+G +LLLENVRFYKEEEKN+PEFAKKLAS
Sbjct  164  VPRLSELLGIQVQKADDVIGPEVEKLVSELPNGSILLLENVRFYKEEEKNDPEFAKKLAS  223

Query  896  LADLFVNDAFGTAHRAHA  949
            LADL+VNDAFGTAHRAHA
Sbjct  224  LADLYVNDAFGTAHRAHA  241



>ref|XP_002441313.1| hypothetical protein SORBIDRAFT_09g024340 [Sorghum bicolor]
 gb|EES19743.1| hypothetical protein SORBIDRAFT_09g024340 [Sorghum bicolor]
Length=483

 Score =   294 bits (752),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 168/196 (86%), Gaps = 3/196 (2%)
 Frame = +2

Query  362  PLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFV  541
            P RSL FAA   D   + HVA++ R   +SA+  R + +MAKKSVGDLT ADL+GK+VFV
Sbjct  43   PARSLAFAAG--DARLAVHVASRCRQ-ASSARGTRAMATMAKKSVGDLTEADLEGKRVFV  99

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVP  721
            RADLNVPLD+ Q ITDDTRIRAA+PTI++LIS GAKVILSSHLGRPKG TPK+SL P+V 
Sbjct  100  RADLNVPLDENQNITDDTRIRAAVPTIQYLISKGAKVILSSHLGRPKGFTPKFSLGPIVG  159

Query  722  RLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLA  901
            RLSELLGIQV KA+D IGPEVEKLV +LP GGVLLLENVRFYKEEEKN+PEFA+KLASLA
Sbjct  160  RLSELLGIQVQKAEDVIGPEVEKLVDALPIGGVLLLENVRFYKEEEKNDPEFAQKLASLA  219

Query  902  DLFVNDAFGTAHRAHA  949
            DL+VNDAFGTAHRAHA
Sbjct  220  DLYVNDAFGTAHRAHA  235



>ref|NP_001147628.1| phosphoglycerate kinase [Zea mays]
 gb|ACG28158.1| phosphoglycerate kinase [Zea mays]
 gb|ACG28313.1| phosphoglycerate kinase [Zea mays]
Length=480

 Score =   293 bits (751),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 148/196 (76%), Positives = 168/196 (86%), Gaps = 3/196 (2%)
 Frame = +2

Query  362  PLRSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFV  541
            P  SL FAA   D   + HVA++ R    S +  R + +MAKKSVG+LT ADL+GK+VFV
Sbjct  40   PAWSLAFAAG--DARLAVHVASRCRQ-AFSGRGTRAMATMAKKSVGELTEADLEGKRVFV  96

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVP  721
            RADLNVPLD+ Q ITDDTRIRAAIPTI++++S GAKVILSSHLGRPKG TPK+SLAPLV 
Sbjct  97   RADLNVPLDENQNITDDTRIRAAIPTIQYILSKGAKVILSSHLGRPKGFTPKFSLAPLVG  156

Query  722  RLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLA  901
            RLSELLGIQV KADD IGPEVEKLVA+LP+GGVLLLENVRFYKEEEKN+PEFA+KLASLA
Sbjct  157  RLSELLGIQVQKADDVIGPEVEKLVAALPNGGVLLLENVRFYKEEEKNDPEFAQKLASLA  216

Query  902  DLFVNDAFGTAHRAHA  949
            DL+VNDAFGTAHRAHA
Sbjct  217  DLYVNDAFGTAHRAHA  232



>gb|EAY98560.1| hypothetical protein OsI_20474 [Oryza sativa Indica Group]
Length=284

 Score =   287 bits (734),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 138/157 (88%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            MAKKSVGDLTAADL+GK+VFVRADLNVPLDD Q ITDDTR+RAAIPTI++LI NGAKVIL
Sbjct  1    MAKKSVGDLTAADLEGKRVFVRADLNVPLDDNQNITDDTRVRAAIPTIQYLIKNGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            SSHLGRPKGVTPK+SLAPLVPRLSELLGIQV KA+D IGP+VEKLV+ LP+G VLLLENV
Sbjct  61   SSHLGRPKGVTPKFSLAPLVPRLSELLGIQVTKAEDVIGPDVEKLVSELPNGSVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  157



>gb|AGT16255.1| phosphoglycerate kinase [Saccharum hybrid cultivar R570]
Length=489

 Score =   291 bits (746),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 149/217 (69%), Positives = 176/217 (81%), Gaps = 12/217 (6%)
 Frame = +2

Query  326  KRAVITRFLPRTPLRSLGF--AAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVG  499
            +RA +    P  P R LG    +A ADP  + HVA++ RS  ++ +  R   +MAKKSVG
Sbjct  31   RRAGLAAAFP--PERLLGSDSLSAGADPRLAIHVASRCRSASSAGRGTRAAATMAKKSVG  88

Query  500  DLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAK--------VI  655
            DL AA+L+GK+V VRAD NVPLDD+Q ITDDTR+RAAIPTIKHLI+NGA+        VI
Sbjct  89   DLAAAELEGKRVLVRADRNVPLDDSQNITDDTRVRAAIPTIKHLINNGARHLINNGARVI  148

Query  656  LSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLEN  835
            L+SHLGRPKGV+PK+SLAPLVPRLSELLGIQV KADD +GPEVEKLV++LP+G V+LLEN
Sbjct  149  LTSHLGRPKGVSPKFSLAPLVPRLSELLGIQVQKADDVVGPEVEKLVSALPNGNVVLLEN  208

Query  836  VRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAH  946
            VRFYKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAH
Sbjct  209  VRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAH  245



>gb|AAB60303.1| phosphoglycerate kinase, partial [Arabidopsis thaliana]
Length=399

 Score =   288 bits (738),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 146/151 (97%), Gaps = 0/151 (0%)
 Frame = +2

Query  497  GDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGR  676
            GDLT+ADLKGKKVFVRADLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLGR
Sbjct  1    GDLTSADLKGKKVFVRADLNVPLDDNQTITDDTRIRAAIPTIKYLIENGAKVILSTHLGR  60

Query  677  PKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEE  856
            PKGVTPK+SLAPLVPRLSELLGI+V KADDCIGPEVE LVASLP+GGVLLLENVRFYKEE
Sbjct  61   PKGVTPKFSLAPLVPRLSELLGIEVTKADDCIGPEVESLVASLPEGGVLLLENVRFYKEE  120

Query  857  EKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            EKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  121  EKNDPEFAKKLASLADLYVNDAFGTAHRAHA  151



>gb|ABR16231.1| unknown [Picea sitchensis]
Length=472

 Score =   291 bits (744),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  452  AKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHL  631
             +  RGVVSMAKKSVGDL  +DLKGK+VFVRADLNVPLD+ Q ITDDTRIRAA+PTIK+L
Sbjct  94   GRGCRGVVSMAKKSVGDLKESDLKGKRVFVRADLNVPLDENQNITDDTRIRAAVPTIKYL  153

Query  632  ISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPD  811
            I NGAKVIL+SHLGRPKGVTPKYSL PLVPRL+ELLG+ V+K DDCIG EVEK VASLPD
Sbjct  154  IGNGAKVILASHLGRPKGVTPKYSLKPLVPRLTELLGVNVLKTDDCIGEEVEKAVASLPD  213

Query  812  GGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            GGVLLLEN+RF+KEEEKN+PEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  214  GGVLLLENLRFHKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHA  259



>gb|ABK24564.1| unknown [Picea sitchensis]
Length=507

 Score =   291 bits (744),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 138/166 (83%), Positives = 153/166 (92%), Gaps = 0/166 (0%)
 Frame = +2

Query  452  AKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHL  631
             +  RGVVSMAKKSVGDL  +DLKGK+VFVRADLNVPLD+ Q ITDDTRIRAA+PTIK+L
Sbjct  94   GRGCRGVVSMAKKSVGDLKESDLKGKRVFVRADLNVPLDENQNITDDTRIRAAVPTIKYL  153

Query  632  ISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPD  811
            I NGAKVIL+SHLGRPKGVTPKYSL PLVPRL+ELLG+ V+K DDCIG EVEK VASLPD
Sbjct  154  IGNGAKVILASHLGRPKGVTPKYSLKPLVPRLTELLGVNVLKTDDCIGEEVEKAVASLPD  213

Query  812  GGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            GGVLLLEN+RF+KEEEKN+PEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  214  GGVLLLENLRFHKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHA  259



>ref|XP_004970258.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like isoform 
X1 [Setaria italica]
Length=485

 Score =   290 bits (741),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 149/199 (75%), Positives = 166/199 (83%), Gaps = 3/199 (2%)
 Frame = +2

Query  362  PLRSLG-FAAA-AADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKV  535
            P RSLG F+    AD     HV  + RS  ++ +  R   +MAKKSVGDL AADL+GK+V
Sbjct  44   PARSLGSFSLGDGADRRLPIHVPPRCRSESSAGREARAAATMAKKSVGDLAAADLEGKRV  103

Query  536  FVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPL  715
             VRADLNVPLDD Q ITDDTR+RAAIPTIKHL++NGAKVIL SHLGRPKGVT K+SLAPL
Sbjct  104  LVRADLNVPLDDRQNITDDTRVRAAIPTIKHLVTNGAKVILCSHLGRPKGVTAKFSLAPL  163

Query  716  VPRLSELLGIQ-VVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLA  892
            VPRLSELLGIQ V KADD IGPEVEKLV+ LP+G +LLLENVRFYKEEEKN+PEFAKKLA
Sbjct  164  VPRLSELLGIQKVQKADDVIGPEVEKLVSELPNGSILLLENVRFYKEEEKNDPEFAKKLA  223

Query  893  SLADLFVNDAFGTAHRAHA  949
            SLADL+VNDAFGTAHRAHA
Sbjct  224  SLADLYVNDAFGTAHRAHA  242



>ref|XP_006654593.1| PREDICTED: phosphoglycerate kinase, chloroplastic-like [Oryza 
brachyantha]
Length=405

 Score =   286 bits (732),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 137/157 (87%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            MAKKSVGDLTAADL+GK+VFVRADLNVPLD+ Q ITDDTR+RAAIPTI++LI NGAKVIL
Sbjct  1    MAKKSVGDLTAADLEGKRVFVRADLNVPLDENQNITDDTRVRAAIPTIQYLIKNGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            SSHLGRPKGVTPK+SLAPLVPRLSELLGI+V KA+D IGPEVEKLV+ LP+G VLLLENV
Sbjct  61   SSHLGRPKGVTPKFSLAPLVPRLSELLGIEVTKAEDVIGPEVEKLVSGLPNGSVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  157



>gb|EMS54865.1| Phosphoglycerate kinase, chloroplastic [Triticum urartu]
Length=460

 Score =   285 bits (728),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 139/157 (89%), Positives = 149/157 (95%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            MAKKSVGDLTAADL+GK+V VRADLNVPLDD Q ITDDTRIRAAIPTIK+L+SNGAKVIL
Sbjct  1    MAKKSVGDLTAADLEGKRVLVRADLNVPLDDNQNITDDTRIRAAIPTIKYLLSNGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SHLGRPKGVTPK+SLAPLVPRLSELLGI+V KA+D IGPEVEKLVA L +G VLLLENV
Sbjct  61   TSHLGRPKGVTPKFSLAPLVPRLSELLGIEVKKAEDVIGPEVEKLVADLANGAVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKN+PEFAKKLASLADLFVNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNDPEFAKKLASLADLFVNDAFGTAHRAHA  157



>gb|ACN32155.1| unknown [Zea mays]
Length=411

 Score =   281 bits (720),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/158 (85%), Positives = 150/158 (95%), Gaps = 0/158 (0%)
 Frame = +2

Query  476  SMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVI  655
            +MAKKSVG+LT ADL+GK+VFVRADLNVPLD+ Q ITDDTRIRAAIPTI++++S GAKVI
Sbjct  3    TMAKKSVGELTEADLEGKRVFVRADLNVPLDENQNITDDTRIRAAIPTIQYILSKGAKVI  62

Query  656  LSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLEN  835
            LSSHLGRPKG TPK+SLAPLV RLSELLGIQV KADD IGPEVEKLVA+LP+GGVLLLEN
Sbjct  63   LSSHLGRPKGFTPKFSLAPLVGRLSELLGIQVQKADDVIGPEVEKLVAALPNGGVLLLEN  122

Query  836  VRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            VRFYKEEEKN+PEFA+KLASLADL+VNDAFGTAHRAHA
Sbjct  123  VRFYKEEEKNDPEFAQKLASLADLYVNDAFGTAHRAHA  160



>gb|ADV16380.1| cytosolic phosphoglycerate kinase 2 [Helianthus annuus]
Length=400

 Score =   281 bits (719),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 146/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSV  L  ADLKGK+VFVRADLNVPLDDT KITDDTRIRAA+PTIK+L+SNGA+VILSS
Sbjct  4    KKSVSSLKEADLKGKRVFVRADLNVPLDDTFKITDDTRIRAAVPTIKYLMSNGARVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  ADDC+GPEVEKLVA +P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVKMADDCVGPEVEKLVAGIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>gb|AFW70285.1| hypothetical protein ZEAMMB73_319281 [Zea mays]
Length=186

 Score =   273 bits (698),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA++PTIK L+  GAKVIL+S
Sbjct  4    KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASVPTIKFLLEKGAKVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++VV A+DCIG EVEKL A+LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVVMANDCIGEEVEKLAAALPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKNEPEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNEPEFAKKLASVADLYVNDAFGTAHRAHA  158



>emb|CDY52872.1| BnaCnng23600D [Brassica napus]
Length=797

 Score =   290 bits (743),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 162/181 (90%), Gaps = 3/181 (2%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRA  547
            R LGF+A   D  F+ HVA++++S +   K  RGVVSMAKKSVGDLT+ADLKGKKVFVRA
Sbjct  397  RPLGFSAVL-DSRFTVHVASKVQSFRG--KGTRGVVSMAKKSVGDLTSADLKGKKVFVRA  453

Query  548  DLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRL  727
            DLNVPLDD Q ITDDTRIRAAIPTIK+LI NGAKVILS+HLGRPKGVTPK+SLAPLVPRL
Sbjct  454  DLNVPLDDNQTITDDTRIRAAIPTIKYLIDNGAKVILSTHLGRPKGVTPKFSLAPLVPRL  513

Query  728  SELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADL  907
            SELLGI+V KADDCIGPEVE LV SLP+GGVLLLENVRFY+EEEKN+PEFAKKLASLADL
Sbjct  514  SELLGIEVKKADDCIGPEVESLVGSLPEGGVLLLENVRFYQEEEKNDPEFAKKLASLADL  573

Query  908  F  910
            +
Sbjct  574  Y  574



>ref|NP_001142404.1| uncharacterized protein LOC100274579 [Zea mays]
 ref|XP_008681565.1| PREDICTED: uncharacterized protein LOC100274579 isoform X1 [Zea 
mays]
 ref|XP_008681566.1| PREDICTED: uncharacterized protein LOC100274579 isoform X1 [Zea 
mays]
 gb|ACF87897.1| unknown [Zea mays]
 gb|ACF88413.1| unknown [Zea mays]
 gb|ACG36709.1| phosphoglycerate kinase, cytosolic [Zea mays]
 gb|AFW70282.1| phosphoglycerate kinase isoform 1 [Zea mays]
 gb|AFW70283.1| phosphoglycerate kinase isoform 2 [Zea mays]
 gb|AFW70284.1| phosphoglycerate kinase isoform 3 [Zea mays]
Length=402

