BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2437

Length=720
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009788012.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      319   4e-102   Nicotiana sylvestris
ref|XP_009613182.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      319   5e-102   Nicotiana tomentosiformis
ref|XP_006356504.1|  PREDICTED: probable peptide/nitrate transpor...    310   2e-98    Solanum tuberosum [potatoes]
ref|XP_004241845.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10 iso...    308   7e-98    Solanum lycopersicum
emb|CDP10687.1|  unnamed protein product                                293   6e-92    Coffea canephora [robusta coffee]
gb|EYU22787.1|  hypothetical protein MIMGU_mgv1a003626mg                292   2e-91    Erythranthe guttata [common monkey flower]
ref|XP_011096252.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      288   6e-90    Sesamum indicum [beniseed]
ref|XP_009593533.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      286   3e-89    Nicotiana tomentosiformis
ref|XP_009115625.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10           284   2e-88    Brassica rapa
ref|XP_009782735.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      284   3e-88    Nicotiana sylvestris
emb|CDY04807.1|  BnaC05g17820D                                          283   3e-88    
emb|CDY21370.1|  BnaA09g30570D                                          283   4e-88    Brassica napus [oilseed rape]
ref|XP_002890519.1|  proton-dependent oligopeptide transport fami...    281   2e-87    
ref|XP_006416188.1|  hypothetical protein EUTSA_v10007248mg             280   6e-87    Eutrema salsugineum [saltwater cress]
ref|XP_011096129.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      280   1e-86    
ref|XP_006307141.1|  hypothetical protein CARUB_v10008731mg             279   2e-86    Capsella rubella
ref|XP_010498728.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10           278   2e-86    Camelina sativa [gold-of-pleasure]
ref|XP_010460012.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      275   5e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010477514.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      275   8e-85    Camelina sativa [gold-of-pleasure]
ref|XP_010534099.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10           274   1e-84    Tarenaya hassleriana [spider flower]
ref|XP_006473248.1|  PREDICTED: probable peptide/nitrate transpor...    274   2e-84    Citrus sinensis [apfelsine]
ref|XP_006434673.1|  hypothetical protein CICLE_v10000719mg             273   2e-84    Citrus clementina [clementine]
gb|KFK44349.1|  hypothetical protein AALP_AA1G246100                    273   3e-84    Arabis alpina [alpine rockcress]
gb|KDO84007.1|  hypothetical protein CISIN_1g045562mg                   271   6e-84    Citrus sinensis [apfelsine]
ref|XP_007020112.1|  Major facilitator superfamily protein              271   3e-83    
emb|CDP10688.1|  unnamed protein product                                270   9e-83    Coffea canephora [robusta coffee]
gb|KHG04630.1|  hypothetical protein F383_29596                         270   2e-82    Gossypium arboreum [tree cotton]
ref|NP_173670.2|  probable peptide/nitrate transporter                  268   2e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010683110.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      267   8e-82    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009593536.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      267   9e-82    Nicotiana tomentosiformis
gb|EPS64734.1|  hypothetical protein M569_10046                         255   2e-80    Genlisea aurea
ref|XP_009783108.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      263   2e-80    Nicotiana sylvestris
ref|XP_007020110.1|  Major facilitator superfamily protein              262   5e-80    
gb|ABR32184.1|  peptide transporter                                     260   4e-79    Hakea actites
gb|KHG26072.1|  hypothetical protein F383_04504                         259   7e-79    Gossypium arboreum [tree cotton]
gb|KJB29708.1|  hypothetical protein B456_005G116000                    260   7e-79    Gossypium raimondii
gb|AAF18524.1|AC006551_10  Similar to peptide transporter               259   9e-79    Arabidopsis thaliana [mouse-ear cress]
ref|XP_007131296.1|  hypothetical protein PHAVU_011G002000g             258   1e-78    Phaseolus vulgaris [French bean]
ref|XP_007131295.1|  hypothetical protein PHAVU_011G001900g             258   1e-78    Phaseolus vulgaris [French bean]
ref|XP_010245114.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      258   3e-78    Nelumbo nucifera [Indian lotus]
gb|KJB81309.1|  hypothetical protein B456_013G138200                    257   4e-78    Gossypium raimondii
ref|XP_010095905.1|  putative peptide/nitrate transporter               258   4e-78    
gb|KHN47085.1|  Putative peptide/nitrate transporter                    256   7e-78    Glycine soja [wild soybean]
ref|XP_003523479.1|  PREDICTED: probable peptide/nitrate transpor...    256   8e-78    Glycine max [soybeans]
ref|XP_003634604.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    256   1e-77    
ref|XP_006376225.1|  hypothetical protein POPTR_0013s11120g             256   1e-77    Populus trichocarpa [western balsam poplar]
ref|XP_010062425.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      256   1e-77    
ref|XP_010665397.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      256   2e-77    Vitis vinifera
ref|XP_008240575.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      255   3e-77    Prunus mume [ume]
gb|KHG19841.1|  hypothetical protein F383_03296                         254   7e-77    Gossypium arboreum [tree cotton]
ref|XP_009362432.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      253   1e-76    Pyrus x bretschneideri [bai li]
emb|CBI39334.3|  unnamed protein product                                256   6e-76    Vitis vinifera
ref|XP_008339153.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    253   2e-75    
ref|XP_008339154.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    253   2e-75    
emb|CBI39328.3|  unnamed protein product                                249   2e-75    Vitis vinifera
ref|XP_007020109.1|  Major facilitator superfamily protein, putat...    249   4e-75    
ref|XP_010683224.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      249   4e-75    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010665395.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      249   5e-75    Vitis vinifera
ref|XP_007020104.1|  Major facilitator superfamily protein isoform 1    249   5e-75    
ref|XP_011001079.1|  PREDICTED: uncharacterized protein LOC105108458    256   5e-75    Populus euphratica
ref|XP_011464750.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      248   6e-75    Fragaria vesca subsp. vesca
ref|XP_012084632.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      249   6e-75    Jatropha curcas
ref|XP_010665399.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      249   6e-75    Vitis vinifera
ref|XP_011001076.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      249   7e-75    Populus euphratica
ref|XP_007204887.1|  hypothetical protein PRUPE_ppa003472mg             248   9e-75    Prunus persica
ref|XP_007020105.1|  Major facilitator superfamily protein isoform 2    249   1e-74    
ref|XP_010665405.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    248   3e-74    Vitis vinifera
emb|CAN75422.1|  hypothetical protein VITISV_011767                     247   4e-74    Vitis vinifera
emb|CAN66299.1|  hypothetical protein VITISV_013344                     246   8e-74    Vitis vinifera
ref|XP_002266023.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10           246   9e-74    Vitis vinifera
ref|XP_009415773.1|  PREDICTED: uncharacterized protein LOC103996574    252   1e-73    
emb|CAN71099.1|  hypothetical protein VITISV_000973                     245   1e-73    Vitis vinifera
gb|KGN52719.1|  hypothetical protein Csa_5G652250                       238   2e-73    Cucumis sativus [cucumbers]
ref|XP_011464751.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      244   3e-73    Fragaria vesca subsp. vesca
emb|CBI39335.3|  unnamed protein product                                246   4e-73    Vitis vinifera
ref|XP_010095893.1|  putative peptide/nitrate transporter               244   5e-73    Morus notabilis
ref|XP_010911895.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      243   8e-73    Elaeis guineensis
gb|ABR32185.1|  peptide transporter                                     243   1e-72    Hakea actites
ref|XP_007020108.1|  Major facilitator superfamily protein, putat...    248   3e-72    
ref|XP_010095904.1|  putative peptide/nitrate transporter               242   3e-72    Morus notabilis
gb|KEH29316.1|  peptide/nitrate transporter plant                       240   4e-72    Medicago truncatula
ref|XP_010521165.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      241   4e-72    Tarenaya hassleriana [spider flower]
gb|KGN50307.1|  hypothetical protein Csa_5G167000                       236   6e-72    Cucumis sativus [cucumbers]
ref|XP_006473250.1|  PREDICTED: probable peptide/nitrate transpor...    238   1e-71    Citrus sinensis [apfelsine]
gb|ACN25499.1|  unknown                                                 231   3e-71    Zea mays [maize]
ref|XP_002319378.2|  hypothetical protein POPTR_0013s11110g             238   6e-71    
ref|XP_011656125.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10           238   8e-71    Cucumis sativus [cucumbers]
ref|XP_006434674.1|  hypothetical protein CICLE_v10000738mg             237   2e-70    Citrus clementina [clementine]
ref|XP_006473249.1|  PREDICTED: probable peptide/nitrate transpor...    237   2e-70    Citrus sinensis [apfelsine]
ref|XP_002265992.2|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      237   2e-70    Vitis vinifera
ref|XP_008459680.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      236   2e-70    Cucumis melo [Oriental melon]
gb|KGN50309.1|  hypothetical protein Csa_5G167020                       229   5e-70    Cucumis sativus [cucumbers]
ref|XP_008437003.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      236   6e-70    Cucumis melo [Oriental melon]
gb|KEH29313.1|  peptide/nitrate transporter plant                       234   8e-70    Medicago truncatula
ref|XP_010683004.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      235   1e-69    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011031497.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      234   1e-69    Populus euphratica
emb|CBI39325.3|  unnamed protein product                                244   2e-69    Vitis vinifera
ref|XP_003540022.1|  PREDICTED: probable peptide/nitrate transpor...    234   2e-69    Glycine max [soybeans]
ref|XP_010062427.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      234   2e-69    Eucalyptus grandis [rose gum]
ref|XP_009362428.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      234   2e-69    Pyrus x bretschneideri [bai li]
gb|KCW69566.1|  hypothetical protein EUGRSUZ_F02995                     234   3e-69    Eucalyptus grandis [rose gum]
ref|XP_006376224.1|  hypothetical protein POPTR_0013s11100g             234   4e-69    
gb|EYU22786.1|  hypothetical protein MIMGU_mgv11b021031mg               233   4e-69    Erythranthe guttata [common monkey flower]
ref|XP_012084631.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      233   8e-69    Jatropha curcas
ref|XP_008783395.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      232   1e-68    Phoenix dactylifera
ref|XP_010665401.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      232   1e-68    Vitis vinifera
tpg|DAA56612.1|  TPA: hypothetical protein ZEAMMB73_385814              231   1e-68    
emb|CBI39329.3|  unnamed protein product                                232   3e-68    Vitis vinifera
ref|XP_011656158.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      236   4e-68    Cucumis sativus [cucumbers]
ref|XP_003566212.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      231   5e-68    Brachypodium distachyon [annual false brome]
ref|XP_010062426.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      231   6e-68    
gb|KCW69567.1|  hypothetical protein EUGRSUZ_F02995                     230   9e-68    Eucalyptus grandis [rose gum]
gb|AFK47982.1|  unknown                                                 225   1e-67    Medicago truncatula
ref|XP_010245116.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    229   2e-67    Nelumbo nucifera [Indian lotus]
ref|XP_010245115.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    229   2e-67    Nelumbo nucifera [Indian lotus]
ref|XP_004499763.1|  PREDICTED: probable peptide/nitrate transpor...    228   4e-67    Cicer arietinum [garbanzo]
emb|CDY36663.1|  BnaCnng07650D                                          226   4e-67    Brassica napus [oilseed rape]
ref|XP_002325970.2|  proton-dependent oligopeptide transport fami...    229   4e-67    
gb|EYU22785.1|  hypothetical protein MIMGU_mgv1a004125mg                228   5e-67    Erythranthe guttata [common monkey flower]
ref|XP_010272857.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      228   5e-67    Nelumbo nucifera [Indian lotus]
ref|XP_002456710.1|  hypothetical protein SORBIDRAFT_03g041190          227   7e-67    
ref|XP_009420953.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10           226   9e-67    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002325969.2|  proton-dependent oligopeptide transport fami...    233   1e-66    
ref|XP_006645087.1|  PREDICTED: probable peptide/nitrate transpor...    226   2e-66    
ref|XP_008437001.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      226   2e-66    
ref|XP_003597990.1|  Peptide transporter PTR3-A                         226   3e-66    Medicago truncatula
gb|ACJ85853.1|  unknown                                                 225   3e-66    Medicago truncatula
ref|XP_002521802.1|  oligopeptide transporter, putative                 221   3e-66    
ref|XP_011654838.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      225   5e-66    Cucumis sativus [cucumbers]
ref|NP_001044938.2|  Os01g0871500                                       224   6e-66    
dbj|BAK03342.1|  predicted protein                                      224   9e-66    Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM85179.1|  unnamed protein product                                224   1e-65    Triticum aestivum [Canadian hard winter wheat]
emb|CDX68286.1|  BnaA07g23260D                                          219   1e-65    
ref|XP_012075471.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      224   1e-65    Jatropha curcas
ref|XP_011656124.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      224   1e-65    Cucumis sativus [cucumbers]
ref|XP_007020107.1|  Major facilitator superfamily protein isoform 2    224   1e-65    
gb|KGN52718.1|  hypothetical protein Csa_5G652240                       224   2e-65    Cucumis sativus [cucumbers]
ref|XP_007020106.1|  Major facilitator superfamily protein isoform 1    224   3e-65    
ref|XP_004506379.1|  PREDICTED: probable peptide/nitrate transpor...    223   4e-65    Cicer arietinum [garbanzo]
gb|KEH29309.1|  proton-dependent oligopeptide transport family pr...    222   6e-65    Medicago truncatula
gb|AFW78190.1|  hypothetical protein ZEAMMB73_551902                    222   7e-65    
ref|XP_010428074.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.14           222   1e-64    Camelina sativa [gold-of-pleasure]
ref|XP_010428067.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.13-lik...    222   1e-64    Camelina sativa [gold-of-pleasure]
emb|CBI39330.3|  unnamed protein product                                222   1e-64    Vitis vinifera
ref|XP_002521809.1|  oligopeptide transporter, putative                 227   2e-64    
ref|XP_009127898.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.13-lik...    220   2e-64    Brassica rapa
gb|KEH29306.1|  proton-dependent oligopeptide transport family pr...    221   2e-64    Medicago truncatula
ref|XP_010272859.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      221   3e-64    Nelumbo nucifera [Indian lotus]
gb|KJB29710.1|  hypothetical protein B456_005G116000                    219   5e-64    Gossypium raimondii
emb|CDY03659.1|  BnaA02g15780D                                          219   5e-64    
gb|KFK44350.1|  hypothetical protein AALP_AA1G246200                    220   7e-64    Arabis alpina [alpine rockcress]
ref|XP_006302084.1|  hypothetical protein CARUB_v10020071mg             219   8e-64    Capsella rubella
emb|CDY65668.1|  BnaCnng48110D                                          218   1e-63    Brassica napus [oilseed rape]
ref|XP_010498731.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.15 iso...    219   1e-63    
