BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2452

Length=707
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_012089992.1|  PREDICTED: uncharacterized protein LOC105648271    160   1e-41   Jatropha curcas
ref|XP_002513491.1|  GTP-binding protein enga, putative                 158   3e-41   
ref|XP_010102336.1|  GTPase Der                                         158   5e-41   Morus notabilis
ref|XP_002314070.2|  hypothetical protein POPTR_0009s05900g             158   5e-41   
ref|XP_011090367.1|  PREDICTED: uncharacterized protein LOC105171060    156   2e-40   Sesamum indicum [beniseed]
gb|EYU26176.1|  hypothetical protein MIMGU_mgv1a002590mg                156   2e-40   Erythranthe guttata [common monkey flower]
ref|XP_011025525.1|  PREDICTED: uncharacterized protein LOC105126373    156   3e-40   Populus euphratica
ref|XP_007214806.1|  hypothetical protein PRUPE_ppa023138m1g            150   4e-39   
emb|CDP04574.1|  unnamed protein product                                152   1e-38   Coffea canephora [robusta coffee]
ref|XP_009347314.1|  PREDICTED: uncharacterized protein LOC103938985    150   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_009376882.1|  PREDICTED: uncharacterized protein LOC103965542    150   3e-38   
ref|XP_006361748.1|  PREDICTED: uncharacterized protein LOC102597805    150   4e-38   Solanum tuberosum [potatoes]
ref|XP_004250946.1|  PREDICTED: uncharacterized protein LOC101251249    149   8e-38   Solanum lycopersicum
ref|XP_002282837.2|  PREDICTED: uncharacterized protein LOC100260...    149   8e-38   
ref|XP_010257319.1|  PREDICTED: uncharacterized protein LOC104597...    149   9e-38   Nelumbo nucifera [Indian lotus]
ref|XP_010257317.1|  PREDICTED: uncharacterized protein LOC104597...    149   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_008227136.1|  PREDICTED: uncharacterized protein LOC103326678    148   2e-37   Prunus mume [ume]
gb|KCW51184.1|  hypothetical protein EUGRSUZ_J00770                     147   2e-37   Eucalyptus grandis [rose gum]
ref|XP_010651244.1|  PREDICTED: uncharacterized protein LOC100260...    148   2e-37   Vitis vinifera
emb|CBI16384.3|  unnamed protein product                                147   3e-37   Vitis vinifera
gb|KDO61272.1|  hypothetical protein CISIN_1g005504mg                   144   4e-37   Citrus sinensis [apfelsine]
ref|XP_010031794.1|  PREDICTED: uncharacterized protein LOC104421519    147   4e-37   Eucalyptus grandis [rose gum]
ref|XP_008385564.1|  PREDICTED: uncharacterized protein LOC103448103    147   5e-37   
gb|KDO61270.1|  hypothetical protein CISIN_1g005504mg                   145   9e-37   Citrus sinensis [apfelsine]
gb|KJB21894.1|  hypothetical protein B456_004G019700                    146   1e-36   Gossypium raimondii
gb|KHG00071.1|  GTPase Der                                              146   1e-36   Gossypium arboreum [tree cotton]
gb|KDO61269.1|  hypothetical protein CISIN_1g005504mg                   145   1e-36   Citrus sinensis [apfelsine]
ref|XP_009375054.1|  PREDICTED: uncharacterized protein LOC103963899    145   1e-36   Pyrus x bretschneideri [bai li]
ref|XP_006446112.1|  hypothetical protein CICLE_v10014514mg             145   2e-36   Citrus clementina [clementine]
ref|XP_006470605.1|  PREDICTED: uncharacterized protein LOC102625...    145   2e-36   
ref|XP_009768584.1|  PREDICTED: uncharacterized protein LOC104219584    145   2e-36   Nicotiana sylvestris
gb|KDO61267.1|  hypothetical protein CISIN_1g005504mg                   145   3e-36   Citrus sinensis [apfelsine]
ref|XP_010519745.1|  PREDICTED: uncharacterized protein LOC104799102    144   3e-36   Tarenaya hassleriana [spider flower]
gb|AGL34232.1|  plastid GTPase Der                                      144   4e-36   Nicotiana benthamiana
ref|XP_010257318.1|  PREDICTED: uncharacterized protein LOC104597...    144   8e-36   Nelumbo nucifera [Indian lotus]
ref|XP_009615948.1|  PREDICTED: uncharacterized protein LOC104108581    143   9e-36   Nicotiana tomentosiformis
ref|XP_006850201.1|  PREDICTED: uncharacterized protein LOC18439984     143   9e-36   Amborella trichopoda
ref|XP_007015041.1|  GTP-binding family protein                         143   9e-36   
ref|XP_011469726.1|  PREDICTED: uncharacterized protein LOC101310...    142   2e-35   Fragaria vesca subsp. vesca
ref|XP_004289593.1|  PREDICTED: uncharacterized protein LOC101310...    142   3e-35   Fragaria vesca subsp. vesca
ref|XP_008449721.1|  PREDICTED: uncharacterized protein LOC103491517    141   5e-35   Cucumis melo [Oriental melon]
ref|XP_010673632.1|  PREDICTED: uncharacterized protein LOC104889980    142   5e-35   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS73678.1|  hypothetical protein M569_01078                         140   5e-35   Genlisea aurea
ref|XP_008813436.1|  PREDICTED: uncharacterized protein LOC103724...    139   2e-34   
ref|XP_004507094.1|  PREDICTED: GTPase Der-like                         139   2e-34   Cicer arietinum [garbanzo]
dbj|BAD93758.1|  hypothetical protein                                   135   8e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011469724.1|  PREDICTED: uncharacterized protein LOC101310...    136   2e-33   Fragaria vesca subsp. vesca
ref|XP_007132015.1|  hypothetical protein PHAVU_011G059500g             136   2e-33   Phaseolus vulgaris [French bean]
gb|KEH30215.1|  GTPase Der protein                                      137   2e-33   Medicago truncatula
ref|NP_001078139.1|  putative double era-like GTPase                    136   3e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004142117.1|  PREDICTED: uncharacterized protein LOC101205027    136   4e-33   Cucumis sativus [cucumbers]
gb|KGN54174.1|  hypothetical protein Csa_4G291380                       136   6e-33   Cucumis sativus [cucumbers]
ref|NP_187815.2|  putative double era-like GTPase                       135   6e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882766.1|  EMB2738                                            134   3e-32   Arabidopsis lyrata subsp. lyrata
ref|NP_001146320.1|  uncharacterized protein LOC100279896               133   5e-32   
tpg|DAA42328.1|  TPA: hypothetical protein ZEAMMB73_012049              133   5e-32   
ref|XP_010486897.1|  PREDICTED: uncharacterized protein LOC104764969    133   7e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010498493.1|  PREDICTED: uncharacterized protein LOC104776175    132   7e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006297160.1|  hypothetical protein CARUB_v10013165mg             132   1e-31   Capsella rubella
gb|EEC68516.1|  hypothetical protein OsI_36791                          132   1e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_002449905.1|  hypothetical protein SORBIDRAFT_05g025430          132   1e-31   
ref|XP_010464959.1|  PREDICTED: uncharacterized protein LOC104745422    132   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006407372.1|  hypothetical protein EUTSA_v10020226mg             132   2e-31   Eutrema salsugineum [saltwater cress]
ref|XP_004979812.1|  PREDICTED: uncharacterized protein LOC101764561    130   4e-31   
emb|CDY01098.1|  BnaC05g41020D                                          130   5e-31   
gb|KFK38573.1|  hypothetical protein AALP_AA3G131000                    130   5e-31   Arabis alpina [alpine rockcress]
ref|XP_006592177.1|  PREDICTED: uncharacterized protein LOC100777...    129   7e-31   
ref|XP_009394388.1|  PREDICTED: uncharacterized protein LOC103979...    129   8e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003539473.1|  PREDICTED: uncharacterized protein LOC100777...    129   1e-30   Glycine max [soybeans]
gb|KHN21905.1|  GTPase Der                                              128   1e-30   Glycine soja [wild soybean]
ref|XP_009146648.1|  PREDICTED: uncharacterized protein LOC103870279    129   2e-30   Brassica rapa
emb|CDY08458.1|  BnaA05g26940D                                          129   2e-30   Brassica napus [oilseed rape]
gb|KHN25243.1|  GTPase Der                                              128   1e-29   Glycine soja [wild soybean]
gb|AAG51052.1|AC069473_14  GTPase, putative; 34281-30152                125   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009394390.1|  PREDICTED: uncharacterized protein LOC103979...    124   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009394391.1|  PREDICTED: uncharacterized protein LOC103979...    123   4e-29   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAB01956.1|  GTP-binding protein-like                               121   4e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010907854.1|  PREDICTED: uncharacterized protein LOC105034...    120   7e-28   
ref|XP_010907853.1|  PREDICTED: uncharacterized protein LOC105034...    120   9e-28   Elaeis guineensis
ref|XP_008813437.1|  PREDICTED: uncharacterized protein LOC103724...    119   9e-28   
ref|XP_010907852.1|  PREDICTED: uncharacterized protein LOC105034...    121   9e-28   Elaeis guineensis
gb|EMS63685.1|  GTPase Der                                              119   4e-27   Triticum urartu
ref|XP_010237503.1|  PREDICTED: uncharacterized protein LOC100845...    118   1e-26   Brachypodium distachyon [annual false brome]
ref|XP_010237502.1|  PREDICTED: uncharacterized protein LOC100845...    117   1e-26   Brachypodium distachyon [annual false brome]
gb|EMT17683.1|  GTP-binding protein engA                                115   1e-25   
ref|XP_001420333.1|  predicted protein                                  102   2e-21   Ostreococcus lucimarinus CCE9901
emb|CEF99667.1|  P-loop containing nucleoside triphosphate hydrolase    101   3e-21   Ostreococcus tauri
ref|XP_001770231.1|  predicted protein                                  101   4e-21   
ref|XP_007509383.1|  GTP-binding protein EngA                           100   2e-20   Bathycoccus prasinos
ref|XP_005843504.1|  hypothetical protein CHLNCDRAFT_37436            99.0    4e-20   Chlorella variabilis
ref|XP_003082033.1|  GTP-binding protein-like (ISS)                   95.5    5e-19   
ref|XP_002985833.1|  hypothetical protein SELMODRAFT_123195           93.6    2e-18   
ref|XP_002984773.1|  hypothetical protein SELMODRAFT_121150           93.2    3e-18   
ref|XP_003061511.1|  predicted protein                                91.7    7e-18   Micromonas pusilla CCMP1545
ref|XP_005651191.1|  P-loop containing nucleoside triphosphate hy...  90.5    4e-17   Coccomyxa subellipsoidea C-169
gb|KIZ00088.1|  GTP-binding protein                                   87.0    6e-16   Monoraphidium neglectum
ref|WP_010024483.1|  GTP-binding protein Der                          79.3    2e-15   
ref|WP_038133265.1|  hypothetical protein                             77.4    5e-15   
ref|XP_001697913.1|  hypothetical protein CHLREDRAFT_120661           82.8    7e-15   Chlamydomonas reinhardtii
ref|WP_023510379.1|  ribosome-associated GTPase EngA                  82.4    1e-14   Sporolactobacillus laevolacticus
ref|WP_028976307.1|  ribosome-associated GTPase EngA                  80.1    7e-14   Sporolactobacillus terrae
ref|WP_016379873.1|  GTP-binding protein Der                          73.9    1e-13   
ref|WP_026731732.1|  ribosome-associated GTPase EngA                  79.7    1e-13   Fischerella sp. PCC 9605
ref|WP_041977481.1|  ribosome-associated GTPase EngA                  79.0    2e-13   Pyrinomonas methylaliphatogenes
ref|WP_008521427.1|  ribosome-associated GTPase EngA                  79.0    2e-13   Jonquetella anthropi
ref|WP_015220743.1|  ribosome-associated GTPase EngA                  79.0    2e-13   Cyanobacterium aponinum
ref|WP_008523016.1|  MULTISPECIES: ribosome-associated GTPase EngA    79.0    2e-13   Jonquetella
ref|WP_012744727.1|  GTPase Der                                       79.0    2e-13   Kosmotoga
ref|WP_010631650.1|  ribosome-associated GTPase EngA                  78.6    2e-13   Sporolactobacillus vineae
ref|WP_012258958.1|  MULTISPECIES: GTPase Der                         79.0    2e-13   Chloroflexus aurantiacus
ref|WP_015942432.1|  GTPase Der                                       78.6    2e-13   Chloroflexus aggregans
ref|WP_015206775.1|  ribosome-associated GTPase EngA                  78.6    2e-13   Cylindrospermum stagnale
ref|XP_005708451.1|  GTP-binding protein                              79.0    2e-13   Galdieria sulphuraria
ref|WP_028459350.1|  ribosome-associated GTPase EngA                  78.6    3e-13   Chloroflexus sp. Y-396-1
ref|WP_031460150.1|  ribosome-associated GTPase EngA                  78.2    3e-13   Chloroflexus sp. MS-G
ref|WP_020402934.1|  ribosome-associated GTPase EngA                  78.2    3e-13   Gracilimonas tropica
gb|AHK22206.1|  GTP-binding protein EngA                              78.2    3e-13   Candidatus Hepatoplasma crinochetorum Av
ref|XP_002509246.1|  predicted protein                                78.2    4e-13   Micromonas commoda
ref|WP_011525430.1|  ribosome-associated GTPase EngA                  78.2    4e-13   Candidatus Koribacter versatilis
gb|AEI41327.1|  EngA                                                  77.8    4e-13   Paenibacillus mucilaginosus KNP414
ref|WP_017718897.1|  ribosome-associated GTPase EngA                  77.8    4e-13   Oscillatoria sp. PCC 10802
ref|WP_029972832.1|  GTPase Der                                       73.9    4e-13   
ref|WP_015166473.1|  ribosome-associated GTPase EngA                  77.8    4e-13   Pseudanabaena sp. PCC 7367
ref|WP_029982035.1|  GTPase Der                                       72.4    4e-13   
ref|WP_025922170.1|  hypothetical protein                             72.4    5e-13   
ref|WP_026499813.1|  ribosome-associated GTPase EngA                  77.4    5e-13   Caldibacillus debilis
ref|WP_038039529.1|  ribosome-associated GTPase EngA                  77.4    6e-13   
ref|WP_015139682.1|  ribosome-associated GTPase EngA                  77.4    6e-13   Nostoc sp. PCC 7524
ref|WP_013192173.1|  ribosome-associated GTPase EngA                  77.4    6e-13   Trichormus azollae
ref|WP_019498611.1|  ribosome-associated GTPase EngA                  77.0    7e-13   Pseudanabaena sp. PCC 6802
ref|WP_010494960.1|  ribosome-associated GTPase EngA                  77.0    8e-13   Paenibacillus elgii
ref|WP_036680709.1|  ribosome-associated GTPase EngA                  77.0    8e-13   Paenibacillus tyrfis
ref|WP_025846395.1|  ribosome-associated GTPase EngA                  77.0    8e-13   Paenibacillus ehimensis
ref|WP_015162474.1|  ribosome-associated GTPase EngA                  77.0    8e-13   Chamaesiphon minutus
ref|WP_015187905.1|  ribosome-associated GTPase EngA                  77.0    9e-13   Gloeocapsa sp. PCC 7428
ref|WP_019122473.1|  ribosome-associated GTPase EngA                  76.6    9e-13   Brevibacillus massiliensis
ref|WP_010690892.1|  ribosome-associated GTPase EngA                  76.6    9e-13   Fructobacillus fructosus
gb|AFH62062.2|  GTP-binding protein Der                               76.6    1e-12   Paenibacillus mucilaginosus K02
ref|WP_018126412.1|  ribosome-associated GTPase EngA                  76.6    1e-12   Balneola vulgaris
ref|WP_014650790.1|  ribosome-associated GTPase EngA                  76.6    1e-12   Paenibacillus mucilaginosus
ref|WP_014370036.1|  ribosome-associated GTPase EngA                  76.6    1e-12   Paenibacillus mucilaginosus
ref|WP_009556849.1|  ribosome-associated GTPase EngA                  76.6    1e-12   Oscillatoriales cyanobacterium JSC-12
ref|WP_029953668.1|  GTPase Der                                       71.6    1e-12   
ref|WP_009631866.1|  ribosome-associated GTPase EngA                  76.6    1e-12   Synechocystis sp. PCC 7509
ref|WP_009629189.1|  ribosome-associated GTPase EngA                  76.3    1e-12   Pseudanabaena biceps
ref|WP_023075386.1|  ribosome-associated GTPase EngA                  76.3    1e-12   Leptolyngbya sp. Heron Island J
ref|WP_015171009.1|  ribosome-associated GTPase EngA                  76.3    1e-12   Geitlerinema sp. PCC 7407
ref|WP_006517461.1|  ribosome-associated GTPase EngA                  76.3    1e-12   Leptolyngbya sp. PCC 7375
ref|WP_023172386.1|  ribosome-associated GTPase EngA                  76.3    1e-12   Gloeobacter kilaueensis
ref|WP_045873105.1|  GTPase Der                                       76.3    1e-12   Nostocales
ref|WP_016876204.1|  ribosome-associated GTPase EngA                  76.3    1e-12   Chlorogloeopsis fritschii
ref|WP_020008349.1|  ribosome-associated GTPase EngA                  76.3    1e-12   Salinicoccus albus
ref|WP_035154056.1|  ribosome-associated GTPase EngA                  76.3    1e-12   Calothrix sp. 336/3
ref|WP_017548929.1|  ribosome-associated GTPase EngA                  76.3    1e-12   Salinicoccus carnicancri
ref|WP_015743770.1|  ribosome-associated GTPase EngA                  76.3    2e-12   
ref|WP_015150727.1|  ribosome-associated GTPase EngA                  76.3    2e-12   Oscillatoria acuminata
ref|WP_033013208.1|  hypothetical protein                             70.9    2e-12   
ref|WP_025956513.1|  hypothetical protein                             73.6    2e-12   
ref|WP_028505583.1|  ribosome-associated GTPase EngA                  75.9    2e-12   Ruminococcus sp. FC2018
ref|WP_015168114.1|  ribosome-associated GTPase EngA                  75.9    2e-12   Synechococcus sp. PCC 7502
dbj|BAQ62868.1|  GTP-binding protein EngA                             75.9    2e-12   Geminocystis sp. NIES-3708
ref|WP_039752516.1|  ribosome-associated GTPase EngA                  75.9    2e-12   
ref|WP_012283044.1|  GTPase Der                                       75.9    2e-12   Heliobacterium modesticaldum
ref|WP_027845405.1|  ribosome-associated GTPase EngA                  75.9    2e-12   Mastigocoleus testarum
ref|WP_015227542.1|  ribosome-associated GTPase EngA                  75.9    2e-12   Halothece sp. PCC 7418
ref|WP_044200424.1|  GTP-binding protein Der                          75.5    2e-12   Oscillochloris trichoides
ref|WP_017294045.1|  ribosome-associated GTPase EngA                  75.5    2e-12   Geminocystis herdmanii
ref|WP_025914220.1|  ribosome-associated GTPase EngA                  75.5    2e-12   
ref|WP_029633792.1|  ribosome-associated GTPase EngA [                75.5    2e-12   [Scytonema hofmanni] UTEX B 1581
ref|WP_027201545.1|  ribosome-associated GTPase EngA                  75.5    2e-12   Butyricimonas virosa
ref|WP_025926052.1|  ribosome-associated GTPase EngA                  75.5    2e-12   
ref|WP_003387108.1|  ribosome-associated GTPase EngA                  75.5    2e-12   Brevibacillus borstelensis
ref|WP_015229104.1|  ribosome-associated GTPase EngA                  75.5    2e-12   Dactylococcopsis salina
ref|WP_023554448.1|  ribosome-associated GTPase EngA                  75.5    3e-12   Brevibacillus panacihumi
ref|WP_009454105.1|  MULTISPECIES: ribosome-associated GTPase EngA    75.5    3e-12   Fischerella thermalis
ref|WP_016865529.1|  ribosome-associated GTPase EngA                  75.5    3e-12   Fischerella muscicola
gb|EFO80464.1|  small GTP-binding protein                             75.5    3e-12   Oscillochloris trichoides DG-6
dbj|BAQ64963.1|  GTP-binding protein EngA                             75.5    3e-12   Geminocystis sp. NIES-3709
ref|WP_011640733.1|  ribosome-associated GTPase EngA                  75.1    3e-12   Syntrophomonas wolfei
ref|WP_011143202.1|  GTPase Der                                       75.1    3e-12   Gloeobacter violaceus
ref|WP_045117204.1|  hypothetical protein                             75.1    3e-12   
ref|WP_015442115.1|  ribosome-associated GTPase EngA                  75.1    3e-12   
ref|WP_007716500.1|  ribosome-associated GTPase EngA                  75.1    3e-12   Brevibacillus
ref|WP_005831336.1|  MULTISPECIES: ribosome-associated GTPase EngA    74.7    4e-12   Bacillales
gb|EDM75385.1|  GTP-binding protein EngA                              75.1    4e-12   Plesiocystis pacifica SIR-1
ref|WP_025843788.1|  ribosome-associated GTPase EngA                  74.7    4e-12   Brevibacillus agri
ref|WP_022134734.1|  ribosome-associated GTPase EngA                  74.7    4e-12   
ref|WP_015222487.1|  ribosome-associated GTPase EngA                  75.1    4e-12   
ref|WP_012686135.1|  GTPase Der                                       74.7    4e-12   Brevibacillus brevis
ref|WP_012408391.1|  GTPase Der                                       74.7    4e-12   Nostoc punctiforme
ref|WP_016740012.1|  ribosome-associated GTPase EngA                  74.7    4e-12   Bacillales
ref|WP_017661046.1|  ribosome-associated GTPase EngA                  74.7    4e-12   Geitlerinema sp. PCC 7105
ref|WP_017319096.1|  ribosome-associated GTPase EngA                  74.7    4e-12   Mastigocladopsis repens
ref|WP_039715879.1|  ribosome-associated GTPase EngA                  74.7    4e-12   
ref|WP_008484261.1|  ribosome-associated GTPase EngA                  74.7    4e-12   Gallaecimonas xiamenensis
ref|WP_015153762.1|  ribosome-associated GTPase EngA                  74.7    4e-12   Chroococcidiopsis
ref|WP_008311305.1|  ribosome-associated GTPase EngA                  74.7    4e-12   Leptolyngbya sp. PCC 6406
ref|WP_025699726.1|  hypothetical protein                             71.6    5e-12   
ref|WP_017248099.1|  ribosome-associated GTPase EngA                  74.7    5e-12   Brevibacillus brevis
ref|WP_002853418.1|  ribosome-associated GTPase EngA                  74.7    5e-12   Ruminococcus albus
ref|WP_045658516.1|  GTP-binding protein Der                          74.7    5e-12   
ref|WP_013498779.1|  ribosome-associated GTPase EngA                  74.7    5e-12   Ruminococcus albus
ref|WP_029099585.1|  MULTISPECIES: ribosome-associated GTPase EngA    74.7    5e-12   Bacillales
ref|WP_040870722.1|  GTP-binding protein Der                          70.1    5e-12   
gb|EPC77340.1|  GTP-binding protein Der                               73.2    5e-12   Lactobacillus paracasei subsp. paracasei Lpp71
ref|WP_013278017.1|  ribosome-associated GTPase EngA                  74.3    5e-12   Acetohalobium arabaticum
ref|WP_016953465.1|  ribosome-associated GTPase EngA                  74.3    5e-12   Anabaena sp. PCC 7108
ref|WP_024856398.1|  ribosome-associated GTPase EngA                  74.3    5e-12   Ruminococcus albus
ref|WP_009325429.1|  ribosome-associated GTPase EngA                  74.3    5e-12   Subdoligranulum sp. 4_3_54A2FAA
ref|WP_037290270.1|  ribosome-associated GTPase EngA                  74.3    6e-12   Ruminococcus albus
ref|WP_041337160.1|  ribosome-associated GTPase EngA                  74.3    6e-12   Ruminococcus bicirculans
ref|WP_022287397.1|  ribosome-associated GTPase EngA                  74.3    6e-12   Ruminococcus sp. AF19-15
gb|KJF39513.1|  GTP-binding protein Der                               74.3    6e-12   Ruthenibacterium lactatiformans
ref|WP_012598288.1|  GTPase Der                                       74.3    6e-12   Cyanothece sp. PCC 7424
ref|WP_007442121.1|  GTP-binding protein EngA                         70.1    6e-12   
ref|WP_025929814.1|  ribosome-associated GTPase EngA                  74.3    6e-12   
ref|WP_027334347.1|  ribosome-associated GTPase EngA                  74.3    6e-12   Mycoplasma elephantis
ref|WP_033101440.1|  ribosome-associated GTPase EngA                  74.3    7e-12   Thermoactinomyces daqus
ref|WP_027718750.1|  ribosome-associated GTPase EngA                  74.3    7e-12   Desulfovirgula thermocuniculi
ref|WP_031414482.1|  ribosome-associated GTPase EngA                  73.9    7e-12   Brevibacillus
ref|WP_022583887.1|  ribosome-associated GTPase EngA                  73.9    7e-12   Brevibacillus laterosporus
ref|WP_039202145.1|  ribosome-associated GTPase EngA                  74.3    7e-12   Nostocales
ref|WP_019488832.1|  ribosome-associated GTPase EngA                  74.3    7e-12   Calothrix sp. PCC 7103
ref|WP_018670146.1|  ribosome-associated GTPase EngA                  73.9    7e-12   Brevibacillus laterosporus
ref|WP_015131793.1|  ribosome-associated GTPase EngA                  73.9    7e-12   Calothrix sp. PCC 7507
ref|WP_027401964.1|  ribosome-associated GTPase EngA                  73.9    7e-12   Aphanizomenon flos-aquae
ref|WP_015078384.1|  ribosome-associated GTPase EngA                  73.9    7e-12   Anabaena sp. 90
ref|WP_016859054.1|  ribosome-associated GTPase EngA                  73.9    7e-12   Fischerella muscicola
ref|WP_022738443.1|  ribosome-associated GTPase EngA                  73.9    7e-12   Laceyella sediminis
ref|WP_003341821.1|  ribosome-associated GTPase EngA                  73.9    7e-12   Brevibacillus laterosporus
ref|WP_003338515.1|  ribosome-associated GTPase EngA                  73.9    7e-12   Brevibacillus laterosporus
ref|WP_028082829.1|  ribosome-associated GTPase EngA                  73.9    7e-12   Dolichospermum circinale
ref|WP_028091329.1|  ribosome-associated GTPase EngA                  73.9    7e-12   Dolichospermum circinale
ref|WP_013406044.1|  ribosome-associated GTPase EngA                  73.9    8e-12   Halanaerobium hydrogeniformans
ref|WP_038015372.1|  ribosome-associated GTPase EngA                  73.9    8e-12   Synechococcus sp. PCC 7335
ref|WP_017309647.1|  ribosome-associated GTPase EngA                  73.9    8e-12   Fischerella sp. PCC 9339
gb|EIA23616.1|  GTP-binding protein engA                              71.2    8e-12   Candidatus Arthromitus sp. SFB-3
ref|WP_026721377.1|  ribosome-associated GTPase EngA                  73.9    8e-12   Fischerella sp. PCC 9431
ref|WP_038474925.1|  ribosome-associated GTPase EngA                  73.9    8e-12   Fimbriimonas ginsengisoli
ref|WP_040104714.1|  ribosome-associated GTPase EngA                  73.9    8e-12   Salinicoccus roseus
ref|WP_031544861.1|  ribosome-associated GTPase EngA                  73.9    8e-12   Salinicoccus luteus
ref|WP_028509684.1|  ribosome-associated GTPase EngA                  73.9    8e-12   Ruminococcus sp. NK3A76
gb|AIE85441.1|  GTP-binding protein EngA                              73.9    8e-12   Fimbriimonas ginsengisoli Gsoil 348
ref|WP_025964619.1|  GTPase Der                                       73.9    8e-12   
ref|WP_015142441.1|  ribosome-associated GTPase EngA                  73.9    8e-12   Pleurocapsa minor
ref|WP_014432991.1|  ribosome-associated GTPase EngA                  73.9    9e-12   Caldilinea aerophila
ref|WP_017653411.1|  ribosome-associated GTPase EngA                  73.9    9e-12   Fortiea contorta
ref|WP_022475896.1|  ribosome-associated GTPase EngA                  73.9    9e-12   
ref|WP_015112943.1|  ribosome-associated GTPase EngA                  73.9    9e-12   Nostoc sp. PCC 7107
ref|WP_012194942.1|  GTPase Der                                       73.9    9e-12   Prochlorococcus marinus
ref|WP_026858078.1|  ribosome-associated GTPase EngA                  73.6    9e-12   Jeotgalicoccus psychrophilus
ref|WP_025947728.1|  ribosome-associated GTPase EngA                  73.6    9e-12   
ref|WP_015197239.1|  ribosome-associated GTPase EngA                  73.6    1e-11   Calothrix parietina
dbj|GAL21620.1|  GTP-binding protein EngA                             69.7    1e-11   Vibrio maritimus
ref|WP_028110930.1|  ribosome-associated GTPase EngA                  73.9    1e-11   Ferrimonas futtsuensis
ref|WP_013579241.1|  ribosome-associated GTPase EngA                  73.9    1e-11   Granulicella tundricola
gb|EHO16864.1|  GTPase Der                                            70.1    1e-11   Fusobacterium necrophorum subsp. funduliforme 1_1_36S
ref|WP_009341396.1|  ribosome-associated GTPase EngA                  73.6    1e-11   Aphanizomenonaceae
ref|WP_025933176.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_013322855.1|  ribosome-associated GTPase EngA                  73.6    1e-11   Cyanothece sp. PCC 7822
gb|KIG11844.1|  GTP-binding protein EngA                              73.6    1e-11   Enhygromyxa salina
ref|WP_039726093.1|  MULTISPECIES: ribosome-associated GTPase EngA    73.6    1e-11   Lyngbya confervoides
ref|WP_017290366.1|  ribosome-associated GTPase EngA                  73.6    1e-11   Leptolyngbya boryana
ref|WP_025971786.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_025953462.1|  GTPase Der                                       73.6    1e-11   
gb|ABE10748.1|  GTP-binding protein                                   73.6    1e-11   uncultured Prochlorococcus marinus clone ASNC1092
ref|WP_036482751.1|  ribosome-associated GTPase EngA                  73.6    1e-11   Myxosarcina sp. GI1
ref|WP_013386690.1|  ribosome-associated GTPase EngA                  73.6    1e-11   Ilyobacter polytropus
ref|WP_006277473.1|  ribosome-associated GTPase EngA                  73.6    1e-11   Cylindrospermopsis raciborskii
ref|WP_025952411.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_025931428.1|  MULTISPECIES: GTPase Der                         73.6    1e-11   
ref|WP_032524108.1|  ribosome-associated GTPase EngA                  73.6    1e-11   Prochlorococcus marinus
ref|WP_025955243.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_025924200.1|  GTPase Der                                       73.6    1e-11   
ref|WP_022511065.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_025929191.1|  MULTISPECIES: GTPase Der                         73.6    1e-11   
ref|WP_002807087.1|  GTPase Der                                       73.6    1e-11   Prochlorococcus marinus
gb|ABE10882.1|  GTP-binding protein                                   73.6    1e-11   uncultured Prochlorococcus marinus clone ASNC2259
ref|WP_025942178.1|  MULTISPECIES: GTPase Der                         73.6    1e-11   
ref|WP_024125807.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_025941350.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_025906324.1|  MULTISPECIES: ribosome-associated GTPase EngA    73.6    1e-11   
ref|WP_011817902.1|  GTPase Der                                       73.6    1e-11   
ref|WP_011413185.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_011862416.1|  MULTISPECIES: GTPase Der                         73.6    1e-11   
ref|WP_015185061.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_011375948.1|  GTPase Der                                       73.6    1e-11   
ref|WP_032517522.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_025945041.1|  MULTISPECIES: ribosome-associated GTPase EngA    73.6    1e-11   
ref|WP_012007226.1|  GTPase Der                                       73.6    1e-11   
ref|WP_006198540.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_026207701.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_032526702.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
gb|ABE11270.1|  GTP-binding protein                                   73.6    1e-11   
ref|WP_032519539.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_032515588.1|  MULTISPECIES: ribosome-associated GTPase EngA    73.6    1e-11   
ref|WP_025959358.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_025880612.1|  GTPase Der                                       73.6    1e-11   
ref|WP_028517327.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_025960871.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_025821993.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_005686431.1|  ribosome-associated GTPase EngA                  73.2    1e-11   
ref|WP_025962830.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_003598629.1|  MULTISPECIES: GTPase Der                         73.2    1e-11   
ref|WP_019678747.1|  ribosome-associated GTPase EngA                  73.2    1e-11   
ref|WP_011056722.1|  GTPase Der                                       73.2    1e-11   
gb|KIE12801.1|  GTPase Der                                            73.2    1e-11   
ref|WP_011319645.1|  GTPase Der                                       73.2    1e-11   
ref|WP_010994659.1|  GTPase Der                                       73.2    1e-11   
ref|WP_005503742.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_025944471.1|  ribosome-associated GTPase EngA                  73.2    1e-11   
ref|WP_035808789.1|  ribosome-associated GTPase EngA                  73.2    1e-11   
ref|WP_011919654.1|  GTPase Der                                       73.6    1e-11   
ref|WP_025013430.1|  MULTISPECIES: ribosome-associated GTPase EngA    73.2    1e-11   
ref|WP_009982832.1|  ribosome-associated GTPase EngA                  73.2    1e-11   
ref|WP_010488434.1|  ribosome-associated GTPase EngA                  73.2    1e-11   
ref|WP_028775761.1|  ribosome-associated GTPase EngA                  73.2    1e-11   
ref|WP_039977774.1|  GTPase Der                                       73.6    1e-11   
ref|WP_037420678.1|  MULTISPECIES: GTPase Der                         73.6    1e-11   
ref|WP_011622020.1|  MULTISPECIES: GTPase Der                         73.6    1e-11   
ref|WP_011625655.1|  GTPase Der                                       73.6    1e-11   
ref|WP_022029670.1|  ribosome-associated GTPase EngA                  73.2    1e-11   
ref|WP_011073184.1|  GTPase Der                                       73.6    1e-11   
ref|WP_011788708.1|  GTPase Der                                       73.6    1e-11   
ref|WP_017004668.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_029494200.1|  ribosome-associated GTPase EngA                  73.2    1e-11   
ref|WP_028548683.1|  ribosome-associated GTPase EngA                  73.2    1e-11   
gb|EFB57351.1|  GTP-binding protein                                   67.8    1e-11   
ref|WP_009837779.1|  ribosome-associated GTPase EngA                  73.6    1e-11   
ref|WP_007646318.1|  ribosome-associated GTPase EngA                  73.2    1e-11   
ref|WP_006511906.1|  ribosome-associated GTPase EngA                  73.2    1e-11   
ref|WP_035987429.1|  ribosome-associated GTPase EngA                  73.2    1e-11   
ref|WP_025967862.1|  ribosome-associated GTPase EngA                  73.2    1e-11   
ref|WP_015739212.1|  ribosome-associated GTPase EngA                  73.2    1e-11   
ref|WP_038480286.1|  ribosome-associated GTPase EngA                  73.2    1e-11   
dbj|GAF14341.1|  LOW QUALITY PROTEIN: GTP-binding protein EngA        73.2    1e-11   
ref|WP_011244073.1|  MULTISPECIES: GTPase Der                         73.2    1e-11   
ref|WP_032513998.1|  ribosome-associated GTPase EngA                  73.2    1e-11   
ref|WP_038470813.1|  ribosome-associated GTPase EngA                  73.2    1e-11   
ref|WP_028520601.1|  ribosome-associated GTPase EngA                  73.2    1e-11   
ref|WP_035442009.1|  ribosome-associated GTPase EngA                  73.2    1e-11   
ref|WP_011819770.1|  GTPase Der                                       73.2    1e-11   
ref|WP_011847341.1|  GTPase Der                                       73.2    1e-11   
ref|WP_016369012.1|  ribosome-associated GTPase EngA                  71.6    2e-11   
ref|WP_039874968.1|  ribosome-associated GTPase EngA                  73.2    2e-11   
ref|WP_026025127.1|  ribosome-associated GTPase EngA                  73.2    2e-11   
ref|WP_012141783.1|  GTPase Der                                       73.2    2e-11   
ref|WP_006082478.1|  MULTISPECIES: GTPase Der                         73.2    2e-11   
ref|WP_042178247.1|  ribosome-associated GTPase EngA                  73.2    2e-11   
ref|WP_039849687.1|  ribosome-associated GTPase EngA                  73.2    2e-11   
ref|WP_026024790.1|  ribosome-associated GTPase EngA                  73.2    2e-11   
ref|WP_020427711.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_022102447.1|  ribosome-associated GTPase EngA                  73.2    2e-11   
ref|WP_044973754.1|  GTP-binding protein Der                          73.2    2e-11   
ref|WP_042203302.1|  ribosome-associated GTPase EngA                  73.2    2e-11   
gb|ESE41870.1|  gtp-binding protein                                   73.2    2e-11   
ref|WP_026024456.1|  ribosome-associated GTPase EngA                  73.2    2e-11   
ref|WP_015121858.1|  ribosome-associated GTPase EngA                  73.2    2e-11   
ref|WP_024859402.1|  ribosome-associated GTPase EngA                  73.2    2e-11   
ref|WP_040928145.1|  ribosome-associated GTPase EngA                  73.2    2e-11   
ref|WP_024594676.1|  GTP-binding protein EngA                         68.2    2e-11   
ref|WP_009136616.1|  MULTISPECIES: ribosome-associated GTPase EngA    73.2    2e-11   
ref|WP_042129594.1|  ribosome-associated GTPase EngA                  73.2    2e-11   
ref|WP_023051168.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_028514387.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_041038340.1|  ribosome-associated GTPase EngA                  73.2    2e-11   
ref|WP_011636594.1|  GTPase Der                                       73.2    2e-11   
ref|WP_031560703.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_022127321.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_005949269.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_008470352.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_015557613.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_042138631.1|  MULTISPECIES: ribosome-associated GTPase EngA    72.8    2e-11   
ref|WP_005979274.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_026689467.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_044876416.1|  GTP-binding protein Der                          72.8    2e-11   
ref|WP_042237654.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_037995291.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_039301779.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
gb|EKD31403.1|  GTP-binding protein engA                              67.4    2e-11   
ref|WP_003565361.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_038594536.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_019909953.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_036727327.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_015254751.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_011246719.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_036698150.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_011495705.1|  GTPase Der                                       72.8    2e-11   
ref|WP_035204261.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_014552973.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
gb|EFP62337.1|  ribosome-associated GTPase EngA                       69.7    2e-11   
ref|WP_032521847.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_016409626.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_011956873.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
gb|AIV03820.1|  GTP-binding protein EngA                              72.8    2e-11   
gb|KFE60450.1|  GTP-binding protein EngA                              72.8    2e-11   
dbj|BAD64411.1|  EngA subfamily GTP-binding protein                   72.8    2e-11   
ref|WP_039835102.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_025709306.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_020715263.1|  ribosome-associated GTPase EngA                  73.2    2e-11   
ref|WP_012871766.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_022282528.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_038697069.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_022267030.1|  GTPase Der                                       70.1    2e-11   
gb|KGE62594.1|  GTPase Der                                            72.8    2e-11   
ref|WP_022494372.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_042190218.1|  ribosome-associated GTPase EngA                  72.4    2e-11   
ref|WP_026232009.1|  ribosome-associated GTPase EngA                  72.4    2e-11   
ref|WP_012627022.1|  GTPase Der                                       72.8    2e-11   
ref|WP_036676212.1|  MULTISPECIES: ribosome-associated GTPase EngA    72.4    2e-11   
ref|WP_040394974.1|  GTP-binding protein Der                          67.0    2e-11   
ref|WP_028114565.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_025863173.1|  ribosome-associated GTPase EngA                  72.4    2e-11   
ref|WP_013048467.1|  ribosome-associated GTPase EngA                  72.4    2e-11   
ref|WP_036597000.1|  MULTISPECIES: ribosome-associated GTPase EngA    72.4    2e-11   
ref|WP_025688014.1|  ribosome-associated GTPase EngA                  72.4    2e-11   
ref|WP_019534078.1|  ribosome-associated GTPase EngA                  72.4    2e-11   
gb|EKN40825.1|  GTP-binding protein Der                               70.1    2e-11   
ref|WP_025698623.1|  ribosome-associated GTPase EngA                  72.4    2e-11   
ref|WP_042228471.1|  ribosome-associated GTPase EngA                  72.4    2e-11   
ref|WP_012121999.1|  ribosome-associated GTPase EngA                  72.8    2e-11   
ref|WP_010273886.1|  ribosome-associated GTPase EngA                  72.4    3e-11   
ref|WP_009671990.1|  MULTISPECIES: ribosome-associated GTPase EngA    72.4    3e-11   
gb|EFE46913.1|  ribosome-associated GTPase EngA                       72.4    3e-11   
ref|WP_005883839.1|  ribosome-associated GTPase EngA                  72.4    3e-11   
ref|WP_012953913.1|  ribosome-associated GTPase EngA                  72.4    3e-11   
ref|WP_022481141.1|  ribosome-associated GTPase EngA                  72.4    3e-11   
emb|CCF82958.1|  GTP-binding protein engA                             72.4    3e-11   
ref|WP_012191099.1|  GTPase Der                                       72.4    3e-11   
ref|WP_038324110.1|  ribosome-associated GTPase EngA                  72.4    3e-11   
ref|WP_022410327.1|  ribosome-associated GTPase EngA                  72.4    3e-11   
ref|WP_035408800.1|  ribosome-associated GTPase EngA                  72.4    3e-11   
ref|WP_036709982.1|  ribosome-associated GTPase EngA                  72.4    3e-11   
ref|WP_013442485.1|  MULTISPECIES: ribosome-associated GTPase EngA    72.4    3e-11   
ref|WP_028023710.1|  ribosome-associated GTPase EngA                  72.4    3e-11   
ref|WP_029420289.1|  ribosome-associated GTPase EngA                  72.4    3e-11   
ref|WP_020616696.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
ref|WP_022792280.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
ref|WP_005888568.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
ref|WP_002754265.1|  ribosome-associated GTPase EngA                  72.4    3e-11   
ref|WP_025362902.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
ref|WP_040666290.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
ref|WP_013975588.1|  ribosome-associated GTPase EngA                  72.4    3e-11   
ref|WP_027128374.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
ref|WP_002774782.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
ref|WP_035996465.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
ref|WP_017299024.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
ref|WP_003658250.1|  GTPase Der                                       72.0    3e-11   
ref|WP_019898657.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
ref|WP_002741006.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
ref|WP_003570284.1|  MULTISPECIES: GTPase Der                         72.0    3e-11   
ref|WP_002766078.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
ref|WP_019885951.1|  GTPase Der                                       72.0    3e-11   
ref|WP_003605113.1|  GTPase Der                                       72.0    3e-11   
ref|WP_002735647.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
ref|WP_004268090.1|  GTPase Der                                       72.0    3e-11   
ref|WP_008205619.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
ref|WP_035501462.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
ref|WP_016482379.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
ref|WP_040615056.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
ref|WP_002782109.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
ref|WP_002761352.1|  GTPase Der                                       72.0    3e-11   
ref|WP_017743501.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
ref|WP_009006030.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
ref|WP_016384854.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
gb|EDP46274.1|  GTP-binding protein EngA                              72.0    3e-11   
ref|WP_022429051.1|  ribosome-associated GTPase EngA                  72.0    3e-11   
gb|EFS22211.1|  ribosome biogenesis GTPase Der                        72.0    3e-11   
ref|WP_003590669.1|  MULTISPECIES: GTPase Der                         72.0    3e-11   
ref|WP_011366249.1|  ribosome-associated GTPase EngA                  72.0    4e-11   
ref|WP_044107095.1|  GTPase Der                                       72.0    4e-11   
ref|WP_016517273.1|  ribosome-associated GTPase EngA                  72.0    4e-11   
gb|EEI67249.1|  ribosome biogenesis GTPase Der                        72.0    4e-11   
ref|WP_040054265.1|  ribosome-associated GTPase EngA                  72.0    4e-11   
ref|WP_017323038.1|  ribosome-associated GTPase EngA                  72.0    4e-11   
ref|WP_035932490.1|  ribosome-associated GTPase EngA                  72.0    4e-11   
ref|WP_027182070.1|  ribosome-associated GTPase EngA                  72.0    4e-11   
ref|WP_028403642.1|  ribosome-associated GTPase EngA                  72.0    4e-11   
ref|WP_009595099.1|  MULTISPECIES: ribosome-associated GTPase EngA    72.0    4e-11   
ref|WP_006209453.1|  MULTISPECIES: ribosome-associated GTPase EngA    72.0    4e-11   
ref|WP_005959365.1|  ribosome-associated GTPase EngA                  72.0    4e-11   
ref|WP_023957189.1|  ribosome-associated GTPase EngA                  72.0    4e-11   
ref|WP_007129806.1|  ribosome-associated GTPase EngA                  72.0    4e-11   
ref|WP_035901129.1|  ribosome-associated GTPase EngA                  72.0    4e-11   
ref|WP_018707152.1|  ribosome-associated GTPase EngA                  72.0    4e-11   
ref|WP_013822915.1|  ribosome-associated GTPase EngA                  72.0    4e-11   
ref|WP_037465183.1|  GTP-binding protein Der                          69.3    4e-11   
ref|WP_022188752.1|  ribosome-associated GTPase EngA                  72.0    4e-11   
ref|WP_013231668.1|  ribosome-associated GTPase EngA                  72.0    4e-11   
ref|WP_019005493.1|  ribosome-associated GTPase EngA                  71.6    4e-11   
ref|WP_041569683.1|  ribosome-associated GTPase EngA                  72.0    4e-11   
ref|WP_003579082.1|  ribosome-associated GTPase EngA                  71.6    4e-11   
ref|WP_017028336.1|  ribosome-associated GTPase EngA                  72.0    4e-11   
ref|WP_026387081.1|  ribosome-associated GTPase EngA                  72.0    4e-11   
ref|WP_010687742.1|  ribosome-associated GTPase EngA                  71.6    4e-11   
ref|WP_042359164.1|  MULTISPECIES: ribosome-associated GTPase EngA    71.6    4e-11   
ref|WP_029509280.1|  ribosome-associated GTPase EngA                  71.6    4e-11   
ref|WP_045174251.1|  GTP-binding protein Der                          71.6    4e-11   
ref|WP_010000209.1|  ribosome-associated GTPase EngA                  71.6    4e-11   
ref|WP_015178472.1|  ribosome-associated GTPase EngA                  71.6    4e-11   