 Score =   276 bits (707),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA++PTIK L+  GAKVIL+S
Sbjct  4    KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASVPTIKFLLEKGAKVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++VV A+DCIG EVEKL A+LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVVMANDCIGEEVEKLAAALPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKNEPEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNEPEFAKKLASVADLYVNDAFGTAHRAHA  158



>gb|AIN39803.1| hypothetical protein, partial [Zoysia matrella]
Length=290

 Score =   273 bits (697),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA++PTIK L+  GAKV+L+S
Sbjct  4    KRSVGSLGEADLKGKKVFVRADLNVPLDDNQKITDDTRIRASVPTIKFLLEKGAKVVLAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ VV A+DCIG EVEKL A+LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHA  158



>gb|ACJ11718.1| phosphoglycerate kinase [Gossypium hirsutum]
 gb|KHG14087.1| Phosphoglycerate kinase, cytosolic [Gossypium arboreum]
Length=401

 Score =   276 bits (706),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVGDL  ADLKGKKVFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G+KVILSS
Sbjct  4    KKSVGDLKEADLKGKKVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGSKVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  A+DCIG EVEK+VA+LPDGGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAALPDGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_011086347.1| PREDICTED: phosphoglycerate kinase, cytosolic [Sesamum indicum]
Length=401

 Score =   275 bits (703),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 134/155 (86%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG L  ADLKGK+VFVR DLNVPLDDT  ITDDTRIRAA+PTIK+LI +GAKVILSS
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDTFHITDDTRIRAAVPTIKYLIDHGAKVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  A+DCIG EVEKLVASLP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVRVANDCIGEEVEKLVASLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>gb|ABI18157.1| cytosolic phosphoglycerate kinase [Helianthus annuus]
Length=401

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSV  LT  DLKGK+VFVR DLNVPLDDT KITDDTRIRAA+PTIK+L+S+GA+VILSS
Sbjct  4    KKSVSSLTEGDLKGKRVFVRVDLNVPLDDTFKITDDTRIRAAVPTIKYLMSHGARVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPK+SL PLVPRLSELLGI+V  ADDCIGP+VEKLVA +P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKFSLKPLVPRLSELLGIEVKMADDCIGPDVEKLVAEIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_004139837.1| PREDICTED: phosphoglycerate kinase, cytosolic [Cucumis sativus]
 gb|KGN44288.1| hypothetical protein Csa_7G239010 [Cucumis sativus]
Length=401

 Score =   275 bits (702),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTI++L+S+GA+VILSS
Sbjct  4    KKSVGTLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIQYLLSHGARVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+QVV A+DCIG EVEK+VA LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGLQVVMANDCIGEEVEKMVAELPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_006858233.1| PREDICTED: phosphoglycerate kinase, cytosolic [Amborella trichopoda]
 gb|ERN19700.1| hypothetical protein AMTR_s00062p00191350 [Amborella trichopoda]
Length=401

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 145/155 (94%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVGDL+ +DLKGK+VFVR DLNVPLDD QKITDDTRIRAA+PTIK+L+ NGAKVIL+S
Sbjct  4    KKSVGDLSPSDLKGKRVFVRVDLNVPLDDNQKITDDTRIRAAVPTIKYLMENGAKVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ V+ ADDCIG  VEKLVASL +GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVPVLTADDCIGEAVEKLVASLTEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEF+KKLA+LADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFSKKLAALADLYVNDAFGTAHRAHA  158



>ref|NP_001058317.1| Os06g0668200 [Oryza sativa Japonica Group]
 dbj|BAD45436.1| putative cytosolic phosphoglycerate kinase 1 [Oryza sativa Japonica 
Group]
 dbj|BAD45421.1| putative cytosolic phosphoglycerate kinase 1 [Oryza sativa Japonica 
Group]
 dbj|BAF20231.1| Os06g0668200 [Oryza sativa Japonica Group]
 gb|EAZ02017.1| hypothetical protein OsI_24050 [Oryza sativa Indica Group]
 gb|EAZ37949.1| hypothetical protein OsJ_22300 [Oryza sativa Japonica Group]
 dbj|BAG95158.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92099.1| unnamed protein product [Oryza sativa Japonica Group]
Length=401

 Score =   274 bits (700),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +2

Query  482  AKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILS  661
            +K+SVG LT +DLKGKKVF+RADLNVPLDD+QKITDDTRIRA++PTIK L+  GAKVIL+
Sbjct  3    SKRSVGTLTESDLKGKKVFLRADLNVPLDDSQKITDDTRIRASVPTIKFLMGKGAKVILA  62

Query  662  SHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVR  841
            SHLGRPKGVTPKYSL PLVPRLSELLG+ VV A+DCIG EV+KL A+LPDGGVLLLENVR
Sbjct  63   SHLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVQKLAATLPDGGVLLLENVR  122

Query  842  FYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            FYKEEEKN+PEFA KLAS+ADL+VNDAFGTAHRAHA
Sbjct  123  FYKEEEKNDPEFANKLASVADLYVNDAFGTAHRAHA  158



>ref|XP_003570108.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brachypodium distachyon]
Length=401

 Score =   273 bits (699),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA++PTIK L+  GAKVIL+S
Sbjct  4    KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASVPTIKFLLEKGAKVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPK+SL PLVPRLSELLGI VV A+DCIG EVEKL A+LPDGGVLLLENVRF
Sbjct  64   HLGRPKGVTPKFSLKPLVPRLSELLGIDVVMANDCIGEEVEKLAAALPDGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHA  158



>gb|KJB14019.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14021.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14022.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14023.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
 gb|KJB14024.1| hypothetical protein B456_002G107200 [Gossypium raimondii]
Length=401

 Score =   273 bits (698),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVGDL  ADLKGKKVFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G+KVILSS
Sbjct  4    KKSVGDLKEADLKGKKVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGSKVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELL ++V  A+DCIG EVEK+VA+LPDGGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLEVEVKMANDCIGEEVEKMVAALPDGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_008447095.1| PREDICTED: phosphoglycerate kinase, cytosolic [Cucumis melo]
Length=401

 Score =   273 bits (697),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTI++L+S+GA+VILSS
Sbjct  4    KRSVGTLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIQYLLSHGARVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+QV+ A+DCIG EVEK+VA LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGLQVIMANDCIGEEVEKMVAELPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_010275944.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nelumbo nucifera]
Length=402

 Score =   273 bits (697),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVGDL  ADLKGKKVFVR DLNVPLD+  KITDDTR+RAA+PTIK+L+ + AKVILSS
Sbjct  4    KRSVGDLKEADLKGKKVFVRVDLNVPLDENLKITDDTRVRAAVPTIKYLMGHKAKVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLGIQV  A+DCIG EVEKLVA++P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGIQVEMANDCIGEEVEKLVAAIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>gb|AIZ68220.1| phosphoglycerate kinase [Ornithogalum saundersiae]
Length=401

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG L AADLKGKKVFVR DLNVPLDD QKITDDTRIRAA+PTIK+L+ +GA++IL+S
Sbjct  4    KKSVGSLKAADLKGKKVFVRVDLNVPLDDNQKITDDTRIRAAVPTIKYLMEHGARIILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ V  ADDCIG EVEK VA+L DG VLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVNVEMADDCIGEEVEKKVAALKDGNVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_009417722.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
 ref|XP_009417729.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVGDL   DLKGK+VFVR DLNVPLDD+QKITDDTR+RAA+PTIK L+ +GA+VIL S
Sbjct  4    KRSVGDLKEDDLKGKRVFVRVDLNVPLDDSQKITDDTRVRAAVPTIKSLMEHGARVILCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ V  A+DCIG EVEK+VA+LPDGGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVDVEMANDCIGEEVEKMVAALPDGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>gb|EYU33791.1| hypothetical protein MIMGU_mgv1a006853mg [Erythranthe guttata]
Length=429

 Score =   273 bits (699),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+LI N AKVILSS
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLIGNAAKVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  A+DCIG EVEKLVA LP+GGV+LLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGLEVKMANDCIGEEVEKLVAGLPEGGVILLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKNEPEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_004966316.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Setaria italica]
Length=401

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L+ ADLKGKKVF+RADLNVPLDD QKITDD RIRA++PTIK L+  GAKVIL+S
Sbjct  4    KRSVGTLSEADLKGKKVFLRADLNVPLDDNQKITDDNRIRASVPTIKFLMEKGAKVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ VV A+DCIG EV KL ASLPDGGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVNVVMANDCIGEEVHKLAASLPDGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHA  158



>ref|XP_006656354.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Oryza brachyantha]
Length=401

 Score =   272 bits (696),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SV  L  +DLKGKKVFVRADLNVPLDD QKITDDTRIRA++PTIK+L+  GAKVIL+S
Sbjct  4    KRSVSTLAESDLKGKKVFVRADLNVPLDDGQKITDDTRIRASVPTIKYLMEKGAKVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ VV A+DCIG EV+KL A+LPDGGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVNVVMANDCIGEEVQKLAATLPDGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHA  158



>ref|XP_009777860.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Nicotiana 
sylvestris]
Length=401

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G+ VIL+S
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMQHGSHVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  ADDCIGPEVEKLVA +P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGLEVKMADDCIGPEVEKLVAEIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKNEPEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_008798227.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
Length=401

 Score =   272 bits (695),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SV  LT ADLKGKKVFVR DLNVPLDD  KITDDTR+RAA+PTIK+L+ +GAKVILSS
Sbjct  4    KRSVSTLTGADLKGKKVFVRVDLNVPLDDNLKITDDTRVRAAVPTIKYLMQHGAKVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ V  ADDCIG  V+K+VA+LPDGGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVNVEMADDCIGEGVQKMVAALPDGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>gb|EMS46092.1| Phosphoglycerate kinase, cytosolic [Triticum urartu]
Length=429

 Score =   273 bits (697),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA+IPTIK+L+  GAKVIL+S
Sbjct  4    KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPK+SL PLVPRLSELLG++VV A DCIG EVEKL A+LPDGGVLLLENVRF
Sbjct  64   HLGRPKGVTPKFSLKPLVPRLSELLGLEVVMAPDCIGEEVEKLAAALPDGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHA  158



>ref|XP_009399252.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   271 bits (694),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG LT ADLKGKKVFVR DLNVPLD+T K+TDDTRIRA++PTIK+L+  GA++IL+S
Sbjct  4    KKSVGALTEADLKGKKVFVRVDLNVPLDETLKVTDDTRIRASVPTIKYLMERGARIILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL P+VPRLSELLG+ V  A+DCIG EVEKL+++LPDGGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPVVPRLSELLGVNVAMANDCIGVEVEKLISALPDGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_002971814.1| hypothetical protein SELMODRAFT_267533 [Selaginella moellendorffii]
 gb|EFJ26731.1| hypothetical protein SELMODRAFT_267533 [Selaginella moellendorffii]
Length=472

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 140/168 (83%), Positives = 147/168 (88%), Gaps = 6/168 (4%)
 Frame = +2

Query  464  RGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNG  643
            RGVV MAKKSVGDL  ADLKGK+VFVRADLNVPLD   KITDDTRIRAA+PTIK+LISNG
Sbjct  56   RGVVCMAKKSVGDLKEADLKGKRVFVRADLNVPLDGDLKITDDTRIRAAVPTIKYLISNG  115

Query  644  AKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGI------QVVKADDCIGPEVEKLVASL  805
            AKVILSSHLGRPKGVT KY L PLVPRLSELLGI      QV KADD IGPEVEK VA+L
Sbjct  116  AKVILSSHLGRPKGVTDKYRLTPLVPRLSELLGIKASLFSQVEKADDSIGPEVEKKVAAL  175

Query  806  PDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            PDGGVLLLENVRFY EEEKN PE A+KLA+LADL+VNDAFGTAHRAHA
Sbjct  176  PDGGVLLLENVRFYPEEEKNVPEHAQKLAALADLYVNDAFGTAHRAHA  223



>ref|XP_006646936.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Oryza brachyantha]
Length=402

 Score =   271 bits (694),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADL+GKKVFVRADLNVPLDD QKITDDTRIRA++PT+K L+  GAKV+L+S
Sbjct  4    KRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVVLAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ VV A+DCIG EVEKL A+LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHA  158



>ref|XP_011095716.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
 ref|XP_011095717.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
 ref|XP_011095718.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Sesamum indicum]
Length=401

 Score =   271 bits (693),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG L  ADLKGK+V VR DLNVPLDD  KITDDTRIRAA+PTIK+L+ +GAKVIL++
Sbjct  4    KKSVGSLKEADLKGKRVLVRVDLNVPLDDNLKITDDTRIRAAVPTIKYLMEHGAKVILTT  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  ADDCIG EVEKLVA LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGLEVKMADDCIGEEVEKLVAGLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>sp|P12783.1|PGKY_WHEAT RecName: Full=Phosphoglycerate kinase, cytosolic [Triticum aestivum]
 emb|CAA33302.1| unnamed protein product [Triticum aestivum]
Length=401

 Score =   271 bits (693),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA+IPTIK+L+  GAKVIL+S
Sbjct  4    KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPK+SL PLV RLSELLG++VV A DCIG EVEKL A+LPDGGVLLLENVRF
Sbjct  64   HLGRPKGVTPKFSLKPLVARLSELLGLEVVMAPDCIGEEVEKLAAALPDGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHA  158



>gb|ABI74567.1| phosphoglycerate kinase [Oryza sativa Indica Group]
Length=402

 Score =   271 bits (692),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADL+GKKVFVRADLNVPLDD QKITDDTRIRA++PT+K L+  GAKVIL+S
Sbjct  4    KRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ VV A+DCIG EVEKL A+LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLA++ADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLAAVADLYVNDAFGTAHRAHA  158



>emb|CDP16886.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   271 bits (692),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/155 (85%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+LI +GAKVILSS
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLIGHGAKVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLV RLSELLG++V  ADDCIG +VEKLVA+LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVGRLSELLGVEVKMADDCIGEQVEKLVATLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|NP_001046020.1| Os02g0169300 [Oryza sativa Japonica Group]
 dbj|BAD25722.1| putative phosphoglycerate kinase, cytosolic [Oryza sativa Japonica 
Group]
 dbj|BAF07934.1| Os02g0169300 [Oryza sativa Japonica Group]
 gb|ABL74575.1| phosphoglycerate kinase [Oryza sativa Japonica Group]
 gb|EEC72574.1| hypothetical protein OsI_06015 [Oryza sativa Indica Group]
 gb|EEE56393.1| hypothetical protein OsJ_05543 [Oryza sativa Japonica Group]
Length=402

 Score =   271 bits (692),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADL+GKKVFVRADLNVPLDD QKITDDTRIRA++PT+K L+  GAKVIL+S
Sbjct  4    KRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ VV A+DCIG EVEKL A+LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLA++ADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLAAVADLYVNDAFGTAHRAHA  158



>ref|XP_004951776.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Setaria italica]
Length=402

 Score =   270 bits (690),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADL+GKKVFVRADLNVPLDD QKITDDTRIRA++PT+K L+  GAKVIL+S
Sbjct  4    KRSVGTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ VV A+DCIG EVEKL A+LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLAS ADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASAADLYVNDAFGTAHRAHA  158



>gb|EMT29203.1| Phosphoglycerate kinase, cytosolic [Aegilops tauschii]
Length=494