ref|XP_010498730.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.15 iso...    219   1e-63    Camelina sativa [gold-of-pleasure]
ref|XP_004516135.1|  PREDICTED: probable peptide/nitrate transpor...    219   1e-63    Cicer arietinum [garbanzo]
ref|XP_002887413.1|  proton-dependent oligopeptide transport fami...    224   2e-63    
gb|KFK44351.1|  hypothetical protein AALP_AA1G246300                    218   2e-63    Arabis alpina [alpine rockcress]
ref|XP_006390702.1|  hypothetical protein EUTSA_v10018554mg             216   2e-63    
ref|XP_011031498.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      218   3e-63    Populus euphratica
ref|XP_010233562.1|  PREDICTED: uncharacterized protein LOC100831418    224   4e-63    
gb|KEH29312.1|  proton-dependent oligopeptide transport family pr...    217   5e-63    Medicago truncatula
ref|XP_009104877.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.14-like      217   9e-63    Brassica rapa
ref|NP_001117585.1|  putative peptide/nitrate transporter               216   2e-62    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010665459.1|  PREDICTED: uncharacterized protein LOC100854586    221   2e-62    
gb|KFK41627.1|  hypothetical protein AALP_AA2G152300                    215   4e-62    Arabis alpina [alpine rockcress]
gb|ACL52999.1|  unknown                                                 215   5e-62    Zea mays [maize]
ref|XP_004970733.1|  PREDICTED: probable peptide/nitrate transpor...    214   7e-62    
dbj|BAJ86454.1|  predicted protein                                      214   7e-62    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008459724.1|  PREDICTED: uncharacterized protein LOC103498766    220   8e-62    
gb|KEH16161.1|  proton-dependent oligopeptide transport family pr...    213   1e-61    Medicago truncatula
ref|XP_002456716.1|  hypothetical protein SORBIDRAFT_03g041260          209   1e-61    
ref|XP_010665406.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    213   2e-61    
ref|XP_010665396.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      213   3e-61    Vitis vinifera
ref|XP_008437711.1|  PREDICTED: uncharacterized protein LOC103483057    218   4e-61    
ref|XP_010460013.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.16-like      213   4e-61    Camelina sativa [gold-of-pleasure]
emb|CDM83970.1|  unnamed protein product                                211   4e-61    Triticum aestivum [Canadian hard winter wheat]
ref|XP_004972267.1|  PREDICTED: probable peptide/nitrate transpor...    212   4e-61    
gb|EYU27212.1|  hypothetical protein MIMGU_mgv1a017651mg                212   5e-61    Erythranthe guttata [common monkey flower]
ref|XP_004963750.1|  PREDICTED: uncharacterized protein LOC101758083    218   5e-61    
ref|XP_006390700.1|  hypothetical protein EUTSA_v10018035mg             217   8e-61    
ref|XP_011001077.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      212   8e-61    Populus euphratica
ref|XP_010665403.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      212   9e-61    Vitis vinifera
ref|XP_010231334.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      211   1e-60    Brachypodium distachyon [annual false brome]
gb|AAG51133.1|AC069273_4  oligopeptide transporter, putative            216   1e-60    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010665398.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      211   1e-60    Vitis vinifera
ref|XP_011464753.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      211   1e-60    Fragaria vesca subsp. vesca
ref|XP_002265311.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10 iso...    211   2e-60    Vitis vinifera
ref|XP_006376226.1|  hypothetical protein POPTR_0013s11130g             211   2e-60    Populus trichocarpa [western balsam poplar]
ref|XP_006304654.1|  hypothetical protein CARUB_v10011811mg             211   2e-60    Capsella rubella
ref|NP_001147980.1|  LOC100281589                                       210   3e-60    
ref|XP_002441154.1|  hypothetical protein SORBIDRAFT_09g021330          210   3e-60    
ref|NP_177357.2|  putative peptide/nitrate transporter                  210   3e-60    Arabidopsis thaliana [mouse-ear cress]
gb|AAL57662.1|  At1g72120/F28P5_2                                       210   3e-60    Arabidopsis thaliana [mouse-ear cress]
dbj|BAK04766.1|  predicted protein                                      209   5e-60    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010414831.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.13-lik...    209   5e-60    
gb|EYU28220.1|  hypothetical protein MIMGU_mgv1a020668mg                209   6e-60    Erythranthe guttata [common monkey flower]
ref|XP_010911915.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    212   7e-60    
dbj|BAJ94112.1|  predicted protein                                      208   1e-59    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010428072.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.13-like      208   2e-59    Camelina sativa [gold-of-pleasure]
dbj|BAD82717.1|  putative amino acid/peptide transporter                203   2e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_011464752.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      208   2e-59    Fragaria vesca subsp. vesca
ref|XP_008781659.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    213   2e-59    
emb|CDX82183.1|  BnaC02g21070D                                          207   3e-59    
ref|XP_010415943.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    207   3e-59    Camelina sativa [gold-of-pleasure]
ref|XP_006376229.1|  proton-dependent oligopeptide transport fami...    207   3e-59    
dbj|BAB86541.1|  OSJNBb0008G24.11                                       208   3e-59    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002441153.1|  hypothetical protein SORBIDRAFT_09g021320          206   5e-59    
emb|CBI39331.3|  unnamed protein product                                211   5e-59    Vitis vinifera
ref|XP_010521166.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.14-like      206   7e-59    Tarenaya hassleriana [spider flower]
gb|AFW78188.1|  hypothetical protein ZEAMMB73_298414                    206   1e-58    
gb|EEC71883.1|  hypothetical protein OsI_04614                          206   1e-58    Oryza sativa Indica Group [Indian rice]
ref|XP_011039203.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    206   1e-58    Populus euphratica
ref|XP_006416185.1|  hypothetical protein EUTSA_v10007251mg             206   1e-58    Eutrema salsugineum [saltwater cress]
ref|NP_001168010.1|  uncharacterized protein LOC100381733               205   2e-58    Zea mays [maize]
ref|XP_009110133.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.15           205   2e-58    Brassica rapa
gb|EAZ14316.1|  hypothetical protein OsJ_04243                          203   2e-58    Oryza sativa Japonica Group [Japonica rice]
emb|CDY41477.1|  BnaA08g20790D                                          205   2e-58    Brassica napus [oilseed rape]
dbj|BAB86548.1|  OSJNBb0008G24.20                                       204   4e-58    Oryza sativa Japonica Group [Japonica rice]
emb|CDY58918.1|  BnaCnng33930D                                          204   5e-58    Brassica napus [oilseed rape]
gb|ERM97850.1|  hypothetical protein AMTR_s00118p00129200               198   6e-58    Amborella trichopoda
ref|XP_010930856.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    209   7e-58    
gb|EAY76648.1|  hypothetical protein OsI_04604                          203   7e-58    Oryza sativa Indica Group [Indian rice]
ref|NP_001044939.2|  Os01g0871600                                       203   8e-58    
ref|XP_010414832.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.13-lik...    203   8e-58    Camelina sativa [gold-of-pleasure]
dbj|BAB86542.1|  OSJNBb0008G24.12                                       203   9e-58    Oryza sativa Japonica Group [Japonica rice]
ref|XP_006306225.1|  hypothetical protein CARUB_v10011935mg             203   1e-57    Capsella rubella
ref|NP_173672.1|  putative peptide/nitrate transporter                  203   1e-57    Arabidopsis thaliana [mouse-ear cress]
emb|CDX91683.1|  BnaC08g06020D                                          203   1e-57    
gb|EMT03148.1|  Peptide transporter PTR2                                202   2e-57    
ref|XP_010498727.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.16           202   2e-57    Camelina sativa [gold-of-pleasure]
ref|XP_002893237.1|  proton-dependent oligopeptide transport fami...    202   3e-57    
emb|CDX68281.1|  BnaA07g23210D                                          202   3e-57    
ref|XP_002893239.1|  predicted protein                                  202   3e-57    Arabidopsis lyrata subsp. lyrata
ref|XP_009104873.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.12-like      201   4e-57    Brassica rapa
gb|KFK41628.1|  hypothetical protein AALP_AA2G152500                    201   4e-57    Arabis alpina [alpine rockcress]
ref|XP_006416184.1|  hypothetical protein EUTSA_v10007239mg             201   5e-57    Eutrema salsugineum [saltwater cress]
ref|XP_010665402.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      201   6e-57    Vitis vinifera
gb|EEE55748.1|  hypothetical protein OsJ_04251                          204   2e-56    Oryza sativa Japonica Group [Japonica rice]
ref|XP_003564730.2|  PREDICTED: uncharacterized protein LOC100833779    204   2e-56    
ref|XP_011656123.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      200   2e-56    Cucumis sativus [cucumbers]
ref|XP_010543249.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    199   3e-56    Tarenaya hassleriana [spider flower]
emb|CDM85180.1|  unnamed protein product                                199   3e-56    Triticum aestivum [Canadian hard winter wheat]
emb|CBI39332.3|  unnamed protein product                                200   3e-56    Vitis vinifera
gb|EMT00830.1|  Peptide transporter PTR2                                199   4e-56    
ref|XP_003568390.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      198   4e-56    Brachypodium distachyon [annual false brome]
ref|XP_010930854.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      197   4e-56    
ref|XP_010415947.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.12-like      199   5e-56    Camelina sativa [gold-of-pleasure]
gb|AGT17393.1|  hypothetical protein SHCRBa_189_K21_R_20                198   5e-56    Saccharum hybrid cultivar R570
gb|AGT17133.1|  peptide/nitrate transporter                             198   6e-56    Saccharum hybrid cultivar R570
ref|XP_011629429.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10           198   1e-55    Amborella trichopoda
emb|CAN63512.1|  hypothetical protein VITISV_031693                     198   1e-55    Vitis vinifera
gb|KFK41643.1|  hypothetical protein AALP_AA2G154400                    197   1e-55    Arabis alpina [alpine rockcress]
emb|CDY03656.1|  BnaA02g15810D                                          197   1e-55    
ref|XP_009127904.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.12           197   1e-55    Brassica rapa
emb|CDY25743.1|  BnaA07g10390D                                          197   2e-55    Brassica napus [oilseed rape]
ref|XP_009103231.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.16-like      197   2e-55    Brassica rapa
ref|NP_001169834.1|  uncharacterized protein LOC100383726               196   2e-55    Zea mays [maize]
ref|XP_010471232.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.12           197   2e-55    Camelina sativa [gold-of-pleasure]
ref|XP_010414835.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.12-like      197   2e-55    Camelina sativa [gold-of-pleasure]
dbj|BAD82719.1|  putative oligopeptide transporter                      197   2e-55    Oryza sativa Japonica Group [Japonica rice]
ref|NP_177359.1|  putative peptide/nitrate transporter                  197   2e-55    Arabidopsis thaliana [mouse-ear cress]
gb|AFW84442.1|  hypothetical protein ZEAMMB73_404805                    196   2e-55    
ref|XP_006302093.1|  hypothetical protein CARUB_v10020083mg             197   3e-55    Capsella rubella
ref|XP_010480599.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.16-like      197   3e-55    Camelina sativa [gold-of-pleasure]
ref|XP_002887417.1|  proton-dependent oligopeptide transport fami...    196   3e-55    Arabidopsis lyrata subsp. lyrata
ref|XP_006856672.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10           197   4e-55    Amborella trichopoda
dbj|BAK05012.1|  predicted protein                                      196   4e-55    Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAD43310.1|  putative peptide transporter PTR2-B                    196   4e-55    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002887414.1|  hypothetical protein ARALYDRAFT_316182             196   5e-55    Arabidopsis lyrata subsp. lyrata
ref|XP_006415889.1|  hypothetical protein EUTSA_v10007254mg             196   5e-55    Eutrema salsugineum [saltwater cress]
ref|XP_002456711.1|  hypothetical protein SORBIDRAFT_03g041200          195   6e-55    
gb|KEH29305.1|  proton-dependent oligopeptide transport family pr...    194   7e-55    Medicago truncatula
dbj|BAJ96362.1|  predicted protein                                      195   1e-54    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011654839.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    195   1e-54    Cucumis sativus [cucumbers]
ref|NP_173671.1|  putative peptide/nitrate transporter                  195   1e-54    Arabidopsis thaliana [mouse-ear cress]
gb|AAO42884.1|  At1g22550                                               195   1e-54    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109895.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.15-like      194   2e-54    Brassica rapa
gb|EMT32453.1|  Peptide transporter PTR1                                189   2e-54    
ref|XP_002887416.1|  proton-dependent oligopeptide transport fami...    194   2e-54    
gb|ABK25104.1|  unknown                                                 194   3e-54    
emb|CDY36098.1|  BnaA08g19500D                                          193   4e-54    
ref|XP_011074962.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    193   5e-54    
ref|XP_003579314.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      193   6e-54    
ref|XP_010521163.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.14-like      193   7e-54    
ref|XP_010428075.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      192   7e-54    
gb|KFK40118.1|  hypothetical protein AALP_AA3G332900                    192   1e-53    
gb|KFK40119.1|  hypothetical protein AALP_AA3G332900                    192   1e-53    
ref|NP_001055627.1|  Os05g0430900                                       192   1e-53    
emb|CDY12523.1|  BnaC07g13630D                                          192   2e-53    
ref|XP_009104872.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      191   2e-53    
gb|KFK41630.1|  hypothetical protein AALP_AA2G152700                    197   2e-53    
ref|XP_006653077.1|  PREDICTED: probable peptide/nitrate transpor...    191   2e-53    
ref|XP_009127902.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-lik...    191   3e-53    
emb|CDY04806.1|  BnaC05g17830D                                          191   3e-53    
ref|XP_008781663.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      182   3e-53    
ref|XP_009115624.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.16           191   3e-53    
emb|CDY21371.1|  BnaA09g30560D                                          191   4e-53    
ref|XP_010428076.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      190   5e-53    
emb|CDY58920.1|  BnaCnng33940D                                          190   7e-53    
ref|XP_009104876.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      189   9e-53    
ref|XP_011464748.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    189   2e-52    
ref|XP_003579530.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      189   2e-52    
ref|XP_011074961.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    189   2e-52    
ref|XP_011464749.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    189   3e-52    
ref|XP_010251739.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       189   3e-52    
ref|XP_010419160.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      188   3e-52    
ref|XP_004301425.2|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    189   4e-52    
emb|CDX82184.1|  BnaC02g21060D                                          187   7e-52    
gb|EEC71884.1|  hypothetical protein OsI_04615                          189   8e-52    
gb|ABK24896.1|  unknown                                                 187   2e-51    
gb|ABR17733.1|  unknown                                                 186   4e-51    
emb|CDX68283.1|  BnaA07g23230D                                          184   7e-51    