>ref|XP_012089992.1| PREDICTED: uncharacterized protein LOC105648271 [Jatropha curcas]
 gb|KDP22086.1| hypothetical protein JCGZ_25917 [Jatropha curcas]
Length=642

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 86/99 (87%), Gaps = 1/99 (1%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTS-SVPDHLLPKVVIVGRPNVGKS  589
            A+ A RE+S SLSRQLR +D+   +KETRK KR K+TS  +PDHLLP+V IVGRPNVGKS
Sbjct  101  AEDAVREYSSSLSRQLRIDDEIDDKKETRKHKRQKATSPEIPDHLLPRVAIVGRPNVGKS  160

Query  590  ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGE EFMVV
Sbjct  161  ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGENEFMVV  199



>ref|XP_002513491.1| GTP-binding protein enga, putative [Ricinus communis]
 gb|EEF48894.1| GTP-binding protein enga, putative [Ricinus communis]
Length=624

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/99 (77%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTS-SVPDHLLPKVVIVGRPNVGKS  589
            A+   RE+S SLSRQLR EDD   +KETRKQKR K T   +PD+LLP+V IVGRPNVGKS
Sbjct  95   AEDVVREYSTSLSRQLRIEDDSDDKKETRKQKRQKFTIPDIPDNLLPRVAIVGRPNVGKS  154

Query  590  ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            ALFNRLVGGN+AIVVDEPGVTRDRLYGRSFWG++EFMVV
Sbjct  155  ALFNRLVGGNKAIVVDEPGVTRDRLYGRSFWGDFEFMVV  193



>ref|XP_010102336.1| GTPase Der [Morus notabilis]
 gb|EXB93297.1| GTPase Der [Morus notabilis]
Length=661

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 85/100 (85%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKET-RKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  586
            A  A R+FS SLS QL+ ED+K   KE  RKQKR KST  S+PDHLLPKV IVGRPNVGK
Sbjct  103  ALDAVRDFSSSLSNQLKIEDEKIDHKEIGRKQKRHKSTVKSIPDHLLPKVAIVGRPNVGK  162

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWG+YEFMV+
Sbjct  163  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGDYEFMVI  202


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  536  DHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            +  +P + IVGRPNVGKS++ N LVG +RAIV    G TRD +
Sbjct  354  EDYIPAMAIVGRPNVGKSSILNALVGEDRAIVSPVSGTTRDAI  396



>ref|XP_002314070.2| hypothetical protein POPTR_0009s05900g [Populus trichocarpa]
 gb|EEE88025.2| hypothetical protein POPTR_0009s05900g [Populus trichocarpa]
Length=651

 Score =   158 bits (399),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/97 (79%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTS-SVPDHLLPKVVIVGRPNVGKS  589
            AK A +E S SLSRQL  EDD   ++E+RKQKR K+TS  +PDHLLPKV IVGRPNVGKS
Sbjct  103  AKFAVKELSTSLSRQLTIEDDTDEKRESRKQKRKKATSKDIPDHLLPKVAIVGRPNVGKS  162

Query  590  ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFM  700
            ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGE+EFM
Sbjct  163  ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEHEFM  199



>ref|XP_011090367.1| PREDICTED: uncharacterized protein LOC105171060 [Sesamum indicum]
Length=657

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 89/100 (89%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKST-SSVPDHLLPKVVIVGRPNVGK  586
            AKQ  ++FS SLSR+L+ EDD + +KETR KQKR  +T S++PDHLLP+V IVGRPNVGK
Sbjct  109  AKQVVKDFSVSLSRELKIEDDVSNQKETRGKQKRRTNTGSNIPDHLLPRVAIVGRPNVGK  168

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGGN+AIVVDEPGVTRDRLYGR++WG+YEFMVV
Sbjct  169  SALFNRLVGGNKAIVVDEPGVTRDRLYGRAYWGDYEFMVV  208


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/53 (47%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  506  KRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            K+L+ T +  +  +P + IVGRPNVGKS++ N LVG +R IV    G TRD +
Sbjct  348  KKLEETENHVEEYVPAIAIVGRPNVGKSSILNALVGEDRTIVSPISGTTRDAI  400