 Score =   273 bits (697),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA+IPTIK+L+  GAKVIL+S
Sbjct  4    KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPK+SL PLVPRLSELLG++VV A DCIG EVEKL A+LPDGGVLLLENVRF
Sbjct  64   HLGRPKGVTPKFSLKPLVPRLSELLGLEVVMAPDCIGEEVEKLAAALPDGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHA  158



>ref|XP_010324204.1| PREDICTED: phosphoglycerate kinase, cytosolic [Solanum lycopersicum]
 ref|XP_010324205.1| PREDICTED: phosphoglycerate kinase, cytosolic [Solanum lycopersicum]
Length=401

 Score =   270 bits (690),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG L  ADLKGK+VFVR DLNVPLDD  KITDDTRIRAA+PTIK+L+ NGA+VIL+S
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDNFKITDDTRIRAAVPTIKYLMQNGARVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLGI+V  A+D +GPEVE LVA LP+GGV+LLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGIEVKMANDSVGPEVENLVAGLPEGGVVLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>gb|ABF69999.1| phosphoglycerate kinase, putative [Musa acuminata]
Length=401

 Score =   270 bits (689),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 143/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG LT ADLKGKKVFVR DLNVPLD+  K+TDDTRIRA++PTIK+L+  GA++IL+S
Sbjct  4    KKSVGALTEADLKGKKVFVRVDLNVPLDENLKVTDDTRIRASVPTIKYLMERGARIILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL P+VPRLSELLG+ V  A+DCIG EVEKL+++LPDGGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPVVPRLSELLGVNVAMANDCIGVEVEKLISALPDGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>gb|ACU18322.1| unknown [Glycine max]
Length=233

 Score =   263 bits (673),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L   DLKGK+VFVR DLNVPLDD   ITDDTR+RAA+PTIK+L  +GAKVILSS
Sbjct  4    KRSVGTLKEGDLKGKRVFVRVDLNVPLDDNLNITDDTRVRAAVPTIKYLTGHGAKVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLS+LLGI+V  A+D IG EVEKLVA LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSQLLGIEVTMANDSIGEEVEKLVAQLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_010941661.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X2 [Elaeis 
guineensis]
Length=401

 Score =   268 bits (686),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SV  LT ADLKGKKVFVR DLNVPLDD  KITDDTR+RAA+PTIK+L+ +GAKVIL S
Sbjct  4    KRSVSTLTGADLKGKKVFVRVDLNVPLDDNLKITDDTRVRAAVPTIKYLMEHGAKVILCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ V  ADDCIG  V+K+V++LPDGGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVNVEMADDCIGEGVQKMVSALPDGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_010544342.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Tarenaya 
hassleriana]
Length=401

 Score =   268 bits (686),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGK+VFVR DLNVPLD++  ITDDTRIRAA+PTI +LI NGA+VILSS
Sbjct  4    KRSVGTLKEADLKGKRVFVRVDLNVPLDESFNITDDTRIRAAVPTINYLIQNGARVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELL I+V  A+DCIG EVEKLVA+LPDGGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLCIEVKMANDCIGEEVEKLVAALPDGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLA+LADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLANLADLYVNDAFGTAHRAHA  158



>ref|XP_010941660.1| PREDICTED: phosphoglycerate kinase, cytosolic isoform X1 [Elaeis 
guineensis]
Length=409

 Score =   268 bits (686),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 130/160 (81%), Positives = 144/160 (90%), Gaps = 1/160 (1%)
 Frame = +2

Query  473  VSMA-KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAK  649
            + MA K+SV  LT ADLKGKKVFVR DLNVPLDD  KITDDTR+RAA+PTIK+L+ +GAK
Sbjct  7    IKMATKRSVSTLTGADLKGKKVFVRVDLNVPLDDNLKITDDTRVRAAVPTIKYLMEHGAK  66

Query  650  VILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLL  829
            VIL SHLGRPKGVTPKYSL PLVPRLSELLG+ V  ADDCIG  V+K+V++LPDGGVLLL
Sbjct  67   VILCSHLGRPKGVTPKYSLKPLVPRLSELLGVNVEMADDCIGEGVQKMVSALPDGGVLLL  126

Query  830  ENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            ENVRFYKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  127  ENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  166



>gb|ABI74568.1| phosphoglycerate kinase [Oryza sativa Indica Group]
Length=402

 Score =   268 bits (684),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SV  L  ADL+GKKVFVRADLNVPLDD QKITDDTRIRA++PT+K L+  GAKVIL+S
Sbjct  4    KRSVWTLGEADLRGKKVFVRADLNVPLDDAQKITDDTRIRASVPTVKFLLEKGAKVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ VV A+DCIG EVEKL A+LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLA++ADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLAAVADLYVNDAFGTAHRAHA  158



>gb|AFW70281.1| phosphoglycerate kinase [Zea mays]
Length=572

 Score =   273 bits (697),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 132/155 (85%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGKKVFVRADLNVPLDD QKITDDTRIRA++PTIK L+  GAKVIL+S
Sbjct  174  KRSVGTLGEADLKGKKVFVRADLNVPLDDAQKITDDTRIRASVPTIKFLLEKGAKVILAS  233

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++VV A+DCIG EVEKL A+LP+GGVLLLENVRF
Sbjct  234  HLGRPKGVTPKYSLKPLVPRLSELLGVEVVMANDCIGEEVEKLAAALPEGGVLLLENVRF  293

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKNEPEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  294  YKEEEKNEPEFAKKLASVADLYVNDAFGTAHRAHA  328



>ref|XP_010557291.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
Length=432

 Score =   268 bits (685),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 153/184 (83%), Gaps = 1/184 (1%)
 Frame = +2

Query  401  PFFSHHVATQLRSLKASAKPVRGVVSMA-KKSVGDLTAADLKGKKVFVRADLNVPLDDTQ  577
            P   + + +Q+  L  S+     + +MA K+SVG L  ADLKGK+VFVR DLNVPLDD  
Sbjct  6    PIPRNSIRSQISHLPLSSDLPFALAAMATKRSVGTLKEADLKGKRVFVRVDLNVPLDDNF  65

Query  578  KITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVK  757
             ITDDTRIRAA+PTI +L+ NGA+VILSSHLGRPKGVTPKYSL PLVPRLSELLG++V  
Sbjct  66   NITDDTRIRAAVPTISYLMQNGARVILSSHLGRPKGVTPKYSLKPLVPRLSELLGVEVKM  125

Query  758  ADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAH  937
            A+DCIG EVE LV +LP+GGVLLLENVRFYKEEEKN+PEFAKKLASLADL+VNDAFGTAH
Sbjct  126  ANDCIGEEVENLVVALPEGGVLLLENVRFYKEEEKNDPEFAKKLASLADLYVNDAFGTAH  185

Query  938  RAHA  949
            RAHA
Sbjct  186  RAHA  189



>ref|XP_010936568.1| PREDICTED: phosphoglycerate kinase, cytosolic [Elaeis guineensis]
Length=401

 Score =   267 bits (682),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SV  LT ADLKGK+VFVR DLNVPLDD  KITDDTRIRAA+PTI++L+  GA+VILSS
Sbjct  4    KRSVSTLTEADLKGKRVFVRVDLNVPLDDNLKITDDTRIRAAVPTIEYLMDRGARVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ V  A+DCIG EVEK+VA+LPDGGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVNVEMANDCIGEEVEKMVAALPDGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+P FAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPAFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_009414502.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVGDL   DLKGK+VFVR DLNVPLDD  KITDDTR+RAA+PTIK+L+ +GA+VIL S
Sbjct  4    KRSVGDLKGDDLKGKRVFVRVDLNVPLDDNLKITDDTRVRAAVPTIKYLLEHGARVILCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLS+LLG+ V  ADDCIG EVEK+VA+LPDGGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSDLLGVNVEMADDCIGEEVEKIVAALPDGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            Y+EEEKN PEFAKKLASLAD++VNDAFGTAHRAHA
Sbjct  124  YREEEKNAPEFAKKLASLADVYVNDAFGTAHRAHA  158



>emb|CDP13576.1| unnamed protein product [Coffea canephora]
Length=401

 Score =   266 bits (681),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 129/155 (83%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG L  ADLKGKKVFVR DLNVPLDD   ITDDTRIRAA+PTI +LI   AK+IL+S
Sbjct  4    KKSVGSLKEADLKGKKVFVRVDLNVPLDDNFNITDDTRIRAAVPTINYLIGCSAKIILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V+ A+DCIG EVEKLVASLP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVIIANDCIGEEVEKLVASLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            +KEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  HKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_011468861.1| PREDICTED: phosphoglycerate kinase, cytosolic [Fragaria vesca 
subsp. vesca]
Length=401

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 142/155 (92%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SV  L  ADLKGK+VFVR DLNVPLD++ KITDDTRIRAA+PTIK+L  NGAKVIL+S
Sbjct  4    KRSVSTLKEADLKGKRVFVRVDLNVPLDESCKITDDTRIRAAVPTIKYLQGNGAKVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  A+DC+G EVEKLVA LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVKIANDCVGEEVEKLVAGLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLAD++VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADVYVNDAFGTAHRAHA  158



>ref|XP_009791377.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nicotiana sylvestris]
Length=401

 Score =   266 bits (680),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G+ VIL+S
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMQHGSHVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  A+D IGPEVEKLVA +P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVKIANDSIGPEVEKLVAEIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKNEPEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_004488762.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Cicer arietinum]
Length=401

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L   DLKGKKVFVR DLNVPLDD   ITDDTRIRAA+PTIK+L   GAKVILSS
Sbjct  4    KRSVGTLKEGDLKGKKVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLSGFGAKVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLGI+V  ADDCIG EVEKLVA +P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGIEVKIADDCIGEEVEKLVAQIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            +KEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  HKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>gb|ACJ84593.1| unknown [Medicago truncatula]
Length=226

 Score =   260 bits (664),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  A+LKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L   GAKVILSS
Sbjct  4    KRSVGTLKEAELKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLTGYGAKVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG QV  ADD IG EVEKLVA +P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGTQVKIADDSIGEEVEKLVAQIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            +KEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  HKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_002263950.1| PREDICTED: phosphoglycerate kinase, cytosolic [Vitis vinifera]
 emb|CAN81988.1| hypothetical protein VITISV_000723 [Vitis vinifera]
Length=401

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 144/155 (93%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVGDL  ADLKGK+VFVR DLNVPLD++ KITDDTR+RAA+PTIK+L+ +GAKVIL+S
Sbjct  4    KRSVGDLKEADLKGKRVFVRVDLNVPLDESLKITDDTRVRAAVPTIKYLMGHGAKVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  A+DCIG EV+ LVA +P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVKILVAKIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|NP_001275451.1| phosphoglycerate kinase, cytosolic-like [Solanum tuberosum]
 gb|ABB87110.1| unknown [Solanum tuberosum]
Length=401

 Score =   266 bits (679),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NGA+VIL+S
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDIFNITDDTRIRAAVPTIKYLMQNGARVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELL I+V  A+D IGPEVE LVA LP+GGV+LLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLAIEVKMANDSIGPEVENLVAELPEGGVVLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>gb|KCW71392.1| hypothetical protein EUGRSUZ_F04463 [Eucalyptus grandis]
Length=304

 Score =   262 bits (670),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTR+RAA+PTIK+L+S+GA VIL+S
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDSFHITDDTRVRAAVPTIKYLMSHGAIVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  A+DCIG EV KLVA  P+GGV+LLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVVKLVAETPEGGVILLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_007149209.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 ref|XP_007149210.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 gb|ESW21203.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
 gb|ESW21204.1| hypothetical protein PHAVU_005G050800g [Phaseolus vulgaris]
Length=401

 Score =   265 bits (678),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L   DLKGK+VFVR DLNVPLDD   ITDDTR+RAA+PTIK+L   GAKVILSS
Sbjct  4    KRSVGTLKEGDLKGKRVFVRVDLNVPLDDNLNITDDTRVRAAVPTIKYLTGYGAKVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLS+LLGI+V  A+DCIG EVEKLVA LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSQLLGIEVKIANDCIGEEVEKLVAGLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLAD++VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADVYVNDAFGTAHRAHA  158



>ref|XP_007022579.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 ref|XP_007022580.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 ref|XP_007022581.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14104.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14105.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
 gb|EOY14106.1| Phosphoglycerate kinase isoform 1 [Theobroma cacao]
Length=401

 Score =   265 bits (678),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G+KVILSS
Sbjct  4    KKSVGALKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGSKVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  A+DCIG EVEKLVA +PDGGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGAEVEKLVAEIPDGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN PEFAKKLASLAD++VNDAFGTAHR HA
Sbjct  124  YKEEEKNVPEFAKKLASLADVYVNDAFGTAHRPHA  158



>ref|XP_008383158.1| PREDICTED: phosphoglycerate kinase, cytosolic [Malus domestica]
Length=401

 Score =   265 bits (677),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSV  L  A+LKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +GAKVIL+S
Sbjct  4    KKSVSTLKEAELKGKRVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLLGHGAKVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  A+DCIG EVEKLVA LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGLEVKIANDCIGEEVEKLVAQLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLAD++VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADVYVNDAFGTAHRAHA  158



>ref|XP_003531483.1| PREDICTED: phosphoglycerate kinase, cytosolic [Glycine max]
 gb|KHN21385.1| Phosphoglycerate kinase, cytosolic [Glycine soja]
Length=401

 Score =   265 bits (677),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L   DLKGK+VFVR DLNVPLDD   ITDDTR+RAA+PTIK+L  +GAKVILSS
Sbjct  4    KRSVGTLKEGDLKGKRVFVRVDLNVPLDDNLNITDDTRVRAAVPTIKYLTGHGAKVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLS+LLGI+V  A+D IG EVEKLVA LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSQLLGIEVTMANDSIGEEVEKLVAQLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_002972334.1| hypothetical protein SELMODRAFT_231942 [Selaginella moellendorffii]
 gb|EFJ26420.1| hypothetical protein SELMODRAFT_231942 [Selaginella moellendorffii]
Length=412

 Score =   265 bits (678),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 135/163 (83%), Positives = 143/163 (88%), Gaps = 6/163 (4%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            MAKKSVGDL  ADLKGK+VFVRADLNVPLD   KITDDTRIRAA+PTIK+LISNGAKVIL
Sbjct  1    MAKKSVGDLKEADLKGKRVFVRADLNVPLDGDLKITDDTRIRAAVPTIKYLISNGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGI------QVVKADDCIGPEVEKLVASLPDGGV  820
            SSHLGRPKGVT KY L PLVPRLSELLGI      QV KADD IGPEVEK VA+LPDGGV
Sbjct  61   SSHLGRPKGVTDKYRLTPLVPRLSELLGIKASLFSQVEKADDSIGPEVEKKVAALPDGGV  120

Query  821  LLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            LLLENVRFY EEEKN PE A+KLA++ADL+VNDAFGTAHRAHA
Sbjct  121  LLLENVRFYPEEEKNVPEHAQKLAAVADLYVNDAFGTAHRAHA  163



>gb|EEC71648.1| hypothetical protein OsI_04088 [Oryza sativa Indica Group]
Length=449

 Score =   266 bits (680),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 140/186 (75%), Positives = 157/186 (84%), Gaps = 2/186 (1%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASAKPV--RGVVSMAKKSVGDLTAADLKGKKVFV  541
            RSLGFAA   DP  + HV+++ R+  ASA     R V +MAKKSVGDL AADL+GK+V +
Sbjct  44   RSLGFAARGTDPRLAIHVSSRRRAASASAGSRLARAVATMAKKSVGDLAAADLEGKRVLL  103