ref|XP_009127900.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.13-lik...    184   8e-51    
ref|XP_010418901.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      184   1e-50    
ref|XP_009104871.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      184   1e-50    
ref|NP_177358.2|  putative peptide/nitrate transporter                  184   1e-50    
emb|CDP10704.1|  unnamed protein product                                182   5e-50    
gb|AAG51131.1|AC069273_2  oligopeptide transporter, putative            184   6e-50    
ref|XP_008781528.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      182   7e-50    
ref|XP_006390697.1|  hypothetical protein EUTSA_v10019443mg             174   8e-50    
gb|AAG51788.1|AC067754_4  peptide transporter PTR2-B, putative; 1...    184   1e-49    
ref|XP_010245117.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    181   1e-49    
ref|XP_006390695.1|  hypothetical protein EUTSA_v10018388mg             181   2e-49    
ref|XP_008781530.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      180   4e-49    
dbj|BAB86549.1|  oligopeptide transporter -like protein                 180   5e-49    
ref|XP_010535327.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      176   1e-48    
ref|XP_006843060.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10           179   2e-48    
ref|XP_006857424.2|  PREDICTED: protein NRT1/ PTR FAMILY 5.2            179   2e-48    
ref|XP_010276617.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       178   3e-48    
emb|CDY24388.1|  BnaCnng04550D                                          177   3e-48    
ref|XP_003579529.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      177   3e-48    
emb|CDY24387.1|  BnaCnng04540D                                          177   3e-48    
ref|XP_010480600.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.15-like      179   4e-48    
emb|CDX72873.1|  BnaC06g33210D                                          177   4e-48    
ref|XP_009105871.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-lik...    177   4e-48    
ref|XP_010930855.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    179   5e-48    
emb|CDY36097.1|  BnaA08g19510D                                          177   7e-48    
ref|XP_010269377.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like...    177   7e-48    
ref|XP_004246394.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       177   9e-48    
ref|XP_010269378.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like...    175   2e-47    
ref|XP_004981956.1|  PREDICTED: peptide transporter PTR2-like           176   2e-47    
ref|XP_007163475.1|  hypothetical protein PHAVU_001G2373001g            168   4e-47    
gb|KFK41633.1|  hypothetical protein AALP_AA2G153000                    178   4e-47    
emb|CDP10710.1|  unnamed protein product                                178   5e-47    
dbj|BAJ95098.1|  predicted protein                                      174   5e-47    
gb|ACG29580.1|  POT family protein                                      174   6e-47    
ref|XP_008679538.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-lik...    173   8e-47    
ref|XP_010262662.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            174   9e-47    
ref|NP_001054358.1|  Os04g0691400                                       172   2e-46    
ref|XP_004147936.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            173   3e-46    
ref|XP_009772498.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       172   4e-46    
ref|XP_009620626.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            172   6e-46    
ref|XP_010108379.1|  putative peptide/nitrate transporter               167   6e-46    
emb|CDX96376.1|  BnaA07g29870D                                          171   6e-46    
ref|XP_007220930.1|  hypothetical protein PRUPE_ppa023730mg             171   7e-46    
ref|XP_010269365.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       171   7e-46    
gb|AES71051.2|  peptide/nitrate transporter plant                       171   8e-46    
dbj|BAJ98420.1|  predicted protein                                      171   9e-46    
ref|XP_002271260.2|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       171   9e-46    
ref|XP_004307585.2|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       171   9e-46    
emb|CAH68100.1|  B0518A01.5                                             170   1e-45    
emb|CBI37163.3|  unnamed protein product                                171   1e-45    
dbj|BAC42330.1|  putative peptide transporter PTR2-B                    170   1e-45    
ref|XP_010044085.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            171   1e-45    
ref|XP_008233505.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       171   2e-45    
emb|CDP06560.1|  unnamed protein product                                171   2e-45    
gb|EYU30228.1|  hypothetical protein MIMGU_mgv1a003438mg                170   2e-45    
ref|XP_010515905.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like...    171   2e-45    
ref|XP_008346431.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.2-like       165   2e-45    
ref|XP_010230764.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       172   3e-45    
ref|XP_008442499.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            170   3e-45    
ref|XP_007220558.1|  hypothetical protein PRUPE_ppa003244mg             170   3e-45    
ref|XP_010032301.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4            169   3e-45    
ref|XP_009621141.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       170   3e-45    
ref|XP_008391631.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       170   3e-45    
ref|XP_003531124.1|  PREDICTED: peptide transporter PTR2-like           169   3e-45    
ref|NP_001146682.1|  hypothetical protein                               169   4e-45    
ref|XP_004972110.1|  PREDICTED: peptide transporter PTR1-like           169   4e-45    
ref|XP_008448441.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            169   4e-45    
dbj|BAJ95092.1|  predicted protein                                      169   5e-45    
ref|XP_010504184.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like       169   5e-45    
ref|XP_010427059.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like       169   5e-45    
ref|XP_006350821.1|  PREDICTED: peptide transporter PTR1-like           169   5e-45    
dbj|BAJ97409.1|  predicted protein                                      169   5e-45    
ref|XP_010907628.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       169   6e-45    
ref|XP_004507202.1|  PREDICTED: probable peptide/nitrate transpor...    169   6e-45    
ref|XP_004241180.2|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       169   6e-45    
gb|EMS68423.1|  Peptide transporter PTR2                                169   6e-45    
ref|XP_009336152.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       169   7e-45    
ref|XP_006390699.1|  hypothetical protein EUTSA_v10019829mg             167   7e-45    
ref|XP_008372579.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       169   8e-45    
ref|XP_008235618.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       169   9e-45    
ref|XP_010515906.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like...    169   9e-45    
ref|NP_001051098.1|  Os03g0719900                                       168   1e-44    
ref|XP_004507194.1|  PREDICTED: putative peptide/nitrate transpor...    168   1e-44    
ref|XP_010312294.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       168   1e-44    
gb|EEE59822.1|  hypothetical protein OsJ_12376                          168   1e-44    
ref|XP_008233850.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1            168   1e-44    
ref|XP_009363640.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       168   1e-44    
ref|XP_006829376.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1            168   1e-44    
gb|AES81567.2|  peptide transporter                                     168   1e-44    
ref|XP_003625349.1|  Peptide transporter PTR3-A                         168   1e-44    
gb|KEH23961.1|  peptide transporter                                     168   1e-44    
ref|XP_009771569.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       168   1e-44    
ref|XP_008785490.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       168   2e-44    
emb|CDY58921.1|  BnaCnng33950D                                          168   2e-44    
ref|XP_006339008.1|  PREDICTED: probable peptide/nitrate transpor...    168   2e-44    
ref|XP_007199454.1|  hypothetical protein PRUPE_ppa026888mg             168   2e-44    
gb|ACL52627.1|  unknown                                                 167   2e-44    
ref|XP_007163474.1|  hypothetical protein PHAVU_001G237200g             167   2e-44    
ref|XP_002277582.2|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            167   2e-44    
ref|XP_002444787.1|  hypothetical protein SORBIDRAFT_07g028040          167   2e-44    
ref|XP_010256764.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6            167   2e-44    
ref|XP_003564738.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.10-like      167   2e-44    
ref|XP_011466487.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       167   2e-44    
ref|XP_010691634.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       167   2e-44    
ref|XP_008340556.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       164   2e-44    
ref|XP_002534074.1|  Peptide transporter, putative                      171   2e-44    
ref|XP_010228489.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1            167   2e-44    
ref|XP_008355088.1|  PREDICTED: LOW QUALITY PROTEIN: protein NRT1...    167   3e-44    
ref|XP_002325913.2|  proton-dependent oligopeptide transport fami...    167   3e-44    
ref|XP_009351271.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       167   3e-44    
ref|XP_011006628.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like...    167   3e-44    
ref|XP_010680056.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       167   3e-44    
ref|XP_003553503.1|  PREDICTED: peptide transporter PTR3-A-like         167   3e-44    
ref|XP_006290772.1|  hypothetical protein CARUB_v10016878mg             167   3e-44    
ref|XP_004503208.1|  PREDICTED: putative peptide/nitrate transpor...    167   4e-44    
ref|NP_001149880.1|  peptide transporter PTR2-B                         166   4e-44    
ref|XP_002463973.1|  hypothetical protein SORBIDRAFT_01g009900          167   4e-44    
gb|KHN11892.1|  Putative peptide/nitrate transporter                    167   4e-44    
emb|CBI26754.3|  unnamed protein product                                165   4e-44    
ref|XP_003600793.1|  Peptide transporter PTR3-B                         167   4e-44    
emb|CDP03779.1|  unnamed protein product                                167   4e-44    
gb|KHN07608.1|  Putative peptide/nitrate transporter                    166   5e-44    
emb|CDY07568.1|  BnaC06g14960D                                          166   5e-44    
emb|CBI30474.3|  unnamed protein product                                164   5e-44    
ref|XP_009351619.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       166   5e-44    
ref|XP_008438477.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       166   5e-44    
emb|CDP00147.1|  unnamed protein product                                166   5e-44    
gb|EMT07041.1|  Peptide transporter PTR2                                169   5e-44    
ref|XP_003524837.1|  PREDICTED: peptide transporter PTR2-like           166   5e-44    
gb|AEZ00896.1|  putative proton-dependent oligopeptide transport ...    160   5e-44    
ref|XP_003516904.1|  PREDICTED: putative peptide/nitrate transpor...    166   6e-44    
ref|NP_190964.2|  probable peptide/nitrate transporter                  166   6e-44    
ref|XP_009116086.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.7-like       166   6e-44    
ref|XP_006601976.1|  PREDICTED: putative peptide/nitrate transpor...    166   7e-44    
ref|XP_002887415.1|  hypothetical protein ARALYDRAFT_339433             164   7e-44    
ref|XP_011094926.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       166   7e-44    
ref|XP_012068161.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       166   7e-44    
emb|CAB88358.1|  transporter-like protein                               166   7e-44    
ref|XP_002520834.1|  oligopeptide transporter, putative                 166   8e-44    
gb|KFK34643.1|  hypothetical protein AALP_AA5G172400                    166   8e-44    
emb|CAN80199.1|  hypothetical protein VITISV_030909                     166   8e-44    
ref|XP_006853953.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2            166   8e-44    
gb|ABR32183.1|  peptide transporter                                     166   8e-44    
ref|XP_010680054.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       166   8e-44    
emb|CDP12418.1|  unnamed protein product                                161   9e-44    
ref|XP_010553271.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6 isof...    166   9e-44    
emb|CAN73656.1|  hypothetical protein VITISV_002496                     166   9e-44    
gb|KHG09768.1|  hypothetical protein F383_13158                         166   9e-44    
ref|XP_009421313.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.1-like       166   9e-44    
ref|XP_006480900.1|  PREDICTED: probable peptide/nitrate transpor...    166   1e-43    
ref|XP_007220562.1|  hypothetical protein PRUPE_ppa003298mg             166   1e-43    
ref|XP_002285274.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       166   1e-43    
ref|XP_007158832.1|  hypothetical protein PHAVU_002G185700g             166   1e-43    
gb|AIL30501.1|  oligopeptide transporter 1                              166   1e-43    
gb|KJB73105.1|  hypothetical protein B456_011G215200                    165   1e-43    
ref|XP_004506789.1|  PREDICTED: peptide transporter PTR1-like iso...    165   1e-43    
ref|XP_009591011.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       165   1e-43    
ref|XP_006650508.1|  PREDICTED: peptide transporter PTR2-like           166   1e-43    
ref|XP_002967570.1|  hypothetical protein SELMODRAFT_231062             165   1e-43    
ref|XP_010532218.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1            165   1e-43    
ref|XP_004493811.1|  PREDICTED: peptide transporter PTR3-A-like         165   1e-43    
ref|XP_008798073.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3            165   1e-43    
gb|KJB36660.1|  hypothetical protein B456_006G169400                    165   1e-43    
ref|XP_012085261.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like       165   1e-43    
ref|XP_008246054.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       165   1e-43    
emb|CDX68280.1|  BnaA07g23200D                                          164   1e-43    
ref|XP_009104874.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.11-like      165   1e-43    
ref|XP_009803584.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like...    165   1e-43    
emb|CBI37164.3|  unnamed protein product                                165   1e-43    
ref|XP_010246838.1|  PREDICTED: protein NRT1/ PTR FAMILY 8.3-like       165   2e-43    
ref|XP_006403634.1|  hypothetical protein EUTSA_v10010224mg             165   2e-43    
ref|XP_008372883.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       165   2e-43    
ref|XP_010652401.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.2-like...    165   2e-43    
ref|XP_010312293.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       165   2e-43    
emb|CDY58917.1|  BnaCnng33920D                                          164   2e-43    
ref|XP_010276618.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.4-like       164   2e-43    
emb|CAN73408.1|  hypothetical protein VITISV_024373                     164   2e-43    
ref|XP_007045395.1|  Peptide transporter 2 isoform 1                    165   2e-43    
gb|AES71287.2|  peptide/nitrate transporter                             165   2e-43    
emb|CBI31605.3|  unnamed protein product                                167   2e-43    
dbj|BAG91734.1|  unnamed protein product                                164   2e-43    
ref|NP_001041994.1|  Os01g0142800                                       164   2e-43    
ref|XP_011077621.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.6-like       164   2e-43    
ref|XP_010104684.1|  Peptide transporter                                164   2e-43    
ref|XP_003623153.1|  Peptide transporter PTR3-B                         164   2e-43    
ref|XP_009617710.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.1            164   2e-43    
ref|XP_003601036.1|  Peptide transporter PTR3-A                         165   2e-43    