>gb|EYU26176.1| hypothetical protein MIMGU_mgv1a002590mg [Erythranthe guttata]
Length=656

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/100 (72%), Positives = 87/100 (87%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR--KQKRLKSTSSVPDHLLPKVVIVGRPNVGK  586
            AK+A +EFS+SL+R+L+ ED+   +K TR  +Q R+ + S++PDHLLP+V IVGRPNVGK
Sbjct  107  AKEAVKEFSDSLARELKIEDEVPNQKRTRGRQQPRITTVSNIPDHLLPRVAIVGRPNVGK  166

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGGN+AIVVDEPGVTRDRLYGR FWGEYEFMVV
Sbjct  167  SALFNRLVGGNKAIVVDEPGVTRDRLYGRGFWGEYEFMVV  206


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            +P + IVGRPNVGKS++ N LVG +R IV    G TRD +
Sbjct  360  IPSIAIVGRPNVGKSSILNALVGEDRTIVSPVSGTTRDAI  399



>ref|XP_011025525.1| PREDICTED: uncharacterized protein LOC105126373 [Populus euphratica]
Length=651

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 76/97 (78%), Positives = 84/97 (87%), Gaps = 1/97 (1%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTS-SVPDHLLPKVVIVGRPNVGKS  589
            AK A +E S SLSRQL  ED+   ++E+RKQKR K+TS  +PDHLLPKV IVGRPNVGKS
Sbjct  103  AKFAVKELSTSLSRQLTIEDETDEKRESRKQKRKKATSKDIPDHLLPKVAIVGRPNVGKS  162

Query  590  ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFM  700
            ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGE+EFM
Sbjct  163  ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEHEFM  199



>ref|XP_007214806.1| hypothetical protein PRUPE_ppa023138m1g, partial [Prunus persica]
 gb|EMJ16005.1| hypothetical protein PRUPE_ppa023138m1g, partial [Prunus persica]
Length=396

 Score =   150 bits (379),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 85/100 (85%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKET-RKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  586
            A+   +EFS SLS QLR ED+K  ++E  RKQ+R KST  S+PDHLLP+V IVGRPNVGK
Sbjct  39   ARYVVQEFSSSLSSQLRIEDEKDDQEEVGRKQRRHKSTVKSIPDHLLPRVAIVGRPNVGK  98

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLV GN+AIVVDEPGVTRDRLYGRSFWG++EFMVV
Sbjct  99   SALFNRLVSGNKAIVVDEPGVTRDRLYGRSFWGDHEFMVV  138



>emb|CDP04574.1| unnamed protein product [Coffea canephora]
Length=659

 Score =   152 bits (383),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 85/100 (85%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKET--RKQKRLKSTSSVPDHLLPKVVIVGRPNVGK  586
            AK A +EFS++LSRQL  EDD   +KET  +++K   S  ++PDHLLP+V IVGRPNVGK
Sbjct  109  AKFAVKEFSDALSRQLTIEDDPVDQKETSIKRRKHKSSAKNIPDHLLPRVTIVGRPNVGK  168

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGGN+AIVVDEPGVTRDRLYGRSFWG+YEF+V+
Sbjct  169  SALFNRLVGGNKAIVVDEPGVTRDRLYGRSFWGDYEFLVI  208



>ref|XP_009347314.1| PREDICTED: uncharacterized protein LOC103938985 [Pyrus x bretschneideri]
 ref|XP_009347317.1| PREDICTED: uncharacterized protein LOC103938988 [Pyrus x bretschneideri]
Length=659

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKST-SSVPDHLLPKVVIVGRPNVGKS  589
            A+    EFS SLS QLR +D+   EK +RKQ+RL ST  ++PDHLLP+V IVGRPNVGKS
Sbjct  111  ARYVVEEFSSSLSTQLRIDDNDDQEKVSRKQRRLTSTVKTIPDHLLPRVAIVGRPNVGKS  170

Query  590  ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            ALFNRLV GN+AIVVDEPGVTRDRLYGRSFWG++EFMVV
Sbjct  171  ALFNRLVSGNKAIVVDEPGVTRDRLYGRSFWGDHEFMVV  209



>ref|XP_009376882.1| PREDICTED: uncharacterized protein LOC103965542 [Pyrus x bretschneideri]
Length=659

 Score =   150 bits (380),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/99 (73%), Positives = 83/99 (84%), Gaps = 1/99 (1%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKST-SSVPDHLLPKVVIVGRPNVGKS  589
            A+    EFS SLS QLR +D+   EK +RKQ+RL ST  ++PDHLLP+V IVGRPNVGKS
Sbjct  111  ARYVVEEFSSSLSTQLRIDDNDDQEKVSRKQRRLTSTVKTIPDHLLPRVAIVGRPNVGKS  170

Query  590  ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            ALFNRLV GN+AIVVDEPGVTRDRLYGRSFWG++EFMVV
Sbjct  171  ALFNRLVSGNKAIVVDEPGVTRDRLYGRSFWGDHEFMVV  209



>ref|XP_006361748.1| PREDICTED: uncharacterized protein LOC102597805 [Solanum tuberosum]
Length=646

 Score =   150 bits (378),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 120/164 (73%), Gaps = 10/164 (6%)
 Frame = +2

Query  236  HRRRRCCFLNFSRRHCLPPAA----AQFYGeeeveedelleiegsdaeddeeesldvdsl  403
            H  RRC   N SR  CLPPA     ++    +E+ E    E E      ++E++LDVDSL
Sbjct  36   HHLRRC---NLSRSFCLPPAVQLSTSREDDGDEMVEIGGSEFEEEVDYAEDEDTLDVDSL  92

Query  404  ereAKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTSS--VPDHLLPKVVIVGRP  574
            EREA+   REFS+SLSRQL  E++++  KE + K+KR K+T+S  +PDHLLPKV IVGRP
Sbjct  93   EREAQLVVREFSDSLSRQLIIEEERSSPKEAQVKEKRRKNTTSKNIPDHLLPKVAIVGRP  152

Query  575  NVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            NVGKSALFNRLVGG +AIVVDEPGVTRDRLYGRS+WG YEFMVV
Sbjct  153  NVGKSALFNRLVGGKKAIVVDEPGVTRDRLYGRSYWGNYEFMVV  196



>ref|XP_004250946.1| PREDICTED: uncharacterized protein LOC101251249 [Solanum lycopersicum]
Length=645

 Score =   149 bits (376),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 112/163 (69%), Gaps = 9/163 (6%)
 Frame = +2

Query  236  HRRRRCCFLNFSRRHCLPPAAAQFYGeeeveedelleiegsdaeddeeesldvdslereA  415
            H  RRC   N SR  CLPPA       E+ +E   +     + EDD  E  D   ++   
Sbjct  36   HHFRRC---NLSRSFCLPPAVQLSTSREDEDEMVDIGGSEYEEEDDYAEDEDTLDVDSLE  92

Query  416  KQA---AREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTSS--VPDHLLPKVVIVGRPN  577
            ++A    REFS+SLSRQL  E++++  KE + K+KR K+T++  +PDHLLPKV IVGRPN
Sbjct  93   REAQLVVREFSDSLSRQLIIEEERSSPKEAQVKEKRRKNTTTKNIPDHLLPKVAIVGRPN  152

Query  578  VGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            VGKSALFNRLVGG +AIVVDEPGVTRDRLYGRS+WG YEFMVV
Sbjct  153  VGKSALFNRLVGGKKAIVVDEPGVTRDRLYGRSYWGNYEFMVV  195


 Score = 50.1 bits (118),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/43 (51%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  536  DHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            ++ +P + IVGRPNVGKS++ N LVG +R IV    G TRD +
Sbjct  346  ENYIPAIAIVGRPNVGKSSILNALVGEDRTIVSPVSGTTRDAI  388



>ref|XP_002282837.2| PREDICTED: uncharacterized protein LOC100260310 isoform X2 [Vitis 
vinifera]
Length=676

 Score =   149 bits (377),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 85/101 (84%), Gaps = 3/101 (3%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR--KQKRLKSTS-SVPDHLLPKVVIVGRPNVG  583
            AK A RE+S  LSRQL  E+D   E + R  KQK+ KST+ ++PDHLLP+V IVGRPNVG
Sbjct  125  AKHAVREYSRFLSRQLSIEEDGANELKGRGGKQKKSKSTTRNIPDHLLPRVTIVGRPNVG  184

Query  584  KSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            KSALFNRLVGGN+AIVVDEPGVTRDRLYGR+FWG+YEFMV+
Sbjct  185  KSALFNRLVGGNKAIVVDEPGVTRDRLYGRAFWGDYEFMVI  225



>ref|XP_010257319.1| PREDICTED: uncharacterized protein LOC104597468 isoform X3 [Nelumbo 
nucifera]
Length=673

 Score =   149 bits (376),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 86/99 (87%), Gaps = 1/99 (1%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTS-SVPDHLLPKVVIVGRPNVGKS  589
            AK A RE++ SLS +L  ED   G+K++ K++R KS+S ++PDHLLP+V IVGRPNVGKS
Sbjct  124  AKDAVREYAFSLSSELTIEDVTNGQKQSGKKRRPKSSSKNIPDHLLPRVTIVGRPNVGKS  183

Query  590  ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            ALFNRLVGGN+AIVVDEPGVTRDRLYGRSFWG++EFMVV
Sbjct  184  ALFNRLVGGNKAIVVDEPGVTRDRLYGRSFWGDHEFMVV  222



>ref|XP_010257317.1| PREDICTED: uncharacterized protein LOC104597468 isoform X1 [Nelumbo 
nucifera]
Length=677

 Score =   149 bits (376),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 86/99 (87%), Gaps = 1/99 (1%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTS-SVPDHLLPKVVIVGRPNVGKS  589
            AK A RE++ SLS +L  ED   G+K++ K++R KS+S ++PDHLLP+V IVGRPNVGKS
Sbjct  124  AKDAVREYAFSLSSELTIEDVTNGQKQSGKKRRPKSSSKNIPDHLLPRVTIVGRPNVGKS  183

Query  590  ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            ALFNRLVGGN+AIVVDEPGVTRDRLYGRSFWG++EFMVV
Sbjct  184  ALFNRLVGGNKAIVVDEPGVTRDRLYGRSFWGDHEFMVV  222



>ref|XP_008227136.1| PREDICTED: uncharacterized protein LOC103326678 [Prunus mume]
Length=662

 Score =   148 bits (374),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 84/100 (84%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTG-EKETRKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  586
            A+   +EFS +LS QLR ED+K   EK +RKQ+R KST  S+PDHLLP+V IVGRPNVGK
Sbjct  113  ARYVVQEFSSTLSSQLRIEDEKDDQEKVSRKQRRQKSTVKSIPDHLLPRVAIVGRPNVGK  172

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLV GN AIVVDEPGVTRDRLYGRSFWG++EFMVV
Sbjct  173  SALFNRLVSGNNAIVVDEPGVTRDRLYGRSFWGDHEFMVV  212



>gb|KCW51184.1| hypothetical protein EUGRSUZ_J00770 [Eucalyptus grandis]
Length=525

 Score =   147 bits (371),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 85/101 (84%), Gaps = 3/101 (3%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKE-TRKQKRLKST--SSVPDHLLPKVVIVGRPNVG  583
            A++A  E+S SLSR+LR+ED+   +KE T KQKR K    + +PDHLLP+V IVGRPNVG
Sbjct  102  AREAVVEYSRSLSRELRSEDEGNEQKEATGKQKRGKRAIKNVIPDHLLPRVAIVGRPNVG  161

Query  584  KSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            KSALFNRLVGGN+AIVVDEPGVTRDRLYGRSFWG +EFMVV
Sbjct  162  KSALFNRLVGGNKAIVVDEPGVTRDRLYGRSFWGHFEFMVV  202



>ref|XP_010651244.1| PREDICTED: uncharacterized protein LOC100260310 isoform X1 [Vitis 
vinifera]
Length=677

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 84/102 (82%), Gaps = 4/102 (4%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR--KQKRLKSTS--SVPDHLLPKVVIVGRPNV  580
            AK A RE+S  LSRQL  E+D   E + R  KQK+ KST+   +PDHLLP+V IVGRPNV
Sbjct  125  AKHAVREYSRFLSRQLSIEEDGANELKGRGGKQKKSKSTTRNVIPDHLLPRVTIVGRPNV  184

Query  581  GKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            GKSALFNRLVGGN+AIVVDEPGVTRDRLYGR+FWG+YEFMV+
Sbjct  185  GKSALFNRLVGGNKAIVVDEPGVTRDRLYGRAFWGDYEFMVI  226



>emb|CBI16384.3| unnamed protein product [Vitis vinifera]
Length=658

 Score =   147 bits (372),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 84/102 (82%), Gaps = 4/102 (4%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR--KQKRLKSTS--SVPDHLLPKVVIVGRPNV  580
            AK A RE+S  LSRQL  E+D   E + R  KQK+ KST+   +PDHLLP+V IVGRPNV
Sbjct  139  AKHAVREYSRFLSRQLSIEEDGANELKGRGGKQKKSKSTTRNVIPDHLLPRVTIVGRPNV  198

Query  581  GKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            GKSALFNRLVGGN+AIVVDEPGVTRDRLYGR+FWG+YEFMV+
Sbjct  199  GKSALFNRLVGGNKAIVVDEPGVTRDRLYGRAFWGDYEFMVI  240



>gb|KDO61272.1| hypothetical protein CISIN_1g005504mg [Citrus sinensis]
Length=381

 Score =   144 bits (364),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 85/100 (85%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKET-RKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  586
            AK A RE+S  LSRQL  +D+    K++ +KQK+ K+T  +VP+HLLP+V IVGRPNVGK
Sbjct  117  AKDAVREYSSLLSRQLIIQDETDDRKDSGKKQKKRKTTIGNVPEHLLPRVAIVGRPNVGK  176

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGGNRAIVVDEPGVTRDR+YGRSFWGE+EFM+V
Sbjct  177  SALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLV  216



>ref|XP_010031794.1| PREDICTED: uncharacterized protein LOC104421519 [Eucalyptus grandis]
Length=650

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 85/101 (84%), Gaps = 3/101 (3%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKE-TRKQKRLKST--SSVPDHLLPKVVIVGRPNVG  583
            A++A  E+S SLSR+LR+ED+   +KE T KQKR K    + +PDHLLP+V IVGRPNVG
Sbjct  102  AREAVVEYSRSLSRELRSEDEGNEQKEATGKQKRGKRAIKNVIPDHLLPRVAIVGRPNVG  161

Query  584  KSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            KSALFNRLVGGN+AIVVDEPGVTRDRLYGRSFWG +EFMVV
Sbjct  162  KSALFNRLVGGNKAIVVDEPGVTRDRLYGRSFWGHFEFMVV  202



>ref|XP_008385564.1| PREDICTED: uncharacterized protein LOC103448103 [Malus domestica]
Length=660

 Score =   147 bits (370),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 82/100 (82%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTG-EKETRKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  586
            A+    EFS SLS QLR EDDK   EK  RKQ+  KST  ++PDHLLP+V IVGRPNVGK
Sbjct  111  ARYLVEEFSSSLSTQLRIEDDKDDQEKVGRKQRNQKSTVKTIPDHLLPRVAIVGRPNVGK  170

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLV GN+AIVVDEPGVTRDRLYGRSFWG++EFMVV
Sbjct  171  SALFNRLVSGNKAIVVDEPGVTRDRLYGRSFWGDHEFMVV  210



>gb|KDO61270.1| hypothetical protein CISIN_1g005504mg [Citrus sinensis]
 gb|KDO61271.1| hypothetical protein CISIN_1g005504mg [Citrus sinensis]
Length=484

 Score =   145 bits (366),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 85/100 (85%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKET-RKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  586
            AK A RE+S  LSRQL  +D+    K++ +KQK+ K+T  +VP+HLLP+V IVGRPNVGK
Sbjct  117  AKDAVREYSSLLSRQLIIQDETDDRKDSGKKQKKRKTTIGNVPEHLLPRVAIVGRPNVGK  176

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGGNRAIVVDEPGVTRDR+YGRSFWGE+EFM+V
Sbjct  177  SALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLV  216



>gb|KJB21894.1| hypothetical protein B456_004G019700 [Gossypium raimondii]
Length=656

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 83/100 (83%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLK-STSSVPDHLLPKVVIVGRPNVGK  586
            AK A R +S SLSRQL  ED+    K  + KQKR K +T ++PDHLLPKV IVGRPNVGK
Sbjct  107  AKDAVRSYSTSLSRQLTIEDETDDLKGFKGKQKRRKGATKTIPDHLLPKVTIVGRPNVGK  166

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWG++EF+VV
Sbjct  167  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGDHEFVVV  206



>gb|KHG00071.1| GTPase Der [Gossypium arboreum]
Length=657

 Score =   146 bits (368),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 83/100 (83%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLK-STSSVPDHLLPKVVIVGRPNVGK  586
            AK A R +S SLSRQL  ED+    K  + KQKR K +T ++PDHLLPKV IVGRPNVGK
Sbjct  108  AKDAVRSYSTSLSRQLTIEDETDDLKGFKGKQKRRKGATKTIPDHLLPKVTIVGRPNVGK  167

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWG++EF+VV
Sbjct  168  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGDHEFVVV  207



>gb|KDO61269.1| hypothetical protein CISIN_1g005504mg [Citrus sinensis]
Length=549

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 85/100 (85%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKET-RKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  586
            AK A RE+S  LSRQL  +D+    K++ +KQK+ K+T  +VP+HLLP+V IVGRPNVGK
Sbjct  117  AKDAVREYSSLLSRQLIIQDETDDRKDSGKKQKKRKTTIGNVPEHLLPRVAIVGRPNVGK  176

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGGNRAIVVDEPGVTRDR+YGRSFWGE+EFM+V
Sbjct  177  SALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLV  216



>ref|XP_009375054.1| PREDICTED: uncharacterized protein LOC103963899 [Pyrus x bretschneideri]
Length=660

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 82/100 (82%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTG-EKETRKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  586
            A+    EFS SLS QLR EDDK   EK  RKQ+  KS+  ++PDHLLP+V IVGRPNVGK
Sbjct  111  ARYLVEEFSSSLSTQLRIEDDKDDQEKVGRKQRNQKSSVKTIPDHLLPRVAIVGRPNVGK  170

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLV GN+AIVVDEPGVTRDRLYGRSFWG++EFMVV
Sbjct  171  SALFNRLVSGNKAIVVDEPGVTRDRLYGRSFWGDHEFMVV  210



>ref|XP_006446112.1| hypothetical protein CICLE_v10014514mg [Citrus clementina]
 ref|XP_006470604.1| PREDICTED: uncharacterized protein LOC102625125 isoform X1 [Citrus 
sinensis]
 gb|ESR59352.1| hypothetical protein CICLE_v10014514mg [Citrus clementina]
 gb|KDO61268.1| hypothetical protein CISIN_1g005504mg [Citrus sinensis]
Length=666

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 85/100 (85%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKET-RKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  586
            AK A RE+S  LSRQL  +D+    K++ +KQK+ K+T  +VP+HLLP+V IVGRPNVGK
Sbjct  117  AKDAVREYSSLLSRQLIIQDETDDRKDSGKKQKKRKTTIGNVPEHLLPRVAIVGRPNVGK  176

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGGNRAIVVDEPGVTRDR+YGRSFWGE+EFM+V
Sbjct  177  SALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLV  216



>ref|XP_006470605.1| PREDICTED: uncharacterized protein LOC102625125 isoform X2 [Citrus 
sinensis]
Length=665

 Score =   145 bits (366),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 85/100 (85%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKET-RKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  586
            AK A RE+S  LSRQL  +D+    K++ +KQK+ K+T  +VP+HLLP+V IVGRPNVGK
Sbjct  117  AKDAVREYSSLLSRQLIIQDETDDRKDSGKKQKKRKTTIGNVPEHLLPRVAIVGRPNVGK  176

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGGNRAIVVDEPGVTRDR+YGRSFWGE+EFM+V
Sbjct  177  SALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLV  216



>ref|XP_009768584.1| PREDICTED: uncharacterized protein LOC104219584 [Nicotiana sylvestris]
Length=652

 Score =   145 bits (365),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 85/100 (85%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTS-SVPDHLLPKVVIVGRPNVGK  586
            A+   REFS+SLSRQL  E++++  KE + K+KR  +TS ++PDHLLPKV IVGRPNVGK
Sbjct  103  AELVVREFSDSLSRQLTIEEERSSPKEAQVKEKRRNNTSKNIPDHLLPKVAIVGRPNVGK  162

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGG +AIVVDEPGVTRDRLYGR+FWG YEF+VV
Sbjct  163  SALFNRLVGGKKAIVVDEPGVTRDRLYGRAFWGNYEFVVV  202



>gb|KDO61267.1| hypothetical protein CISIN_1g005504mg [Citrus sinensis]
Length=693

 Score =   145 bits (366),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 85/100 (85%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKET-RKQKRLKST-SSVPDHLLPKVVIVGRPNVGK  586
            AK A RE+S  LSRQL  +D+    K++ +KQK+ K+T  +VP+HLLP+V IVGRPNVGK
Sbjct  117  AKDAVREYSSLLSRQLIIQDETDDRKDSGKKQKKRKTTIGNVPEHLLPRVAIVGRPNVGK  176

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGGNRAIVVDEPGVTRDR+YGRSFWGE+EFM+V
Sbjct  177  SALFNRLVGGNRAIVVDEPGVTRDRMYGRSFWGEHEFMLV  216



>ref|XP_010519745.1| PREDICTED: uncharacterized protein LOC104799102 [Tarenaya hassleriana]
 ref|XP_010519746.1| PREDICTED: uncharacterized protein LOC104799102 [Tarenaya hassleriana]
Length=655

 Score =   144 bits (364),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 85/99 (86%), Gaps = 1/99 (1%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTSSVPDHLLPKVVIVGRPNVGKS  589
            A++  R+++ SLS++L+ ED+K G KE+R K+ RL   S +P+HLLP+V IVGRPNVGKS
Sbjct  106  AEEVVRDYTSSLSQELKLEDEKNGGKESRRKEIRLAKNSQIPEHLLPRVAIVGRPNVGKS  165

Query  590  ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            ALFNRLVG NRAIVVDEPGVTRDRLYGRS+WG++EF+V+
Sbjct  166  ALFNRLVGENRAIVVDEPGVTRDRLYGRSYWGDHEFVVI  204



>gb|AGL34232.1| plastid GTPase Der [Nicotiana benthamiana]
Length=651

 Score =   144 bits (364),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 85/100 (85%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTS-SVPDHLLPKVVIVGRPNVGK  586
            A+   REFS+SLSRQL  E++++  KE + K+KR  +TS ++PDHLLPKV IVGRPNVGK
Sbjct  102  AELVVREFSDSLSRQLTIEEERSSRKEAQFKEKRRNNTSKNIPDHLLPKVAIVGRPNVGK  161

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGG +AIVVDEPGVTRDRLYGRSFWG +EF+VV
Sbjct  162  SALFNRLVGGKQAIVVDEPGVTRDRLYGRSFWGNHEFLVV  201


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/42 (55%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +2

Query  539  HLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            + +P + IVGRPNVGKS++ N LVG NR IV    G TRD +
Sbjct  353  NYVPAIAIVGRPNVGKSSILNALVGENRTIVSPVSGTTRDAI  394



>ref|XP_010257318.1| PREDICTED: uncharacterized protein LOC104597468 isoform X2 [Nelumbo 
nucifera]
Length=676

 Score =   144 bits (362),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/99 (72%), Positives = 86/99 (87%), Gaps = 2/99 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTS-SVPDHLLPKVVIVGRPNVGKS  589
            AK A RE++ SLS +L T D   G+K++ K++R KS+S ++PDHLLP+V IVGRPNVGKS
Sbjct  124  AKDAVREYAFSLSSEL-TIDVTNGQKQSGKKRRPKSSSKNIPDHLLPRVTIVGRPNVGKS  182

Query  590  ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            ALFNRLVGGN+AIVVDEPGVTRDRLYGRSFWG++EFMVV
Sbjct  183  ALFNRLVGGNKAIVVDEPGVTRDRLYGRSFWGDHEFMVV  221



>ref|XP_009615948.1| PREDICTED: uncharacterized protein LOC104108581 [Nicotiana tomentosiformis]
Length=654

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 85/100 (85%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTS-SVPDHLLPKVVIVGRPNVGK  586
            A+   REFS+SLSRQL  +++++  KE + K+KR  +TS ++PDHLLPKV IVGRPNVGK
Sbjct  105  AELVVREFSDSLSRQLTIDEERSSPKEAQVKEKRRNNTSKNIPDHLLPKVAIVGRPNVGK  164

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGG +AIVVDEPGVTRDRLYGR+FWG YEF+VV
Sbjct  165  SALFNRLVGGKKAIVVDEPGVTRDRLYGRAFWGNYEFVVV  204



>ref|XP_006850201.1| PREDICTED: uncharacterized protein LOC18439984 [Amborella trichopoda]
 gb|ERN11782.1| hypothetical protein AMTR_s00022p00249930 [Amborella trichopoda]
Length=651

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 81/100 (81%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRK--QKRLKSTSSVPDHLLPKVVIVGRPNVGK  586
            A+ A RE+S SLSR+L  E+D + +K   K  ++R  S   VPDHLLP+V IVGRPNVGK
Sbjct  100  AQAAVREYSLSLSRELSIEEDASDQKNQGKWQKRRAGSFQHVPDHLLPRVTIVGRPNVGK  159