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVP  721
            RADLNVPLD +Q ITDDTR+RAAIPTIKHLI NGAKVIL SHLGRPKG+TPK+SLAPLVP
Sbjct  104  RADLNVPLDASQNITDDTRVRAAIPTIKHLIGNGAKVILCSHLGRPKGITPKFSLAPLVP  163

Query  722  RLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLA  901
            RLSELLGIQV KADD IGPEVEK V+ LP+G VLLLENVRFYKEEEKN+PEFAKKLASLA
Sbjct  164  RLSELLGIQVQKADDVIGPEVEKSVSVLPNGSVLLLENVRFYKEEEKNDPEFAKKLASLA  223

Query  902  DLFVND  919
            DL+  D
Sbjct  224  DLYELD  229



>ref|XP_009607754.1| PREDICTED: phosphoglycerate kinase, cytosolic [Nicotiana tomentosiformis]
 sp|Q42962.1|PGKY_TOBAC RecName: Full=Phosphoglycerate kinase, cytosolic [Nicotiana tabacum]
 emb|CAA88840.1| phosphoglycerate kinase (PGK) [Nicotiana tabacum]
Length=401

 Score =   265 bits (676),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG L  ADLKGK+VFVR DLNVPLD+   ITDDTRIRAA+PTIK+L+ +G+ VIL+S
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDENFNITDDTRIRAAVPTIKYLMQHGSHVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  A+D IGPEVEKLVA +P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVKIANDSIGPEVEKLVAEIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKNEPEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_008805982.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
 ref|XP_008776888.1| PREDICTED: phosphoglycerate kinase, cytosolic [Phoenix dactylifera]
Length=400

 Score =   264 bits (674),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SV  L  ADLKGK+VFVR DLNVPLDD+  ITDD RIRAA+PTIK+L+ +GA+VILSS
Sbjct  4    KRSVSTLKEADLKGKRVFVRVDLNVPLDDSLNITDDNRIRAAVPTIKYLMDHGARVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ V  A+DCIG EVEK+VA+LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVSVEMANDCIGEEVEKMVAALPNGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|NP_001172606.1| Os01g0800266 [Oryza sativa Japonica Group]
 dbj|BAH91336.1| Os01g0800266 [Oryza sativa Japonica Group]
Length=385

 Score =   263 bits (671),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 156/186 (84%), Gaps = 2/186 (1%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASAKPV--RGVVSMAKKSVGDLTAADLKGKKVFV  541
            RSLGFAA   DP  + HV+++ R+  ASA     R V +MAKKSVGDL AADL+GK+V +
Sbjct  33   RSLGFAARGTDPRLAIHVSSRRRAASASAGSRLARAVATMAKKSVGDLAAADLEGKRVLL  92

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVP  721
            RADLNVPLD +Q ITDDTR+ AAIPTIKHLI NGAKVIL SHLGRPKG+TPK+SLAPLVP
Sbjct  93   RADLNVPLDASQNITDDTRVIAAIPTIKHLIGNGAKVILCSHLGRPKGITPKFSLAPLVP  152

Query  722  RLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLA  901
            RLSELLGIQV KADD IGPEVEK V+ LP+G VLLLENVRFYKEEEKN+PEFAKKLASLA
Sbjct  153  RLSELLGIQVQKADDVIGPEVEKSVSVLPNGSVLLLENVRFYKEEEKNDPEFAKKLASLA  212

Query  902  DLFVND  919
            DL+  D
Sbjct  213  DLYELD  218



>ref|XP_003546821.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Glycine max]
 gb|KHN48876.1| Phosphoglycerate kinase, cytosolic [Glycine soja]
Length=401

 Score =   263 bits (672),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L   DLKGK+VFVR DLNVPLDD   ITDDTR+RAA+PTIK+L   GAKVILSS
Sbjct  4    KRSVGTLKEGDLKGKRVFVRVDLNVPLDDNLNITDDTRVRAAVPTIKYLTGYGAKVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLS+LLGI+V  A+D IG EVEKLV  LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSQLLGIEVTMANDSIGEEVEKLVTQLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_002312237.1| hypothetical protein POPTR_0008s08400g [Populus trichocarpa]
 gb|EEE89604.1| hypothetical protein POPTR_0008s08400g [Populus trichocarpa]
Length=401

 Score =   263 bits (672),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSV  L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+S+GA+VILSS
Sbjct  4    KKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMSHGARVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ V  A+DCIG EVEK+VA +P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVDVKMANDCIGVEVEKIVAEIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLA+++VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLAEIYVNDAFGTAHRAHA  158



>gb|ABK92531.1| unknown [Populus trichocarpa]
Length=401

 Score =   263 bits (671),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSV  L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+S+GA+VILSS
Sbjct  4    KKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMSHGARVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ V  A+DCIG EVEK+VA +P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVDVKMANDCIGVEVEKIVAEIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLA+++VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLAEIYVNDAFGTAHRAHA  158



>ref|XP_008226131.1| PREDICTED: phosphoglycerate kinase, cytosolic [Prunus mume]
Length=401

 Score =   263 bits (671),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SV  L  A+LKGK+VFVR DLNVPLDD  KITDDTR+RAA+PTIK+L  +GAKVIL+S
Sbjct  4    KRSVSTLKEAELKGKRVFVRVDLNVPLDDNSKITDDTRVRAAVPTIKYLQGHGAKVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  A+DCIG EVEKLVA LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVKIANDCIGEEVEKLVAQLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEF+KKLASLAD++VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFSKKLASLADVYVNDAFGTAHRAHA  158



>gb|KCW71391.1| hypothetical protein EUGRSUZ_F04463 [Eucalyptus grandis]
Length=378

 Score =   262 bits (669),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTR+RAA+PTIK+L+S+GA VIL+S
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDSFHITDDTRVRAAVPTIKYLMSHGAIVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  A+DCIG EV KLVA  P+GGV+LLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVVKLVAETPEGGVILLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_010064085.1| PREDICTED: phosphoglycerate kinase, cytosolic [Eucalyptus grandis]
 gb|KCW71390.1| hypothetical protein EUGRSUZ_F04463 [Eucalyptus grandis]
Length=401

 Score =   263 bits (671),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 126/155 (81%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG L  ADLKGK+VFVR DLNVPLDD+  ITDDTR+RAA+PTIK+L+S+GA VIL+S
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDSFHITDDTRVRAAVPTIKYLMSHGAIVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  A+DCIG EV KLVA  P+GGV+LLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVVKLVAETPEGGVILLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_007213914.1| hypothetical protein PRUPE_ppa005669mg [Prunus persica]
 gb|EMJ15113.1| hypothetical protein PRUPE_ppa005669mg [Prunus persica]
Length=449

 Score =   264 bits (675),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 131/181 (72%), Positives = 149/181 (82%), Gaps = 4/181 (2%)
 Frame = +2

Query  407  FSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKIT  586
             +HH+ + L      A  V       K+SV  L  A+LKGK+VFVR DLNVPLDD  KIT
Sbjct  30   ITHHIFSDLCHCTFFAVTVMAT----KRSVSTLKEAELKGKRVFVRVDLNVPLDDNSKIT  85

Query  587  DDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADD  766
            DDTR+RAA+PTIK+L  +GAKVIL+SHLGRPKGVTPKYSL PLVPRLSELLG++V  A+D
Sbjct  86   DDTRVRAAVPTIKYLQGHGAKVILASHLGRPKGVTPKYSLKPLVPRLSELLGVEVKIAND  145

Query  767  CIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAH  946
            CIG EVEKLVA LPDGGVLLLENVRFYKEEEKN+PEF+KKLASLAD++VNDAFGTAHRAH
Sbjct  146  CIGEEVEKLVAQLPDGGVLLLENVRFYKEEEKNDPEFSKKLASLADVYVNDAFGTAHRAH  205

Query  947  A  949
            A
Sbjct  206  A  206



>ref|XP_009106677.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brassica rapa]
 ref|XP_009106678.1| PREDICTED: phosphoglycerate kinase, cytosolic [Brassica rapa]
Length=401

 Score =   262 bits (670),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAAIPTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAIPTIKYLMENGSRVVLCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPK+SL PLVPRLSELLG++VV A+D IG EV+KLVA LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKFSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLA+LAD++VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHA  158



>gb|EEE55536.1| hypothetical protein OsJ_03768 [Oryza sativa Japonica Group]
Length=429

 Score =   263 bits (672),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 139/186 (75%), Positives = 156/186 (84%), Gaps = 2/186 (1%)
 Frame = +2

Query  368  RSLGFAAAAADPFFSHHVATQLRSLKASAKPV--RGVVSMAKKSVGDLTAADLKGKKVFV  541
            RSLGFAA   DP  + HV+++ R+  ASA     R V +MAKKSVGDL AADL+GK+V +
Sbjct  77   RSLGFAARGTDPRLAIHVSSRRRAASASAGSRLARAVATMAKKSVGDLAAADLEGKRVLL  136

Query  542  RADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVP  721
            RADLNVPLD +Q ITDDTR+ AAIPTIKHLI NGAKVIL SHLGRPKG+TPK+SLAPLVP
Sbjct  137  RADLNVPLDASQNITDDTRVIAAIPTIKHLIGNGAKVILCSHLGRPKGITPKFSLAPLVP  196

Query  722  RLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLA  901
            RLSELLGIQV KADD IGPEVEK V+ LP+G VLLLENVRFYKEEEKN+PEFAKKLASLA
Sbjct  197  RLSELLGIQVQKADDVIGPEVEKSVSVLPNGSVLLLENVRFYKEEEKNDPEFAKKLASLA  256

Query  902  DLFVND  919
            DL+  D
Sbjct  257  DLYELD  262



>ref|XP_006422250.1| hypothetical protein CICLE_v10005101mg [Citrus clementina]
 ref|XP_006493790.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Citrus sinensis]
 gb|ESR35490.1| hypothetical protein CICLE_v10005101mg [Citrus clementina]
Length=401

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  482  AKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILS  661
            AKKSV  L  ADLKGK+VFVR DLNVPLDD   ITDD R+RAA+PTIK+L+ +GAKVILS
Sbjct  3    AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILS  62

Query  662  SHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVR  841
            SHLGRPKGVTPKYSL PLVPRLSELLG++V  A+DCIG EVEK+VA +P+GGVLLLENVR
Sbjct  63   SHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVR  122

Query  842  FYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            F+KEEEKN+PEFAKKLASLADL+VNDAFG+AHRAHA
Sbjct  123  FHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHA  158



>gb|KDO61597.1| hypothetical protein CISIN_1g040813mg [Citrus sinensis]
Length=401

 Score =   262 bits (669),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/156 (80%), Positives = 141/156 (90%), Gaps = 0/156 (0%)
 Frame = +2

Query  482  AKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILS  661
            AKKSV  L  ADLKGK+VFVR DLNVPLDD   ITDD R+RAA+PTIK+L+ +GAKVILS
Sbjct  3    AKKSVSVLKEADLKGKRVFVRVDLNVPLDDNLNITDDNRVRAAVPTIKYLMGHGAKVILS  62

Query  662  SHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVR  841
            SHLGRPKGVTPKYSL PLVPRLSELLG++V  A+DCIG EVEK+VA +P+GGVLLLENVR
Sbjct  63   SHLGRPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKMVAEIPEGGVLLLENVR  122

Query  842  FYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            F+KEEEKN+PEFAKKLASLADL+VNDAFG+AHRAHA
Sbjct  123  FHKEEEKNDPEFAKKLASLADLYVNDAFGSAHRAHA  158



>emb|CDY70232.1| BnaC02g46710D [Brassica napus]
Length=401

 Score =   262 bits (669),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPK+SL PLVPRLSELLG++VV A+D IG EV+KLVA LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKFSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLA+LAD++VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHA  158



>ref|XP_006300323.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 ref|XP_006300324.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 gb|EOA33221.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
 gb|EOA33222.1| hypothetical protein CARUB_v10020404mg [Capsella rubella]
Length=401

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++VV A+D IG EV+KLVA+LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAALPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            Y EEEKN+PEFAKKLA+LAD++VNDAFGTAHRAHA
Sbjct  124  YTEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHA  158



>emb|CDX87375.1| BnaA07g34980D [Brassica napus]
Length=401

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPK+SL PLVPRLSELLG++VV A+D IG EV+KLVA LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKFSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLA+LAD++VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHA  158



>gb|AAO63774.1| 3-phosphoglycerate kinase [Populus tremuloides]
Length=401

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSV  L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +GA+VILSS
Sbjct  4    KKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGARVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ V  A+DCIG EVEK+VA +P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVDVKMANDCIGVEVEKIVAEIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLA+++VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLAEIYVNDAFGTAHRAHA  158



>ref|XP_009128369.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Brassica 
rapa]
Length=401

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPK+SL PLVPRLSELLG++VV A+D IG EV+KLVA LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKFSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLA+LAD++VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHA  158



>gb|AAM61185.1| phosphoglycerate kinase, putative [Arabidopsis thaliana]
Length=401

 Score =   261 bits (667),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++VV A+D IG EV+KLVA LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            Y EEEKN+PEFAKKLA+LAD++VNDAFGTAHRAHA
Sbjct  124  YAEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHA  158



>ref|XP_002889253.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65512.1| hypothetical protein ARALYDRAFT_477124 [Arabidopsis lyrata subsp. 
lyrata]
Length=401

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++VV A+D IG EV+KLVA LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            Y EEEKN+PEFAKKLA+LAD++VNDAFGTAHRAHA
Sbjct  124  YAEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHA  158



>ref|NP_178073.1| phosphoglycerate kinase [Arabidopsis thaliana]
 ref|NP_849907.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAD30221.1|AC007202_3 Is a member of the PF|00162 Phosphoglycerate kinase family. ESTs 
gb|N38721, gb|T22178, gb|R90345, gb|R90715, gb|T21140, gb|T46295, 
gb|H37082, gb|T46076, gb|N37132, gb|AA597649, gb|AI100648 
and gb|Z48462 come from this gene [Arabidopsis thaliana]
 gb|AAF70260.1|AF247560_1 cytosolic phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAK15553.1|AF348582_1 putative phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AAL32941.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP37845.1| At1g79550 [Arabidopsis thaliana]
 gb|AEE36262.1| phosphoglycerate kinase [Arabidopsis thaliana]
 gb|AEE36263.1| phosphoglycerate kinase [Arabidopsis thaliana]
Length=401

 Score =   261 bits (667),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++VV A+D IG EV+KLVA LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            Y EEEKN+PEFAKKLA+LAD++VNDAFGTAHRAHA
Sbjct  124  YAEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHA  158



>ref|XP_003596093.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66344.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=401

 Score =   261 bits (666),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 127/155 (82%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L   +LKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L   GAKVILSS
Sbjct  4    KRSVGTLKEGELKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLTGYGAKVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELL  QV  +DDCIG EVEKLVA +P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLETQVKISDDCIGEEVEKLVAQIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            +KEEEKNEPEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  HKEEEKNEPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_003596092.1| Phosphoglycerate kinase [Medicago truncatula]
 gb|AES66343.1| phosphoglycerate kinase-like protein [Medicago truncatula]
Length=401

 Score =   261 bits (666),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  A+LKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L   GAKVILSS
Sbjct  4    KRSVGTLKEAELKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLTGYGAKVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG QV  ADD IG EVEKLVA +P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGTQVKIADDSIGEEVEKLVAQIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            +KEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  HKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>gb|AFK46712.1| unknown [Medicago truncatula]
Length=401