>ref|XP_009788012.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nicotiana sylvestris]
Length=568

 Score =   319 bits (818),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 183/225 (81%), Positives = 199/225 (88%), Gaps = 3/225 (1%)
 Frame = +1

Query  49   ATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGIS  228
            ATG  I SDAETPFL  DVV+GSVDFKGRP  RS++G WRSASFIIGVEVAERF+YYGIS
Sbjct  2    ATGVNI-SDAETPFLG-DVVEGSVDFKGRPVTRSKSGGWRSASFIIGVEVAERFAYYGIS  59

Query  229  SNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLA  408
            SNLISYLTGPLGQS A AA NVNAWSG ASLLPLLGAF+ADS+LGRYRTI+ISSLLY L 
Sbjct  60   SNLISYLTGPLGQSVATAAVNVNAWSGTASLLPLLGAFIADSYLGRYRTIIISSLLYILG  119

Query  409  LGFLTISTVLPFESSDSQNGAG-SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFD  585
            LGFLT+STVLPF  SD Q+ A  SPP+ Q+IFFFFALYLVA  QGGHKPCVQAFGADQFD
Sbjct  120  LGFLTLSTVLPFNYSDCQDTATCSPPKLQIIFFFFALYLVAFGQGGHKPCVQAFGADQFD  179

Query  586  TQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             QDP+E KAKSSFFNWWYFGMC G+++TLWILNY+QDNLSWGLGF
Sbjct  180  AQDPEESKAKSSFFNWWYFGMCGGLLMTLWILNYIQDNLSWGLGF  224



>ref|XP_009613182.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nicotiana tomentosiformis]
Length=569

 Score =   319 bits (818),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 182/225 (81%), Positives = 198/225 (88%), Gaps = 2/225 (1%)
 Frame = +1

Query  49   ATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGIS  228
            ATG   +SDAE PFL  DVV+GSVDFKGRP  RS +G WRSASFIIGVEVAERF+YYGIS
Sbjct  2    ATGGVNISDAEIPFLG-DVVEGSVDFKGRPVTRSISGGWRSASFIIGVEVAERFAYYGIS  60

Query  229  SNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLA  408
            SNLISYLTGPLGQS A AA NVNAWSG ASLLPLLGAF+ADS+LGRYRTI+ISSLLY L 
Sbjct  61   SNLISYLTGPLGQSVATAAVNVNAWSGTASLLPLLGAFIADSYLGRYRTIIISSLLYILG  120

Query  409  LGFLTISTVLPFESSDSQNGAG-SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFD  585
            LGFLT+STVLPF  SD Q+ A  SPP+FQ+IFFFFALYLVA  QGGHKPCVQAFGADQFD
Sbjct  121  LGFLTLSTVLPFNYSDCQDTATCSPPKFQIIFFFFALYLVAFGQGGHKPCVQAFGADQFD  180

Query  586  TQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             QDP+E KAKSSFFNWWYFGMC G+++TLWILNY+QDNLSWGLGF
Sbjct  181  AQDPEESKAKSSFFNWWYFGMCGGLLMTLWILNYIQDNLSWGLGF  225



>ref|XP_006356504.1| PREDICTED: probable peptide/nitrate transporter At1g22540-like 
[Solanum tuberosum]
Length=568

 Score =   310 bits (794),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 178/225 (79%), Positives = 196/225 (87%), Gaps = 3/225 (1%)
 Frame = +1

Query  49   ATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGIS  228
            A G TI SDAETPFL  DVV+GSVD+KGRP  RS++G WRSASFIIGVEVAERF+YYGI 
Sbjct  2    ANGVTI-SDAETPFL-SDVVEGSVDYKGRPVTRSKSGGWRSASFIIGVEVAERFAYYGIG  59

Query  229  SNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLA  408
            SNLISYLTGPLGQS A+AA NVN WSG ASLLPLLGAF+ADS+LGRYRTI+ISS+LY L 
Sbjct  60   SNLISYLTGPLGQSVASAAENVNVWSGTASLLPLLGAFIADSYLGRYRTIIISSVLYILG  119

Query  409  LGFLTISTVLPFESSDSQNGAG-SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFD  585
            LGFLT+STVLP   SD Q+ A  SPP+FQ+IFFFF+LYLVA  QGGHKPCVQAFGADQFD
Sbjct  120  LGFLTLSTVLPSSHSDCQDTATCSPPKFQIIFFFFSLYLVAFGQGGHKPCVQAFGADQFD  179

Query  586  TQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             QDP+E KAKSSFFNWWYFGMC G+ +TL ILNYVQDNLSWGLGF
Sbjct  180  AQDPEESKAKSSFFNWWYFGMCGGLFMTLCILNYVQDNLSWGLGF  224



>ref|XP_004241845.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 isoform X1 [Solanum 
lycopersicum]
Length=566

 Score =   308 bits (790),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 175/225 (78%), Positives = 198/225 (88%), Gaps = 3/225 (1%)
 Frame = +1

Query  49   ATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGIS  228
            A G  I SDAETPFL  +VV+GSVD+KGRP  RS++G WRSASFIIGVEVAERF+YYGI+
Sbjct  2    ANGVAI-SDAETPFLG-NVVEGSVDYKGRPVTRSKSGGWRSASFIIGVEVAERFAYYGIA  59

Query  229  SNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLA  408
            SNLISYLTGPLGQS A+AA NVN WSG ASLLPLLGAF+ADS+LGRYRTI+ISS+LY L 
Sbjct  60   SNLISYLTGPLGQSVASAAENVNIWSGTASLLPLLGAFIADSYLGRYRTIIISSVLYILG  119

Query  409  LGFLTISTVLPFESSDSQNGAG-SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFD  585
            LGFLT+STV+P+  S+ Q+ A  SPP FQ+IFFFF+LYLVA+ QGGHKPCVQAFGADQFD
Sbjct  120  LGFLTLSTVIPYSHSECQDTATCSPPTFQIIFFFFSLYLVAIGQGGHKPCVQAFGADQFD  179

Query  586  TQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             QDPQE KAKSSFFNWWYFGMC G+ +TL+ILNYVQDNLSWGLGF
Sbjct  180  AQDPQESKAKSSFFNWWYFGMCGGLFMTLYILNYVQDNLSWGLGF  224



>emb|CDP10687.1| unnamed protein product [Coffea canephora]
Length=579

 Score =   293 bits (751),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 163/234 (70%), Positives = 193/234 (82%), Gaps = 5/234 (2%)
 Frame = +1

Query  34   LLSMAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFS  213
            ++S  AT   I    E P L  D V G+VD+KGRP  RS++GRW+SASFIIGVE+AERF+
Sbjct  1    MVSSTATAANISDAIEAPTLLDDGVQGNVDYKGRPVNRSKSGRWKSASFIIGVEMAERFA  60