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWG +EFMVV
Sbjct  160  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGAHEFMVV  199


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 7/55 (13%)
 Frame = +2

Query  536  DHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFM  700
            ++ +P + IVGRPNVGKS++ N LVG +R IV    G TRD +       + EFM
Sbjct  351  ENYIPAIAIVGRPNVGKSSILNALVGEDRTIVSPISGTTRDAI-------DTEFM  398



>ref|XP_007015041.1| GTP-binding family protein [Theobroma cacao]
 gb|EOY32660.1| GTP-binding family protein [Theobroma cacao]
Length=648

 Score =   143 bits (361),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 82/100 (82%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKE-TRKQKRLKSTS-SVPDHLLPKVVIVGRPNVGK  586
            AK A R +S SLSR L  ED+    KE + KQKR KS S S+PD LLP+V IVGRPNVGK
Sbjct  99   AKDAVRRYSSSLSRHLTIEDEADDSKELSGKQKRRKSASKSIPDQLLPRVAIVGRPNVGK  158

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGG+RAIVVDEPGVTRDRLYGRSFWG++EF+VV
Sbjct  159  SALFNRLVGGDRAIVVDEPGVTRDRLYGRSFWGDHEFVVV  198



>ref|XP_011469726.1| PREDICTED: uncharacterized protein LOC101310757 isoform X3 [Fragaria 
vesca subsp. vesca]
Length=617

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 81/94 (86%), Gaps = 2/94 (2%)
 Frame = +2

Query  431  EFSESLSRQLRTEDDKTGEKETRKQKRLKST--SSVPDHLLPKVVIVGRPNVGKSALFNR  604
            EFS SLS+ L  ED+KT ++E  +++R ++T   ++PDHLLP+V IVGRPNVGKSALFNR
Sbjct  86   EFSSSLSKLLTIEDEKTDQEEIGRKQRRRTTPIKTIPDHLLPRVAIVGRPNVGKSALFNR  145

Query  605  LVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LV GN+AIVVDEPGVTRDRLYGRSFWG++EFMVV
Sbjct  146  LVSGNKAIVVDEPGVTRDRLYGRSFWGDFEFMVV  179



>ref|XP_004289593.1| PREDICTED: uncharacterized protein LOC101310757 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011469717.1| PREDICTED: uncharacterized protein LOC101310757 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=629

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 81/94 (86%), Gaps = 2/94 (2%)
 Frame = +2

Query  431  EFSESLSRQLRTEDDKTGEKETRKQKRLKST--SSVPDHLLPKVVIVGRPNVGKSALFNR  604
            EFS SLS+ L  ED+KT ++E  +++R ++T   ++PDHLLP+V IVGRPNVGKSALFNR
Sbjct  86   EFSSSLSKLLTIEDEKTDQEEIGRKQRRRTTPIKTIPDHLLPRVAIVGRPNVGKSALFNR  145

Query  605  LVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LV GN+AIVVDEPGVTRDRLYGRSFWG++EFMVV
Sbjct  146  LVSGNKAIVVDEPGVTRDRLYGRSFWGDFEFMVV  179



>ref|XP_008449721.1| PREDICTED: uncharacterized protein LOC103491517 [Cucumis melo]
Length=660

 Score =   141 bits (356),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 84/101 (83%), Gaps = 3/101 (3%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKST---SSVPDHLLPKVVIVGRPNVG  583
            AK   RE+S SLSR+LR +D+ T + ET ++K+ + T   + +PDHLLPKV IVGRPNVG
Sbjct  110  AKDVLREYSSSLSRELRLDDELTDQSETGRKKKKRKTTPRNVIPDHLLPKVAIVGRPNVG  169

Query  584  KSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            KSA+FNRLVGGNRAIVVDEPGVTRDRLYGRSFWG+ EFMVV
Sbjct  170  KSAMFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGDNEFMVV  210


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 36/67 (54%), Gaps = 5/67 (7%)
 Frame = +2

Query  479  TGEKETRKQKRLKSTSSVPD-----HLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEP  643
            TGE       RL+   S  D       +P V IVGRPNVGKS++ N LVG +R IV    
Sbjct  338  TGELLDLLCSRLQKVESSEDLHEEEDYIPAVAIVGRPNVGKSSILNALVGEDRTIVSPIS  397

Query  644  GVTRDRL  664
            G TRD +
Sbjct  398  GTTRDAI  404



>ref|XP_010673632.1| PREDICTED: uncharacterized protein LOC104889980 [Beta vulgaris 
subsp. vulgaris]
Length=670

 Score =   142 bits (357),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 79/96 (82%), Gaps = 3/96 (3%)
 Frame = +2

Query  428  REFSESLSRQLRTEDDKT---GEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALF  598
            REFS SLSR+LR E+D+    GE   +++ R     S+PDHLLPKV I GRPNVGKSALF
Sbjct  126  REFSTSLSRELRIEEDEASLRGEVGGKQKGRKILPRSIPDHLLPKVAIFGRPNVGKSALF  185

Query  599  NRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            NRLVGGN+AIVVDEPGVTRDRLYGRSFWG++EFMVV
Sbjct  186  NRLVGGNKAIVVDEPGVTRDRLYGRSFWGDHEFMVV  221



>gb|EPS73678.1| hypothetical protein M569_01078, partial [Genlisea aurea]
Length=544

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 69/97 (71%), Positives = 80/97 (82%), Gaps = 2/97 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKS--TSSVPDHLLPKVVIVGRPNVGK  586
            A+   +EFS+SLSRQL  ED+   +KETR +    S  +S+VPDHLLPKV IVGRPNVGK
Sbjct  13   AENVVKEFSQSLSRQLLIEDENALQKETRARHGRNSIFSSNVPDHLLPKVAIVGRPNVGK  72

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEF  697
            SALFNRLVGGN+AIVVDEPGVTRDRLYGRS WG++EF
Sbjct  73   SALFNRLVGGNKAIVVDEPGVTRDRLYGRSVWGDHEF  109



>ref|XP_008813436.1| PREDICTED: uncharacterized protein LOC103724064 isoform X1 [Phoenix 
dactylifera]
Length=587

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 84/102 (82%), Gaps = 4/102 (4%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS----VPDHLLPKVVIVGRPNV  580
            A+   RE+S SLSR+L  ++D   +K+  ++++L+ +SS    +PDHLLP++ IVGRPNV
Sbjct  108  ARDVVREYSASLSRELDIDEDIEEKKKFSEKQKLQRSSSKHFQIPDHLLPRIAIVGRPNV  167

Query  581  GKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            GKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWG+ EF+VV
Sbjct  168  GKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGDREFIVV  209


 Score = 53.9 bits (128),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  521  TSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            TS V ++ +P + IVGRPNVGKS++ N LVG +R IV    G TRD +
Sbjct  356  TSEVEENYVPSIAIVGRPNVGKSSILNALVGEDRTIVSPISGTTRDAI  403



>ref|XP_004507094.1| PREDICTED: GTPase Der-like [Cicer arietinum]
Length=653

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 80/100 (80%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRK-QKRLKSTSSV-PDHLLPKVVIVGRPNVGK  586
            AK    E+S SLSR L  +D+K+  KET K  KR K    + PD+LLP++ IVGRPNVGK
Sbjct  103  AKDVVLEYSNSLSRVLSIDDEKSDVKETAKTSKRSKQKKKIIPDNLLPRIAIVGRPNVGK  162

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGGNRAIVVDEPGVTRDRLYGRS+WGE+EFMVV
Sbjct  163  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSYWGEHEFMVV  202



>dbj|BAD93758.1| hypothetical protein [Arabidopsis thaliana]
Length=370

 Score =   135 bits (341),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 82/100 (82%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRL-KSTSSVPDHLLPKVVIVGRPNVGK  586
            A+   R+++ +LSR+L+ ED+    KETR K KRL K+T  +P+HLL +V IVGRPNVGK
Sbjct  112  ARDIVRDYATTLSRELKIEDETIEGKETRRKGKRLAKNTQQIPEHLLQRVAIVGRPNVGK  171

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVG NRAIVVDEPGVTRDRLYGRS+WG+ EF+VV
Sbjct  172  SALFNRLVGENRAIVVDEPGVTRDRLYGRSYWGDQEFVVV  211



>ref|XP_011469724.1| PREDICTED: uncharacterized protein LOC101310757 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=628

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/94 (70%), Positives = 81/94 (86%), Gaps = 3/94 (3%)
 Frame = +2

Query  431  EFSESLSRQLRTEDDKTGEKETRKQKRLKST--SSVPDHLLPKVVIVGRPNVGKSALFNR  604
            EFS SLS+ L T D+KT ++E  +++R ++T   ++PDHLLP+V IVGRPNVGKSALFNR
Sbjct  86   EFSSSLSKLL-TIDEKTDQEEIGRKQRRRTTPIKTIPDHLLPRVAIVGRPNVGKSALFNR  144

Query  605  LVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LV GN+AIVVDEPGVTRDRLYGRSFWG++EFMVV
Sbjct  145  LVSGNKAIVVDEPGVTRDRLYGRSFWGDFEFMVV  178



>ref|XP_007132015.1| hypothetical protein PHAVU_011G059500g [Phaseolus vulgaris]
 gb|ESW04009.1| hypothetical protein PHAVU_011G059500g [Phaseolus vulgaris]
Length=633

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 80/101 (79%), Gaps = 3/101 (3%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKS---TSSVPDHLLPKVVIVGRPNVG  583
            AK AA+ +S SLS+ L  ED++  + E   Q R +S   T S+PD+LL +V IVGRPNVG
Sbjct  82   AKDAAQAYSSSLSQVLTIEDEEKNDHEETAQSRSRSARRTKSIPDNLLQRVAIVGRPNVG  141

Query  584  KSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            KSALFNRLVG NRAIVVDEPGVTRDRLYGRS+WGE+EFMVV
Sbjct  142  KSALFNRLVGRNRAIVVDEPGVTRDRLYGRSYWGEHEFMVV  182



>gb|KEH30215.1| GTPase Der protein [Medicago truncatula]
Length=646

 Score =   137 bits (344),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 81/100 (81%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQ-KRLKSTSSV-PDHLLPKVVIVGRPNVGK  586
            AK+ A E+S SLSR L  ED+++  KET K  KR K    + PD+LLP++ IVGRPNVGK
Sbjct  92   AKEVALEYSSSLSRVLTIEDERSDVKETGKNSKRSKPKRKIIPDNLLPRIAIVGRPNVGK  151

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGGN+AIVVDEPGVTRDRLYGRS+WG+ EFMVV
Sbjct  152  SALFNRLVGGNKAIVVDEPGVTRDRLYGRSYWGDNEFMVV  191



>ref|NP_001078139.1| putative double era-like GTPase [Arabidopsis thaliana]
 gb|AEE75147.1| GTP-binding protein [Arabidopsis thaliana]
Length=587

 Score =   136 bits (342),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 82/100 (82%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRL-KSTSSVPDHLLPKVVIVGRPNVGK  586
            A+   R+++ +LSR+L+ ED+    KETR K KRL K+T  +P+HLL +V IVGRPNVGK
Sbjct  112  ARDIVRDYATTLSRELKIEDETIEGKETRRKGKRLAKNTQQIPEHLLQRVAIVGRPNVGK  171

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVG NRAIVVDEPGVTRDRLYGRS+WG+ EF+VV
Sbjct  172  SALFNRLVGENRAIVVDEPGVTRDRLYGRSYWGDQEFVVV  211



>ref|XP_004142117.1| PREDICTED: uncharacterized protein LOC101205027 [Cucumis sativus]
Length=660

 Score =   136 bits (342),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 83/101 (82%), Gaps = 3/101 (3%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKST---SSVPDHLLPKVVIVGRPNVG  583
            AK   RE+S SLSR+L  +D+ + + ET ++K+ + T   + +PDHLLP+V IVGRPNVG
Sbjct  110  AKDVLREYSSSLSRELIIDDELSDQSETGRKKKKRKTTPRNVIPDHLLPRVAIVGRPNVG  169

Query  584  KSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            KSA+FNRLVGGNRAIVVDEPGVTRDRLYGRSFWG+ EFMVV
Sbjct  170  KSAMFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGDNEFMVV  210


 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 36/67 (54%), Gaps = 5/67 (7%)
 Frame = +2

Query  479  TGEKETRKQKRLKSTSSVPD-----HLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEP  643
            TGE       RL+   S  D       +P V IVGRPNVGKS++ N LVG +R IV    
Sbjct  338  TGELLDLLCSRLQKVESSEDLHEEEDYIPAVAIVGRPNVGKSSILNALVGEDRTIVSPIS  397

Query  644  GVTRDRL  664
            G TRD +
Sbjct  398  GTTRDAI  404



>gb|KGN54174.1| hypothetical protein Csa_4G291380 [Cucumis sativus]
Length=697

 Score =   136 bits (342),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 83/101 (82%), Gaps = 3/101 (3%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKST---SSVPDHLLPKVVIVGRPNVG  583
            AK   RE+S SLSR+L  +D+ + + ET ++K+ + T   + +PDHLLP+V IVGRPNVG
Sbjct  147  AKDVLREYSSSLSRELIIDDELSDQSETGRKKKKRKTTPRNVIPDHLLPRVAIVGRPNVG  206

Query  584  KSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            KSA+FNRLVGGNRAIVVDEPGVTRDRLYGRSFWG+ EFMVV
Sbjct  207  KSAMFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGDNEFMVV  247


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 30/67 (45%), Positives = 36/67 (54%), Gaps = 5/67 (7%)
 Frame = +2

Query  479  TGEKETRKQKRLKSTSSVPD-----HLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEP  643
            TGE       RL+   S  D       +P V IVGRPNVGKS++ N LVG +R IV    
Sbjct  375  TGELLDLLCSRLQKVESSEDLHEEEDYIPAVAIVGRPNVGKSSILNALVGEDRTIVSPIS  434

Query  644  GVTRDRL  664
            G TRD +
Sbjct  435  GTTRDAI  441



>ref|NP_187815.2| putative double era-like GTPase [Arabidopsis thaliana]
 gb|ACI49783.1| At3g12080 [Arabidopsis thaliana]
 gb|AEE75146.1| GTP-binding protein [Arabidopsis thaliana]
Length=663

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 82/100 (82%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRL-KSTSSVPDHLLPKVVIVGRPNVGK  586
            A+   R+++ +LSR+L+ ED+    KETR K KRL K+T  +P+HLL +V IVGRPNVGK
Sbjct  112  ARDIVRDYATTLSRELKIEDETIEGKETRRKGKRLAKNTQQIPEHLLQRVAIVGRPNVGK  171

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVG NRAIVVDEPGVTRDRLYGRS+WG+ EF+VV
Sbjct  172  SALFNRLVGENRAIVVDEPGVTRDRLYGRSYWGDQEFVVV  211



>ref|XP_002882766.1| EMB2738 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59025.1| EMB2738 [Arabidopsis lyrata subsp. lyrata]
Length=661

 Score =   134 bits (337),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 81/100 (81%), Gaps = 2/100 (2%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRL-KSTSSVPDHLLPKVVIVGRPNVGK  586
            A+   R+++  LSR+L+ ED+    KETR K KRL K+T  +P+HLL +V IVGRPNVGK
Sbjct  110  ARDIVRDYATILSRELKLEDETIEGKETRRKGKRLAKNTQQIPEHLLQRVAIVGRPNVGK  169

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVG NRAIVVDEPGVTRDRLYGRS+WG+ EF+VV
Sbjct  170  SALFNRLVGENRAIVVDEPGVTRDRLYGRSYWGDQEFVVV  209



>ref|NP_001146320.1| uncharacterized protein LOC100279896 [Zea mays]
 gb|ACL53683.1| unknown [Zea mays]
Length=653

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 82/100 (82%), Gaps = 5/100 (5%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS--VPDHLLPKVVIVGRPNVGK  586
            A+ AA + ++ L+R+L  +DD    +E R+  R K++ S  +PD+LLPKV I+GRPNVGK
Sbjct  109  ARGAAADLAKRLARELHIDDDV---REKRRNIRDKTSVSKHIPDNLLPKVAIIGRPNVGK  165

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGGNRAIVVDEPGVTRDRLYGRS+WG++EFMV+
Sbjct  166  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSYWGDHEFMVI  205



>tpg|DAA42328.1| TPA: hypothetical protein ZEAMMB73_012049 [Zea mays]
Length=653

 Score =   133 bits (334),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 82/100 (82%), Gaps = 5/100 (5%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS--VPDHLLPKVVIVGRPNVGK  586
            A+ AA + ++ L+R+L  +DD    +E R+  R K++ S  +PD+LLPKV I+GRPNVGK
Sbjct  109  ARGAAADLAKRLARELHIDDDV---REKRRNIRDKTSVSKHIPDNLLPKVAIIGRPNVGK  165

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGGNRAIVVDEPGVTRDRLYGRS+WG++EFMV+
Sbjct  166  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSYWGDHEFMVI  205



>ref|XP_010486897.1| PREDICTED: uncharacterized protein LOC104764969 [Camelina sativa]
Length=663

 Score =   133 bits (334),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTSSVPDHLLPKVVIVGRPNVGKS  589
            A+   R+++ +LSR+L+ ED+    KETR K KR    + +P+HLL +V IVGRPNVGKS
Sbjct  113  ARDIVRDYATTLSRELKLEDELIEGKETRRKGKRQAKNTQIPEHLLQRVAIVGRPNVGKS  172

Query  590  ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            ALFNRLVG NRAIVVDEPGVTRDRLYGRS+WG+ EF+VV
Sbjct  173  ALFNRLVGENRAIVVDEPGVTRDRLYGRSYWGDQEFVVV  211



>ref|XP_010498493.1| PREDICTED: uncharacterized protein LOC104776175 [Camelina sativa]
Length=656

 Score =   132 bits (333),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTSSVPDHLLPKVVIVGRPNVGKS  589
            A+   R+++ +LSR+L+ ED+    KETR K KR    + +P+HLL +V IVGRPNVGKS
Sbjct  106  ARDIVRDYATTLSRELKLEDELIEGKETRRKGKRQAKNTQIPEHLLQRVAIVGRPNVGKS  165

Query  590  ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            ALFNRLVG NRAIVVDEPGVTRDRLYGRS+WG+ EF+VV
Sbjct  166  ALFNRLVGENRAIVVDEPGVTRDRLYGRSYWGDQEFVVV  204



>ref|XP_006297160.1| hypothetical protein CARUB_v10013165mg [Capsella rubella]
 gb|EOA30058.1| hypothetical protein CARUB_v10013165mg [Capsella rubella]
Length=655

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTSSVPDHLLPKVVIVGRPNVGKS  589
            A+   R+++ +LSR+L+ ED+    K TR K KR   T+ +P+HLL +V IVGRPNVGKS
Sbjct  106  ARDIVRDYATTLSRELKLEDELIEGKATRRKGKRQAKTTQIPEHLLQRVAIVGRPNVGKS  165

Query  590  ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            ALFNRLVG NRAIVVDEPGVTRDRLYGRS+WG+ EF+VV
Sbjct  166  ALFNRLVGENRAIVVDEPGVTRDRLYGRSYWGDQEFVVV  204



>gb|EEC68516.1| hypothetical protein OsI_36791 [Oryza sativa Indica Group]
Length=676

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 81/100 (81%), Gaps = 5/100 (5%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS--VPDHLLPKVVIVGRPNVGK  586
            A  A  + SE LSR+LR +DD    ++ R+  R K+++S  +PD+LLP+V I+GRPNVGK
Sbjct  118  ALGAVADLSERLSRELRIDDDV---RDKRRIIRDKTSASKHIPDNLLPRVAIIGRPNVGK  174

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGGNRAIVVDEPGVTRDRLYGRS+WG+ EFMV+
Sbjct  175  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSYWGDREFMVI  214



>ref|XP_002449905.1| hypothetical protein SORBIDRAFT_05g025430 [Sorghum bicolor]
 gb|EES08893.1| hypothetical protein SORBIDRAFT_05g025430 [Sorghum bicolor]
Length=684

 Score =   132 bits (332),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 81/100 (81%), Gaps = 5/100 (5%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS--VPDHLLPKVVIVGRPNVGK  586
            A+ AA + ++ L+R+L  +DD    +E R+  R K++ S  +PD+LLPKV I+GRPNVGK
Sbjct  115  ARGAAADLAKRLARELHIDDDV---REKRRNIRDKTSVSKHIPDNLLPKVAIIGRPNVGK  171

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGGNRAIVVDEPGVTRDRLYGRS+WG+ EFMV+
Sbjct  172  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSYWGDQEFMVI  211



>ref|XP_010464959.1| PREDICTED: uncharacterized protein LOC104745422 [Camelina sativa]
Length=656

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 78/99 (79%), Gaps = 1/99 (1%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTSSVPDHLLPKVVIVGRPNVGKS  589
            A+   R+++ +LSR+L+ ED+    KETR K KR      +P+HLL +V IVGRPNVGKS
Sbjct  107  ARAIVRDYATTLSRELKLEDELIEGKETRRKGKRQAKNKEIPEHLLQRVAIVGRPNVGKS  166

Query  590  ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            ALFNRLVG NRAIVVDEPGVTRDRLYGRS+WG+ EF+VV
Sbjct  167  ALFNRLVGENRAIVVDEPGVTRDRLYGRSYWGDQEFVVV  205



>ref|XP_006407372.1| hypothetical protein EUTSA_v10020226mg [Eutrema salsugineum]
 gb|ESQ48825.1| hypothetical protein EUTSA_v10020226mg [Eutrema salsugineum]
Length=664

 Score =   132 bits (331),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 80/99 (81%), Gaps = 1/99 (1%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTSSVPDHLLPKVVIVGRPNVGKS  589
            A+  AR+++ +LSR+L+ ED+    KE+R K KR    + +P+HLL +V IVGRPNVGKS
Sbjct  114  ARDIARDYATTLSRELKLEDEIIEGKESRRKGKRQAKNTQIPEHLLQRVAIVGRPNVGKS  173

Query  590  ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            ALFNRLVG N+AIVVDEPGVTRDRLYGRS+WG+ EF+VV
Sbjct  174  ALFNRLVGENKAIVVDEPGVTRDRLYGRSYWGDQEFVVV  212



>ref|XP_004979812.1| PREDICTED: uncharacterized protein LOC101764561 [Setaria italica]
Length=661

 Score =   130 bits (328),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 80/100 (80%), Gaps = 5/100 (5%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS--VPDHLLPKVVIVGRPNVGK  586
            A+ AA + ++ L+R+L  +DD    +E R+  R K++ S  +PD+LLPKV I+GRPNVGK
Sbjct  117  ARGAATDLAKRLARELHIDDDV---REKRRNIRDKTSVSKQIPDNLLPKVAIIGRPNVGK  173

Query  587  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            SALFNRLVGGNRAIVVDEPGVTRDRLYGRS+WG  EFMV+
Sbjct  174  SALFNRLVGGNRAIVVDEPGVTRDRLYGRSYWGAQEFMVI  213



>emb|CDY01098.1| BnaC05g41020D [Brassica napus]
Length=656

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/101 (60%), Positives = 83/101 (82%), Gaps = 3/101 (3%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS---VPDHLLPKVVIVGRPNVG  583
            A+  AR+++ +LSR+L+ EDD    KE+R++ + ++ ++   +P+HLL +V IVGRPNVG
Sbjct  104  ARDIARDYATTLSRELKLEDDVVEGKESRRKGKRQAKNNQAQIPEHLLQRVAIVGRPNVG  163

Query  584  KSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            KSALFNRLVG N+AIVVDEPGVTRDRLYGRS+WG+ EF+VV
Sbjct  164  KSALFNRLVGENKAIVVDEPGVTRDRLYGRSYWGDQEFVVV  204



>gb|KFK38573.1| hypothetical protein AALP_AA3G131000 [Arabis alpina]
Length=658

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 79/99 (80%), Gaps = 1/99 (1%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTSSVPDHLLPKVVIVGRPNVGKS  589
            A+   R+++ +LSR+L+ ED+    KE+R K KR    + +P+HLL +V IVGRPNVGKS
Sbjct  108  ARDIVRDYASTLSRELKLEDEIVEGKESRRKGKRQAKNTQIPEHLLQRVAIVGRPNVGKS  167

Query  590  ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            ALFNRLVG N+AIVVDEPGVTRDRLYGRS+WG+ EF+VV
Sbjct  168  ALFNRLVGENKAIVVDEPGVTRDRLYGRSYWGDQEFVVV  206



>ref|XP_006592177.1| PREDICTED: uncharacterized protein LOC100777588 isoform X2 [Glycine 
max]
Length=572

 Score =   129 bits (324),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 80/101 (79%), Gaps = 3/101 (3%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKS---TSSVPDHLLPKVVIVGRPNVG  583
            AK A   +S SLS+ L  ED++  +++   Q R KS   T  +PD+LLP+V IVGRPNVG
Sbjct  82   AKDAVEAYSSSLSQILSIEDEEKSDRKESAQSRRKSPRRTKIIPDNLLPRVAIVGRPNVG  141

Query  584  KSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            KSALFNRLVGGNRAIVVDEPGVTRDRLYGRS+WGE+EFMVV
Sbjct  142  KSALFNRLVGGNRAIVVDEPGVTRDRLYGRSYWGEHEFMVV  182