 Score =   261 bits (666),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  A+LKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L   GAKVILSS
Sbjct  4    KRSVGTLKEAELKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLTGYGAKVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG QV  ADD IG EVEKLVA +P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGTQVKIADDSIGEEVEKLVAQIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            +KEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  HKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_006389877.1| hypothetical protein EUTSA_v10018657mg [Eutrema salsugineum]
 gb|ESQ27163.1| hypothetical protein EUTSA_v10018657mg [Eutrema salsugineum]
Length=401

 Score =   261 bits (666),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPK+SL PLVPRLSELLG++VV A+D +G EV+KLVA LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKFSLKPLVPRLSELLGVEVVMANDTVGEEVQKLVAGLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLA+LAD++VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHA  158



>dbj|BAA33801.1| cytosolic phosphoglycerate kinase 1 [Populus nigra]
Length=401

 Score =   260 bits (665),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSV  L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +GA+VILSS
Sbjct  4    KKSVSSLKEADLKGKSVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGARVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ V  A+DCIG EVEK+VA +P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVDVKMANDCIGVEVEKIVAEIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLA+++VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLAEIYVNDAFGTAHRAHA  158



>ref|XP_010417621.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
 ref|XP_010429848.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
 ref|XP_010429849.1| PREDICTED: phosphoglycerate kinase, cytosolic [Camelina sativa]
Length=401

 Score =   260 bits (665),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLS+LLG++VV A+D IG EV+KLVA LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSQLLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            Y EEEKN+PEFAKKLA+LAD++VNDAFGTAHRAHA
Sbjct  124  YAEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHA  158



>ref|XP_010472814.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Camelina 
sativa]
Length=401

 Score =   259 bits (663),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTIKYLMGNGSRVVLCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLS+LLG++VV A+D IG EV+KLVA LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSQLLGVEVVMANDSIGEEVQKLVAGLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            Y EEEKN+PEFAKKLA+LAD++VNDAFGTAHRAHA
Sbjct  124  YAEEEKNDPEFAKKLAALADVYVNDAFGTAHRAHA  158



>gb|AAF85975.1|AF275639_1 cytosolic phosphoglycerate kinase [Pisum sativum]
Length=401

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAAIPTIK+L   GAKVILSS
Sbjct  4    KRSVGTLKEADLKGKRVFVRVDLNVPLDDNLNITDDTRIRAAIPTIKYLTGYGAKVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG +V  A D IG EVEKLVA +P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGSEVTIAGDSIGEEVEKLVAQIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            +KEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  HKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_012087351.1| PREDICTED: phosphoglycerate kinase, cytosolic [Jatropha curcas]
 gb|KDP25066.1| hypothetical protein JCGZ_22601 [Jatropha curcas]
Length=401

 Score =   259 bits (663),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/155 (81%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSV  L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L  +GA+VIL++
Sbjct  4    KKSVSSLKEADLKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLRDHGARVILAT  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLGI+V  A+DCIG EVEKLVA +P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGIEVKMANDCIGEEVEKLVAEIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            +KEEEKN+PEFAKKLASLAD++VNDAFGTAHRAHA
Sbjct  124  HKEEEKNDPEFAKKLASLADVYVNDAFGTAHRAHA  158



>gb|EPS64076.1| phosphoglycerate kinase [Genlisea aurea]
Length=401

 Score =   259 bits (662),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG L  ADLKGK+V VR DLNVPLDD   ITDDTRIRAA+PTI +LI +GA+VIL++
Sbjct  4    KKSVGSLKEADLKGKRVLVRVDLNVPLDDNFNITDDTRIRAAVPTINYLIGHGARVILTT  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PL+PRLS+LLG++V   +DCIG EVEK+VA LPDGGV+LLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLIPRLSQLLGVEVAITNDCIGEEVEKVVAELPDGGVVLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            +KEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  HKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>ref|XP_002513352.1| phosphoglycerate kinase, putative [Ricinus communis]
 gb|EEF48755.1| phosphoglycerate kinase, putative [Ricinus communis]
Length=401

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSV  L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +GA+VIL +
Sbjct  4    KKSVSSLKEADLKGKRVFVRVDLNVPLDDNLNITDDTRIRAAVPTIKYLMDHGARVILCT  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  A DCIG EVEKLVA +P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVKMASDCIGEEVEKLVAEIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            +KEEEKNEPEFAKKLA LAD++VNDAFGTAHRAHA
Sbjct  124  HKEEEKNEPEFAKKLAGLADVYVNDAFGTAHRAHA  158



>ref|XP_009104523.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Brassica 
rapa]
Length=401

 Score =   259 bits (661),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  ADLKGK VFVR DLNVPLDD   ITDDTRIRAA+PT+K+L+ NG++V+L S
Sbjct  4    KRSVGTLKEADLKGKSVFVRVDLNVPLDDNSNITDDTRIRAAVPTVKYLMENGSRVVLCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPK+SL PLVPRLSELLGI+VV A+D IG EV+KLVA LP+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKFSLKPLVPRLSELLGIEVVMANDSIGEEVQKLVAGLPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEE KN+PEFAKKLA+LAD++VNDAFGTAHRAHA
Sbjct  124  YKEEAKNDPEFAKKLAALADVYVNDAFGTAHRAHA  158



>dbj|BAJ85222.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   258 bits (660),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L   DL GKKV +RADLNVPLDD Q+I DD RIRA++PTIK L+  GAKV+L+S
Sbjct  4    KRSVGTLGDKDLGGKKVLLRADLNVPLDDGQRIADDNRIRASVPTIKFLMGKGAKVVLAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ VV A+DCIG EVE L A+LPDGGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVENLAAALPDGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHA  158



>ref|XP_011016588.1| PREDICTED: phosphoglycerate kinase, cytosolic [Populus euphratica]
Length=401

 Score =   258 bits (658),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSV  L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +GA+VILSS
Sbjct  4    KKSVSSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMGHGARVILSS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ V  A+DCIG EV K+VA +P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVDVKMANDCIGVEVVKIVAEIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLA+++VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLAEIYVNDAFGTAHRAHA  158



>gb|EMT08517.1| Phosphoglycerate kinase, cytosolic [Aegilops tauschii]
Length=401

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L   DL GK+V +RADLNVPLDD Q+I DD RIRA++PTIK L+  GA+V+L+S
Sbjct  4    KRSVGTLGDKDLSGKRVLLRADLNVPLDDGQRIADDNRIRASVPTIKFLMGKGARVVLAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ VV A+DCIG EVEKL  +LPDGGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLATALPDGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHA  158



>ref|XP_009384174.1| PREDICTED: phosphoglycerate kinase, cytosolic [Musa acuminata 
subsp. malaccensis]
Length=401

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 119/155 (77%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVGDL  AD+KGK+VFVR DLNVPLD+  K+TDDTRIRA +PTIK+L+  GA++IL+S
Sbjct  4    KRSVGDLKEADVKGKRVFVRVDLNVPLDENLKVTDDTRIRATVPTIKYLMERGARIILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL P+VPRLSELLG+ V  A+D IG EVEK +A+LP+GG++LLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPVVPRLSELLGVNVEMANDSIGEEVEKSIAALPNGGIVLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADLYVNDAFGTAHRAHA  158



>gb|EMS52006.1| Phosphoglycerate kinase, cytosolic [Triticum urartu]
Length=520

 Score =   260 bits (664),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L   DL GKKV +RADLNVPLDD Q+I DD RIRA++PTIK L+  GA+V+L+S
Sbjct  47   KRSVGTLGDKDLSGKKVLLRADLNVPLDDGQRIADDNRIRASVPTIKFLMGKGARVVLAS  106

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ VV A+DCIG EVEKL A+LPDGGVLLLENVRF
Sbjct  107  HLGRPKGVTPKYSLKPLVPRLSELLGVDVVMANDCIGEEVEKLAAALPDGGVLLLENVRF  166

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  167  YKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHA  201



>ref|XP_002315067.1| cytosolic phosphoglycerate kinase family protein [Populus trichocarpa]
 gb|EEF01238.1| cytosolic phosphoglycerate kinase family protein [Populus trichocarpa]
Length=401

 Score =   256 bits (653),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSV  L   DLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +GA+VIL S
Sbjct  4    KKSVSSLKETDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMDHGARVILCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  A+DCIG EVEKLVA +P GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVKIANDCIGEEVEKLVAEIPGGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            +KEEEKN+PEFAKKLASLA+++VNDAFGTAHRAHA
Sbjct  124  HKEEEKNDPEFAKKLASLAEVYVNDAFGTAHRAHA  158



>ref|XP_010537804.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
 ref|XP_010537805.1| PREDICTED: phosphoglycerate kinase, cytosolic [Tarenaya hassleriana]
Length=401

 Score =   255 bits (652),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 136/153 (89%), Gaps = 0/153 (0%)
 Frame = +2

Query  491  SVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHL  670
            SV  L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+SNGA+VIL SHL
Sbjct  6    SVSTLKEADLKGKRVFVRVDLNVPLDDHSNITDDTRIRAAVPTIKYLMSNGARVILCSHL  65

Query  671  GRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYK  850
            GRPKGVTPKYSL PLVPRLSELLG++V  A+D IG EVE LVA L +GGVLLLENVRFYK
Sbjct  66   GRPKGVTPKYSLKPLVPRLSELLGVEVKMANDSIGEEVETLVAGLSEGGVLLLENVRFYK  125

Query  851  EEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            EEEKN+PEFAKKLA+LAD++VNDAFGTAHRAHA
Sbjct  126  EEEKNDPEFAKKLAALADVYVNDAFGTAHRAHA  158



>gb|AGL76992.1| phosphoglycerate kinase, partial [Anisodus luridus]
Length=361

 Score =   254 bits (648),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  521  KGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKY  700
            KGK+VFVR DLNVPLDD   ITDDTRIRAA+PTI +L+ NGA+VIL+SHLGRPKGVTPKY
Sbjct  1    KGKRVFVRVDLNVPLDDNFNITDDTRIRAALPTINYLMQNGARVILASHLGRPKGVTPKY  60

Query  701  SLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFA  880
            SL PLVPRLSELLG++V  A+D +GPEVEKLVA LP+GGVLLLENVRFYKEEEKNEPEFA
Sbjct  61   SLKPLVPRLSELLGLEVKMANDSVGPEVEKLVAELPEGGVLLLENVRFYKEEEKNEPEFA  120

Query  881  KKLASLADLFVNDAFGTAHRAHA  949
            KKLASLADL+VNDAFGTAHRAHA
Sbjct  121  KKLASLADLYVNDAFGTAHRAHA  143



>dbj|BAJ88371.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=382

 Score =   254 bits (649),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 131/139 (94%), Gaps = 0/139 (0%)
 Frame = +2

Query  533  VFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAP  712
            VFVRADLNVPLDD QKITDDTRIRA+IPTIK+L+  GAKVIL+SHLGRPKGVTPK+SL P
Sbjct  1    VFVRADLNVPLDDAQKITDDTRIRASIPTIKYLLEKGAKVILASHLGRPKGVTPKFSLKP  60

Query  713  LVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLA  892
            LVPRLSELLG++VV A DCIG EVEKL A+LPDGGVLLLENVRFYKEEEKNEPEFAKKLA
Sbjct  61   LVPRLSELLGLEVVMAPDCIGQEVEKLAAALPDGGVLLLENVRFYKEEEKNEPEFAKKLA  120

Query  893  SLADLFVNDAFGTAHRAHA  949
            S+ADL+VNDAFGTAHRAHA
Sbjct  121  SVADLYVNDAFGTAHRAHA  139



>ref|XP_011013882.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X2 
[Populus euphratica]
Length=401

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSV  L   DLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +GA+VIL S
Sbjct  4    KKSVSSLKETDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMDHGARVILCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  A+DCIG EVEKLVA +P GG LLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVKIANDCIGEEVEKLVAEIPGGGALLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            +KEEEKN+PEFAKKLASLA+++VNDAFGTAHRAHA
Sbjct  124  HKEEEKNDPEFAKKLASLAEVYVNDAFGTAHRAHA  158



>dbj|BAA33802.1| cytosolic phosphoglycerate kinase 1 [Populus nigra]
Length=401

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 138/155 (89%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSV  L   DLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PT+K+L+ +GA+VIL S
Sbjct  4    KKSVSSLKETDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTVKYLMDHGARVILCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  A+DCIG EVEKLVA +P GGV+LLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVKIANDCIGEEVEKLVAEIPGGGVVLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            +KEEEKN+PEFAKKLASLA+++VNDAFGTAHRAHA
Sbjct  124  HKEEEKNDPEFAKKLASLAEVYVNDAFGTAHRAHA  158



>ref|XP_010094705.1| Phosphoglycerate kinase [Morus notabilis]
 gb|EXB56751.1| Phosphoglycerate kinase [Morus notabilis]
Length=401

 Score =   253 bits (647),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 136/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SVG L  A+LKGK+VFVR DLNVPLDD   ITDDTRIR A+PTI++LI  GAKVIL S
Sbjct  4    KRSVGTLKEAELKGKRVFVRVDLNVPLDDNLNITDDTRIRGALPTIQYLIGYGAKVILCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG +V  A DCIG EVEKLVA LP+GGVLLLEN RF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGFEVKIAPDCIGEEVEKLVAELPEGGVLLLENARF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            +KEEEKN+PEFAKKLASLA+++VNDAFGTAHRAHA
Sbjct  124  HKEEEKNDPEFAKKLASLAEVYVNDAFGTAHRAHA  158



>ref|XP_011013868.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Populus euphratica]
 ref|XP_011013875.1| PREDICTED: phosphoglycerate kinase, cytosolic-like isoform X1 
[Populus euphratica]
Length=429

 Score =   254 bits (649),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 137/155 (88%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSV  L   DLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +GA+VIL S
Sbjct  4    KKSVSSLKETDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMDHGARVILCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG++V  A+DCIG EVEKLVA +P GG LLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGVEVKIANDCIGEEVEKLVAEIPGGGALLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            +KEEEKN+PEFAKKLASLA+++VNDAFGTAHRAHA
Sbjct  124  HKEEEKNDPEFAKKLASLAEVYVNDAFGTAHRAHA  158



>gb|AGH55660.1| phosphoglycerate kinase, partial [Atropa belladonna]
Length=363

 Score =   252 bits (644),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  521  KGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKY  700
            KGK+VFVR DLNVPLDD   ITDDTRIRAAIPTI +L+ NGA+VIL+SHLGRPKGVTPKY
Sbjct  1    KGKRVFVRVDLNVPLDDNFNITDDTRIRAAIPTIXYLMQNGARVILASHLGRPKGVTPKY  60

Query  701  SLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFA  880
            SL PL PRLSELLG++V  A+D +GPEVEKLVA LP+GGVLL+ENVRFYKEEEKNEPEFA
Sbjct  61   SLKPLAPRLSELLGLEVKMANDSVGPEVEKLVAELPEGGVLLMENVRFYKEEEKNEPEFA  120

Query  881  KKLASLADLFVNDAFGTAHRAHA  949
            KKLASLADL+VNDAFGTAHRAHA
Sbjct  121  KKLASLADLYVNDAFGTAHRAHA  143



>ref|XP_010669985.1| PREDICTED: phosphoglycerate kinase, cytosolic [Beta vulgaris 
subsp. vulgaris]
Length=401