Query  214  YYGISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSL  393
            YYGI+SNLISYLTGPLGQSTA AA NVNA SG + LLPLLGAF+ADSFLGRYRTI++SSL
Sbjct  61   YYGINSNLISYLTGPLGQSTATAAENVNALSGTSQLLPLLGAFVADSFLGRYRTIILSSL  120

Query  394  LYTLALGFLTISTV-LPFESSDSQNGAG----SPPQFQVIffffalylvalaQGGHKPCV  558
            LY + LGFLT+STV +  ++SD Q+ A     SP +FQVIFFFFALY++A+A+GGHKPCV
Sbjct  121  LYIMGLGFLTVSTVFIASKTSDCQHAANAMNCSPSEFQVIFFFFALYIIAVAEGGHKPCV  180

Query  559  QAFGADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            QAFGADQFD QDP+ECKAKSSFFNWWYFGMC  + VTL +L Y+Q+NLSWGLGF
Sbjct  181  QAFGADQFDGQDPEECKAKSSFFNWWYFGMCGAITVTLVVLTYIQENLSWGLGF  234



>gb|EYU22787.1| hypothetical protein MIMGU_mgv1a003626mg [Erythranthe guttata]
Length=573

 Score =   292 bits (747),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 167/227 (74%), Positives = 187/227 (82%), Gaps = 6/227 (3%)
 Frame = +1

Query  55   GTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSN  234
             T  +SDAE P L+ DVV+GSVDFK RP +RS++G WRSASFIIGVEVAERF+YYGISSN
Sbjct  4    ATAAISDAEVPLLN-DVVEGSVDFKDRPVSRSKSGGWRSASFIIGVEVAERFAYYGISSN  62

Query  235  LISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALG  414
            LISYLTGPLGQSTA AA NVN WSG ASLLPLLGAFLADSFLGRYR I+ +S+LY L LG
Sbjct  63   LISYLTGPLGQSTATAAENVNLWSGTASLLPLLGAFLADSFLGRYRMIIAASVLYILGLG  122

Query  415  FLTIST-VLPFESSDSQNGAG----SPPQFQVIffffalylvalaQGGHKPCVQAFGADQ  579
             LT+S  V    SSD +N A     SPP+ Q+I FFF+LY+VAL QGGHKPCVQAFGADQ
Sbjct  123  CLTLSALVYSLGSSDCENAANNASCSPPRLQIIVFFFSLYIVALGQGGHKPCVQAFGADQ  182

Query  580  FDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FD QDP+ECKAKSSFFNWWYF  C GV+V L +LNY+QDNLSWGLGF
Sbjct  183  FDEQDPEECKAKSSFFNWWYFSFCAGVLVALSVLNYIQDNLSWGLGF  229



>ref|XP_011096252.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Sesamum indicum]
Length=563

 Score =   288 bits (736),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 163/225 (72%), Positives = 187/225 (83%), Gaps = 8/225 (4%)
 Frame = +1

Query  49   ATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGIS  228
            A G   +SDAE P L  D V+GS+DFKGRP +RS++G W+SASFIIGVEVAERF+YYGIS
Sbjct  2    ALGAAAISDAEAPLLD-DTVEGSIDFKGRPVSRSKSGGWKSASFIIGVEVAERFAYYGIS  60

Query  229  SNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLA  408
            SNLISYLTGPLGQSTA AA NVN WSG ASLLPLLG FLADSF GRYR IV++S+LY L 
Sbjct  61   SNLISYLTGPLGQSTATAAENVNVWSGTASLLPLLGGFLADSFFGRYRMIVVASVLYILG  120

Query  409  LGFLTISTVL-PFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFD  585
            LG L++S ++  F+SSD      SPPQ Q++ FFF+LY+VALAQGGHKPCVQAFGADQFD
Sbjct  121  LGCLSLSALIYSFDSSD------SPPQLQIVLFFFSLYIVALAQGGHKPCVQAFGADQFD  174

Query  586  TQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             QDP+ECKAKSSFFNWWYF  C GV+V L +LNY+QDNLSWGLGF
Sbjct  175  EQDPEECKAKSSFFNWWYFSFCAGVVVALSVLNYIQDNLSWGLGF  219



>ref|XP_009593533.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nicotiana tomentosiformis]
Length=572

 Score =   286 bits (732),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 166/228 (73%), Positives = 188/228 (82%), Gaps = 5/228 (2%)
 Frame = +1

Query  49   ATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGIS  228
            A G  I SDAETPFL  +VV+G +D+KGR   RS++G W SA FIIGVEVAERF+YYGIS
Sbjct  2    ANGANI-SDAETPFLGGEVVEGFIDYKGRQVTRSKSGGWNSAYFIIGVEVAERFAYYGIS  60

Query  229  SNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLA  408
            SNLI+YLTGP+GQSTA AAANVNAWSG A LLPLLGAF+ADSFLGRYRTI+I+S+LY L 
Sbjct  61   SNLINYLTGPIGQSTATAAANVNAWSGTAFLLPLLGAFIADSFLGRYRTIIIASVLYVLG  120

Query  409  LGFLTISTVLPFESSDSQN----GAGSPPQFQVIffffalylvalaQGGHKPCVQAFGAD  576
            L FLT+  V PF SSD QN     A SPP+FQ + FFFALYLVA AQGGHKPCVQAFGAD
Sbjct  121  LCFLTVLAVFPFNSSDCQNPDTIKACSPPEFQAVLFFFALYLVAFAQGGHKPCVQAFGAD  180

Query  577  QFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            QFDTQDP+ECKAKSSFFNWW FG+  G +V + IL+Y+QDNLSW LGF
Sbjct  181  QFDTQDPEECKAKSSFFNWWNFGLSAGALVAILILSYIQDNLSWALGF  228



>ref|XP_009115625.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 [Brassica rapa]
Length=561

 Score =   284 bits (726),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 163/227 (72%), Positives = 187/227 (82%), Gaps = 4/227 (2%)
 Frame = +1

Query  43   MAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYG  222
            MA  G    ++A TP L +  VDGSVD++  PA RS +G WRSA FIIGVEVAERF+YYG
Sbjct  1    MAIAGVD--NEAGTPLLSK-TVDGSVDYRNEPAVRSSSGGWRSAGFIIGVEVAERFAYYG  57

Query  223  ISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYT  402
            ISSNLI YLTGPLGQSTAAAA+NVNAW G ASLLPLLGAF+ADSFLGR+RTI+ +S LY 
Sbjct  58   ISSNLIMYLTGPLGQSTAAAASNVNAWYGTASLLPLLGAFVADSFLGRFRTILAASALYV  117

Query  403  LALGFLTISTVLPFESSDSQN-GAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQ  579
            L LG LT+S ++P +   +    + SPP+FQVI FF ALYLVALAQGGHKPCVQAFGADQ
Sbjct  118  LGLGLLTLSAMIPSDCKVANPLTSCSPPRFQVIAFFGALYLVALAQGGHKPCVQAFGADQ  177

Query  580  FDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FD +DP+ECKAKSSFFNWWYFGMCFG +VTLW+LNY+QDNLSW LGF
Sbjct  178  FDEKDPEECKAKSSFFNWWYFGMCFGTLVTLWVLNYIQDNLSWALGF  224



>ref|XP_009782735.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nicotiana sylvestris]
Length=571

 Score =   284 bits (726),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 169/228 (74%), Positives = 189/228 (83%), Gaps = 6/228 (3%)
 Frame = +1

Query  49   ATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGIS  228
            A G  I SDAETPFL  +VV+G VDFKG    RS++G W+SA FIIGVEVAERF+YYGIS
Sbjct  2    ANGANI-SDAETPFLG-EVVEGFVDFKGHQVVRSKSGGWKSAYFIIGVEVAERFAYYGIS  59

Query  229  SNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLA  408
            SNLI+YLTGPLGQSTA AAANVNAWSG A LLPLLGAF+ADSFLGRYRTI+I+S+LY L 
Sbjct  60   SNLINYLTGPLGQSTATAAANVNAWSGTAFLLPLLGAFIADSFLGRYRTIIIASVLYVLG  119

Query  409  LGFLTISTVLPFESSDSQN----GAGSPPQFQVIffffalylvalaQGGHKPCVQAFGAD  576
            L FLTI  V+PF SSD Q+     A SPP+ QVI FFFALYLVA AQGGHKPCVQAFGAD
Sbjct  120  LCFLTILAVIPFNSSDCQSPDTIKACSPPEIQVILFFFALYLVAFAQGGHKPCVQAFGAD  179

Query  577  QFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            QFDTQDP+ECKAKSSFFNWW FG+  G +V + IL+Y+QDNLSW LGF
Sbjct  180  QFDTQDPEECKAKSSFFNWWNFGLSAGALVAILILSYIQDNLSWALGF  227



>emb|CDY04807.1| BnaC05g17820D [Brassica napus]
Length=561

 Score =   283 bits (725),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 165/227 (73%), Positives = 187/227 (82%), Gaps = 4/227 (2%)
 Frame = +1

Query  43   MAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYG  222
            MA  G    ++A TP L +  VDGSVD++  PA RS +G WRSA FIIGVEVAERF+YYG
Sbjct  1    MAIAGVD--NEAGTPLLSK-TVDGSVDYRNEPAVRSSSGGWRSAGFIIGVEVAERFAYYG  57

Query  223  ISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYT  402
            ISSNLI YLTGPLGQSTAAAAANVNAW G ASLLPLLGAF+ADSFLGR+RTI+ +S LY 
Sbjct  58   ISSNLIMYLTGPLGQSTAAAAANVNAWYGTASLLPLLGAFVADSFLGRFRTILAASALYV  117

Query  403  LALGFLTISTVLPFESSDSQNGAG-SPPQFQVIffffalylvalaQGGHKPCVQAFGADQ  579
            L LG LT+S ++P +   +   A  SPP+FQVI FF ALYLVALAQGGHKPCVQAFGADQ
Sbjct  118  LGLGLLTLSAMIPSDCKVTNPLASCSPPRFQVIAFFGALYLVALAQGGHKPCVQAFGADQ  177

Query  580  FDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FD +DP+ECKAKSSFFNWWYFGMCFG +VTLW+LNY+QDNLSW LGF
Sbjct  178  FDEKDPEECKAKSSFFNWWYFGMCFGTLVTLWVLNYIQDNLSWALGF  224



>emb|CDY21370.1| BnaA09g30570D [Brassica napus]
Length=561

 Score =   283 bits (724),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 184/218 (84%), Gaps = 2/218 (1%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            ++A  P L +  VDGSVD++  PA RS +G WRSA FIIGVEVAERF+YYGISSNLI+YL
Sbjct  8    NEAGAPLLSK-TVDGSVDYRNEPAVRSSSGGWRSAGFIIGVEVAERFAYYGISSNLITYL  66

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLGQSTAAAA+NVNAW G ASLLPLLGAF+ADSFLGR+RTI+ +S LY L LG LT+S
Sbjct  67   TGPLGQSTAAAASNVNAWYGTASLLPLLGAFVADSFLGRFRTILAASALYVLGLGLLTLS  126

Query  430  TVLPFESSDSQN-GAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQEC  606
             ++P +   +    + SPP+FQVI FF ALYLVALAQGGHKPCVQAFGADQFD +DP+EC
Sbjct  127  AMIPSDCKVANPLTSCSPPRFQVIAFFGALYLVALAQGGHKPCVQAFGADQFDEKDPEEC  186

Query  607  KAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KAKSSFFNWWYFGMCFG +VTLW+LNY+QDNLSW LGF
Sbjct  187  KAKSSFFNWWYFGMCFGTLVTLWVLNYIQDNLSWALGF  224



>ref|XP_002890519.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH66778.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=561

 Score =   281 bits (719),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 163/226 (72%), Positives = 187/226 (83%), Gaps = 3/226 (1%)
 Frame = +1

Query  43   MAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYG  222
            MA +G   + +A TP L   V DGSVDF+ +PA RS +G WRSA FIIGVEVAERF+YYG
Sbjct  1    MAISGA--VDEAGTPLLAVTV-DGSVDFRSKPAVRSSSGGWRSAGFIIGVEVAERFAYYG  57

Query  223  ISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYT  402
            ISSNLI+YLTGPLGQSTAAAAANVNAWSG ASLLPLLGAF+ADSFLGR+RTI+ +S LY 
Sbjct  58   ISSNLITYLTGPLGQSTAAAAANVNAWSGTASLLPLLGAFVADSFLGRFRTILAASALYI  117

Query  403  LALGFLTISTVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQF  582
            L LG LT+S ++P +   S   +   P+FQVI FF ALYLVALAQGGHKPCVQAFGADQF
Sbjct  118  LGLGLLTLSAMIPSDCKVSNLLSSCSPRFQVITFFSALYLVALAQGGHKPCVQAFGADQF  177