>ref|XP_009394388.1| PREDICTED: uncharacterized protein LOC103979879 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=634

 Score =   129 bits (325),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 77/104 (74%), Gaps = 9/104 (9%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS------VPDHLLPKVVIVGRP  574
            A  A R++S+SLS ++  ED+     E RK    K          +PDHLLP+V IVGRP
Sbjct  103  AIDAVRQYSQSLSTEMGFEDEV---NERRKHSSEKQKLKKSSSKHIPDHLLPRVTIVGRP  159

Query  575  NVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            NVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWG++EFMVV
Sbjct  160  NVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGDHEFMVV  203



>ref|XP_003539473.1| PREDICTED: uncharacterized protein LOC100777588 isoform X1 [Glycine 
max]
Length=632

 Score =   129 bits (324),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 80/101 (79%), Gaps = 3/101 (3%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKS---TSSVPDHLLPKVVIVGRPNVG  583
            AK A   +S SLS+ L  ED++  +++   Q R KS   T  +PD+LLP+V IVGRPNVG
Sbjct  82   AKDAVEAYSSSLSQILSIEDEEKSDRKESAQSRRKSPRRTKIIPDNLLPRVAIVGRPNVG  141

Query  584  KSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            KSALFNRLVGGNRAIVVDEPGVTRDRLYGRS+WGE+EFMVV
Sbjct  142  KSALFNRLVGGNRAIVVDEPGVTRDRLYGRSYWGEHEFMVV  182


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +2

Query  503  QKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            QK  +S + V +  +P + IVGRPNVGKS++ N LVG +R IV    G TRD +
Sbjct  322  QKIEESNNLVEEDYVPAISIVGRPNVGKSSILNALVGEDRTIVSPISGTTRDAI  375



>gb|KHN21905.1| GTPase Der [Glycine soja]
Length=518

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 81/101 (80%), Gaps = 3/101 (3%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKS---TSSVPDHLLPKVVIVGRPNVG  583
            AK A + +S SLS+ L  ED++  +++   Q R KS   T  +PD+LLP+V IVGRPNVG
Sbjct  81   AKDAVQAYSSSLSQILSIEDEEKSDRKESAQSRRKSPRRTKIIPDNLLPRVAIVGRPNVG  140

Query  584  KSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            KSAL+NRLVGGNRAIVVDEPGVTRDRLYGRS+WGE+EFMVV
Sbjct  141  KSALYNRLVGGNRAIVVDEPGVTRDRLYGRSYWGEHEFMVV  181



>ref|XP_009146648.1| PREDICTED: uncharacterized protein LOC103870279 [Brassica rapa]
Length=657

 Score =   129 bits (324),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 82/101 (81%), Gaps = 3/101 (3%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS---VPDHLLPKVVIVGRPNVG  583
            A+   R+++ +LSR+L+ EDD    KE+R++ + ++ ++   +P+HLL +V IVGRPNVG
Sbjct  105  ARDIVRDYATTLSRELKLEDDVVEGKESRRKGKRQAKNNQTQIPEHLLQRVAIVGRPNVG  164

Query  584  KSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            KSALFNRLVG N+AIVVDEPGVTRDRLYGRS+WG+ EF+VV
Sbjct  165  KSALFNRLVGENKAIVVDEPGVTRDRLYGRSYWGDQEFVVV  205



>emb|CDY08458.1| BnaA05g26940D [Brassica napus]
Length=659

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 82/101 (81%), Gaps = 3/101 (3%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSS---VPDHLLPKVVIVGRPNVG  583
            A+   R+++ +LSR+L+ EDD    KE+R++ + ++ ++   +P+HLL +V IVGRPNVG
Sbjct  107  ARDIVRDYATTLSRELKLEDDVVEGKESRRKGKRQAKNNQTQIPEHLLQRVAIVGRPNVG  166

Query  584  KSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            KSALFNRLVG N+AIVVDEPGVTRDRLYGRS+WG+ EF+VV
Sbjct  167  KSALFNRLVGENKAIVVDEPGVTRDRLYGRSYWGDQEFVVV  207



>gb|KHN25243.1| GTPase Der [Glycine soja]
Length=957

 Score =   128 bits (321),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 80/101 (79%), Gaps = 3/101 (3%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKS---TSSVPDHLLPKVVIVGRPNVG  583
            AK A   +S SLS+ L  ED++  +++   Q R KS   T  +PD+LLP+V IVGRPNVG
Sbjct  407  AKDAVEAYSSSLSQILSIEDEEKSDRKESAQSRRKSPRRTKIIPDNLLPRVAIVGRPNVG  466

Query  584  KSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            KSALFNRLVGGNRAIVVDEPGVTRDRLYGRS+WGE+EFMVV
Sbjct  467  KSALFNRLVGGNRAIVVDEPGVTRDRLYGRSYWGEHEFMVV  507


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/54 (48%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +2

Query  503  QKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            QK  +S + V +  +P + IVGRPNVGKS++ N LVG +R IV    G TRD +
Sbjct  647  QKIEESNNLVEEDYVPAISIVGRPNVGKSSILNALVGEDRTIVSPISGTTRDAI  700



>gb|AAG51052.1|AC069473_14 GTPase, putative; 34281-30152 [Arabidopsis thaliana]
Length=659

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 76/99 (77%), Gaps = 4/99 (4%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETR-KQKRLKSTSSVPDHLLPKVVIVGRPNVGKS  589
            A+   R+++ +LSR+L+ ED+    KETR K KRL        HLL +V IVGRPNVGKS
Sbjct  112  ARDIVRDYATTLSRELKIEDETIEGKETRRKGKRLAKNVK---HLLQRVAIVGRPNVGKS  168

Query  590  ALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            ALFNRLVG NRAIVVDEPGVTRDRLYGRS+WG+ EF+VV
Sbjct  169  ALFNRLVGENRAIVVDEPGVTRDRLYGRSYWGDQEFVVV  207



>ref|XP_009394390.1| PREDICTED: uncharacterized protein LOC103979879 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=506

 Score =   124 bits (310),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/61 (90%), Positives = 60/61 (98%), Gaps = 0/61 (0%)
 Frame = +2

Query  524  SSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMV  703
            +S+PDHLLP+V IVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWG++EFMV
Sbjct  15   ASIPDHLLPRVTIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGDHEFMV  74

Query  704  V  706
            V
Sbjct  75   V  75



>ref|XP_009394391.1| PREDICTED: uncharacterized protein LOC103979879 isoform X3 [Musa 
acuminata subsp. malaccensis]
Length=492

 Score =   123 bits (309),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/60 (92%), Positives = 59/60 (98%), Gaps = 0/60 (0%)
 Frame = +2

Query  527  SVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            S+PDHLLP+V IVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWG++EFMVV
Sbjct  2    SIPDHLLPRVTIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGDHEFMVV  61



>dbj|BAB01956.1| GTP-binding protein-like [Arabidopsis thaliana]
Length=537

 Score =   121 bits (303),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/82 (74%), Positives = 69/82 (84%), Gaps = 2/82 (2%)
 Frame = +2

Query  467  EDDKTGEKETR-KQKRL-KSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDE  640
            ED+    KETR K KRL K+T  +P+HLL +V IVGRPNVGKSALFNRLVG NRAIVVDE
Sbjct  4    EDETIEGKETRRKGKRLAKNTQQIPEHLLQRVAIVGRPNVGKSALFNRLVGENRAIVVDE  63

Query  641  PGVTRDRLYGRSFWGEYEFMVV  706
            PGVTRDRLYGRS+WG+ EF+VV
Sbjct  64   PGVTRDRLYGRSYWGDQEFVVV  85



>ref|XP_010907854.1| PREDICTED: uncharacterized protein LOC105034405 isoform X3 [Elaeis 
guineensis]
Length=525

 Score =   120 bits (301),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  530  VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +PDHLLP++ IVGRPNVGKSALFNRLVGG+RAIVVDEPGVTRDRLYGRSFWG++EFMVV
Sbjct  19   IPDHLLPRIAIVGRPNVGKSALFNRLVGGSRAIVVDEPGVTRDRLYGRSFWGDHEFMVV  77


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  521  TSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            +S V ++ +P + IVGRPNVGKS++ N LVG +R IV    G TRD +
Sbjct  224  SSEVEENYVPSIAIVGRPNVGKSSILNALVGEDRTIVSPISGTTRDAI  271



>ref|XP_010907853.1| PREDICTED: uncharacterized protein LOC105034405 isoform X2 [Elaeis 
guineensis]
Length=549

 Score =   120 bits (301),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 58/59 (98%), Gaps = 0/59 (0%)
 Frame = +2

Query  530  VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +PDHLLP++ IVGRPNVGKSALFNRLVGG+RAIVVDEPGVTRDRLYGRSFWG++EFMVV
Sbjct  43   IPDHLLPRIAIVGRPNVGKSALFNRLVGGSRAIVVDEPGVTRDRLYGRSFWGDHEFMVV  101


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  521  TSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            +S V ++ +P + IVGRPNVGKS++ N LVG +R IV    G TRD +
Sbjct  248  SSEVEENYVPSIAIVGRPNVGKSSILNALVGEDRTIVSPISGTTRDAI  295



>ref|XP_008813437.1| PREDICTED: uncharacterized protein LOC103724064 isoform X2 [Phoenix 
dactylifera]
Length=479

 Score =   119 bits (299),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 52/59 (88%), Positives = 57/59 (97%), Gaps = 0/59 (0%)
 Frame = +2

Query  530  VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +PDHLLP++ IVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWG+ EF+VV
Sbjct  43   IPDHLLPRIAIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGDREFIVV  101


 Score = 53.5 bits (127),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  521  TSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            TS V ++ +P + IVGRPNVGKS++ N LVG +R IV    G TRD +
Sbjct  248  TSEVEENYVPSIAIVGRPNVGKSSILNALVGEDRTIVSPISGTTRDAI  295



>ref|XP_010907852.1| PREDICTED: uncharacterized protein LOC105034405 isoform X1 [Elaeis 
guineensis]
Length=657

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 82/102 (80%), Gaps = 4/102 (4%)
 Frame = +2

Query  413  AKQAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTS----SVPDHLLPKVVIVGRPNV  580
            A+   RE+S SLSR+L  E++   +K+   +K+ + +S     +PDHLLP++ IVGRPNV
Sbjct  108  ARDVVREYSASLSRELDIEEEIDEKKKFSGKKKSQRSSSKHFQIPDHLLPRIAIVGRPNV  167

Query  581  GKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            GKSALFNRLVGG+RAIVVDEPGVTRDRLYGRSFWG++EFMVV
Sbjct  168  GKSALFNRLVGGSRAIVVDEPGVTRDRLYGRSFWGDHEFMVV  209


 Score = 52.4 bits (124),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  521  TSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            +S V ++ +P + IVGRPNVGKS++ N LVG +R IV    G TRD +
Sbjct  356  SSEVEENYVPSIAIVGRPNVGKSSILNALVGEDRTIVSPISGTTRDAI  403



>gb|EMS63685.1| GTPase Der [Triticum urartu]
Length=640

 Score =   119 bits (299),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/89 (65%), Positives = 71/89 (80%), Gaps = 7/89 (8%)
 Frame = +2

Query  452  RQLRTEDDKTGEKETRKQKRLKSTSS----VPDHLLPKVVIVGRPNVGKSALFNRLVGGN  619
            R+LR + D    +E R+  R K+++S    +PD  LPKV ++GRPNVGKSALFNRLVGGN
Sbjct  110  RELRLDGDV---REKRRTMRDKTSTSKHVGIPDSKLPKVAVIGRPNVGKSALFNRLVGGN  166

Query  620  RAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            RAIVVDEPGVTRDRLYGRS+WG+ EFMV+
Sbjct  167  RAIVVDEPGVTRDRLYGRSYWGDQEFMVI  195



>ref|XP_010237503.1| PREDICTED: uncharacterized protein LOC100845933 isoform X2 [Brachypodium 
distachyon]
Length=645

 Score =   118 bits (295),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 5/86 (6%)
 Frame = +2

Query  455  QLRTEDDKTGEKETRKQKRLKSTSS--VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAI  628
            +LR + D    +E R+  R K+++S  +PD+ LPKV I+GRPNVGKSALFNRLVG NRAI
Sbjct  115  ELRVDGDV---REKRRTMRDKTSTSKHIPDNNLPKVAIIGRPNVGKSALFNRLVGSNRAI  171

Query  629  VVDEPGVTRDRLYGRSFWGEYEFMVV  706
            VVDEPGVTRDRLYGRS+WG+ EFMV+
Sbjct  172  VVDEPGVTRDRLYGRSYWGDQEFMVI  197



>ref|XP_010237502.1| PREDICTED: uncharacterized protein LOC100845933 isoform X1 [Brachypodium 
distachyon]
Length=648

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 70/86 (81%), Gaps = 5/86 (6%)
 Frame = +2

Query  455  QLRTEDDKTGEKETRKQKRLKSTSS--VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAI  628
            +LR + D    +E R+  R K+++S  +PD+ LPKV I+GRPNVGKSALFNRLVG NRAI
Sbjct  115  ELRVDGDV---REKRRTMRDKTSTSKHIPDNNLPKVAIIGRPNVGKSALFNRLVGSNRAI  171

Query  629  VVDEPGVTRDRLYGRSFWGEYEFMVV  706
            VVDEPGVTRDRLYGRS+WG+ EFMV+
Sbjct  172  VVDEPGVTRDRLYGRSYWGDQEFMVI  197



>gb|EMT17683.1| GTP-binding protein engA [Aegilops tauschii]
Length=639

 Score =   115 bits (288),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +2

Query  524  SSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMV  703
            +++PD  LPKV ++GRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRS+WG+ EFMV
Sbjct  139  NTIPDSKLPKVAVIGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSYWGDQEFMV  198

Query  704  V  706
            +
Sbjct  199  I  199



>ref|XP_001420333.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98626.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=555

 Score =   102 bits (254),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/69 (67%), Positives = 56/69 (81%), Gaps = 0/69 (0%)
 Frame = +2

Query  500  KQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSF  679
            ++K  +  S VPD  LP+V +VGRPNVGKSALFNRL G  RAIV DEPGVTRDR+Y R++
Sbjct  71   RRKTRRDWSKVPDEALPRVAVVGRPNVGKSALFNRLTGTKRAIVYDEPGVTRDRMYVRAY  130

Query  680  WGEYEFMVV  706
            WGE+EFM+V
Sbjct  131  WGEHEFMMV  139



>emb|CEF99667.1| P-loop containing nucleoside triphosphate hydrolase [Ostreococcus 
tauri]
Length=515

 Score =   101 bits (252),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/69 (68%), Positives = 55/69 (80%), Gaps = 0/69 (0%)
 Frame = +2

Query  500  KQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSF  679
            ++K  +  S VPD  LP+V +VGRPNVGKSALFNRL G  RAIV DEPGVTRDR+Y RS+
Sbjct  29   RRKTRRDWSKVPDAALPRVAVVGRPNVGKSALFNRLTGTKRAIVYDEPGVTRDRMYTRSY  88

Query  680  WGEYEFMVV  706
            WGE EFM+V
Sbjct  89   WGESEFMMV  97



>ref|XP_001770231.1| predicted protein [Physcomitrella patens]
 gb|EDQ64906.1| predicted protein [Physcomitrella patens]
Length=542

 Score =   101 bits (252),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 52/88 (59%), Positives = 60/88 (68%), Gaps = 5/88 (6%)
 Frame = +2

Query  458  LRTEDDKTGEKETRKQKRL-----KSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNR  622
            +R ED        R QKRL      S   +PD LLPK+ IVGRPNVGKSALFNR+ GG+ 
Sbjct  1    MRREDAGLKGMAKRSQKRLAKEEFSSELRIPDALLPKIAIVGRPNVGKSALFNRIAGGDI  60

Query  623  AIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            AIV DE GVTRDRLY R+FW  +EFM+V
Sbjct  61   AIVHDEAGVTRDRLYTRAFWSTHEFMLV  88



>ref|XP_007509383.1| GTP-binding protein EngA [Bathycoccus prasinos]
 emb|CCO19186.1| GTP-binding protein EngA [Bathycoccus prasinos]
Length=816

 Score =   100 bits (250),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 44/60 (73%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  527  SVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            ++P  LLPKV +VGRPNVGKSALFNRL G  RAIV DEPGVTRDR+Y R+FWG++EFM+V
Sbjct  309  TIPQELLPKVAVVGRPNVGKSALFNRLTGTKRAIVFDEPGVTRDRMYVRAFWGDHEFMLV  368



>ref|XP_005843504.1| hypothetical protein CHLNCDRAFT_37436 [Chlorella variabilis]
 gb|EFN51402.1| hypothetical protein CHLNCDRAFT_37436 [Chlorella variabilis]
Length=540

 Score = 99.0 bits (245),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 51/59 (86%), Gaps = 0/59 (0%)
 Frame = +2

Query  530  VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            VPD LLPKV IVGRPNVGKSALFNR+VG   AIV D PGVTRDRLY R+FWG++EF++V
Sbjct  96   VPDELLPKVAIVGRPNVGKSALFNRIVGRQVAIVYDYPGVTRDRLYTRAFWGDHEFLLV  154



>ref|XP_003082033.1| GTP-binding protein-like (ISS) [Ostreococcus tauri]
Length=500

 Score = 95.5 bits (236),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  536  DHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            D  LP+V +VGRPNVGKSALFNRL G  RAIV DEPGVTRDR+Y RS+WGE EFM+V
Sbjct  26   DAALPRVAVVGRPNVGKSALFNRLTGTKRAIVYDEPGVTRDRMYTRSYWGESEFMMV  82



>ref|XP_002985833.1| hypothetical protein SELMODRAFT_123195, partial [Selaginella 
moellendorffii]
 gb|EFJ13010.1| hypothetical protein SELMODRAFT_123195, partial [Selaginella 
moellendorffii]
Length=492

 Score = 93.6 bits (231),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  521  TSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFM  700
            T  VP HLLPKV IVGRPNVGKSALFNR+VG N AIV DEPGVTRDRLYGR      EFM
Sbjct  1    TLQVPSHLLPKVAIVGRPNVGKSALFNRIVGRNMAIVHDEPGVTRDRLYGRVRGSVQEFM  60

Query  701  VV  706
            ++
Sbjct  61   LI  62



>ref|XP_002984773.1| hypothetical protein SELMODRAFT_121150, partial [Selaginella 
moellendorffii]
 gb|EFJ14023.1| hypothetical protein SELMODRAFT_121150, partial [Selaginella 
moellendorffii]
Length=490

 Score = 93.2 bits (230),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/59 (76%), Positives = 48/59 (81%), Gaps = 0/59 (0%)
 Frame = +2

Query  530  VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            VP HLLPKV IVGRPNVGKSALFNR+VG N AIV DEPGVTRDRLYGR      EFM++
Sbjct  2    VPSHLLPKVAIVGRPNVGKSALFNRIVGRNMAIVHDEPGVTRDRLYGRVRGSVQEFMLI  60



>ref|XP_003061511.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54141.1| predicted protein [Micromonas pusilla CCMP1545]
Length=470

 Score = 91.7 bits (226),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP+V IVGRPNVGKSALFNRL G  RAIV D+PG+TRDR+Y R+FWG+ EFM+V
Sbjct  3    LPRVAIVGRPNVGKSALFNRLTGTKRAIVYDQPGITRDRMYVRAFWGDSEFMMV  56


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  551  KVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            KV IVGRPNVGKS+L N+L G  RAIV D  G TRD +
Sbjct  201  KVAIVGRPNVGKSSLLNQLSGDARAIVSDHSGTTRDTI  238



>ref|XP_005651191.1| P-loop containing nucleoside triphosphate hydrolase protein [Coccomyxa 
subellipsoidea C-169]
 gb|EIE26647.1| P-loop containing nucleoside triphosphate hydrolase protein [Coccomyxa 
subellipsoidea C-169]
Length=610

 Score = 90.5 bits (223),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 45/79 (57%), Positives = 55/79 (70%), Gaps = 1/79 (1%)
 Frame = +2

Query  473  DKTGEKETRKQK-RLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGV  649
            D    K TR+ +  + + + +P   LPKV IVGRPNVGKSALFNR+ G N AIV D PGV
Sbjct  109  DAKKSKRTREARGSIPTDNGIPLADLPKVAIVGRPNVGKSALFNRITGSNLAIVYDYPGV  168

Query  650  TRDRLYGRSFWGEYEFMVV  706
            TRDRLY R+ WG  +F+VV
Sbjct  169  TRDRLYTRASWGATDFVVV  187



>gb|KIZ00088.1| GTP-binding protein [Monoraphidium neglectum]
Length=613

 Score = 87.0 bits (214),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/67 (55%), Positives = 51/67 (76%), Gaps = 0/67 (0%)
 Frame = +2

Query  506  KRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWG  685
            ++ +S   +P   LPKV +VGRPNVGKSA+FNR+ G + A+V D PGVTRDR+Y R+FWG
Sbjct  115  RKRRSAQQLPLSALPKVAVVGRPNVGKSAMFNRIAGSSVAVVYDYPGVTRDRIYTRAFWG  174

Query  686  EYEFMVV  706
            + EF ++
Sbjct  175  DKEFCLI  181



>ref|WP_010024483.1| GTP-binding protein Der, partial [Sporolactobacillus inulinus]
Length=97

 Score = 79.3 bits (194),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P + IVGRPNVGKS LFNR+VGG  AIV D+PGVTRDRLYG   W  +EF V+
Sbjct  4    PTIAIVGRPNVGKSTLFNRIVGGRLAIVEDKPGVTRDRLYGNGTWLTHEFHVI  56



>ref|WP_038133265.1| hypothetical protein, partial [Verrucomicrobia bacterium SCGC 
AAA168-F10]
Length=65

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Composition-based stats.
 Identities = 35/55 (64%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP V IVGRPNVGKS +FNRLVG  +AIV DE GVTRDR YG S+W   +F ++
Sbjct  1    MLPTVSIVGRPNVGKSTIFNRLVGERQAIVHDEYGVTRDRHYGDSYWNGVDFNII  55



>ref|XP_001697913.1| hypothetical protein CHLREDRAFT_120661 [Chlamydomonas reinhardtii]
 gb|EDO99796.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=446

 Score = 82.8 bits (203),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  554  VVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            V IVGRPNVGKSALFNR+ G + A+V D+PGVTRDRLY R+FWG+ EF+++
Sbjct  1    VAIVGRPNVGKSALFNRIAGASVAVVFDQPGVTRDRLYTRAFWGDKEFVMI  51



>ref|WP_023510379.1| ribosome-associated GTPase EngA [Sporolactobacillus laevolacticus]
 gb|EST11711.1| GTP-binding protein Der [Sporolactobacillus laevolacticus DSM 
442]
Length=438

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P + IVGRPNVGKS LFNR+VGG  AIV D+PGVTRDRLYG   W  YEF V+
Sbjct  4    PTIAIVGRPNVGKSTLFNRIVGGRMAIVEDKPGVTRDRLYGNGSWLNYEFHVI  56



>ref|WP_028976307.1| ribosome-associated GTPase EngA [Sporolactobacillus terrae]
Length=438

 Score = 80.1 bits (196),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P + IVGRPNVGKS LFNR+VGG  AIV D+PGVTRDRLYG   W  +EF V+
Sbjct  4    PTIAIVGRPNVGKSTLFNRIVGGRLAIVEDKPGVTRDRLYGNGTWLTHEFHVI  56



>ref|WP_016379873.1| GTP-binding protein Der, partial [Lactobacillus paracasei]
 gb|EPC76589.1| GTP-binding protein Der, partial [Lactobacillus paracasei subsp. 
paracasei Lpp221]
Length=65

 Score = 73.9 bits (180),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/55 (60%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP + IVGRPNVGKS +FNR++G   +IV D PGVTRDR+YG S W   EF V+
Sbjct  2    VLPTLAIVGRPNVGKSTIFNRILGERVSIVEDTPGVTRDRIYGTSEWLGKEFAVI  56



>ref|WP_026731732.1| ribosome-associated GTPase EngA [Fischerella sp. PCC 9605]
Length=453

 Score = 79.7 bits (195),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G   AIV DEPGVTRDR Y  +FWG+ EF+VV
Sbjct  3    LPIVAIIGRPNVGKSTLVNRLAGEQSAIVFDEPGVTRDRTYLPAFWGDREFLVV  56



>ref|WP_041977481.1| ribosome-associated GTPase EngA [Pyrinomonas methylaliphatogenes]
 emb|CDM66290.1| ribosome-associated GTPase EngA [Pyrinomonas methylaliphatogenes]
Length=459

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS LFNRL+G  RAIV DEPG+TRDR+YG + W    F VV
Sbjct  12   LPLVAIIGRPNVGKSTLFNRLIGQRRAIVGDEPGITRDRIYGEAEWAGRRFAVV  65



>ref|WP_008521427.1| ribosome-associated GTPase EngA [Jonquetella anthropi]
 gb|EEX47920.1| ribosome biogenesis GTPase Der [Jonquetella anthropi E3_33 E1]
Length=440

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  554  VVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            V IVGRPNVGKS+LFNRLVG  RAIV D+PGVTRDRL+GR  WG+  F +V
Sbjct  4    VSIVGRPNVGKSSLFNRLVGSRRAIVDDQPGVTRDRLFGRVEWGDRSFYLV  54



>ref|WP_015220743.1| ribosome-associated GTPase EngA [Cyanobacterium aponinum]
 gb|AFZ55024.1| GTP-binding protein engA [Cyanobacterium aponinum PCC 10605]
Length=453