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 123/155 (79%), Positives = 135/155 (87%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            K+SV  L  +DLKGK+VFVR DLNVPLDD   ITDDTRIRAAIPTIK+L   GAKVIL S
Sbjct  4    KRSVSTLQESDLKGKRVFVRVDLNVPLDDNCNITDDTRIRAAIPTIKYLSGYGAKVILCS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPK+SL PLVPRLSELLG +V  A D IG EVEK+VA LP+GGV+LLENVRF
Sbjct  64   HLGRPKGVTPKFSLKPLVPRLSELLGCEVKMAKDSIGEEVEKMVAELPEGGVVLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKN+PEFAKKLASLAD++VNDAFGTAHRAHA
Sbjct  124  YKEEEKNDPEFAKKLASLADVYVNDAFGTAHRAHA  158



>gb|ABB86242.1| phosphoglycerate kinase-like [Solanum tuberosum]
Length=402

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 136/156 (87%), Gaps = 1/156 (1%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG L  ADLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ NGA+VIL+S
Sbjct  4    KKSVGSLKEADLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMQNGARVILAS  63

Query  665  HLGRPKG-VTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVR  841
            HLGRPKG V PK  L P VPRLSELLGI+V  A+D IGPEVE LVA LP+GGV+LLENVR
Sbjct  64   HLGRPKGLVHPKVQLKPFVPRLSELLGIEVKMANDSIGPEVENLVAELPEGGVVLLENVR  123

Query  842  FYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            FYKEEEKN+ EFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  FYKEEEKNDLEFAKKLASLADLYVNDAFGTAHRAHA  159



>ref|XP_009618219.1| PREDICTED: phosphoglycerate kinase, cytosolic-like [Nicotiana 
tomentosiformis]
Length=401

 Score =   244 bits (624),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            KKSVG L   DLKGK+VFVR DLNVPLDD   ITDDTRIRAA+PTIK+L+ +G++VIL+S
Sbjct  4    KKSVGSLKEGDLKGKRVFVRVDLNVPLDDNFNITDDTRIRAAVPTIKYLMQHGSRVILAS  63

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLGRPKGVTPKYSL PLVPRLSELLG+ V  ADDCIGPEVEKLVA +P+GGVLLLENVRF
Sbjct  64   HLGRPKGVTPKYSLKPLVPRLSELLGLDVKMADDCIGPEVEKLVAEIPEGGVLLLENVRF  123

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YKEEEKNE EFAKKLASLADL+VNDAFGTAHRAHA
Sbjct  124  YKEEEKNEFEFAKKLASLADLYVNDAFGTAHRAHA  158



>emb|CDP13575.1| unnamed protein product [Coffea canephora]
Length=947

 Score =   255 bits (652),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 138/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  482  AKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILS  661
            A++S+G L   DLKGK+VFVR DLNVPLDD   ITDD RIRAA+PTI +LI+ GAKVIL+
Sbjct  3    AQRSMGSLKEPDLKGKRVFVRVDLNVPLDDNFNITDDARIRAAVPTINYLIAYGAKVILA  62

Query  662  SHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVR  841
            SHLG PKGVTPKYSL PLVPRLSELLG++V  A+DCIG EVEKLVASLP+GGVLLLENVR
Sbjct  63   SHLGCPKGVTPKYSLKPLVPRLSELLGVEVKMANDCIGEEVEKLVASLPEGGVLLLENVR  122

Query  842  FYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            FYKEE+KN+PEFAKKLASLADL+VND  GTAHRAHA
Sbjct  123  FYKEEDKNDPEFAKKLASLADLYVNDVSGTAHRAHA  158



>gb|AAT07576.1| putative chloroplast phosphoglycerate kinase [Oryza sativa Japonica 
Group]
Length=310

 Score =   238 bits (608),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 130/197 (66%), Positives = 149/197 (76%), Gaps = 28/197 (14%)
 Frame = +2

Query  362  PLRSLGFAAAAADPFFSHHVATQLR-SLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVF  538
            P RSL   AAAADP  + HVA++ R +  +S++  R V +MAKKSVGDLTAADL+GK+VF
Sbjct  88   PARSL-AFAAAADPRLATHVASRCRQAASSSSRGTRAVATMAKKSVGDLTAADLEGKRVF  146

Query  539  VRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLV  718
            VRADLNVPLDD Q ITDDTR+RAAIPTI++LI NGAKVILSSHL                
Sbjct  147  VRADLNVPLDDNQNITDDTRVRAAIPTIQYLIKNGAKVILSSHL----------------  190

Query  719  PRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASL  898
                      V KA+D IGP+VEKLV+ LP+G VLLLENVRFYKEEEKN+PEFAKKLASL
Sbjct  191  ----------VTKAEDVIGPDVEKLVSELPNGSVLLLENVRFYKEEEKNDPEFAKKLASL  240

Query  899  ADLFVNDAFGTAHRAHA  949
            ADL+VNDAFGTAHRAHA
Sbjct  241  ADLYVNDAFGTAHRAHA  257



>ref|XP_001699523.1| phosphoglycerate kinase [Chlamydomonas reinhardtii]
 gb|EDO98586.1| phosphoglycerate kinase [Chlamydomonas reinhardtii]
Length=462

 Score =   241 bits (614),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 126/183 (69%), Positives = 145/183 (79%), Gaps = 6/183 (3%)
 Frame = +2

Query  407  FSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDD-TQKI  583
            F+  V+  +R +  S    R VV   KKSVGDL  ADL+GK+VFVRADLNVPLD  T  I
Sbjct  41   FAAEVSVDIRRVGRS----RIVVEAVKKSVGDLHKADLEGKRVFVRADLNVPLDKATLAI  96

Query  584  TDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGV-TPKYSLAPLVPRLSELLGIQVVKA  760
            TDDTRIRAA+PT+K+L+ NGAKV+L+SHLGRPKG    KY L P+V RLSELLG  V K 
Sbjct  97   TDDTRIRAAVPTLKYLLDNGAKVLLTSHLGRPKGGPEDKYRLTPVVARLSELLGKPVTKV  156

Query  761  DDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHR  940
            DDCIGPEVEK V ++ +G +LLLENVRFYKEEEKNEPEFAKKLA+ ADL+VNDAFGTAHR
Sbjct  157  DDCIGPEVEKAVGAMKNGELLLLENVRFYKEEEKNEPEFAKKLAANADLYVNDAFGTAHR  216

Query  941  AHA  949
            AHA
Sbjct  217  AHA  219



>ref|XP_002951648.1| phosphoglycerate kinase [Volvox carteri f. nagariensis]
 sp|Q9SBN4.1|PGKH_VOLCA RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Volvox carteri]
 gb|AAD55564.1|AF110782_1 phosphoglycerate kinase precursor [Volvox carteri f. nagariensis]
 gb|EFJ47459.1| phosphoglycerate kinase [Volvox carteri f. nagariensis]
Length=462

 Score =   239 bits (611),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 127/183 (69%), Positives = 144/183 (79%), Gaps = 6/183 (3%)
 Frame = +2

Query  407  FSHHVATQLRSLKASAKPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDD-TQKI  583
            F+  V+  +R    S    R VV   KKSVGDL  ADL+GK+VFVRADLNVPLD  T  I
Sbjct  41   FAPEVSIDIRRAGRS----RIVVEAVKKSVGDLGKADLEGKRVFVRADLNVPLDKKTLAI  96

Query  584  TDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGV-TPKYSLAPLVPRLSELLGIQVVKA  760
            TDDTRIRAA+PT+K+L+ NGAKV+L+SHLGRPKG    KY L P+V RLSELLG +V K 
Sbjct  97   TDDTRIRAAVPTLKYLLDNGAKVLLTSHLGRPKGGPEDKYRLTPVVARLSELLGKEVKKV  156

Query  761  DDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHR  940
            DDCIGP VE+ VASL  G +LLLENVRFYKEEEKN+PEFAKKLAS ADL+VNDAFGTAHR
Sbjct  157  DDCIGPSVEQAVASLKSGELLLLENVRFYKEEEKNDPEFAKKLASNADLYVNDAFGTAHR  216

Query  941  AHA  949
            AHA
Sbjct  217  AHA  219



>gb|KIY97385.1| phosphoglycerate kinase [Monoraphidium neglectum]
Length=229

 Score =   231 bits (589),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 136/167 (81%), Gaps = 2/167 (1%)
 Frame = +2

Query  455  KPVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLD-DTQKITDDTRIRAAIPTIKHL  631
            +P + VV  AKKSVGDLT  DL+GK+VFVRADLNVPLD  T  ITDDTRIRAA+PT+K+L
Sbjct  26   RPRKLVVLSAKKSVGDLTKDDLEGKRVFVRADLNVPLDKQTLAITDDTRIRAAVPTLKYL  85

Query  632  ISNGAKVILSSHLGRPK-GVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLP  808
            + NGAKV+L+SHLGRPK G   K+ L P+ PRLSELLG  V K DDCIG EVEK V    
Sbjct  86   LDNGAKVLLTSHLGRPKSGPEDKFRLTPVAPRLSELLGKPVTKLDDCIGAEVEKAVVDAK  145

Query  809  DGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            +G +LLLENVRFYKEEEKNE EFAKKLA+ ADL+VNDAFGTAHRAHA
Sbjct  146  NGELLLLENVRFYKEEEKNEAEFAKKLAANADLYVNDAFGTAHRAHA  192



>sp|P41758.1|PGKH_CHLRE RecName: Full=Phosphoglycerate kinase, chloroplastic; Flags: 
Precursor [Chlamydomonas reinhardtii]
 gb|AAA70082.1| phosphoglycerate kinase precursor [Chlamydomonas reinhardtii]
 gb|AAQ14241.1| phosphoglycerate kinase [Chlamydomonas reinhardtii]
Length=461

 Score =   238 bits (606),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 125/177 (71%), Positives = 141/177 (80%), Gaps = 4/177 (2%)
 Frame = +2

Query  431  LRSLKASAK--PVRGVVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDD-TQKITDDTRI  601
            LR L  SA    +  VV   KKSVGDL  ADL+GK+VFVRADLNVPLD  T  ITDDTRI
Sbjct  42   LRCLWTSAAWAALASVVEAVKKSVGDLHKADLEGKRVFVRADLNVPLDKATLAITDDTRI  101

Query  602  RAAIPTIKHLISNGAKVILSSHLGRPKGV-TPKYSLAPLVPRLSELLGIQVVKADDCIGP  778
            RAA+PT+K+L+ NGAKV+L+SHLGRPKG    KY L P+V RLSELLG  V K DDCIGP
Sbjct  102  RAAVPTLKYLLDNGAKVLLTSHLGRPKGGPEDKYRLTPVVARLSELLGKPVTKVDDCIGP  161

Query  779  EVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            EVEK V ++ +G +LLLEN RFYKEEEKNEPEFAKKLA+ ADL+VNDAFGTAHRAHA
Sbjct  162  EVEKAVGAMKNGELLLLENCRFYKEEEKNEPEFAKKLAANADLYVNDAFGTAHRAHA  218



>ref|WP_015204810.1| phosphoglycerate kinase [Crinalium epipsammum]
 gb|AFZ14710.1| phosphoglycerate kinase [Crinalium epipsammum PCC 9333]
Length=400

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KKSV +L+A+DL GK+V VR D NVPLDD   ITDDTRIRAA+PTI+ L   GAKVIL
Sbjct  1    MSKKSVANLSASDLSGKRVLVRVDFNVPLDDAGNITDDTRIRAALPTIQDLTGKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGV  K  L P+  RLSELLG  V+K DDCIG EV   V ++ DG V LLENV
Sbjct  61   TSHFGRPKGVDDKLRLTPVAKRLSELLGQDVIKCDDCIGDEVTSSVGAMQDGQVALLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKN+PEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHA  157



>ref|XP_005791258.1| phosphoglycerate kinase, partial [Emiliania huxleyi CCMP1516]
 gb|EOD38829.1| phosphoglycerate kinase, partial [Emiliania huxleyi CCMP1516]
Length=269

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 137/178 (77%), Gaps = 7/178 (4%)
 Frame = +2

Query  434  RSLKASAKPVRGV-----VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTR  598
             +L   A P+R +     + MAKKSVGDL+ ADLKGKKV VR DLNVPLD  + ITDDTR
Sbjct  17   EALTIGAAPMRSISRSCNIEMAKKSVGDLSEADLKGKKVLVRCDLNVPLD-GKTITDDTR  75

Query  599  IRAAIPTIKHLISNGAKVILSSHLGRPK-GVTPKYSLAPLVPRLSELLGIQVVKADDCIG  775
            IRA++PT+K+L+  GAKV+LSSHLGRPK G   K+SL P+ PRLSELLG  VV A DCIG
Sbjct  76   IRASVPTVKYLVEKGAKVLLSSHLGRPKSGPEDKFSLGPVAPRLSELLGKDVVMAPDCIG  135

Query  776  PEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
              V++ V  + DG VLLLEN RFYKEEEKN PEFA+KLA+ ADLFVNDAFGTAHRAH 
Sbjct  136  DGVKECVDKMGDGDVLLLENTRFYKEEEKNVPEFAEKLAANADLFVNDAFGTAHRAHG  193



>dbj|BAJ87335.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=370

 Score =   229 bits (583),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/155 (75%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = +2

Query  485  KKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVILSS  664
            +KS+  L  ADLKGKKVFVRADL+VPLD+ Q ITDDTRIRA++PTIK LI  GAKVIL+S
Sbjct  4    EKSLRTLGDADLKGKKVFVRADLDVPLDNAQ-ITDDTRIRASVPTIKFLIKKGAKVILAS  62

Query  665  HLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENVRF  844
            HLG PKGVTPK+SL PLVPRL ELLG+ VV A+DCIG EVEKL A+LP+GGVLLLENVRF
Sbjct  63   HLGCPKGVTPKFSLKPLVPRLFELLGVDVVMANDCIGAEVEKLAAALPEGGVLLLENVRF  122

Query  845  YKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            YK E  N+ +FAKKLAS+ADL+VNDAFGT H  HA
Sbjct  123  YKGEVNNDLKFAKKLASVADLYVNDAFGTPHWHHA  157



>ref|WP_026719925.1| phosphoglycerate kinase [Fischerella sp. PCC 9431]
Length=400

 Score =   229 bits (585),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 129/157 (82%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KK++ +L+A DL GK+ FVR D NVP+DDT KITDDTRIRAA+PTI+ L+  GAKVIL
Sbjct  1    MSKKTLANLSATDLSGKRAFVRVDFNVPVDDTGKITDDTRIRAALPTIQDLVQKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGV  K  L P+  RLSELLG +VVK DDCIG +V   + +L +G VLLLENV
Sbjct  61   ASHFGRPKGVDEKLRLTPVAKRLSELLGQEVVKTDDCIGDDVAAKIGALQNGQVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKN+PEFAKKLA+ ADL+VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNDPEFAKKLAANADLYVNDAFGTAHRAHA  157



>ref|WP_019495207.1| phosphoglycerate kinase [Calothrix sp. PCC 7103]
Length=400

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KKS+ +L+A+DL GK+ FVR D NVPLDD   ITDDTRIRAA+PTI+ L S GAKVIL
Sbjct  1    MSKKSLANLSASDLSGKRAFVRVDFNVPLDDAGNITDDTRIRAALPTIQDLASKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGV  K  L P+  RLSELLG +VVK DDCIG EV   V SL +G VLLLENV
Sbjct  61   ASHFGRPKGVDDKLRLTPVAARLSELLGQEVVKCDDCIGDEVAAKVGSLQNGQVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKN+ EFA+KLAS ADL+VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNDSEFAQKLASNADLYVNDAFGTAHRAHA  157