Query  583  DTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            D ++P+ECKAKSSFFNWWYFGMCFG + TLW+LNY+QDNLSW LGF
Sbjct  178  DEKEPEECKAKSSFFNWWYFGMCFGTLTTLWVLNYIQDNLSWALGF  223



>ref|XP_006416188.1| hypothetical protein EUTSA_v10007248mg [Eutrema salsugineum]
 gb|ESQ34541.1| hypothetical protein EUTSA_v10007248mg [Eutrema salsugineum]
Length=562

 Score =   280 bits (716),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 159/216 (74%), Positives = 181/216 (84%), Gaps = 1/216 (0%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            +A TP L +  VDGSVD++ +PA RS +G WRSA FIIGVEVAERF+YYGISSNLI+YLT
Sbjct  9    EAGTPLLAK-TVDGSVDYRSKPAIRSSSGGWRSAGFIIGVEVAERFAYYGISSNLITYLT  67

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQSTAAAAANVNAW G ASLLPLLGAF+ADSFLGR+RTI+ +S LY L LG LT+S 
Sbjct  68   GPLGQSTAAAAANVNAWYGTASLLPLLGAFVADSFLGRFRTILAASALYILGLGLLTLSA  127

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
            ++P +   +       P+FQVI FF ALYLVALAQGGHKPC QAFGADQFD +DP+ECKA
Sbjct  128  MIPSDCKVTNPLTSCSPRFQVITFFSALYLVALAQGGHKPCAQAFGADQFDEKDPEECKA  187

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KSSFFNWWYFGMCFG +VTLWILNY+QDNLSW LGF
Sbjct  188  KSSFFNWWYFGMCFGTLVTLWILNYIQDNLSWVLGF  223



>ref|XP_011096129.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Sesamum indicum]
Length=574

 Score =   280 bits (715),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 162/221 (73%), Positives = 185/221 (84%), Gaps = 6/221 (3%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            +AETP L  DVV GS+DF G PA +S++G WRSASFIIGVEVAERF+YYGISSNLISYLT
Sbjct  9    EAETPLL-DDVVRGSLDFNGLPANKSKSGCWRSASFIIGVEVAERFAYYGISSNLISYLT  67

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQSTAAAA NVNAW+G A LLPL GAF+ADSFLGRYRTI+I+SLLY L LGFL++S 
Sbjct  68   GPLGQSTAAAAENVNAWNGAAMLLPLFGAFVADSFLGRYRTIIIASLLYVLGLGFLSMSA  127

Query  433  VL-PFESSDSQNGAG----SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDP  597
             L  + SSD +N A     SPP F+VI FFF+LYLVA AQGGHKPCVQAFGADQFD +DP
Sbjct  128  ALHSYNSSDCKNDANNLACSPPPFEVILFFFSLYLVAFAQGGHKPCVQAFGADQFDEEDP  187

Query  598  QECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +ECKAKSSFFNWWYF M  G++V L IL+Y+Q+NLSW LGF
Sbjct  188  EECKAKSSFFNWWYFSMNGGILVALLILSYIQENLSWELGF  228



>ref|XP_006307141.1| hypothetical protein CARUB_v10008731mg [Capsella rubella]
 gb|EOA40039.1| hypothetical protein CARUB_v10008731mg [Capsella rubella]
Length=561

 Score =   279 bits (713),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 184/216 (85%), Gaps = 1/216 (0%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            +A TPFL+   V+GSVD++ +PA RS +G WRSA FIIGVEVAERF+YYGISSNLI+YLT
Sbjct  9    EAGTPFLNV-TVNGSVDYRSKPAVRSASGGWRSAGFIIGVEVAERFAYYGISSNLITYLT  67

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQSTAAAAANVNAWSG ASLLPLLGAF+ADSFLGR+RTI+ +S LY L LG LT+S 
Sbjct  68   GPLGQSTAAAAANVNAWSGTASLLPLLGAFVADSFLGRFRTILAASALYILGLGLLTLSA  127

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
            ++P + + S   A    +FQVI FF ALYLVALAQGGHKPCVQAFGADQFD +DP+ECK 
Sbjct  128  MIPSDCNVSNLLASCSRRFQVITFFSALYLVALAQGGHKPCVQAFGADQFDEKDPEECKE  187

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            K+SFFNWWYFGMCFG +VTLW+LNYVQDNLSW LGF
Sbjct  188  KASFFNWWYFGMCFGTLVTLWVLNYVQDNLSWALGF  223



>ref|XP_010498728.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 [Camelina sativa]
 ref|XP_010498729.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 [Camelina sativa]
Length=562

 Score =   278 bits (712),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 160/226 (71%), Positives = 186/226 (82%), Gaps = 2/226 (1%)
 Frame = +1

Query  43   MAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYG  222
            MA +G   + +A TP L    VDGSVD++ +PA RS +G WRSA FIIGVEVAERF+YYG
Sbjct  1    MAISGA--VDEAGTPLLAVTTVDGSVDYRSKPAVRSSSGGWRSAGFIIGVEVAERFAYYG  58

Query  223  ISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYT  402
            ISSNLI+YLTGPLGQSTAAAAANVNAWSG ASLLPLLGAF+ADSFLGR+RTI+ +S LY 
Sbjct  59   ISSNLITYLTGPLGQSTAAAAANVNAWSGTASLLPLLGAFIADSFLGRFRTILAASALYI  118

Query  403  LALGFLTISTVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQF  582
            L LG LT+S ++P + +     +   P+FQVI FF ALYLVALAQGGHKPCVQAFGADQF
Sbjct  119  LGLGLLTLSAMIPSDCNAYNLLSSCSPRFQVIMFFSALYLVALAQGGHKPCVQAFGADQF  178

Query  583  DTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            D +DP+E K K+SFFNWWYFGMCFG +VTLW+LNY+QDNLSW LGF
Sbjct  179  DEKDPEERKQKTSFFNWWYFGMCFGTLVTLWVLNYIQDNLSWALGF  224



>ref|XP_010460012.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Camelina sativa]
Length=562

 Score =   275 bits (703),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 158/226 (70%), Positives = 185/226 (82%), Gaps = 2/226 (1%)
 Frame = +1

Query  43   MAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYG  222
            MA +G   + +A TP L    VDGSVD++ +PA RS +G WRSA FIIGVEVAERF++YG
Sbjct  1    MAISGA--VDEAGTPLLAVTTVDGSVDYRSKPAVRSSSGGWRSAGFIIGVEVAERFAFYG  58

Query  223  ISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYT  402
            ISSNLI+YLTGPLGQSTAAAAANVNAWSG ASLLPLLGAF+ADSFLGR+RTI+ +S LY 
Sbjct  59   ISSNLITYLTGPLGQSTAAAAANVNAWSGTASLLPLLGAFIADSFLGRFRTILAASALYI  118

Query  403  LALGFLTISTVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQF  582
            L LG LT+S ++P + +     +   P+FQVI FF ALYLVALAQGGHKPCVQAFGADQF
Sbjct  119  LGLGLLTLSAMIPSDCNAYNLLSSCSPRFQVIMFFSALYLVALAQGGHKPCVQAFGADQF  178

Query  583  DTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            D +DP+E K K+SFFNWWYF MCFG +VTLW+LNY+QDNLSW LGF
Sbjct  179  DEKDPEERKQKASFFNWWYFSMCFGTLVTLWVLNYIQDNLSWALGF  224



>ref|XP_010477514.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Camelina sativa]
 ref|XP_010477515.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Camelina sativa]
Length=563

 Score =   275 bits (702),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 160/227 (70%), Positives = 186/227 (82%), Gaps = 3/227 (1%)
 Frame = +1

Query  43   MAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYG  222
            MA +G   + +A TP L    VDGSVD++ +PA RS +G WRSA FIIGVEVAERF+YYG
Sbjct  1    MAISGA--VDEAGTPLLAVTTVDGSVDYRSKPAVRSSSGGWRSAGFIIGVEVAERFAYYG  58

Query  223  ISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYT  402
            ISSNLI+YLTG LGQSTAAAAANVNAWSG ASLLPLLGAF+ADSFLGR+RTI+ +S LY 
Sbjct  59   ISSNLITYLTGQLGQSTAAAAANVNAWSGTASLLPLLGAFIADSFLGRFRTILAASALYI  118

Query  403  LALGFLTISTVLPFESSDSQNGAGS-PPQFQVIffffalylvalaQGGHKPCVQAFGADQ  579
            L LG LT+S ++P + +  +    S  P+FQVI FF ALYLVALAQGGHKPCVQAFGADQ
Sbjct  119  LGLGLLTLSAMVPSDCNAYKLLLSSCSPRFQVIMFFSALYLVALAQGGHKPCVQAFGADQ  178

Query  580  FDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FD +DP+ECK K+SFFNWWYF MCFG +VTLW+LNY+QDNLSW LGF
Sbjct  179  FDEKDPKECKQKTSFFNWWYFSMCFGTLVTLWVLNYIQDNLSWALGF  225



>ref|XP_010534099.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 [Tarenaya hassleriana]
Length=561

 Score =   274 bits (701),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 158/216 (73%), Positives = 179/216 (83%), Gaps = 1/216 (0%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            +A  P L  D VDGS+DF+G+PA R  +G WR+A F+IGVEVAERF+YYGISSNLI YLT
Sbjct  9    EAGIPLL-PDTVDGSLDFRGKPAVRISSGGWRAAGFVIGVEVAERFAYYGISSNLIMYLT  67

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQSTAAAAANVNAWSG ASLLPLLG F+ADSFLGR+RTI+ SS LY L LG LT+S 
Sbjct  68   GPLGQSTAAAAANVNAWSGTASLLPLLGGFVADSFLGRFRTILASSALYILGLGLLTLSA  127

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
            ++P +   +   +    QFQVI FF ALYLVALAQGGHKPCVQAFGADQFD QDP+ECKA
Sbjct  128  MIPSDCKVANLLSSCSAQFQVILFFGALYLVALAQGGHKPCVQAFGADQFDGQDPEECKA  187

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KSSFFNWWYFGMC G +VTLW+LNY+QDNLSW LGF
Sbjct  188  KSSFFNWWYFGMCTGTLVTLWVLNYIQDNLSWALGF  223



>ref|XP_006473248.1| PREDICTED: probable peptide/nitrate transporter At1g22540-like 
[Citrus sinensis]
Length=569

 Score =   274 bits (700),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 180/218 (83%), Gaps = 2/218 (1%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAA-RSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            +AE P +  DVVDG VD+KGRP   RS+ G WRSA FIIGVE+AERF+YYG+SSNLI+YL
Sbjct  8    EAERPLVEDDVVDGCVDYKGRPVNNRSKYGGWRSALFIIGVEMAERFAYYGVSSNLITYL  67

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPL QSTA AA NVNAWSGVASLLPL GAFLADSFLGRYR I+I+SL+Y L LG LT+S
Sbjct  68   TGPLAQSTATAAENVNAWSGVASLLPLFGAFLADSFLGRYRAIIIASLIYVLGLGLLTLS  127

Query  430  TVL-PFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQEC  606
             VL    +S+ QN + S  QFQVIFFFF+LYL+AL QGGHKPCVQAFGADQFD+Q PQE 
Sbjct  128  AVLLSGSTSECQNTSCSANQFQVIFFFFSLYLIALGQGGHKPCVQAFGADQFDSQHPQES  187

Query  607  KAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            K KSSFFNWWYFGMC G  VTL +LNY+QDNL+W LGF
Sbjct  188  KLKSSFFNWWYFGMCMGTFVTLTVLNYIQDNLNWILGF  225



>ref|XP_006434673.1| hypothetical protein CICLE_v10000719mg [Citrus clementina]
 gb|ESR47913.1| hypothetical protein CICLE_v10000719mg [Citrus clementina]
Length=569

 Score =   273 bits (699),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 159/218 (73%), Positives = 180/218 (83%), Gaps = 2/218 (1%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAA-RSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            +AE P +  DVVDG VD+KGRP   RS+ G WRSA FIIGVE+AERF+YYG+SSNLI+YL
Sbjct  8    EAERPLVEDDVVDGCVDYKGRPVNNRSKYGGWRSALFIIGVEMAERFAYYGVSSNLITYL  67