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP V I+GRPNVGKSAL NRL G   AIV D+PGVTRDR Y R+FW + EF VV
Sbjct  1    MLPIVAIIGRPNVGKSALVNRLCGEQDAIVFDQPGVTRDRTYRRAFWQDREFQVV  55



>ref|WP_008523016.1| MULTISPECIES: ribosome-associated GTPase EngA [Jonquetella]
 gb|EHM13360.1| ribosome-associated GTPase EngA [Jonquetella anthropi DSM 22815]
 gb|ERL24885.1| ribosome-associated GTPase EngA [Jonquetella sp. BV3C21]
Length=440

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  554  VVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            V IVGRPNVGKS+LFNRLVG  RAIV D+PGVTRDRL+GR  WG+  F +V
Sbjct  4    VSIVGRPNVGKSSLFNRLVGSRRAIVDDQPGVTRDRLFGRVEWGDRSFYLV  54



>ref|WP_012744727.1| GTPase Der [Kosmotoga olearia]
 sp|C5CIV1.1|DER_KOSOT RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Kosmotoga olearia TBF 19.5.1]
 gb|ACR78940.1| small GTP-binding protein [Kosmotoga olearia TBF 19.5.1]
Length=442

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +  V+IVGRPNVGKS LFNRLVGG RAI+ D+PGVTRD ++GR FW    F VV
Sbjct  1    MATVLIVGRPNVGKSTLFNRLVGGRRAIIDDQPGVTRDFVFGRVFWQHKSFEVV  54


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  551  KVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRD  658
            KV I+G+PN GKS+LFN +VG +R++V + PG TRD
Sbjct  183  KVAIIGKPNAGKSSLFNSIVGSDRSLVTEIPGTTRD  218



>ref|WP_010631650.1| ribosome-associated GTPase EngA [Sporolactobacillus vineae]
Length=438

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V IVGRPNVGKS +FNR+VGG  AIV D+PGVTRDRLYG   W  +EF V+
Sbjct  4    PTVAIVGRPNVGKSTVFNRIVGGRTAIVEDKPGVTRDRLYGNGEWLNHEFHVI  56



>ref|WP_012258958.1| MULTISPECIES: GTPase Der [Chloroflexus]
 ref|YP_001636694.1| GTP-binding protein EngA [Chloroflexus aurantiacus J-10-fl]
 sp|A9WHH9.1|DER_CHLAA RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Chloroflexus aurantiacus J-10-fl]
 sp|B9LBT6.1|DER_CHLSY RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Chloroflexus sp. Y-400-fl]
 gb|ABY36305.1| small GTP-binding protein [Chloroflexus aurantiacus J-10-fl]
 gb|ACM54731.1| small GTP-binding protein [Chloroflexus sp. Y-400-fl]
Length=449

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V IVGRPNVGKS  FNRL+G  RAIV D PG TRDRLYG +FW   EF VV
Sbjct  4    PIVAIVGRPNVGKSTFFNRLIGERRAIVEDLPGTTRDRLYGDTFWNGREFTVV  56


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  551  KVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRD  658
            ++ IVGRPNVGKS+L NRL+G  R++V   PG TRD
Sbjct  184  RIAIVGRPNVGKSSLLNRLLGQERSVVSSIPGTTRD  219



>ref|WP_015942432.1| GTPase Der [Chloroflexus aggregans]
 sp|B8GAY7.1|DER_CHLAD RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Chloroflexus aggregans DSM 9485]
 gb|ACL26587.1| small GTP-binding protein [Chloroflexus aggregans DSM 9485]
Length=449

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V IVGRPNVGKS  FNRL+G  RAIV D PG TRDRLYG +FW   EF VV
Sbjct  4    PIVAIVGRPNVGKSTFFNRLIGERRAIVEDIPGTTRDRLYGDTFWNGREFTVV  56


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = +2

Query  551  KVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGR-SFWGE  688
            +V IVGRPNVGKS+L NRL+G  R++V   PG TRD +    +++GE
Sbjct  184  RVAIVGRPNVGKSSLLNRLLGKERSVVSPIPGTTRDPIDTTITYYGE  230



>ref|WP_015206775.1| ribosome-associated GTPase EngA [Cylindrospermum stagnale]
 gb|AFZ23519.1| ribosome-associated GTPase EngA [Cylindrospermum stagnale PCC 
7417]
Length=454

 Score = 78.6 bits (192),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/54 (70%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G   AIV DEPGVTRDR Y  SFW + EFMVV
Sbjct  3    LPIVAIIGRPNVGKSTLVNRLAGEQTAIVHDEPGVTRDRTYMPSFWNDREFMVV  56



>ref|XP_005708451.1| GTP-binding protein [Galdieria sulphuraria]
 gb|EME31931.1| GTP-binding protein [Galdieria sulphuraria]
Length=541

 Score = 79.0 bits (193),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/93 (47%), Positives = 59/93 (63%), Gaps = 3/93 (3%)
 Frame = +2

Query  434  FSESLSRQLRTEDDKTGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVG  613
            FS+ +++Q  T+DD T + E + +K +  T  +  +L P V IVGRPNVGKS L NRL  
Sbjct  54   FSQLVAKQNSTKDDLTSQTEEKTRKEIPKTRIIRRNL-PLVAIVGRPNVGKSTLLNRLTR  112

Query  614  GNR--AIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
              R  AI VD PG+TRDR Y R+FW   +F +V
Sbjct  113  DFRFGAIAVDVPGITRDRTYHRAFWNGIDFELV  145



>ref|WP_028459350.1| ribosome-associated GTPase EngA [Chloroflexus sp. Y-396-1]
Length=449

 Score = 78.6 bits (192),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V IVGRPNVGKS  FNRL+G  RAIV D PG TRDRLYG +FW   EF VV
Sbjct  4    PIVAIVGRPNVGKSTFFNRLIGERRAIVEDIPGTTRDRLYGDTFWNGREFTVV  56



>ref|WP_031460150.1| ribosome-associated GTPase EngA [Chloroflexus sp. MS-G]
Length=448

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V IVGRPNVGKS  FNRL+G  RAIV D PG TRDRLYG +FW   EF VV
Sbjct  4    PIVAIVGRPNVGKSTFFNRLIGERRAIVEDIPGTTRDRLYGDTFWNGREFTVV  56



>ref|WP_020402934.1| ribosome-associated GTPase EngA [Gracilimonas tropica]
Length=435

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP V IVGRPNVGKS LFNRL+G  +AIV DE GVTRDR YG +FW   +F V+
Sbjct  1    MLPVVSIVGRPNVGKSTLFNRLIGSRKAIVHDEYGVTRDRHYGETFWNGRDFTVI  55


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +PK+  +GRPNVGKS+LFN ++   RAIV +  G TRD +     +   E+++V
Sbjct  174  VPKLAFIGRPNVGKSSLFNAILDDERAIVTNIAGTTRDSINSDLTYDGKEYILV  227



>gb|AHK22206.1| GTP-binding protein EngA [Candidatus Hepatoplasma crinochetorum 
Av]
Length=437

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +PKVVI+GRPNVGKS LFNRL+G   +I  D+ GVTRDR+Y +S W + EF+++
Sbjct  4    IPKVVIIGRPNVGKSTLFNRLIGKKISITFDKEGVTRDRIYQKSTWIDKEFLII  57



>ref|XP_002509246.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO70504.1| predicted protein [Micromonas sp. RCC299]
Length=468

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/45 (76%), Positives = 39/45 (87%), Gaps = 0/45 (0%)
 Frame = +2

Query  572  PNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            PNVGKSALFNRL G  RAIV D+PGVTRDR+Y R+FWG+ EFM+V
Sbjct  8    PNVGKSALFNRLTGTKRAIVYDQPGVTRDRMYIRAFWGDTEFMMV  52


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/38 (61%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  551  KVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            KV I+GRPNVGKS+L N+L G  R+IV D  G TRD +
Sbjct  199  KVAIIGRPNVGKSSLLNQLAGDARSIVSDYSGTTRDTI  236



>ref|WP_011525430.1| ribosome-associated GTPase EngA [Candidatus Koribacter versatilis]
 gb|ABF43633.1| Small GTP-binding protein [Candidatus Koribacter versatilis Ellin345]
Length=511

 Score = 78.2 bits (191),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 47/67 (70%), Gaps = 2/67 (3%)
 Frame = +2

Query  506  KRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWG  685
            ++ K T ++P  L+  + IVGRPNVGKS LFNRLVG  RAIV DEPG+TRDRLYG S W 
Sbjct  3    RKKKETVTLP--LVGMIAIVGRPNVGKSTLFNRLVGQRRAIVGDEPGITRDRLYGYSEWA  60

Query  686  EYEFMVV  706
                 VV
Sbjct  61   GKRLRVV  67



>gb|AEI41327.1| EngA [Paenibacillus mucilaginosus KNP414]
Length=469

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/70 (54%), Positives = 48/70 (69%), Gaps = 3/70 (4%)
 Frame = +2

Query  497  RKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRS  676
            RKQ+R K    +     P + IVGRPNVGKS +FNR++G   AIV D+PGVTRDRLYGR 
Sbjct  19   RKQQREKGMKRMA---RPVIAIVGRPNVGKSTIFNRIIGDKLAIVEDKPGVTRDRLYGRG  75

Query  677  FWGEYEFMVV  706
             W + EF ++
Sbjct  76   EWLDQEFSII  85



>ref|WP_017718897.1| ribosome-associated GTPase EngA [Oscillatoria sp. PCC 10802]
Length=452

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G   AIV DEPGVTRDR Y ++FWG+ EF+VV
Sbjct  3    LPIVAIIGRPNVGKSTLANRLAGVRDAIVHDEPGVTRDRTYRQAFWGDREFLVV  56


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +2

Query  512  LKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            L     +P+    KV IVGRPNVGKS+L N  VG NRAIV    G TRD +
Sbjct  165  LPPAGEIPEPEEIKVAIVGRPNVGKSSLLNAFVGENRAIVSPISGTTRDAI  215



>ref|WP_029972832.1| GTPase Der, partial [Prochlorococcus sp. scB243_495G23]
Length=133

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/56 (59%), Positives = 39/56 (70%), Gaps = 0/56 (0%)
 Frame = +2

Query  539  HLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
             +LP + I+GRPNVGKS L NRL   N AIV D+PGVTRDR Y  + WG  EF +V
Sbjct  1    MILPTIAIIGRPNVGKSTLVNRLCQSNDAIVFDKPGVTRDRTYQNASWGGKEFQIV  56



>ref|WP_015166473.1| ribosome-associated GTPase EngA [Pseudanabaena sp. PCC 7367]
 gb|AFY71519.1| GTP-binding protein engA [Pseudanabaena sp. PCC 7367]
Length=454

 Score = 77.8 bits (190),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKSA  NRL G   AIV D+PGVTRDR Y R+FW ++EF VV
Sbjct  3    LPIVAIVGRPNVGKSAFVNRLAGQQDAIVYDQPGVTRDRTYRRAFWRDHEFNVV  56



>ref|WP_029982035.1| GTPase Der, partial [Prochlorococcus sp. scB245a_519G16]
Length=83

 Score = 72.4 bits (176),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP V I+GRPNVGKS L NRL   N AIV D+PGVTRDR Y  + WG  EF +V
Sbjct  4    ILPTVAIIGRPNVGKSTLVNRLCQSNDAIVFDKPGVTRDRTYQNASWGGKEFQIV  58



>ref|WP_025922170.1| hypothetical protein, partial [Prochlorococcus sp. scB241_529D18]
Length=81

 Score = 72.4 bits (176),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP + I+GRPNVGKS L NRL   N AIV D+PGVTRDR Y  + WG  EF +V
Sbjct  2    ILPTIAIIGRPNVGKSTLVNRLCQSNDAIVFDKPGVTRDRTYQNASWGGKEFQIV  56



>ref|WP_026499813.1| ribosome-associated GTPase EngA [Caldibacillus debilis]
Length=436

 Score = 77.4 bits (189),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS +FNR+VG   AIV D PGVTRDRLYG+  W  +EF V+
Sbjct  3    LPTVAIVGRPNVGKSTIFNRIVGERLAIVEDVPGVTRDRLYGKGEWLNFEFNVI  56



>ref|WP_038039529.1| ribosome-associated GTPase EngA, partial [Thermomicrobiales bacterium 
KI4]
Length=453

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +2

Query  530  VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +P+  LP V IVGRPNVGKS LFNR++G  RAIV D PG TRDR+YG + WG   F +V
Sbjct  1    MPEGPLPLVAIVGRPNVGKSTLFNRILGQRRAIVEDLPGTTRDRIYGEAEWGRTRFALV  59



>ref|WP_015139682.1| ribosome-associated GTPase EngA [Nostoc sp. PCC 7524]
 gb|AFY49252.1| ribosome-associated GTPase EngA [Nostoc sp. PCC 7524]
Length=453

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G   AIV DEPGVTRDR Y  ++WG+ EF+VV
Sbjct  3    LPIVAIIGRPNVGKSTLVNRLAGEQTAIVHDEPGVTRDRTYMPAYWGDREFLVV  56



>ref|WP_013192173.1| ribosome-associated GTPase EngA [Trichormus azollae]
 gb|ADI65159.1| ribosome-associated GTPase EngA ['Nostoc azollae' 0708]
Length=454

 Score = 77.4 bits (189),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G   AIV DEPGVTRDR Y  +FWG  EF+VV
Sbjct  3    LPIVAIIGRPNVGKSTLVNRLAGDQTAIVHDEPGVTRDRTYRPAFWGNREFVVV  56



>ref|WP_019498611.1| ribosome-associated GTPase EngA [Pseudanabaena sp. PCC 6802]
Length=454

 Score = 77.0 bits (188),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS L NRL G   AIV DEPG+TRDR Y   FWG+++F VV
Sbjct  3    LPIVAIVGRPNVGKSTLVNRLAGEQFAIVFDEPGITRDRTYRNCFWGKHDFTVV  56



>ref|WP_010494960.1| ribosome-associated GTPase EngA [Paenibacillus elgii]
Length=440

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V IVGRPNVGKS +FNR++G   AIV D+PGVTRDRLYGR  W + EF V+
Sbjct  4    PIVAIVGRPNVGKSTVFNRIIGDKLAIVEDKPGVTRDRLYGRGEWLDTEFSVI  56



>ref|WP_036680709.1| ribosome-associated GTPase EngA [Paenibacillus sp. MSt1]
 gb|KEQ26111.1| GTP-binding protein Der [Paenibacillus sp. MSt1]
Length=440

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V IVGRPNVGKS +FNR++G   AIV D+PGVTRDRLYGR  W + EF V+
Sbjct  4    PIVAIVGRPNVGKSTVFNRIIGDKLAIVEDKPGVTRDRLYGRGEWLDTEFSVI  56



>ref|WP_025846395.1| ribosome-associated GTPase EngA [Paenibacillus ehimensis]
Length=440

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V IVGRPNVGKS +FNR++G   AIV D+PGVTRDRLYGR  W + EF V+
Sbjct  4    PIVAIVGRPNVGKSTVFNRIIGDKLAIVEDKPGVTRDRLYGRGEWLDTEFSVI  56



>ref|WP_015162474.1| ribosome-associated GTPase EngA [Chamaesiphon minutus]
 gb|AFY96391.1| ribosome-associated GTPase EngA [Chamaesiphon minutus PCC 6605]
Length=452

 Score = 77.0 bits (188),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G   +IV DEPGVTRDR Y R+FW + EF+VV
Sbjct  3    LPIVAIIGRPNVGKSTLVNRLAGARESIVHDEPGVTRDRTYRRAFWQDREFVVV  56



>ref|WP_015187905.1| ribosome-associated GTPase EngA [Gloeocapsa sp. PCC 7428]
 gb|AFZ30030.1| GTP-binding protein engA [Gloeocapsa sp. PCC 7428]
Length=452

 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G   AIV DEPGVTRDR Y  ++W + EF+VV
Sbjct  3    LPIVAIIGRPNVGKSTLVNRLAGAQDAIVYDEPGVTRDRTYSNAYWRDREFVVV  56



>ref|WP_019122473.1| ribosome-associated GTPase EngA [Brevibacillus massiliensis]
Length=437

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS +FNRLVG   AIV D PGVTRDRLYG+  W  ++F V+
Sbjct  3    LPVVAIVGRPNVGKSTIFNRLVGQRIAIVEDTPGVTRDRLYGKGEWLNHQFHVI  56



>ref|WP_010690892.1| ribosome-associated GTPase EngA [Fructobacillus fructosus]
Length=436

 Score = 76.6 bits (187),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V +VGRPNVGKS LFNR+VG   AIV D+PGVTRDRLY R+ W  Y+F V+
Sbjct  4    PVVAVVGRPNVGKSTLFNRIVGERMAIVEDKPGVTRDRLYARAEWLNYDFRVI  56



>gb|AFH62062.2| GTP-binding protein Der [Paenibacillus mucilaginosus K02]
Length=443

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P + IVGRPNVGKS +FNR++G   AIV D+PGVTRDRLYGR  W + EF ++
Sbjct  7    PVIAIVGRPNVGKSTIFNRIIGDKLAIVEDKPGVTRDRLYGRGEWLDQEFSII  59



>ref|WP_018126412.1| ribosome-associated GTPase EngA [Balneola vulgaris]
Length=435

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP V IVGRPNVGKS +FNRL+G  +AIV DE GVTRDR YG+++W   +F V+
Sbjct  1    MLPVVSIVGRPNVGKSTIFNRLIGKRKAIVHDEYGVTRDRHYGQTYWNGIDFNVI  55


 Score = 50.4 bits (119),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            PK+  +GRPNVGKS+L N L+   R+IV D  G TRD +  +  +   ++++V
Sbjct  175  PKLAFIGRPNVGKSSLVNALLNDERSIVTDIAGTTRDTINSKFNYNNKDYILV  227



>ref|WP_014650790.1| ribosome-associated GTPase EngA [Paenibacillus mucilaginosus]
Length=440

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P + IVGRPNVGKS +FNR++G   AIV D+PGVTRDRLYGR  W + EF ++
Sbjct  4    PVIAIVGRPNVGKSTIFNRIIGDKLAIVEDKPGVTRDRLYGRGEWLDQEFSII  56



>ref|WP_014370036.1| ribosome-associated GTPase EngA [Paenibacillus mucilaginosus]
 gb|AFC29877.1| EngA [Paenibacillus mucilaginosus 3016]
Length=440

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P + IVGRPNVGKS +FNR++G   AIV D+PGVTRDRLYGR  W + EF ++
Sbjct  4    PVIAIVGRPNVGKSTIFNRIIGDKLAIVEDKPGVTRDRLYGRGEWLDQEFSII  56



>ref|WP_009556849.1| ribosome-associated GTPase EngA [Oscillatoriales cyanobacterium 
JSC-12]
 gb|EKQ68084.1| ribosome-associated GTPase EngA [Oscillatoriales cyanobacterium 
JSC-12]
Length=452

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS + NRL G   AIV DEPGVTRDR Y R++W + EF+VV
Sbjct  3    LPVVAIIGRPNVGKSTIVNRLAGVQEAIVYDEPGVTRDRTYKRAYWRDREFLVV  56



>ref|WP_029953668.1| GTPase Der, partial [Prochlorococcus sp. scB241_528J14]
Length=89

 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP + I+GRPNVGKS L NRL   N AIV D+PGVTRDR Y  + WG  EF +V
Sbjct  2    ILPTIAIIGRPNVGKSTLVNRLCQSNDAIVFDKPGVTRDRTYQNASWGGKEFPIV  56



>ref|WP_009631866.1| ribosome-associated GTPase EngA [Synechocystis sp. PCC 7509]
Length=458

 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS + NRL G   AIV DEPG+TRDR Y  ++WG+ +F+VV
Sbjct  3    LPIVAIIGRPNVGKSTIVNRLAGTGAAIVYDEPGITRDRTYVNAYWGDRDFVVV  56


 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 35/64 (55%), Gaps = 0/64 (0%)
 Frame = +2

Query  473  DKTGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVT  652
            + TGE        L     +PD    K+ IVGRPNVGKS+L N  VG NRAIV    G T
Sbjct  152  NGTGELLDAVVAHLPLAEDLPDVDEVKIAIVGRPNVGKSSLLNAFVGENRAIVSPISGTT  211

Query  653  RDRL  664
            RD +
Sbjct  212  RDAI  215



>ref|WP_009629189.1| ribosome-associated GTPase EngA [Pseudanabaena biceps]
 gb|ELS30741.1| GTP-binding protein engA [Pseudanabaena biceps PCC 7429]
Length=452

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V +VGRPNVGKS L NRL G   AIV D+PGVTRDR+Y   FWG +EF VV
Sbjct  3    LPIVAVVGRPNVGKSTLVNRLSGEQYAIVYDQPGVTRDRVYRECFWGAHEFQVV  56



>ref|WP_023075386.1| ribosome-associated GTPase EngA [Leptolyngbya sp. Heron Island 
J]
 gb|ESA33759.1| ribosome-associated gtpase [Leptolyngbya sp. Heron Island J]
Length=453

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G   AIV D+PGVTRDR Y  +FW + +FMVV
Sbjct  3    LPVVAIIGRPNVGKSTLVNRLAGAREAIVYDQPGVTRDRTYQPAFWQDRDFMVV  56


 Score = 52.8 bits (125),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  TGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRD  658
            TGE        L  T  + +    KV IVGRPNVGKS+L N  VG NR+IV D  G TRD
Sbjct  154  TGELLDELITHLPPTDELTEDDEIKVAIVGRPNVGKSSLLNAFVGENRSIVSDISGTTRD  213

Query  659  RL  664
             +
Sbjct  214  TI  215



>ref|WP_015171009.1| ribosome-associated GTPase EngA [Geitlerinema sp. PCC 7407]
 gb|AFY65442.1| ribosome-associated GTPase EngA [Geitlerinema sp. PCC 7407]
Length=453

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NR  G   +IV DEPGVTRDR Y R+FW + EFMVV
Sbjct  3    LPIVAIIGRPNVGKSTLVNRFAGVTDSIVHDEPGVTRDRTYRRAFWQDREFMVV  56



>ref|WP_006517461.1| ribosome-associated GTPase EngA [Leptolyngbya sp. PCC 7375]
 gb|EKV03091.1| ribosome-associated GTPase EngA [Leptolyngbya sp. PCC 7375]
Length=453

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G   AIV D+PGVTRDR Y  +FW + +FMVV
Sbjct  3    LPVVAIIGRPNVGKSTLVNRLAGAREAIVYDQPGVTRDRTYQPAFWQDRDFMVV  56


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  TGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRD  658
            TGE        L  T  + +    KV IVGRPNVGKS+L N  VG NRAIV +  G TRD
Sbjct  154  TGELLDELVTHLPPTDEIEEDDEIKVAIVGRPNVGKSSLLNAFVGENRAIVSNISGTTRD  213

Query  659  RL  664
             +
Sbjct  214  TI  215



>ref|WP_023172386.1| ribosome-associated GTPase EngA [Gloeobacter kilaueensis]
 gb|AGY57317.1| GTP-binding protein EngA [Gloeobacter kilaueensis JS1]
Length=456

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS L NRL GG+ AIV D+PGVTRDRLY  + W  Y F VV
Sbjct  3    LPVVAIVGRPNVGKSTLLNRLAGGSEAIVYDQPGVTRDRLYLPAEWCGYRFQVV  56



>ref|WP_045873105.1| GTPase Der [Tolypothrix sp. PCC 7601]
 gb|EKE98712.1| ribosome-associated GTPase EngA [Tolypothrix sp. PCC 7601]
Length=453

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G   AIV DEPGVTRDR Y  S+W + EF+VV
Sbjct  3    LPIVAIIGRPNVGKSTLVNRLAGEQTAIVHDEPGVTRDRTYMPSYWSDREFLVV  56


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  TGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRD  658
            TGE      K +   + VP+    KV I+GRPNVGKS+L N  VG  RAIV    G TRD
Sbjct  154  TGELLDELIKHIPQVTDVPETNEIKVAIIGRPNVGKSSLLNAFVGEERAIVSPISGTTRD  213

Query  659  RL  664
             +
Sbjct  214  AI  215



>ref|WP_016876204.1| ribosome-associated GTPase EngA [Chlorogloeopsis fritschii]
Length=453

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS   NRL G   AIV DEPGVTRDR Y  SFW + EFMVV
Sbjct  3    LPIVAIIGRPNVGKSTFVNRLAGEQSAIVYDEPGVTRDRTYLPSFWRDREFMVV  56


 Score = 50.1 bits (118),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 27/51 (53%), Positives = 32/51 (63%), Gaps = 0/51 (0%)
 Frame = +2

Query  512  LKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            L  T+ +P+     V IVGRPNVGKS+L N LVG  RAIV    G TRD +
Sbjct  165  LPPTAEIPETDEINVAIVGRPNVGKSSLLNALVGEQRAIVSPISGTTRDAI  215



>ref|WP_020008349.1| ribosome-associated GTPase EngA [Salinicoccus albus]
Length=436

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P + +VGRPNVGKS LFNR++G  +AIV D PGVTRDRLY    W  YEF V+
Sbjct  4    PTIAVVGRPNVGKSTLFNRIIGERKAIVEDTPGVTRDRLYAAGDWLNYEFNVI  56