>ref|WP_017323648.1| phosphoglycerate kinase [cyanobacterium PCC 7702]
Length=400

 Score =   229 bits (583),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KK++  L+AADL GK+ FVR D NVP+DD   ITDDTRIRAA+PTIK L+  GAKVIL
Sbjct  1    MSKKTLASLSAADLSGKRAFVRVDFNVPVDDAGNITDDTRIRAALPTIKDLVRKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGV  K  L P+  RLSELLG +V+K +DCIG EV   VA+L +G VLLLENV
Sbjct  61   ASHFGRPKGVDEKLRLTPVAKRLSELLGQEVIKTNDCIGEEVAAKVAALQNGQVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEE+N+PEFAKKLAS ADL+VNDAFGTAHRAHA
Sbjct  121  RFYKEEEQNDPEFAKKLASNADLYVNDAFGTAHRAHA  157



>ref|WP_017309094.1| MULTISPECIES: phosphoglycerate kinase [Stigonematales]
 gb|KIY12309.1| phosphoglycerate kinase [Mastigocladus laminosus UU774]
Length=400

 Score =   229 bits (583),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 110/157 (70%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KK++ +L+A DL GK+ FVR D NVP+DD   ITDDTRIRAA+PTI+ L+  GAKVIL
Sbjct  1    MSKKTLANLSATDLSGKRAFVRVDFNVPVDDAGNITDDTRIRAALPTIQDLVQKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGV  K  L P+  RLSELLG +VVKADDCIG +V   V SL +G VLLLENV
Sbjct  61   ASHFGRPKGVDEKLRLTPVAKRLSELLGQEVVKADDCIGDDVAAKVGSLQNGQVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKN+PEFAKKLA+ ADL+VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNDPEFAKKLAANADLYVNDAFGTAHRAHA  157



>gb|AAW79325.1| phosphoglycerate kinase [Isochrysis galbana]
Length=436

 Score =   230 bits (586),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 118/178 (66%), Positives = 137/178 (77%), Gaps = 7/178 (4%)
 Frame = +2

Query  434  RSLKASAKPVRGV-----VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTR  598
             +L+  A P+R       + MAKKSVGDLT ADL+GK+V VR DLNVPLD  + ITDDTR
Sbjct  17   EALRIGAAPMRSTSRTCTIEMAKKSVGDLTKADLEGKRVLVRCDLNVPLDG-KTITDDTR  75

Query  599  IRAAIPTIKHLISNGAKVILSSHLGRPKGV-TPKYSLAPLVPRLSELLGIQVVKADDCIG  775
            IRA+IPTIK+LI NGAKV+LSSHLGRPKG    K+SL P+ PRLSELLG +V  A DCIG
Sbjct  76   IRASIPTIKYLIDNGAKVLLSSHLGRPKGGPEDKFSLGPVAPRLSELLGKEVTMAPDCIG  135

Query  776  PEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
              V   V  + +G VLLLEN RFYKEEEKN+PEFA+KLA+ AD+FVNDAFGTAHRAH 
Sbjct  136  DAVADCVTKMANGDVLLLENTRFYKEEEKNDPEFAEKLAANADMFVNDAFGTAHRAHG  193



>ref|XP_002977295.1| hypothetical protein SELMODRAFT_107116 [Selaginella moellendorffii]
 gb|EFJ21299.1| hypothetical protein SELMODRAFT_107116 [Selaginella moellendorffii]
Length=402

 Score =   228 bits (582),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 135/159 (85%), Gaps = 0/159 (0%)
 Frame = +2

Query  473  VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKV  652
            +++ KKSVGDLTAAD+KGK+VF+RADLNVPLD    ITDDTR+RA++PTI+HL   GAK+
Sbjct  1    MAVTKKSVGDLTAADVKGKRVFLRADLNVPLDAEFNITDDTRLRASVPTIQHLRRLGAKI  60

Query  653  ILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLE  832
            IL+SHLGRPKG T    LAPLV RLSELLG++V +ADD +G EVE  +A+L DGGVLLLE
Sbjct  61   ILASHLGRPKGYTKSCCLAPLVGRLSELLGVKVDRADDSVGAEVEAKIAALDDGGVLLLE  120

Query  833  NVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            N+RF+ EEEKN+ E A+KL +LADL+VNDAFGTAHRAHA
Sbjct  121  NLRFHPEEEKNDAEHARKLGALADLYVNDAFGTAHRAHA  159



>gb|EMT12348.1| Phosphoglycerate kinase, chloroplastic [Aegilops tauschii]
Length=376

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 110/125 (88%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +2

Query  575  QKITDDTRIRAAIPTIKHLISNGAKVILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVV  754
              ITDDTRIRAAIPTIK+L+SNGAKVIL+SHLGRPKGVTPK+SLAPLVPRLSELLGI+V 
Sbjct  1    MNITDDTRIRAAIPTIKYLLSNGAKVILTSHLGRPKGVTPKFSLAPLVPRLSELLGIEVK  60

Query  755  KADDCIGPEVEKLVASLPDGGVLLLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTA  934
            KA+D IGPEVEKLVA L +G VLLLENVRFYKEEEKN+PEFAKKLASLADLFVNDAFGTA
Sbjct  61   KAEDVIGPEVEKLVADLANGAVLLLENVRFYKEEEKNDPEFAKKLASLADLFVNDAFGTA  120

Query  935  HRAHA  949
            HRAHA
Sbjct  121  HRAHA  125



>ref|WP_026734580.1| phosphoglycerate kinase [Fischerella sp. PCC 9605]
Length=400

 Score =   228 bits (581),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KK++ +L+A DL GK+ FVR D NVP+DD   ITDDTRIRAA+PTI+ L+  GAKVIL
Sbjct  1    MSKKTLANLSATDLSGKRAFVRVDFNVPMDDAGNITDDTRIRAALPTIQDLMQKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGV  K  L P+  RLSELLG +VVK DDCIG EV   V +L +G VLLLENV
Sbjct  61   ASHFGRPKGVDEKLRLTPVAKRLSELLGQEVVKTDDCIGDEVAAKVGALQNGQVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKN+PEFAKKLA+ ADL+VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNDPEFAKKLAANADLYVNDAFGTAHRAHA  157



>ref|WP_016873269.1| phosphoglycerate kinase [Chlorogloeopsis fritschii]
Length=400

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 130/157 (83%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KK++ +L+A+DL GK+ FVR D NVP+DD+  ITDDTRIRAA+PTIK L+  GAKVIL
Sbjct  1    MSKKTLANLSASDLSGKRAFVRVDFNVPVDDSGNITDDTRIRAALPTIKDLMQKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGV  K  L P+  RLSELLG +VVK DDCIG EV   V++L +G VLLLENV
Sbjct  61   ASHFGRPKGVDDKLRLTPVAKRLSELLGQEVVKTDDCIGEEVAAKVSALQNGQVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKN+P+FA+KLA+ ADL+VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNDPDFAQKLAANADLYVNDAFGTAHRAHA  157



>gb|ABH10990.1| phosphoglycerate kinase [Polytomella parva]
Length=259

 Score =   223 bits (568),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 131/162 (81%), Gaps = 2/162 (1%)
 Frame = +2

Query  470  VVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDD-TQKITDDTRIRAAIPTIKHLISNGA  646
            V + AKKSVGDL+ ADLKGKKVFVRADLNVPLD  T K+TDDTRIRAA PT+K+L+ NGA
Sbjct  33   VKTEAKKSVGDLSIADLKGKKVFVRADLNVPLDKKTNKVTDDTRIRAAAPTLKYLLKNGA  92

Query  647  KVILSSHLGRPKGVTPK-YSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVL  823
            KVIL+SHLGRPK    K YSL P++ +LS  +G  V K DDCIGP V K  + L DG +L
Sbjct  93   KVILTSHLGRPKKDNKKKYSLDPVIEKLSHYVGTPVKKVDDCIGPVVAKAASELKDGEIL  152

Query  824  LLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            LLENVRFY EEEKN+PEFAK LA+ ADL+VNDAFGTAHRAHA
Sbjct  153  LLENVRFYPEEEKNKPEFAKALAANADLYVNDAFGTAHRAHA  194



>ref|WP_009454679.1| MULTISPECIES: phosphoglycerate kinase [Fischerella]
 gb|EHC18638.1| Phosphoglycerate kinase [Fischerella sp. JSC-11]
Length=400

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KK++ +L+A DL GK+ FVR D NVP+DD   ITDDTRIRAA+PTI+ L+  GAKVIL
Sbjct  1    MSKKTLANLSATDLSGKRAFVRVDFNVPVDDAGNITDDTRIRAALPTIQDLVQKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGV  K  L P+  RLSELLG +VVK DDCIG EV   V +L +G VLLLENV
Sbjct  61   ASHFGRPKGVDEKLRLTPVAKRLSELLGQEVVKTDDCIGDEVAAKVEALQNGQVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKN+PEFAKKLA+ ADL+VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNDPEFAKKLAANADLYVNDAFGTAHRAHA  157



>ref|WP_016865730.1| phosphoglycerate kinase [Fischerella muscicola]
Length=400

 Score =   227 bits (579),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KK++ +L+A DL GK+ FVR D NVP DD   ITDDTRIRAA+PTI+ L+  GAKVIL
Sbjct  1    MSKKTLANLSATDLSGKRAFVRVDFNVPTDDAGNITDDTRIRAALPTIQDLVQKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGV  K  L P+  RLSELLG +VVK DDCIG EV   V +L +G VLLLENV
Sbjct  61   ASHFGRPKGVDEKLRLTPVAKRLSELLGQEVVKTDDCIGDEVAAKVGALQNGQVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKN+PEFAKKLA+ ADL+VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNDPEFAKKLAANADLYVNDAFGTAHRAHA  157



>ref|XP_011396717.1| Phosphoglycerate kinase, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM23839.1| Phosphoglycerate kinase, chloroplastic [Auxenochlorella protothecoides]
Length=454

 Score =   228 bits (581),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 132/160 (83%), Gaps = 1/160 (1%)
 Frame = +2

Query  473  VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKV  652
            V  AKKSV DL+ +DL+GK VFVRADLNVPLD TQ ITDDTRIRAA+PT+++LI NGA++
Sbjct  54   VEAAKKSVSDLSKSDLEGKVVFVRADLNVPLDGTQNITDDTRIRAAVPTLEYLIKNGARI  113

Query  653  ILSSHLGRPK-GVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLL  829
            +L+SHLGRPK G   K+ L P+ PRLS+LLGI V+KADD IG EVE  V  L +G VLLL
Sbjct  114  LLASHLGRPKSGPEDKFRLTPIAPRLSQLLGITVIKADDSIGSEVESKVKDLKNGQVLLL  173

Query  830  ENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            ENVRFYKEEEKN+P  AK+LA  AD+FVNDAFGTAHRAH+
Sbjct  174  ENVRFYKEEEKNDPGHAKELAKFADVFVNDAFGTAHRAHS  213



>ref|WP_026098466.1| phosphoglycerate kinase [Oscillatoria sp. PCC 10802]
Length=400

 Score =   226 bits (576),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M KK+V +L+A+DL GK+V VRAD NVPLD+   ITDDTRIRAA+PTI+ L   GAKVIL
Sbjct  1    MPKKTVANLSASDLAGKRVLVRADFNVPLDEAGNITDDTRIRAALPTIQDLTGKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
             SH GRPKGV  K  L P+  RLSELLG +V+K DDCIG EV   V ++ DG V LLENV
Sbjct  61   CSHFGRPKGVDDKLRLTPVAKRLSELLGQEVIKCDDCIGEEVASKVGAMQDGQVALLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKN+PEFA+KLAS+ADL+VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNDPEFAQKLASVADLYVNDAFGTAHRAHA  157



>ref|WP_015140688.1| phosphoglycerate kinase [Nostoc sp. PCC 7524]
 gb|AFY50278.1| 3-phosphoglycerate kinase [Nostoc sp. PCC 7524]
Length=400

 Score =   226 bits (576),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KK++  L+AAD+ GK+ FVR D NVP+DD   ITDDTRIRAA+PTI  L   GAKVIL
Sbjct  1    MSKKTLASLSAADISGKRAFVRVDFNVPVDDQGNITDDTRIRAALPTINDLTQKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGV  K  L P+  RLSELLG +V+K DDCIG EV   VA+L +G VLLLENV
Sbjct  61   ASHFGRPKGVDDKLRLTPVAKRLSELLGQEVIKTDDCIGDEVAAKVAALQNGQVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKNEPEFAKKLA+ AD +VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNEPEFAKKLAANADFYVNDAFGTAHRAHA  157



>ref|XP_002972143.1| hypothetical protein SELMODRAFT_96742 [Selaginella moellendorffii]
 gb|EFJ27060.1| hypothetical protein SELMODRAFT_96742 [Selaginella moellendorffii]
Length=402

 Score =   226 bits (575),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/159 (69%), Positives = 134/159 (84%), Gaps = 0/159 (0%)
 Frame = +2

Query  473  VSMAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKV  652
            +++ KKSVGDLT AD+KGK+VF+RADLNVPLD    ITDDTR+RAA+PTI++L   GAK+
Sbjct  1    MAVTKKSVGDLTEADVKGKRVFLRADLNVPLDAEFNITDDTRLRAAVPTIQYLRRLGAKI  60

Query  653  ILSSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLE  832
            IL+SHLGRPKG T    LAPLV RLSELLG++V +ADD +G EVE  +A+L DGGVLLLE
Sbjct  61   ILASHLGRPKGYTKSCCLAPLVGRLSELLGVKVDRADDSVGTEVEAKIAALDDGGVLLLE  120

Query  833  NVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            N+RF+ EEEKN+ E A+KL +LADL+VNDAFGTAHRAHA
Sbjct  121  NLRFHPEEEKNDEEHARKLGALADLYVNDAFGTAHRAHA  159



>ref|WP_016861411.1| phosphoglycerate kinase [Fischerella muscicola]
Length=400

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 127/157 (81%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KK++ +L+A DL GK+ FVR D NVP+DD   ITDDTRIRAA+PTI+ L+  GAKVIL
Sbjct  1    MSKKTLANLSATDLSGKRAFVRVDFNVPVDDAGNITDDTRIRAALPTIQDLVQKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGV  K  L P+  RLSELLG +VVK DDCIG +V   V +L +G V+LLENV
Sbjct  61   ASHFGRPKGVDEKLRLTPVAKRLSELLGQEVVKTDDCIGDDVAAKVGALQNGQVILLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKN+PEFAKKLA+ ADL+VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNDPEFAKKLAANADLYVNDAFGTAHRAHA  157



>ref|WP_035157181.1| phosphoglycerate kinase [Calothrix sp. 336/3]
 gb|KFB85656.1| phosphoglycerate kinase [Calothrix sp. 336/3]
Length=400

 Score =   225 bits (574),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 128/157 (82%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KK++ +L+AADL GK+ FVR D NVP+DD   ITDDTRIRAA+PTI+ L   GAKVIL
Sbjct  1    MSKKTLANLSAADLAGKRAFVRVDFNVPVDDAGNITDDTRIRAALPTIQDLTQKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGV  K  L P+  RLSELLG +V+K DDCIG +V   VA++ +G VLLLENV
Sbjct  61   ASHFGRPKGVDDKLRLTPVAKRLSELLGQEVIKTDDCIGDDVAAKVAAMSNGQVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKN+PEFA+KLA+ ADL+VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNDPEFAQKLAANADLYVNDAFGTAHRAHA  157