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPL QSTA AA NVNAWSGVASLLPL GAFLADSFLGRYR I+I+SL+Y L LG LT+S
Sbjct  68   TGPLAQSTATAAENVNAWSGVASLLPLFGAFLADSFLGRYRAIIIASLIYVLGLGLLTLS  127

Query  430  TVL-PFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQEC  606
             VL    +S+ QN + S  QFQVIFFFF+LYL+AL QGGHKPCVQAFGADQFD+Q PQE 
Sbjct  128  AVLLSGSTSECQNTSCSANQFQVIFFFFSLYLIALGQGGHKPCVQAFGADQFDSQHPQES  187

Query  607  KAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            K KSSFFNWWYFGMC G  VTL +LNY+QDNL+W LGF
Sbjct  188  KLKSSFFNWWYFGMCMGTFVTLTVLNYIQDNLNWILGF  225



>gb|KFK44349.1| hypothetical protein AALP_AA1G246100 [Arabis alpina]
Length=558

 Score =   273 bits (697),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 157/216 (73%), Positives = 181/216 (84%), Gaps = 4/216 (2%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            +A TP L  + V+GSVD++ +PA RS +G WRSA  IIGVEVAERF+YYGISSNLI+YLT
Sbjct  9    EAGTPLL-SETVNGSVDYRSKPAVRSSSGGWRSAGLIIGVEVAERFAYYGISSNLITYLT  67

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQSTAAAAANVNAWSG ASLLPLLGAF+ADSFLGR+RTI+ +S LY L LG LT+S 
Sbjct  68   GPLGQSTAAAAANVNAWSGTASLLPLLGAFVADSFLGRFRTILAASALYILGLGILTLSA  127

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
            ++P   SD +  + S P+FQVI FF ALYLVALAQGGHKPCVQAFGADQFD  + +ECKA
Sbjct  128  MIP---SDCKVSSCSSPRFQVIVFFSALYLVALAQGGHKPCVQAFGADQFDENEAKECKA  184

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KSSFFNWWYF MCFG + TLW+LNY+QDNLSW LGF
Sbjct  185  KSSFFNWWYFCMCFGTLTTLWVLNYIQDNLSWALGF  220



>gb|KDO84007.1| hypothetical protein CISIN_1g045562mg, partial [Citrus sinensis]
Length=525

 Score =   271 bits (693),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 158/218 (72%), Positives = 179/218 (82%), Gaps = 2/218 (1%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAA-RSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            +AE P +  DVVDG VD+KGRP   RS+ G WRSA FIIGVE+AERF+YYG+SSNLI+YL
Sbjct  8    EAERPLVEDDVVDGCVDYKGRPVNNRSKYGGWRSALFIIGVEMAERFAYYGVSSNLITYL  67

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPL QSTA AA NVNAWSGVASLLPL GAFLADSFLGRYR I+I+SL+Y L LG LT+S
Sbjct  68   TGPLAQSTATAAENVNAWSGVASLLPLFGAFLADSFLGRYRAIIIASLIYVLGLGLLTLS  127

Query  430  TV-LPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQEC  606
             V L   +S+ QN + S  QFQVIFFFF+LYL+AL QGGHKPCVQAFGADQFD+Q P E 
Sbjct  128  AVLLSGSTSECQNTSCSANQFQVIFFFFSLYLIALGQGGHKPCVQAFGADQFDSQHPLES  187

Query  607  KAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            K KSSFFNWWYFGMC G  VTL +LNY+QDNL+W LGF
Sbjct  188  KLKSSFFNWWYFGMCMGTFVTLTVLNYIQDNLNWILGF  225



>ref|XP_007020112.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY17337.1| Major facilitator superfamily protein [Theobroma cacao]
Length=571

 Score =   271 bits (692),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 164/227 (72%), Positives = 185/227 (81%), Gaps = 6/227 (3%)
 Frame = +1

Query  55   GTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSN  234
              + LS A+TP L  D VDGS+D+KGRP  RS +G WRSASFII VE+ ERF+YYGISSN
Sbjct  2    AASTLSAAQTPLLD-DTVDGSLDYKGRPLRRSNSGGWRSASFIIAVEITERFAYYGISSN  60

Query  235  LISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALG  414
            LI+YLTGPLG+STA AAA VNA SG ASLLPLLGAF+ADSFLGRYRTI+++SLLY L LG
Sbjct  61   LITYLTGPLGESTATAAAQVNALSGAASLLPLLGAFIADSFLGRYRTIILASLLYILGLG  120

Query  415  FLTISTVLP-FESSDSQNGAG----SPPQFQVIffffalylvalaQGGHKPCVQAFGADQ  579
             LT+S  LP   +S  QN       S  QFQVI FFF+LYLVA AQGGHKPCVQAFGADQ
Sbjct  121  LLTLSATLPSVSTSVGQNADNVTLSSSLQFQVILFFFSLYLVAFAQGGHKPCVQAFGADQ  180

Query  580  FDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FDTQDP+ECKAKSSFFNWWYFGMC G ++TLW+LNY+QDNLSW LGF
Sbjct  181  FDTQDPEECKAKSSFFNWWYFGMCAGTLITLWVLNYIQDNLSWVLGF  227



>emb|CDP10688.1| unnamed protein product [Coffea canephora]
Length=577

 Score =   270 bits (689),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 159/223 (71%), Positives = 180/223 (81%), Gaps = 5/223 (2%)
 Frame = +1

Query  67   LSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            +SDA    L  DVVDG+VD+KGRP  RS++GRW+SASFII VE+AERF YYGIS NLISY
Sbjct  11   ISDAIETTLLDDVVDGNVDYKGRPVKRSKSGRWKSASFIICVEMAERFVYYGISVNLISY  70

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTGPLGQSTA AA NVNAWSG A +LPLLGAF+ADSFLGRYRTI+ISSLLY L LGFLT+
Sbjct  71   LTGPLGQSTATAAENVNAWSGTAQMLPLLGAFVADSFLGRYRTILISSLLYILGLGFLTL  130

Query  427  STVL-PFESSDSQNGAG----SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQ  591
            ST     +SS+ QN A     SP +FQVIFF FALYL+A+AQGGHKPCVQAFGADQFD +
Sbjct  131  STFFTSVKSSECQNAAKVTTCSPSEFQVIFFIFALYLIAVAQGGHKPCVQAFGADQFDGR  190

Query  592  DPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            DP+E KAKSSFFNW +   C  + V L IL Y+QDNLSWGLGF
Sbjct  191  DPKESKAKSSFFNWLFSASCGAITVALVILTYIQDNLSWGLGF  233



>gb|KHG04630.1| hypothetical protein F383_29596 [Gossypium arboreum]
Length=598

 Score =   270 bits (689),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 177/222 (80%), Gaps = 6/222 (3%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            S A+TP L  D VDG +D+KGRP  RS +G WRSASFII VE+AERF+YYGISSNLI+YL
Sbjct  33   SAAQTPLL-DDTVDGCLDYKGRPVRRSSSGCWRSASFIIVVEIAERFAYYGISSNLITYL  91

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLG+STA AAA VNAW+G ASLLPLLGAF+ADSFLGRYRTI+++SL+Y L +G L +S
Sbjct  92   TGPLGESTATAAAQVNAWNGAASLLPLLGAFIADSFLGRYRTIILASLVYVLGIGLLALS  151

Query  430  TVLPFESSDSQNGA-----GSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQD  594
              L   SS     A      S  QFQVI FF +LYLVA AQGGHKPCVQAFGADQFDTQD
Sbjct  152  ATLSSISSSGGQNADDIALSSSLQFQVILFFSSLYLVAFAQGGHKPCVQAFGADQFDTQD  211

Query  595  PQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             +ECKAKSSFFNWWYFGMC G + TL ILNY+QDNLSW LGF
Sbjct  212  AEECKAKSSFFNWWYFGMCAGTLTTLSILNYIQDNLSWVLGF  253



>ref|NP_173670.2| probable peptide/nitrate transporter [Arabidopsis thaliana]
 sp|Q0WP01.1|PTR9_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 5.10; Short=AtNPF5.10 
[Arabidopsis thaliana]
 dbj|BAF01148.1| similar to peptide transporter [Arabidopsis thaliana]
 gb|ACE79042.1| At1g22540 [Arabidopsis thaliana]
 gb|AEE30254.1| probable peptide/nitrate transporter [Arabidopsis thaliana]
Length=557

 Score =   268 bits (686),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 153/218 (70%), Positives = 180/218 (83%), Gaps = 5/218 (2%)
 Frame = +1

Query  67   LSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            + +A TP L       +VD++ +PA +S +G WRSA FIIGVEVAERF+YYGISSNLI+Y
Sbjct  7    VDEAGTPLLAV-----TVDYRNKPAVKSSSGGWRSAGFIIGVEVAERFAYYGISSNLITY  61

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTGPLGQSTAAAAANVNAWSG ASLLPLLGAF+ADSFLGR+RTI+ +S LY + LG LT+
Sbjct  62   LTGPLGQSTAAAAANVNAWSGTASLLPLLGAFVADSFLGRFRTILAASALYIVGLGVLTL  121

Query  427  STVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQEC  606
            S ++P +   S   +   P+FQVI FF ALYLVALAQGGHKPCVQAFGADQFD ++P+EC
Sbjct  122  SAMIPSDCKVSNLLSSCSPRFQVITFFSALYLVALAQGGHKPCVQAFGADQFDEKEPEEC  181

Query  607  KAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KAKSSFFNWWYFGMCFG + TLW+LNY+QDNLSW LGF
Sbjct  182  KAKSSFFNWWYFGMCFGTLTTLWVLNYIQDNLSWALGF  219



>ref|XP_010683110.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Beta vulgaris 
subsp. vulgaris]
Length=574

 Score =   267 bits (682),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 146/220 (66%), Positives = 175/220 (80%), Gaps = 3/220 (1%)
 Frame = +1

Query  70   SDAETPFL---HQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLI  240
            +DA+TPFL    ++ VDG++D+KG PA RS+ GRW+SASFIIGVEVAER +YYGI+SNLI
Sbjct  11   ADAQTPFLLLEEEETVDGALDYKGNPAIRSKHGRWKSASFIIGVEVAERIAYYGITSNLI  70

Query  241  SYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFL  420
            SYLTGPLGQSTA+AAANVNAWSG ASL P++GA +ADSFLGRYRTI++SS +Y L L  L
Sbjct  71   SYLTGPLGQSTASAAANVNAWSGFASLFPVIGAIIADSFLGRYRTIIVSSFIYILGLALL  130

Query  421  TISTVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQ  600
            T+S VLPF    +         FQ +  F +LYLVA+ Q GHKPCVQAFGADQFD QDPQ
Sbjct  131  TLSAVLPFCKKTTNGMLCDSLPFQTMSIFVSLYLVAVGQSGHKPCVQAFGADQFDGQDPQ  190

Query  601  ECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            E KAKSSFFNWWY GMC G ++ + +LNY+QDN+ WGLGF
Sbjct  191  ESKAKSSFFNWWYMGMCLGPLLVISVLNYIQDNVGWGLGF  230



>ref|XP_009593536.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nicotiana tomentosiformis]
Length=588

 Score =   267 bits (683),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 156/218 (72%), Positives = 175/218 (80%), Gaps = 5/218 (2%)
 Frame = +1

Query  82   TPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPL  261
            TP    DVV  SVDF GRP  RS +GRWRSAS II VE+AERF+YYGI+SNLI+YLTGPL
Sbjct  27   TPTHSNDVVPDSVDFYGRPVLRSNSGRWRSASLIICVEIAERFAYYGINSNLINYLTGPL  86

Query  262  GQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLP  441
            GQSTAAAA NVNAWSG ASL PLLGA +ADSFLGRYRTIV +SL Y L LG LT+S V P
Sbjct  87   GQSTAAAAENVNAWSGTASLTPLLGALVADSFLGRYRTIVFASLFYILGLGLLTLSAVFP  146

Query  442  FESSDS-----QNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQEC  606
            F SS +        A SPP+ QV+ FFF+LYLVA+AQGGHKPCVQAFGADQFD  DP EC
Sbjct  147  FFSSSNCQTTDNADACSPPRLQVVLFFFSLYLVAVAQGGHKPCVQAFGADQFDPLDPIEC  206

Query  607  KAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KA+SSFFNWWYFGMC G +VT+ +LNY+QDN +WGLGF
Sbjct  207  KARSSFFNWWYFGMCGGNIVTISVLNYIQDNFNWGLGF  244



>gb|EPS64734.1| hypothetical protein M569_10046, partial [Genlisea aurea]
Length=300