>ref|WP_035154056.1| ribosome-associated GTPase EngA [Calothrix sp. 336/3]
 gb|KFB84034.1| GTPase Der [Calothrix sp. 336/3]
Length=453

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G   AIV DEPG+TRDR Y  +FW + EF+VV
Sbjct  3    LPIVAIIGRPNVGKSTLVNRLAGQQSAIVYDEPGITRDRTYLPAFWSDREFLVV  56



>ref|WP_017548929.1| ribosome-associated GTPase EngA [Salinicoccus carnicancri]
Length=436

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P + +VGRPNVGKS LFNR++G  +AIV D PGVTRDRLY    W  YEF V+
Sbjct  4    PTIAVVGRPNVGKSTLFNRIIGERKAIVEDSPGVTRDRLYAAGDWLNYEFNVI  56



>ref|WP_015743770.1| ribosome-associated GTPase EngA [Candidatus Methylomirabilis 
oxyfera]
 emb|CBE68269.1| GTP-binding protein engA [Candidatus Methylomirabilis oxyfera]
Length=439

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/46 (78%), Positives = 37/46 (80%), Gaps = 0/46 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFW  682
            LP V IVGRPNVGKS LFNRLVGG RAIV D+PGVTRDRLY    W
Sbjct  3    LPIVTIVGRPNVGKSTLFNRLVGGRRAIVHDQPGVTRDRLYATVEW  48



>ref|WP_015150727.1| ribosome-associated GTPase EngA [Oscillatoria acuminata]
 gb|AFY84106.1| ribosome-associated GTPase EngA [Oscillatoria acuminata PCC 6304]
Length=454

 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NR+ GG +AIV DEPGVTRDR Y  +FW + +F +V
Sbjct  3    LPIVAIIGRPNVGKSTLVNRIAGGKQAIVHDEPGVTRDRTYRDAFWQDRDFQIV  56



>ref|WP_033013208.1| hypothetical protein, partial [Pseudoalteromonas haloplanktis]
Length=74

 Score = 70.9 bits (172),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP + +VGRPNVGKS LFNRL     A+V D PG+TRDR YG++ +  YEF+VV
Sbjct  1    MLPVIALVGRPNVGKSTLFNRLTRTRDALVADFPGLTRDRKYGQASYDGYEFIVV  55



>ref|WP_025956513.1| hypothetical protein, partial [Prochlorococcus sp. scB243_498L10]
Length=219

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP + I+GRPNVGKS L NRL   N AIV D+PGVTRDR Y  + WG  EF +V
Sbjct  2    ILPTIAIIGRPNVGKSTLVNRLCQSNDAIVFDKPGVTRDRTYQNASWGGKEFQIV  56



>ref|WP_028505583.1| ribosome-associated GTPase EngA [Ruminococcus sp. FC2018]
Length=443

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS LFN+L+G   +IV D PGVTRDR+YG+  W   EFM+V
Sbjct  3    LPVVAIVGRPNVGKSTLFNKLIGQRLSIVEDTPGVTRDRIYGKCEWLSKEFMLV  56



>ref|WP_015168114.1| ribosome-associated GTPase EngA [Synechococcus sp. PCC 7502]
 gb|AFY73456.1| ribosome-associated GTPase EngA [Synechococcus sp. PCC 7502]
Length=460

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V +VGRPNVGKSAL NRL G N AIV D+PG+TRDR Y  +FW  ++F +V
Sbjct  3    LPIVAVVGRPNVGKSALVNRLTGENYAIVYDQPGITRDRTYRPAFWNGHDFTIV  56



>dbj|BAQ62868.1| GTP-binding protein EngA [Geminocystis sp. NIES-3708]
Length=452

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP V I+GRPNVGKSAL NRL G   AIV DEPG+TRDR Y  +FW + EF +V
Sbjct  1    MLPIVAIIGRPNVGKSALVNRLSGEQDAIVYDEPGITRDRTYRPAFWQDREFQIV  55



>ref|WP_039752516.1| ribosome-associated GTPase EngA [Hassallia byssoidea]
 gb|KIF28918.1| GTPase Der [Hassallia byssoidea VB512170]
Length=454

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G   AIV DEPGVTRDR Y  ++WG+ E++VV
Sbjct  3    LPIVAIIGRPNVGKSTLVNRLAGQQSAIVHDEPGVTRDRTYLPAYWGDREYLVV  56



>ref|WP_012283044.1| GTPase Der [Heliobacterium modesticaldum]
 sp|B0TFW3.1|DER_HELMI RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Heliobacterium modesticaldum Ice1]
 gb|ABZ84543.1| GTP-binding protein [Heliobacterium modesticaldum Ice1]
Length=442

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V IVGRPNVGKS LFNRL GG  AIV D+PGVTRDRLY  + W + EF VV
Sbjct  4    PIVAIVGRPNVGKSTLFNRLTGGRVAIVEDQPGVTRDRLYRDANWLDREFTVV  56


 Score = 50.1 bits (118),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 2/44 (5%)
 Frame = +2

Query  533  PDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            PD +  K+ ++GRPNVGKS+L N ++G  R IV D PG TRD +
Sbjct  175  PDTI--KIAVIGRPNVGKSSLVNAILGQERVIVSDIPGTTRDAI  216



>ref|WP_027845405.1| ribosome-associated GTPase EngA [Mastigocoleus testarum]
Length=453

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G   AIV D+PGVTRDR Y  S+WG+ EF+VV
Sbjct  3    LPIVAIIGRPNVGKSTLVNRLAGEKAAIVHDQPGVTRDRTYLPSYWGDREFVVV  56


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/64 (44%), Positives = 36/64 (56%), Gaps = 0/64 (0%)
 Frame = +2

Query  473  DKTGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVT  652
            + TG+      K L +   +P+    KV I+GRPNVGKS+L N  VG  RAIV    G T
Sbjct  152  NGTGDLLDELIKHLPAVEELPEDNEIKVAIIGRPNVGKSSLLNAFVGEERAIVSPISGTT  211

Query  653  RDRL  664
            RD +
Sbjct  212  RDAI  215



>ref|WP_015227542.1| ribosome-associated GTPase EngA [Halothece sp. PCC 7418]
 gb|AFZ45670.1| ribosome-associated GTPase EngA [Halothece sp. PCC 7418]
Length=455

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NR  G   AIV DEPG+TRDRLY  SFW + +F+VV
Sbjct  4    LPIVAIIGRPNVGKSTLVNRFTGSRHAIVHDEPGITRDRLYQPSFWRDRDFIVV  57



>ref|WP_044200424.1| GTP-binding protein Der [Oscillochloris trichoides]
Length=460

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V +VGRPNVGKS  FNRL+G  RAIV D PG TRDR+YG +FW   +F VV
Sbjct  4    PIVALVGRPNVGKSTFFNRLIGERRAIVEDMPGTTRDRIYGDTFWNGRDFTVV  56



>ref|WP_017294045.1| ribosome-associated GTPase EngA [Geminocystis herdmanii]
Length=452

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/55 (64%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP V I+GRPNVGKSAL NRL G   AIV DEPG+TRDR Y  +FW + EF +V
Sbjct  1    MLPIVAIIGRPNVGKSALVNRLSGEQDAIVYDEPGITRDRTYRPAFWQDREFQIV  55



>ref|WP_025914220.1| ribosome-associated GTPase EngA [Prochlorococcus sp. scB245a_520K10]
Length=457

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LPK+ I+GRPNVGKS L NRL   N AIV D+PGVTRDR Y  + WG  EF +V
Sbjct  2    ILPKIAIIGRPNVGKSTLVNRLCESNDAIVFDKPGVTRDRTYQNASWGGKEFQIV  56



>ref|WP_029633792.1| ribosome-associated GTPase EngA [[Scytonema hofmanni] UTEX B 
1581]
Length=454

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G   AIV DEPGVTRDR Y  ++WG+ E++VV
Sbjct  3    LPIVAIIGRPNVGKSTLVNRLAGQQSAIVHDEPGVTRDRTYLPAYWGDREYLVV  56



>ref|WP_027201545.1| ribosome-associated GTPase EngA [Butyricimonas virosa]
Length=435

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/51 (71%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  554  VVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            V IVGRPNVGKS LFNRLVGG +AIV +E GVTRDR YG+S W   EF V+
Sbjct  5    VAIVGRPNVGKSTLFNRLVGGRKAIVNEESGVTRDRNYGKSEWNGKEFSVI  55


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LPK+ IVGRPNVGKS+  N L+G  R IV D  G TRD +  R     ++F++V
Sbjct  175  LPKIAIVGRPNVGKSSTINALIGEERNIVTDIAGTTRDTITTRYNRFGHDFLLV  228



>ref|WP_025926052.1| ribosome-associated GTPase EngA [Prochlorococcus sp. scB241_528J8]
Length=457

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LPK+ I+GRPNVGKS L NRL   N AIV D+PGVTRDR Y  + WG  EF +V
Sbjct  2    ILPKIAIIGRPNVGKSTLVNRLCESNDAIVFDKPGVTRDRTYQNASWGGKEFQIV  56



>ref|WP_003387108.1| ribosome-associated GTPase EngA [Brevibacillus borstelensis]
 gb|EMT53614.1| GTP-binding protein EngA [Brevibacillus borstelensis AK1]
Length=437

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS +FNRLVG   AIV D+PGVTRDRLYG+  W +  F V+
Sbjct  3    LPVVAIVGRPNVGKSTIFNRLVGERIAIVEDKPGVTRDRLYGKGEWLDQYFHVI  56



>ref|WP_015229104.1| ribosome-associated GTPase EngA [Dactylococcopsis salina]
 gb|AFZ50100.1| ribosome-associated GTPase EngA [Dactylococcopsis salina PCC 
8305]
Length=456

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NR  G   AIV DEPG+TRDRLY  SFW + +F+VV
Sbjct  4    LPIVAIIGRPNVGKSTLVNRFTGSRTAIVHDEPGITRDRLYQPSFWRDRDFLVV  57



>ref|WP_023554448.1| ribosome-associated GTPase EngA [Brevibacillus panacihumi]
 gb|EST56072.1| GTP-binding protein Der [Brevibacillus panacihumi W25]
Length=437

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS +FNRL+G   AIV D+PGVTRDRLYG+  W  + F V+
Sbjct  3    LPVVAIVGRPNVGKSTIFNRLIGERIAIVEDKPGVTRDRLYGKGEWLTHTFHVI  56



>ref|WP_009454105.1| MULTISPECIES: ribosome-associated GTPase EngA [Fischerella]
 gb|EHC19496.1| GTP-binding protein engA [Fischerella sp. JSC-11]
Length=453

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G   AIV D+PGVTRDR Y  +FW + EFMVV
Sbjct  3    LPIVAIIGRPNVGKSTLVNRLAGEQSAIVYDQPGVTRDRTYLPAFWRDREFMVV  56


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  TGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRD  658
            TG+   +    L+    +PD    K+ IVGRPNVGKS+L N  VG  RAIV    G TRD
Sbjct  154  TGDLLDKLINYLQPVQDLPDINEIKIAIVGRPNVGKSSLLNAFVGEERAIVSPISGTTRD  213

Query  659  RL  664
             +
Sbjct  214  AI  215



>ref|WP_016865529.1| ribosome-associated GTPase EngA [Fischerella muscicola]
Length=453

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G   AIV D+PGVTRDR Y  +FW + EFMVV
Sbjct  3    LPIVAIIGRPNVGKSTLVNRLAGEQSAIVYDQPGVTRDRTYLPAFWRDREFMVV  56


 Score = 50.4 bits (119),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +2

Query  512  LKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            L+    +PD    K+ IVGRPNVGKS+L N  VG  RAIV    G TRD +
Sbjct  165  LQPVQDIPDIDEIKIAIVGRPNVGKSSLLNAFVGEERAIVSPISGTTRDAI  215



>gb|EFO80464.1| small GTP-binding protein [Oscillochloris trichoides DG-6]
Length=525

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V +VGRPNVGKS  FNRL+G  RAIV D PG TRDR+YG +FW   +F VV
Sbjct  69   PIVALVGRPNVGKSTFFNRLIGERRAIVEDMPGTTRDRIYGDTFWNGRDFTVV  121



>dbj|BAQ64963.1| GTP-binding protein EngA [Geminocystis sp. NIES-3709]
Length=452

 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/55 (65%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP V I+GRPNVGKSAL NRL G   AIV DEPG+TRDR Y  +FW + EF VV
Sbjct  1    MLPIVAIIGRPNVGKSALVNRLSGEQDAIVYDEPGITRDRTYRPAFWRDREFQVV  55



>ref|WP_011640733.1| ribosome-associated GTPase EngA [Syntrophomonas wolfei]
 gb|ABI68633.1| conserved hypothetical protein [Syntrophomonas wolfei subsp. 
wolfei str. Goettingen G311]
Length=441

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V IVGRPNVGKS LFNRL G  +AIV D PGVTRDRLY  S W   EF+++
Sbjct  3    PVVAIVGRPNVGKSTLFNRLAGARKAIVEDIPGVTRDRLYDSSDWNGREFIII  55


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  551  KVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            K+ IVGRPNVGKS+L N L+G  R IV D PG TRD +
Sbjct  177  KIAIVGRPNVGKSSLVNALLGEERVIVSDVPGTTRDAI  214



>ref|WP_011143202.1| GTPase Der [Gloeobacter violaceus]
 ref|NP_926156.1| GTP-binding protein EngA [Gloeobacter violaceus PCC 7421]
 sp|Q7NGF9.1|DER_GLOVI RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Gloeobacter violaceus PCC 7421]
 dbj|BAC91151.1| gll3210 [Gloeobacter violaceus PCC 7421]
Length=455

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL GG+ AIV D+PGVTRDRLY  + W  Y F VV
Sbjct  3    LPIVAIIGRPNVGKSTLLNRLAGGSEAIVYDQPGVTRDRLYLPAEWCGYRFEVV  56



>ref|WP_045117204.1| hypothetical protein [Plesiocystis pacifica]
Length=475

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V I+GRPNVGKS LFNRLVG   AIV D PGVTRDRLYG + W    F+VV
Sbjct  16   PLVAIIGRPNVGKSTLFNRLVGRREAIVEDRPGVTRDRLYGVASWEGRHFLVV  68



>ref|WP_015442115.1| ribosome-associated GTPase EngA [Ilumatobacter coccineus]
 dbj|BAN02868.1| GTP-binding protein EngA [Ilumatobacter coccineus YM16-304]
Length=476

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/59 (61%), Positives = 43/59 (73%), Gaps = 0/59 (0%)
 Frame = +2

Query  530  VPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            VP+  LP VVI+GRPNVGKS LFNR+VG  +AIV D PG+TRDR    + W E  F+VV
Sbjct  28   VPEAELPTVVIIGRPNVGKSTLFNRVVGSQQAIVEDRPGITRDRKVLEASWLEVPFLVV  86


 Score = 58.2 bits (139),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            P+V IVGRPNVGKS LFNRLVG +RA+V D  G TRD +
Sbjct  224  PRVAIVGRPNVGKSTLFNRLVGEDRAVVHDMAGTTRDSI  262



>ref|WP_007716500.1| ribosome-associated GTPase EngA [Brevibacillus sp. BC25]
 gb|EJL32094.1| ribosome-associated GTPase EngA [Brevibacillus sp. BC25]
Length=437

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS +FNRL+G   AIV D PGVTRDRLYG+  W  + F V+
Sbjct  3    LPVVAIVGRPNVGKSTIFNRLIGQRVAIVEDMPGVTRDRLYGKGEWLTHTFHVI  56



>ref|WP_005831336.1| MULTISPECIES: ribosome-associated GTPase EngA [Bacillales]
 gb|EJL40940.1| ribosome-associated GTPase EngA [Brevibacillus sp. CF112]
 gb|ELK41683.1| GTP-binding protein EngA [Brevibacillus agri BAB-2500]
Length=437

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS +FNRLVG   AIV D PGVTRDRLYG+  W  + F V+
Sbjct  3    LPVVAIVGRPNVGKSTIFNRLVGERIAIVEDMPGVTRDRLYGKGEWLTHTFHVI  56



>gb|EDM75385.1| GTP-binding protein EngA [Plesiocystis pacifica SIR-1]
Length=487

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V I+GRPNVGKS LFNRLVG   AIV D PGVTRDRLYG + W    F+VV
Sbjct  28   PLVAIIGRPNVGKSTLFNRLVGRREAIVEDRPGVTRDRLYGVASWEGRHFLVV  80



>ref|WP_025843788.1| ribosome-associated GTPase EngA [Brevibacillus agri]
Length=437

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS +FNRLVG   AIV D PGVTRDRLYG+  W  + F V+
Sbjct  3    LPVVAIVGRPNVGKSTIFNRLVGERIAIVEDMPGVTRDRLYGKGEWLTHTFHVI  56



>ref|WP_022134734.1| ribosome-associated GTPase EngA [Clostridium sp. CAG:594]
 emb|CDA80642.1| gTPase Der [Clostridium sp. CAG:594]
Length=437

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP + +VGRPNVGKS +FNRLVG  +AI+ D PGVTRDR+YG   + +Y+F V+
Sbjct  3    LPTIALVGRPNVGKSTIFNRLVGKKQAIIEDTPGVTRDRIYGTGSYYDYKFNVI  56



>ref|WP_015222487.1| ribosome-associated GTPase EngA [Cyanobacterium stanieri]
 gb|AFZ47169.1| ribosome-associated GTPase EngA [Cyanobacterium stanieri PCC 
7202]
Length=452

 Score = 75.1 bits (183),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 41/55 (75%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP V ++GRPNVGKSAL NRL G   AIV DEPG+TRDR Y  +FW + EF +V
Sbjct  1    MLPIVAVIGRPNVGKSALVNRLSGEQDAIVFDEPGITRDRTYRPAFWQDREFQIV  55



>ref|WP_012686135.1| GTPase Der [Brevibacillus brevis]
 sp|C0ZCB6.1|DER_BREBN RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Brevibacillus brevis NBRC 100599]
 dbj|BAH43425.1| GTP-binding protein EngA [Brevibacillus brevis NBRC 100599]
Length=437

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS +FNRL+G   AIV D PGVTRDRLYG+  W  + F V+
Sbjct  3    LPVVAIVGRPNVGKSTIFNRLIGERVAIVEDMPGVTRDRLYGKGEWLTHTFHVI  56



>ref|WP_012408391.1| GTPase Der [Nostoc punctiforme]
 sp|B2J1L2.1|DER_NOSP7 RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Nostoc punctiforme PCC 73102]
 gb|ACC80373.1| small GTP-binding protein [Nostoc punctiforme PCC 73102]
Length=456

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G   AIV DEPGVTRDR Y  +FW   EF+VV
Sbjct  3    LPIVAIIGRPNVGKSTLVNRLAGEQTAIVHDEPGVTRDRTYMPAFWNGREFLVV  56


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 34/62 (55%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  TGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRD  658
            TGE        + +   +P+    KV IVGRPNVGKS+L N  VG  RAIV    G TRD
Sbjct  154  TGELLDELVNHIPAVEDIPETNEIKVAIVGRPNVGKSSLLNAFVGEERAIVSPISGTTRD  213

Query  659  RL  664
             +
Sbjct  214  AI  215



>ref|WP_016740012.1| ribosome-associated GTPase EngA [Brevibacillus brevis]
Length=437

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS +FNRL+G   AIV D PGVTRDRLYG+  W  + F V+
Sbjct  3    LPVVAIVGRPNVGKSTIFNRLIGERVAIVEDMPGVTRDRLYGKGEWLTHTFHVI  56



>ref|WP_017661046.1| ribosome-associated GTPase EngA [Geitlerinema sp. PCC 7105]
Length=453

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS + NRL G   AIV DEPG+TRDR Y ++FW + EF VV
Sbjct  3    LPIVAIIGRPNVGKSTIVNRLAGRKEAIVHDEPGITRDRTYKQAFWQDREFQVV  56



>ref|WP_017319096.1| ribosome-associated GTPase EngA [Mastigocladopsis repens]
Length=453

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G   AIV DEPG+TRDR Y  ++W + EF+VV
Sbjct  3    LPIVAIIGRPNVGKSTLVNRLAGEQSAIVHDEPGITRDRTYKPAYWSDREFLVV  56


 Score = 53.1 bits (126),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  TGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRD  658
            TGE      K L +   VP+    KV IVGRPNVGKS+L N  VG  RAIV    G TRD
Sbjct  154  TGELLDELIKHLPAVEQVPETNEIKVAIVGRPNVGKSSLLNAFVGEERAIVSPISGTTRD  213

Query  659  RL  664
             +
Sbjct  214  AI  215



>ref|WP_039715879.1| ribosome-associated GTPase EngA [Scytonema millei]
 gb|KIF18353.1| GTPase Der [Scytonema millei VB511283]
Length=452

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS L NRL G   AIV DEPGVTRDR Y  ++W + EF+VV
Sbjct  3    LPIVAIVGRPNVGKSTLANRLAGVQEAIVYDEPGVTRDRTYMPAYWCDREFLVV  56



>ref|WP_008484261.1| ribosome-associated GTPase EngA [Gallaecimonas xiamenensis]
 gb|EKE74952.1| GTP-binding protein Der [Gallaecimonas xiamenensis 3-C-1]
Length=495

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP V +VGRPNVGKS LFNRL     A+V D PG+TRDR YG++ +GEY+F++V
Sbjct  1    MLPVVALVGRPNVGKSTLFNRLTNSRDALVADYPGLTRDRKYGQARYGEYDFILV  55


 Score = 55.1 bits (131),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 51/96 (53%), Gaps = 4/96 (4%)
 Frame = +2

Query  419  QAAREFSESLSRQLRTEDDKTGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALF  598
            QA  E SE+L+  L  E       E  ++      + +P     K+ IVGRPNVGKS L 
Sbjct  168  QAEDEASEALADVLGQELIDVDAIEDEEEAEAIPYADLP----VKIAIVGRPNVGKSTLT  223

Query  599  NRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            NR++G  R +V D PG TRD +Y     G+  ++++
Sbjct  224  NRILGEERVVVYDMPGTTRDSVYIPMERGDKHYILI  259



>ref|WP_015153762.1| ribosome-associated GTPase EngA [Chroococcidiopsis thermalis]
 gb|AFY87214.1| ribosome-associated GTPase EngA [Chroococcidiopsis thermalis 
PCC 7203]
Length=452

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS L NRL G   AIV DEPGVTRDR Y  ++W + EF+VV
Sbjct  3    LPIVAIVGRPNVGKSTLANRLAGVQEAIVYDEPGVTRDRTYMPAYWCDREFLVV  56



>ref|WP_008311305.1| ribosome-associated GTPase EngA [Leptolyngbya sp. PCC 6406]
Length=453

 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V ++GRPNVGKS L NRL G   AIV D+PGVTRDR Y  +FW + EFMVV
Sbjct  3    LPVVAVIGRPNVGKSTLVNRLAGARDAIVHDQPGVTRDRTYQPAFWRDREFMVV  56



>ref|WP_025699726.1| hypothetical protein, partial [Paenibacillus durus]
Length=164

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/53 (62%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V IVGRPNVGKS +FNRL+G   AIV D+PG+TRDR+YG S W    F V+
Sbjct  4    PVVAIVGRPNVGKSTIFNRLIGDRLAIVEDKPGITRDRIYGVSEWNGKAFSVI  56



>ref|WP_017248099.1| ribosome-associated GTPase EngA [Brevibacillus brevis]
Length=437

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS +FNRL+G   AIV D PGVTRDRLYG+  W  + F V+
Sbjct  3    LPVVAIVGRPNVGKSTIFNRLIGERVAIVEDMPGVTRDRLYGKGEWLTHTFHVI  56



>ref|WP_002853418.1| ribosome-associated GTPase EngA [Ruminococcus albus]
 gb|EGC01231.1| ribosome biogenesis GTPase Der [Ruminococcus albus 8]
Length=443

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP V +VGRPNVGKS LFN+L+G   +IV D PGVTRDR+YG+  W   EFM+V
Sbjct  2    VLPVVAVVGRPNVGKSTLFNKLIGQRLSIVEDTPGVTRDRIYGKCEWLGREFMLV  56



>ref|WP_045658516.1| GTP-binding protein Der [Clostridiaceae bacterium BRH_c20a]
 gb|KJS22527.1| GTP-binding protein Der [Clostridiaceae bacterium BRH_c20a]
Length=437

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V IVGRPNVGKS LFNRL GG  AI+ + PGVTRDRLY  + W E+ F V+
Sbjct  3    PIVAIVGRPNVGKSTLFNRLTGGMTAIIENTPGVTRDRLYKDAQWQEFSFTVI  55


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 36/58 (62%), Gaps = 2/58 (3%)
 Frame = +2

Query  533  PDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            PD +  K  +VGRPNVGKS+L N L+G  R IV D PG TRD +       E E++++
Sbjct  173  PDTI--KFAVVGRPNVGKSSLVNVLLGQERVIVSDIPGTTRDAIDTPFKHNEQEYVII  228



>ref|WP_013498779.1| ribosome-associated GTPase EngA [Ruminococcus albus]
 gb|ADU22622.1| ribosome-associated GTPase EngA [Ruminococcus albus 7 = DSM 20455]
Length=443

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP V +VGRPNVGKS LFN+L+G   +IV D PGVTRDR+YG+  W   EFM+V
Sbjct  2    VLPVVAVVGRPNVGKSTLFNKLIGQRLSIVEDTPGVTRDRIYGKCEWLGREFMLV  56