>ref|WP_006633515.1| phosphoglycerate kinase [Microcoleus vaginatus]
 gb|EGK87204.1| Phosphoglycerate kinase [Microcoleus vaginatus FGP-2]
Length=399

 Score =   224 bits (572),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 126/157 (80%), Gaps = 1/157 (1%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M KK+V +L+A+DL GK+V VRAD NVPLD+   ITDDTRIRAA+PTI+ L S GAKVIL
Sbjct  1    MTKKTVANLSASDLSGKRVLVRADFNVPLDNGN-ITDDTRIRAALPTIQDLASKGAKVIL  59

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
             SH GRPKGVT K  L P+  RLSELLG +V K DDCIG EV   VA + DG VLLLENV
Sbjct  60   CSHFGRPKGVTEKLRLTPVAKRLSELLGKEVKKTDDCIGDEVAATVAGMQDGDVLLLENV  119

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFY EEE N+PEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  120  RFYPEEEANDPEFAKKLASVADLYVNDAFGTAHRAHA  156



>ref|WP_015177490.1| phosphoglycerate kinase [Oscillatoria nigro-viridis]
 gb|AFZ08239.1| phosphoglycerate kinase [Oscillatoria nigro-viridis PCC 7112]
Length=399

 Score =   224 bits (571),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 127/157 (81%), Gaps = 1/157 (1%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M KK+V +L+A+DL GK+V VRAD NVPLD+   ITDDTRIRAA+PTI+ L S GAKVIL
Sbjct  1    MTKKTVANLSASDLSGKRVLVRADFNVPLDNGN-ITDDTRIRAALPTIQDLASKGAKVIL  59

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
             SH GRPKGVT K  L P+  RLSELLG +V K DDCIG EV   VA++ DG VLLLENV
Sbjct  60   CSHFGRPKGVTEKLRLTPVAVRLSELLGKEVKKTDDCIGDEVAATVAAMQDGDVLLLENV  119

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFY EEE N+PEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  120  RFYPEEEANDPEFAKKLASVADLYVNDAFGTAHRAHA  156



>ref|WP_015217208.1| phosphoglycerate kinase [Anabaena cylindrica]
 gb|AFZ60594.1| phosphoglycerate kinase [Anabaena cylindrica PCC 7122]
Length=400

 Score =   224 bits (570),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KKS+  L+AAD+ GK+  VR D NVP+DD   ITDDTRIRAA+PTI+ L   GAKVIL
Sbjct  1    MSKKSLASLSAADVSGKRALVRVDFNVPVDDQGSITDDTRIRAALPTIQDLTKKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGV  K  L P+  RLSELLG +VVK DDCIG +V   VA+L +G VLLLENV
Sbjct  61   ASHFGRPKGVDDKLRLTPVAKRLSELLGQEVVKTDDCIGDDVAAKVAALQNGQVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKNEPEFAKKLA+ AD +VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNEPEFAKKLAANADFYVNDAFGTAHRAHA  157



>ref|XP_005851391.1| hypothetical protein CHLNCDRAFT_48457 [Chlorella variabilis]
 gb|EFN59289.1| hypothetical protein CHLNCDRAFT_48457 [Chlorella variabilis]
Length=399

 Score =   224 bits (570),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 132/158 (84%), Gaps = 2/158 (1%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            MAKKSVGDL+ ADL+GK VFVRADLNVPLD   KITDDTRIRAA+PT+K+L+ NGAKV+L
Sbjct  1    MAKKSVGDLSKADLEGKVVFVRADLNVPLD-GDKITDDTRIRAAVPTLKYLVDNGAKVLL  59

Query  659  SSHLGRPK-GVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLEN  835
            +SHLGRPK G   K+ L P+V RLSEL+G  V KA+DCIG  V   +A + +G VLLLEN
Sbjct  60   TSHLGRPKKGPEDKFRLTPVVGRLSELMGAAVEKAEDCIGEAVTSKLAKMSNGSVLLLEN  119

Query  836  VRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            VRFY EEEKN+PEFAKKLA+ ADL+VNDAFGTAHRAHA
Sbjct  120  VRFYPEEEKNDPEFAKKLAAPADLYVNDAFGTAHRAHA  157



>ref|WP_016949614.1| phosphoglycerate kinase [Anabaena sp. PCC 7108]
Length=400

 Score =   223 bits (569),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KKS+  L+AAD+ GK+  VR D NVP+DD   ITDDTRIRAA+PTIK L   GAKVIL
Sbjct  1    MSKKSLASLSAADISGKRALVRVDFNVPVDDQGNITDDTRIRAALPTIKDLTEKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGVT K  L P+  RLSELLG +VVK DDCIG +V   VA+L +G VLLLENV
Sbjct  61   TSHFGRPKGVTEKLRLTPVAKRLSELLGQEVVKTDDCIGDDVAAKVAALQNGQVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFY EEEKN+PEFAKKLA+ AD +VNDAFGTAHRAHA
Sbjct  121  RFYPEEEKNDPEFAKKLAANADFYVNDAFGTAHRAHA  157



>ref|WP_015149149.1| phosphoglycerate kinase [Oscillatoria acuminata]
 gb|AFY82513.1| 3-phosphoglycerate kinase [Oscillatoria acuminata PCC 6304]
Length=401

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 126/158 (80%), Gaps = 1/158 (1%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M KK+V +L+A+DL GK+V VRAD NVPLDD   ITDDTRIRAA+PTI+ L   GAKVIL
Sbjct  1    MPKKTVANLSASDLSGKRVLVRADFNVPLDDAGNITDDTRIRAALPTIQDLTGKGAKVIL  60

Query  659  SSHLGRPKG-VTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLEN  835
            SSH GRPKG V  K  L P+  RLSELLG +V+K DDCIG EV   V S+ +G V LLEN
Sbjct  61   SSHFGRPKGQVNEKMRLTPVAKRLSELLGKEVLKCDDCIGDEVASKVQSMENGQVALLEN  120

Query  836  VRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            VRFY EEEKN+PEFAKKLAS+ADL+VNDAFGTAHRAHA
Sbjct  121  VRFYAEEEKNDPEFAKKLASVADLYVNDAFGTAHRAHA  158



>gb|KIE11439.1| phosphoglycerate kinase [Tolypothrix bouteillei VB521301]
Length=400

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KKS+ +L+AADL GK+  VR D NVPLDD   ITDDTRIRAA+PTI+ L   GAKVIL
Sbjct  1    MSKKSLANLSAADLSGKRALVRVDFNVPLDDAGNITDDTRIRAALPTIQDLTQKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGV  K  L P+  RLSELLG +VVK DD IG +V   VA+L +G VLLLENV
Sbjct  61   TSHFGRPKGVDDKLRLTPVAKRLSELLGQEVVKTDDSIGDDVTAKVAALQNGQVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEE+N+PEFAKKLA+ ADL+VNDAFGTAHRAHA
Sbjct  121  RFYKEEEQNDPEFAKKLAANADLYVNDAFGTAHRAHA  157



>ref|WP_015162225.1| phosphoglycerate kinase [Chamaesiphon minutus]
 gb|AFY96141.1| 3-phosphoglycerate kinase [Chamaesiphon minutus PCC 6605]
Length=400

 Score =   223 bits (567),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KKS+  L+AADL GK+V VRAD NVP+DD   ITDDTRIRAA+PTIK L   GAKVIL
Sbjct  1    MSKKSIASLSAADLTGKRVLVRADFNVPVDDAGNITDDTRIRAALPTIKDLTGKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            SSH GRPKGV  K  L P+  RLSELLG  VV   DCIG EV + +A++ +G V LLENV
Sbjct  61   SSHFGRPKGVDEKLRLTPVAKRLSELLGQDVVACKDCIGDEVARQIAAMSNGQVALLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFY EEEKN+PEFAKKLA+ ADL+VNDAFGTAHRAHA
Sbjct  121  RFYPEEEKNDPEFAKKLAANADLYVNDAFGTAHRAHA  157



>emb|CBY84995.1| phosphoglycerate kinase, partial [Polytomella sp. Pringsheim 
198.80]
Length=422

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/162 (71%), Positives = 131/162 (81%), Gaps = 2/162 (1%)
 Frame = +2

Query  470  VVSMAKKSVGDLTAADLKGKKVFVRADLNVPLDD-TQKITDDTRIRAAIPTIKHLISNGA  646
            V + AKKSVGDL+ ADLKGKKVFVRADLNVPLD  T K+TDDTRIRAA PT+K+L+ NGA
Sbjct  37   VKTEAKKSVGDLSIADLKGKKVFVRADLNVPLDKKTNKVTDDTRIRAAAPTLKYLLKNGA  96

Query  647  KVILSSHLGRPKGVTPK-YSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVL  823
            KVIL+SHLGRPK    K YSL P++ +LS  +G  V K DDCIGP V K  + L DG +L
Sbjct  97   KVILTSHLGRPKKDNKKKYSLDPVIEKLSHYVGTPVKKVDDCIGPVVAKAASELKDGEIL  156

Query  824  LLENVRFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            LLENVRFY EEEKN+PEFAK LA+ ADL+VNDAFGTAHRAHA
Sbjct  157  LLENVRFYPEEEKNKPEFAKALAANADLYVNDAFGTAHRAHA  198



>ref|WP_006199298.1| phosphoglycerate kinase, partial [Nodularia spumigena]
 gb|EAW42603.1| phosphoglycerate kinase [Nodularia spumigena CCY9414]
Length=388

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KK++ +L+AAD+ GK+  VR D NVP+DD   ITDDTRIRAA+PTI+ L+  GAKVIL
Sbjct  1    MSKKTLANLSAADISGKRALVRVDFNVPVDDNGNITDDTRIRAALPTIQDLMEKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGV  K  L P+  RLSELLG +VVK DDCIG  V   V +L +G VLLLENV
Sbjct  61   ASHFGRPKGVDDKLRLTPVAQRLSELLGQEVVKTDDCIGDAVTAQVGALQNGQVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKN+PEFAKKLA+ AD +VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNDPEFAKKLAANADFYVNDAFGTAHRAHA  157



>ref|WP_011317630.1| phosphoglycerate kinase [Anabaena variabilis]
 sp|Q3MF40.1|PGK_ANAVT RecName: Full=Phosphoglycerate kinase [Anabaena variabilis ATCC 
29413]
 gb|ABA20396.1| phosphoglycerate kinase [Anabaena variabilis ATCC 29413]
Length=400

 Score =   222 bits (566),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/157 (69%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KK+V  L+AAD+ GK+  VR D NVPLDD   ITDDTRIRAA+PTI+ L   GAKVIL
Sbjct  1    MSKKTVASLSAADISGKRALVRVDFNVPLDDQGNITDDTRIRAALPTIQDLTQKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGV  K  L P+  RLSELLG +VVK DD IG EV   VA+L +G VLLLENV
Sbjct  61   ASHFGRPKGVDEKLRLTPVAKRLSELLGQEVVKTDDSIGDEVAAKVAALQNGQVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKN+PEFAKKLA+ AD +VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNDPEFAKKLAANADFYVNDAFGTAHRAHA  157



>ref|WP_010998270.1| phosphoglycerate kinase [Nostoc sp. PCC 7120]
 sp|Q8YPR1.1|PGK_NOSS1 RecName: Full=Phosphoglycerate kinase [Nostoc sp. PCC 7120]
 dbj|BAB75830.1| phosphoglycerate kinase [Nostoc sp. PCC 7120]
Length=400

 Score =   222 bits (565),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KK+V  L+AAD+ GK+  VR D NVPLDD   ITDDTRIRAA+PTI+ L   GAKVIL
Sbjct  1    MSKKTVASLSAADISGKRALVRVDFNVPLDDQGNITDDTRIRAALPTIQDLTQKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGV  K  L P+  RLSELLG +V+K DD IG EV   VA+L +G VLLLENV
Sbjct  61   ASHFGRPKGVDEKLRLTPVAKRLSELLGQEVIKTDDSIGDEVAAKVATLQNGQVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKN+PEFAKKLA+ AD +VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNDPEFAKKLAANADFYVNDAFGTAHRAHA  157



>ref|WP_015153171.1| phosphoglycerate kinase [Chroococcidiopsis thermalis]
 gb|AFY86622.1| phosphoglycerate kinase [Chroococcidiopsis thermalis PCC 7203]
Length=400

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KK++ +L+++DL GK+  VR D NVPLDD   ITDDTRIRAA+PTI+ LI  GAKVIL
Sbjct  1    MSKKTLANLSSSDLSGKRALVRVDFNVPLDDQGNITDDTRIRAALPTIQDLIKKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGV  K  L P+  RLSELLG +V+K DDCIG EV   VA + +G VLLLENV
Sbjct  61   ASHFGRPKGVDDKLRLTPVAKRLSELLGQEVIKCDDCIGDEVAGKVAGMQNGQVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFY EEEKN PEFA+KLA+ ADL+VNDAFGTAHRAHA
Sbjct  121  RFYPEEEKNNPEFAQKLAANADLYVNDAFGTAHRAHA  157



>ref|WP_039715776.1| phosphoglycerate kinase [Scytonema millei]
 gb|KIF18238.1| phosphoglycerate kinase [Scytonema millei VB511283]
Length=400

 Score =   221 bits (564),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KK++ +L+++DL GK+  VR D NVPLDD   ITDDTRIRAA+PTI+ LI  GAKVIL
Sbjct  1    MSKKTLANLSSSDLSGKRALVRVDFNVPLDDQGNITDDTRIRAALPTIQDLIKKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGV  K  L P+  RLSELLG +V+K DDCIG EV   VA + +G VLLLENV
Sbjct  61   ASHFGRPKGVDDKLRLTPVAKRLSELLGQEVIKCDDCIGDEVAGKVAGMQNGQVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFY EEEKN PEFA+KLA+ ADL+VNDAFGTAHRAHA
Sbjct  121  RFYPEEEKNNPEFAQKLAANADLYVNDAFGTAHRAHA  157



>ref|WP_017803962.1| phosphoglycerate kinase [Nodularia spumigena]
 gb|AHJ28092.1| Phosphoglycerate kinase [Nodularia spumigena CCY9414]
Length=400

 Score =   221 bits (564),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 106/157 (68%), Positives = 125/157 (80%), Gaps = 0/157 (0%)
 Frame = +2

Query  479  MAKKSVGDLTAADLKGKKVFVRADLNVPLDDTQKITDDTRIRAAIPTIKHLISNGAKVIL  658
            M+KK++ +L+AAD+ GK+  VR D NVP+DD   ITDDTRIRAA+PTI+ L+  GAKVIL
Sbjct  1    MSKKTLANLSAADISGKRALVRVDFNVPVDDNGNITDDTRIRAALPTIQDLMEKGAKVIL  60

Query  659  SSHLGRPKGVTPKYSLAPLVPRLSELLGIQVVKADDCIGPEVEKLVASLPDGGVLLLENV  838
            +SH GRPKGV  K  L P+  RLSELLG +VVK DDCIG  V   V +L +G VLLLENV
Sbjct  61   ASHFGRPKGVDDKLRLTPVAQRLSELLGQEVVKTDDCIGDAVTAQVGALQNGQVLLLENV  120

Query  839  RFYKEEEKNEPEFAKKLASLADLFVNDAFGTAHRAHA  949
            RFYKEEEKN+PEFAKKLA+ AD +VNDAFGTAHRAHA
Sbjct  121  RFYKEEEKNDPEFAKKLAANADFYVNDAFGTAHRAHA  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 2282261823154