>ref|WP_029099585.1| MULTISPECIES: ribosome-associated GTPase EngA [Bacillales]
Length=437

 Score = 74.7 bits (182),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS +FNRLVG   AIV D+PGVTRDRLYG+  W    F V+
Sbjct  3    LPVVAIVGRPNVGKSTIFNRLVGERIAIVEDKPGVTRDRLYGKGEWLNRHFHVI  56



>ref|WP_040870722.1| GTP-binding protein Der, partial [delta proteobacterium MLMS-1]
Length=100

 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V +VGRPNVGKS+LFNR+ GG +AIV   PGVTRDR Y +  W +  FM++
Sbjct  7    LPLVALVGRPNVGKSSLFNRIAGGRKAIVDPTPGVTRDRHYQQVSWNQRHFMLI  60



>gb|EPC77340.1| GTP-binding protein Der, partial [Lactobacillus paracasei subsp. 
paracasei Lpp71]
Length=306

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP + IVGRPNVGKS +FNR++G   +IV D PGVTRDR+YG+S W   EF V+
Sbjct  2    VLPTLAIVGRPNVGKSTIFNRILGERVSIVEDTPGVTRDRIYGKSEWLGKEFAVI  56



>ref|WP_013278017.1| ribosome-associated GTPase EngA [Acetohalobium arabaticum]
 gb|ADL12571.1| ribosome-associated GTPase EngA [Acetohalobium arabaticum DSM 
5501]
Length=438

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V IVGRPNVGKS LFNR+VG   +IV DEP +TRDRLYG   W +  F+VV
Sbjct  4    PVVAIVGRPNVGKSTLFNRIVGNRISIVEDEPSITRDRLYGEGEWLDNHFLVV  56


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 35/52 (67%), Gaps = 0/52 (0%)
 Frame = +2

Query  551  KVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            ++ ++GRPNVGKS+L N ++G  R IV D PG TRD +      G+ +F+++
Sbjct  179  RISVIGRPNVGKSSLVNSILGKERVIVNDVPGTTRDAIDTYFEVGDNQFVII  230



>ref|WP_016953465.1| ribosome-associated GTPase EngA [Anabaena sp. PCC 7108]
Length=454

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP + I+GRPNVGKS L NRL G   AIV DEPGVTRDR Y  +FW + +F+VV
Sbjct  3    LPIIAIIGRPNVGKSTLVNRLAGDQTAIVHDEPGVTRDRTYRPAFWNDRDFLVV  56



>ref|WP_024856398.1| ribosome-associated GTPase EngA [Ruminococcus albus]
Length=443

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP V +VGRPNVGKS LFN+L+G   +IV D PGVTRDR+YG+  W   EFM+V
Sbjct  2    VLPVVAVVGRPNVGKSTLFNKLIGQRLSIVEDTPGVTRDRIYGKCEWLGREFMLV  56



>ref|WP_009325429.1| ribosome-associated GTPase EngA [Subdoligranulum sp. 4_3_54A2FAA]
 gb|EHL65780.1| ribosome-associated GTPase EngA [Subdoligranulum sp. 4_3_54A2FAA]
Length=441

 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V IVGRPNVGKS LFN+LVG   AIV D PGVTRDRLYG   W ++ F+++
Sbjct  4    PIVAIVGRPNVGKSTLFNKLVGQRLAIVEDTPGVTRDRLYGNCEWQDHRFLLI  56



>ref|WP_037290270.1| ribosome-associated GTPase EngA [Ruminococcus albus]
 gb|EXM38096.1| GTP-binding protein Der [Ruminococcus albus SY3]
Length=443

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP V +VGRPNVGKS LFN+L+G   +IV D PGVTRDR+YG+  W   EFM+V
Sbjct  2    VLPVVAVVGRPNVGKSTLFNKLIGQRLSIVEDTPGVTRDRIYGKCEWLGREFMLV  56



>ref|WP_041337160.1| ribosome-associated GTPase EngA [Ruminococcus bicirculans]
 emb|CCO05804.1| GTP-binding protein EngA [Ruminococcus bicirculans]
Length=443

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS LFN+L+G   +IV D PGVTRDR+Y +  W  +EFM+V
Sbjct  3    LPIVAIVGRPNVGKSTLFNKLIGQRLSIVEDTPGVTRDRIYAKCEWLGHEFMLV  56



>ref|WP_022287397.1| ribosome-associated GTPase EngA [Ruminococcus sp. CAG:57]
 emb|CDC67589.1| gTPase Der [Ruminococcus sp. CAG:57]
Length=443

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS LFN+L+G   +IV D PGVTRDR+Y +  W  +EFM+V
Sbjct  3    LPIVAIVGRPNVGKSTLFNKLIGQRLSIVEDTPGVTRDRIYAKCEWLGHEFMLV  56



>gb|KJF39513.1| GTP-binding protein Der [Ruminococcaceae bacterium 585-1]
Length=441

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V IVGRPNVGKS LFN+LVG   AIV D PGVTRDRLYG   W ++ F+++
Sbjct  4    PIVAIVGRPNVGKSTLFNKLVGQRLAIVEDTPGVTRDRLYGNCEWQDHRFLLI  56



>ref|WP_012598288.1| GTPase Der [Cyanothece sp. PCC 7424]
 sp|B7KHD2.1|DER_CYAP7 RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Cyanothece sp. PCC 7424]
 gb|ACK69341.1| small GTP-binding protein [Cyanothece sp. PCC 7424]
Length=452

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G  +AIV DEPG+TRDR Y  +FW + +F VV
Sbjct  3    LPIVAIIGRPNVGKSTLVNRLAGDQQAIVHDEPGITRDRTYRPAFWQDRDFQVV  56


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 37/62 (60%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  TGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRD  658
            TGE   +    L +T S+ +    KV IVGRPNVGKS+L N L G NRAIV    G TRD
Sbjct  154  TGELLDKLIIYLPTTESLSETNEIKVAIVGRPNVGKSSLLNALTGENRAIVSPISGTTRD  213

Query  659  RL  664
             +
Sbjct  214  AI  215



>ref|WP_007442121.1| GTP-binding protein EngA, partial [Candidatus Arthromitus sp. 
SFB-4]
 gb|EIA29853.1| GTP-binding protein EngA, partial [Candidatus Arthromitus sp. 
SFB-4]
Length=120

 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V IVGRPNVGKS LFNR+VG   +IV D PGVTRDR+Y  + W +Y+F+++
Sbjct  4    PIVAIVGRPNVGKSTLFNRIVGDRVSIVDDSPGVTRDRIYRDAEWLKYKFIMI  56



>ref|WP_025929814.1| ribosome-associated GTPase EngA [Prochlorococcus sp. scB241_528O2]
Length=457

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/55 (62%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP V I+GRPNVGKS L NRL   N AIV D+PGVTRDR Y  + WG  EF +V
Sbjct  2    ILPTVAIIGRPNVGKSTLVNRLCQSNDAIVFDKPGVTRDRTYQNATWGGKEFQIV  56



>ref|WP_027334347.1| ribosome-associated GTPase EngA [Mycoplasma elephantis]
Length=433

 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 41/51 (80%), Gaps = 0/51 (0%)
 Frame = +2

Query  554  VVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            + I+G+PNVGKS LFNR++G  ++IV DEPGVTRDRLY ++ W  ++F V+
Sbjct  7    IAIIGKPNVGKSTLFNRIIGKRKSIVYDEPGVTRDRLYHKASWTNHDFFVI  57



>ref|WP_033101440.1| ribosome-associated GTPase EngA [Thermoactinomyces daqus]
Length=439

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS +FNRL G   AIV D+PG+TRDR+Y RS W   EF ++
Sbjct  3    LPVVAIVGRPNVGKSTIFNRLAGERIAIVEDQPGITRDRIYSRSEWNGREFHLI  56



>ref|WP_027718750.1| ribosome-associated GTPase EngA [Desulfovirgula thermocuniculi]
Length=438

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 36/53 (68%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V IVGRPNVGKS LFNRLVGG  AIV D+PG+TRDRLY    WG   F +V
Sbjct  4    PIVAIVGRPNVGKSTLFNRLVGGRVAIVEDQPGITRDRLYRDVEWGGRTFTLV  56



>ref|WP_031414482.1| ribosome-associated GTPase EngA [Brevibacillus laterosporus]
Length=437

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS +FNRL+G   AIV D+PGVTRDRLY +  W   EF V+
Sbjct  3    LPVVAIVGRPNVGKSTIFNRLIGERVAIVEDKPGVTRDRLYAKGEWLNREFHVI  56



>ref|WP_022583887.1| ribosome-associated GTPase EngA [Brevibacillus laterosporus]
 gb|ERM20192.1| GTP-binding protein Der [Brevibacillus laterosporus PE36]
Length=437

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS +FNRL+G   AIV D+PGVTRDRLY +  W   EF V+
Sbjct  3    LPVVAIVGRPNVGKSTIFNRLIGERVAIVEDKPGVTRDRLYAKGEWLNREFHVI  56



>ref|WP_039202145.1| ribosome-associated GTPase EngA [Aphanizomenon flos-aquae]
 gb|KHG41079.1| GTPase Der [Aphanizomenon flos-aquae 2012/KM1/D3]
Length=454

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS   NRL G   AIV DEPGVTRDR Y  +FW + EF+VV
Sbjct  3    LPIVAIIGRPNVGKSTFVNRLAGDQTAIVHDEPGVTRDRTYRPAFWNDREFVVV  56


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  TGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRD  658
            TGE        +  T  V ++   KV I+GRPNVGKS+L N  VG NRAIV    G TRD
Sbjct  154  TGEILDELMNHIPHTVEVEENTEIKVAIIGRPNVGKSSLLNAFVGENRAIVSPISGTTRD  213

Query  659  RL  664
             +
Sbjct  214  TI  215



>ref|WP_019488832.1| ribosome-associated GTPase EngA [Calothrix sp. PCC 7103]
Length=455

 Score = 74.3 bits (181),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS   NRL G   AIV DEPGVTRDR Y ++FW + EF VV
Sbjct  3    LPVVAIIGRPNVGKSTFVNRLAGEQTAIVHDEPGVTRDRTYLKAFWRDREFTVV  56


 Score = 51.2 bits (121),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 34/62 (55%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  TGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRD  658
            TGE        L     +P++   K+ IVGRPNVGKS+L N  VG  RAIV    G TRD
Sbjct  154  TGELLDELINHLPMVQDIPENEEIKIAIVGRPNVGKSSLLNAFVGEERAIVSPISGTTRD  213

Query  659  RL  664
             +
Sbjct  214  AI  215



>ref|WP_018670146.1| ribosome-associated GTPase EngA [Brevibacillus laterosporus]
Length=437

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS +FNRL+G   AIV D+PGVTRDRLY +  W   EF V+
Sbjct  3    LPVVAIVGRPNVGKSTIFNRLIGERVAIVEDKPGVTRDRLYAKGEWLNREFHVI  56



>ref|WP_015131793.1| ribosome-associated GTPase EngA [Calothrix sp. PCC 7507]
 gb|AFY36003.1| GTP-binding protein engA [Calothrix sp. PCC 7507]
Length=454

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G   AIV DEPGVTRDR Y  ++W + E++VV
Sbjct  3    LPIVAIIGRPNVGKSTLVNRLAGEQTAIVHDEPGVTRDRTYKPAYWSDREYLVV  56


 Score = 51.6 bits (122),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  TGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRD  658
            TG+      K + + + VP+    KV I+GRPNVGKS+L N  VG  RAIV    G TRD
Sbjct  154  TGDILDELIKHIPAVTEVPETNEIKVAIIGRPNVGKSSLLNAFVGEERAIVSPISGTTRD  213

Query  659  RL  664
             +
Sbjct  214  AI  215



>ref|WP_027401964.1| ribosome-associated GTPase EngA [Aphanizomenon flos-aquae]
Length=454

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS   NRL G   AIV DEPGVTRDR Y  +FW + EF+VV
Sbjct  3    LPIVAIIGRPNVGKSTFVNRLAGDQTAIVHDEPGVTRDRTYRPAFWNDREFVVV  56


 Score = 52.8 bits (125),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  TGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRD  658
            TGE        +  T  V ++   KV I+GRPNVGKS+L N  VG NRAIV    G TRD
Sbjct  154  TGEILDELMNHIPHTVEVEENTEIKVAIIGRPNVGKSSLLNAFVGENRAIVSPISGTTRD  213

Query  659  RL  664
             +
Sbjct  214  TI  215



>ref|WP_015078384.1| ribosome-associated GTPase EngA [Anabaena sp. 90]
 gb|AFW93220.1| small GTP-binding protein [Anabaena sp. 90]
Length=454

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS   NRL G   AIV DEPGVTRDR Y  +FW + EF+VV
Sbjct  3    LPIVAIIGRPNVGKSTFVNRLAGDQTAIVHDEPGVTRDRTYRPAFWNDREFVVV  56



>ref|WP_016859054.1| ribosome-associated GTPase EngA [Fischerella muscicola]
Length=453

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS   NRL G   AIV D+PGVTRDR Y  +FW + EFMVV
Sbjct  3    LPIVAIIGRPNVGKSTFVNRLAGEQSAIVYDQPGVTRDRTYLPAFWRDREFMVV  56


 Score = 50.8 bits (120),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 26/51 (51%), Positives = 31/51 (61%), Gaps = 0/51 (0%)
 Frame = +2

Query  512  LKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRL  664
            L+    +PD    K+ IVGRPNVGKS+L N  VG  RAIV    G TRD +
Sbjct  165  LQPAQDIPDIDEIKIAIVGRPNVGKSSLLNAFVGEQRAIVSPISGTTRDAI  215



>ref|WP_022738443.1| ribosome-associated GTPase EngA [Laceyella sacchari]
Length=437

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS +FNRL G   AIV D+PG+TRDR+Y RS W   EF ++
Sbjct  3    LPVVAIVGRPNVGKSTIFNRLAGERIAIVEDQPGITRDRIYSRSEWNGREFHLI  56



>ref|WP_003341821.1| ribosome-associated GTPase EngA [Brevibacillus laterosporus]
 emb|CCF14244.1| ribosome-associated GTPase EngA [Brevibacillus laterosporus GI-9]
Length=437

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS +FNRL+G   AIV D+PGVTRDRLY +  W   EF V+
Sbjct  3    LPVVAIVGRPNVGKSTIFNRLIGERVAIVEDKPGVTRDRLYAKGEWLNREFHVI  56



>ref|WP_003338515.1| ribosome-associated GTPase EngA [Brevibacillus laterosporus]
 gb|AIG26200.1| GTP-binding protein EngA [Brevibacillus laterosporus LMG 15441]
Length=437

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V IVGRPNVGKS +FNRL+G   AIV D+PGVTRDRLY +  W   EF V+
Sbjct  3    LPVVAIVGRPNVGKSTIFNRLIGERVAIVEDKPGVTRDRLYAKGEWLNREFHVI  56



>ref|WP_028082829.1| ribosome-associated GTPase EngA [Dolichospermum circinale]
Length=454

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS   NRL G   AIV DEPGVTRDR Y  +FW + EF+VV
Sbjct  3    LPIVAIIGRPNVGKSTFVNRLAGDQTAIVHDEPGVTRDRTYRPAFWNDREFVVV  56


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  TGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRD  658
            TGE        +   + V ++   KV I+GRPNVGKS+L N  VG NRAIV    G TRD
Sbjct  154  TGEILDELMNHIPYATEVEENPEIKVAIIGRPNVGKSSLLNTFVGENRAIVSPISGTTRD  213

Query  659  RL  664
             +
Sbjct  214  TI  215



>ref|WP_028091329.1| ribosome-associated GTPase EngA [Dolichospermum circinale]
Length=454

 Score = 73.9 bits (180),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS   NRL G   AIV DEPGVTRDR Y  +FW + EF+VV
Sbjct  3    LPIVAIIGRPNVGKSTFVNRLAGDQTAIVHDEPGVTRDRTYRPAFWNDREFVVV  56


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 35/62 (56%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  TGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRD  658
            TGE        +   + V ++   KV I+GRPNVGKS+L N  VG NRAIV    G TRD
Sbjct  154  TGEILDELMNHIPYATEVEENPEIKVAIIGRPNVGKSSLLNAFVGENRAIVSPISGTTRD  213

Query  659  RL  664
             +
Sbjct  214  TI  215



>ref|WP_013406044.1| ribosome-associated GTPase EngA [Halanaerobium hydrogeniformans]
 gb|ADQ14967.1| ribosome-associated GTPase EngA [Halanaerobium hydrogeniformans]
Length=438

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/51 (69%), Positives = 39/51 (76%), Gaps = 0/51 (0%)
 Frame = +2

Query  554  VVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            V IVGRPNVGKS LFNRLVGG RAIV  EP VTRDR+YG + W +  F V+
Sbjct  6    VAIVGRPNVGKSTLFNRLVGGRRAIVEGEPNVTRDRIYGEAEWLDRTFNVI  56


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/48 (50%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  554  VVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEF  697
            + ++G+PNVGKS+L N LVG NR IV D PG TRD +     W + +F
Sbjct  180  IAVIGKPNVGKSSLINHLVGENRVIVSDMPGTTRDAVDTLIEWKDIKF  227



>ref|WP_038015372.1| ribosome-associated GTPase EngA [Synechococcus sp. PCC 7335]
Length=466

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NR  GG ++IV D+PGVTRDR Y  +FW + EF+ V
Sbjct  3    LPVVAIIGRPNVGKSMLVNRFAGGRQSIVFDQPGVTRDRTYQPAFWKDREFLAV  56



>ref|WP_017309647.1| ribosome-associated GTPase EngA [Fischerella sp. PCC 9339]
Length=453

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS   NRL G   AIV D+PGVTRDR Y  +FW + EFMVV
Sbjct  3    LPIVAIIGRPNVGKSTFVNRLAGEQSAIVYDQPGVTRDRTYLPAFWRDREFMVV  56



>gb|EIA23616.1| GTP-binding protein engA [Candidatus Arthromitus sp. SFB-3]
Length=188

 Score = 71.2 bits (173),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V IVGRPNVGKS LFNR+VG   +IV D PGVTRDR+Y  + W +Y+F+++
Sbjct  4    PIVAIVGRPNVGKSTLFNRIVGDRVSIVDDSPGVTRDRIYRDAEWLKYKFIMI  56



>ref|WP_026721377.1| ribosome-associated GTPase EngA [Fischerella sp. PCC 9431]
Length=453

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS   NRL G   AIV D+PGVTRDR Y  +FW + EFMVV
Sbjct  3    LPIVAIIGRPNVGKSTFVNRLAGEQSAIVYDQPGVTRDRTYLPAFWRDREFMVV  56



>ref|WP_038474925.1| ribosome-associated GTPase EngA [Fimbriimonas ginsengisoli]
Length=450

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP VVIVGRPNVGKS LFNRLVG   A+V D PG+TRDRLY  + W    F VV
Sbjct  5    LPVVVIVGRPNVGKSTLFNRLVGRRVAVVEDTPGITRDRLYAETEWNGRRFQVV  58



>ref|WP_040104714.1| ribosome-associated GTPase EngA [Salinicoccus roseus]
 gb|KIH71940.1| GTP-binding protein Der [Salinicoccus roseus]
Length=436

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P + +VGRPNVGKS LFNR++G  +AIV D PGVTRDRLY    W  +EF V+
Sbjct  4    PTIAVVGRPNVGKSTLFNRIIGERKAIVEDTPGVTRDRLYASGDWLNHEFNVI  56



>ref|WP_031544861.1| ribosome-associated GTPase EngA [Salinicoccus luteus]
Length=436

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P + +VGRPNVGKS LFNR++G  +AIV D PGVTRDRLY    W  +EF V+
Sbjct  4    PTIAVVGRPNVGKSTLFNRIIGERKAIVEDTPGVTRDRLYASGDWLNHEFNVI  56



>ref|WP_028509684.1| ribosome-associated GTPase EngA [Ruminococcus sp. NK3A76]
Length=443

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V +VGRPNVGKS LFN+L+G   +IV D PGVTRDR+Y +  W  +EFM+V
Sbjct  3    LPIVAVVGRPNVGKSTLFNKLIGQRLSIVEDTPGVTRDRIYSKCEWLGHEFMLV  56



>gb|AIE85441.1| GTP-binding protein EngA [Fimbriimonas ginsengisoli Gsoil 348]
Length=471

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP VVIVGRPNVGKS LFNRLVG   A+V D PG+TRDRLY  + W    F VV
Sbjct  26   LPVVVIVGRPNVGKSTLFNRLVGRRVAVVEDTPGITRDRLYAETEWNGRRFQVV  79



>ref|WP_025964619.1| GTPase Der [Prochlorococcus sp. scB243_498P15]
Length=457

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/55 (60%), Positives = 39/55 (71%), Gaps = 0/55 (0%)
 Frame = +2

Query  542  LLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            +LP + I+GRPNVGKS L NRL   N AIV D+PGVTRDR Y  + WG  EF +V
Sbjct  2    ILPTIAIIGRPNVGKSTLVNRLCQSNNAIVFDKPGVTRDRTYQNASWGGKEFQIV  56



>ref|WP_015142441.1| ribosome-associated GTPase EngA [Pleurocapsa minor]
 gb|AFY76133.1| ribosome-associated GTPase EngA [Pleurocapsa sp. PCC 7327]
Length=452

 Score = 73.9 bits (180),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G  +AIV DEPG+TRDR Y  +FW + EF VV
Sbjct  3    LPIVAIIGRPNVGKSTLVNRLAGDQQAIVHDEPGITRDRTYRPAFWRDREFQVV  56



>ref|WP_014432991.1| ribosome-associated GTPase EngA [Caldilinea aerophila]
 dbj|BAL99753.1| GTPase Der [Caldilinea aerophila DSM 14535 = NBRC 104270]
Length=456

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V +VGRPNVGKS LFNRL+G   AIV DEPG TRDR+YG S W    F+V+
Sbjct  6    PVVALVGRPNVGKSTLFNRLIGRPVAIVEDEPGTTRDRIYGESDWNGVGFIVI  58



>ref|WP_017653411.1| ribosome-associated GTPase EngA [Microchaete sp. PCC 7126]
Length=454

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V I+GRPNVGKS L NRL G   AIV DEPGVTRDR Y  ++W + EF+VV
Sbjct  4    PIVAIIGRPNVGKSTLVNRLAGEQTAIVHDEPGVTRDRTYLSAYWNDREFLVV  56


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 36/62 (58%), Gaps = 0/62 (0%)
 Frame = +2

Query  479  TGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRD  658
            TGE      + + S   +P++   KV I+GRPNVGKS+L N  VG  RAIV    G TRD
Sbjct  154  TGELLDELIQYIPSAEEIPENNEIKVAIIGRPNVGKSSLLNSFVGQERAIVSPISGTTRD  213

Query  659  RL  664
             +
Sbjct  214  AI  215



>ref|WP_022475896.1| ribosome-associated GTPase EngA [Ruminococcus sp. CAG:353]
 emb|CDE81514.1| gTPase Der [Ruminococcus sp. CAG:353]
Length=443

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V +VGRPNVGKS LFN+LVG   +IV D PGVTRDR+Y +  W   EFM+V
Sbjct  3    LPIVAVVGRPNVGKSTLFNKLVGKRLSIVEDTPGVTRDRIYSKCEWRNREFMIV  56


 Score = 50.1 bits (118),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  536  DHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRD  658
            D    KV ++G+PNVGKS+L NR+ G  RAIV D  G TRD
Sbjct  174  DEEYIKVAVIGKPNVGKSSLINRIAGEERAIVSDIAGTTRD  214



>ref|WP_015112943.1| ribosome-associated GTPase EngA [Nostoc sp. PCC 7107]
 gb|AFY42727.1| GTP-binding protein engA [Nostoc sp. PCC 7107]
Length=453

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +2

Query  545  LPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            LP V I+GRPNVGKS L NRL G   AIV DEPGVTRDR Y  ++W + E++VV
Sbjct  3    LPIVAIIGRPNVGKSTLVNRLAGEQTAIVHDEPGVTRDRTYMPAYWNDREYLVV  56


 Score = 53.5 bits (127),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 37/64 (58%), Gaps = 0/64 (0%)
 Frame = +2

Query  473  DKTGEKETRKQKRLKSTSSVPDHLLPKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVT  652
            + TGE      K + S + +P+    KV I+GRPNVGKS+L N  VG  RAIV    G T
Sbjct  152  NGTGELLDELIKHIPSVTEIPETNEIKVAIIGRPNVGKSSLLNAFVGEERAIVSPISGTT  211

Query  653  RDRL  664
            RD +
Sbjct  212  RDAI  215



>ref|WP_012194942.1| GTPase Der [Prochlorococcus marinus]
 sp|A9BE09.1|DER_PROM4 RecName: Full=GTPase Der; AltName: Full=GTP-binding protein EngA 
[Prochlorococcus marinus str. MIT 9211]
 gb|ABX08319.1| GTP-binding protein (HSR1-related) [Prochlorococcus marinus str. 
MIT 9211]
Length=456

 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 34/53 (64%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  548  PKVVIVGRPNVGKSALFNRLVGGNRAIVVDEPGVTRDRLYGRSFWGEYEFMVV  706
            P V I+GRPNVGKS L NRL G   AIV D+PGVTRDR Y  +FW + EF VV
Sbjct  4    PIVAIIGRPNVGKSTLVNRLCGSREAIVDDQPGVTRDRTYQDAFWADREFKVV  56



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1253469667140