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 147/221 (67%), Positives = 176/221 (80%), Gaps = 3/221 (1%)
 Frame = +1

Query  67   LSDAETPFLHQ-DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLIS  243
            +S+A  PFL++ DVV+G VD KGRP  RSR+G W+SA+F+IGVEV ERF YYGISSNLI+
Sbjct  6    VSEAGVPFLNENDVVEGRVDCKGRPVLRSRSGCWKSAAFLIGVEVPERFGYYGISSNLIT  65

Query  244  YLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLT  423
            YLTGPLGQSTA+AAANVNAWSG +SLLPL  AF ADSFLGR+RTI+++S LY L LG LT
Sbjct  66   YLTGPLGQSTASAAANVNAWSGASSLLPLFVAFFADSFLGRHRTILLASALYILGLGCLT  125

Query  424  ISTVLPFESSDSQNGAG--SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDP  597
            +S V+      +   A   SPP  Q++ FF +LY VALAQ GHKPC+QAFGADQFD  DP
Sbjct  126  LSAVIYSSGCQTTTNASSCSPPGLQIVLFFISLYTVALAQSGHKPCLQAFGADQFDENDP  185

Query  598  QECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +ECKAKSSFFNWWYF  C G++V L  L+Y+QDNL+WGLGF
Sbjct  186  RECKAKSSFFNWWYFSSCAGILVALIFLSYIQDNLNWGLGF  226



>ref|XP_009783108.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nicotiana sylvestris]
Length=588

 Score =   263 bits (673),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 155/218 (71%), Positives = 175/218 (80%), Gaps = 5/218 (2%)
 Frame = +1

Query  82   TPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPL  261
            TP    D+V  SVD+ GRP  RS +GRWRSAS II VE+AERF+YYGI+SNLI+YLTGPL
Sbjct  26   TPTHSNDIVPDSVDYYGRPVHRSNSGRWRSASLIICVEIAERFAYYGINSNLINYLTGPL  85

Query  262  GQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLP  441
            GQSTAAAA NVNAWSG ASL PLLGA +ADSFLGRYRTIV +SL Y L LG LT+S V P
Sbjct  86   GQSTAAAAENVNAWSGTASLTPLLGALVADSFLGRYRTIVFASLFYILGLGLLTLSAVFP  145

Query  442  FESSDS-----QNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQEC  606
            F SS +        A SPP+FQV+ FFF+LYLVA+AQGGHKPCVQAFGADQFD  DP EC
Sbjct  146  FFSSSNCQTTDNADACSPPRFQVVLFFFSLYLVAIAQGGHKPCVQAFGADQFDPLDPIEC  205

Query  607  KAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KA+SSFFNWWYFGM  G +VT+ +LNYVQDN +WGLGF
Sbjct  206  KARSSFFNWWYFGMSGGNIVTVSVLNYVQDNFNWGLGF  243



>ref|XP_007020110.1| Major facilitator superfamily protein [Theobroma cacao]
 gb|EOY17335.1| Major facilitator superfamily protein [Theobroma cacao]
Length=570

 Score =   262 bits (670),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 154/224 (69%), Positives = 179/224 (80%), Gaps = 4/224 (2%)
 Frame = +1

Query  61   TILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLI  240
            ++LS AETP L QD +DG V   GRP AR+++G WRSASFIIG+EVAERF+Y+GI SNLI
Sbjct  4    SVLSGAETPLLEQDTIDGYVGCNGRPVARAKSGGWRSASFIIGIEVAERFAYFGIESNLI  63

Query  241  SYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFL  420
            SYLTGPLGQSTAAAA  VNAWSG A LLPLLG F+ADSFLGRYRTI+++SLLY L L  L
Sbjct  64   SYLTGPLGQSTAAAAEQVNAWSGTAMLLPLLGGFVADSFLGRYRTIIVASLLYVLGLSLL  123

Query  421  TISTVLPFES----SDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDT  588
            T++  LP  +     ++ N A    QFQ I FFFAL+LVAL QGG KPCVQAFGADQFDT
Sbjct  124  TVTATLPSVNPSGCQNTDNFALCSSQFQEILFFFALFLVALGQGGQKPCVQAFGADQFDT  183

Query  589  QDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            QDP+ECKAKSSFFNWWYF +C  + +T W+LNY+QDNLSW LGF
Sbjct  184  QDPEECKAKSSFFNWWYFCLCTAMFITHWVLNYIQDNLSWVLGF  227



>gb|ABR32184.1| peptide transporter [Hakea actites]
Length=567

 Score =   260 bits (664),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 149/220 (68%), Positives = 177/220 (80%), Gaps = 7/220 (3%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E P L  D V+G+VD KG+PA RS+TGRWRSA+FIIGVE+ ERFSYYGI  NLI+YLTGP
Sbjct  2    EAPLL-SDTVEGAVDHKGQPAIRSKTGRWRSAAFIIGVEIGERFSYYGIQGNLITYLTGP  60

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            L QST  AA NVN WSGVAS+LPLLGAF+AD++LGRY TI+ +SLLY L L FLT+S VL
Sbjct  61   LQQSTVTAAVNVNTWSGVASMLPLLGAFVADAYLGRYWTILFASLLYVLGLSFLTLSAVL  120

Query  439  P------FESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQ  600
            P        + ++ + +  PP +Q+IFFF +LYLVALAQGGHKPCVQAFGADQFD Q P+
Sbjct  121  PSLIPSTCGNINTISTSCHPPLYQIIFFFSSLYLVALAQGGHKPCVQAFGADQFDGQHPE  180

Query  601  ECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            ECK+KSSFFNWWYFGMC G++ T  IL Y+QDNL+WGLGF
Sbjct  181  ECKSKSSFFNWWYFGMCSGIVCTNLILTYIQDNLNWGLGF  220



>gb|KHG26072.1| hypothetical protein F383_04504 [Gossypium arboreum]
Length=562

 Score =   259 bits (662),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 177/225 (79%), Gaps = 8/225 (4%)
 Frame = +1

Query  67   LSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            L+ AETP L  D V G +DFKGRP  RS +G W SASFI+ VEVAERF+YYGISSNLI+Y
Sbjct  4    LAAAETPLL-DDSVKGCLDFKGRPVHRSNSGGWTSASFIMAVEVAERFAYYGISSNLITY  62

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTGPLG STAAAAA VN+WSGVA+LLPLLGAFLADSFLGRYRTI+++SL+Y L LG LT+
Sbjct  63   LTGPLGLSTAAAAAQVNSWSGVATLLPLLGAFLADSFLGRYRTIILASLVYILGLGLLTL  122

Query  427  STVLPFESSDSQNGA-------GSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFD  585
            S  LP  ++     A        S  Q+QVI FFF+LYLVA  QGGHKPCVQAFGADQFD
Sbjct  123  SATLPSVTTSGAPNADNVTLNTSSMLQYQVILFFFSLYLVAFGQGGHKPCVQAFGADQFD  182

Query  586  TQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             + P ECKAKSSFFNWWYF +  G+++TL ILNY+Q+NLSW LGF
Sbjct  183  AEHPVECKAKSSFFNWWYFSIAAGILLTLLILNYIQENLSWVLGF  227



>gb|KJB29708.1| hypothetical protein B456_005G116000 [Gossypium raimondii]
Length=599

 Score =   260 bits (664),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 157/222 (71%), Positives = 178/222 (80%), Gaps = 6/222 (3%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            S A+TP L  D +DG +D+KGRP  RS +G W SASFII VE+AERF+YYGISSNLI+YL
Sbjct  33   SAAQTPLL-DDTIDGCLDYKGRPVRRSSSGCWISASFIIVVEIAERFAYYGISSNLITYL  91

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLG+STA AAA VNAW+G ASLLPLLGAF+ADSFLGRYRTI+++SL+Y L LG L +S
Sbjct  92   TGPLGESTATAAAQVNAWNGAASLLPLLGAFIADSFLGRYRTIILASLVYILGLGLLALS  151

Query  430  TVL-PFESSDSQN----GAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQD  594
              L    SS  QN       S  QFQVI FF +LYLVA AQGGHKPCVQAFGADQFDTQD
Sbjct  152  ATLGSISSSGGQNADDIALSSSLQFQVILFFSSLYLVAFAQGGHKPCVQAFGADQFDTQD  211

Query  595  PQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            P+ECKAK+SFFNWWYFGMC G + TL ILNY+QDNLSW LGF
Sbjct  212  PEECKAKTSFFNWWYFGMCAGTLTTLSILNYIQDNLSWVLGF  253



>gb|AAF18524.1|AC006551_10 Similar to peptide transporter [Arabidopsis thaliana]
Length=570

 Score =   259 bits (661),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 153/231 (66%), Positives = 180/231 (78%), Gaps = 18/231 (8%)
 Frame = +1

Query  67   LSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            + +A TP L       +VD++ +PA +S +G WRSA FIIGVEVAERF+YYGISSNLI+Y
Sbjct  7    VDEAGTPLLAV-----TVDYRNKPAVKSSSGGWRSAGFIIGVEVAERFAYYGISSNLITY  61

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTL-------  405
            LTGPLGQSTAAAAANVNAWSG ASLLPLLGAF+ADSFLGR+RTI+ +S LY +       
Sbjct  62   LTGPLGQSTAAAAANVNAWSGTASLLPLLGAFVADSFLGRFRTILAASALYIVMSLKLYS  121

Query  406  ------ALGFLTISTVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAF  567
                   LG LT+S ++P +   S   +   P+FQVI FF ALYLVALAQGGHKPCVQAF
Sbjct  122  DLIEQQGLGVLTLSAMIPSDCKVSNLLSSCSPRFQVITFFSALYLVALAQGGHKPCVQAF  181

Query  568  GADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            GADQFD ++P+ECKAKSSFFNWWYFGMCFG + TLW+LNY+QDNLSW LGF
Sbjct  182  GADQFDEKEPEECKAKSSFFNWWYFGMCFGTLTTLWVLNYIQDNLSWALGF  232



>ref|XP_007131296.1| hypothetical protein PHAVU_011G002000g [Phaseolus vulgaris]
 gb|ESW03290.1| hypothetical protein PHAVU_011G002000g [Phaseolus vulgaris]
Length=566

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 146/214 (68%), Positives = 169/214 (79%), Gaps = 5/214 (2%)
 Frame = +1

Query  94   HQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQST  273
              DVVDG+VDF+G  A RS++G WRSA  IIGVEVAER +YYGI  N+ISYLTGPL QST
Sbjct  17   RDDVVDGAVDFRGGTAVRSKSGSWRSAGLIIGVEVAERIAYYGIQGNMISYLTGPLRQST  76

Query  274  aaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESS  453
            A AA N+N WSG ASLLPLLGAFLADSFLGRYRTI+++SL+Y L LG LT+S +LP  S+
Sbjct  77   ATAAENINVWSGTASLLPLLGAFLADSFLGRYRTIILASLVYILGLGLLTLSAMLPSLSN  136

Query  454  -----DSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKS  618
                 D +  + SPP+ QVI FF +LYLVA+ QGGHKPCVQAFGADQFD Q P+E K +S
Sbjct  137  SECQVDDELKSCSPPRSQVILFFISLYLVAIGQGGHKPCVQAFGADQFDEQHPKEHKDRS  196

Query  619  SFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            SFFNWWYF MC G M TL +LNY+QDNLSW LGF
Sbjct  197  SFFNWWYFTMCLGCMATLSVLNYIQDNLSWVLGF  230



>ref|XP_007131295.1| hypothetical protein PHAVU_011G001900g [Phaseolus vulgaris]
 gb|ESW03289.1| hypothetical protein PHAVU_011G001900g [Phaseolus vulgaris]
Length=565

 Score =   258 bits (660),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 146/212 (69%), Positives = 169/212 (80%), Gaps = 5/212 (2%)
 Frame = +1

Query  100  DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaa  279
            DVVDG+VDF+G  A RS+TG WRSA  IIGVEVAER +YYGI  N+ISYLTGPL QSTA 
Sbjct  18   DVVDGAVDFRGGTAVRSKTGSWRSAGLIIGVEVAERIAYYGIQGNMISYLTGPLRQSTAT  77

Query  280  aaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESS--  453
            AA N+N WSG ASLLPLLGAFLADSFLGRYRTI+++SL+Y L LG LT+S +LP  S+  
Sbjct  78   AAENINVWSGTASLLPLLGAFLADSFLGRYRTIILASLVYILGLGLLTLSAMLPSLSNSE  137

Query  454  ---DSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSF  624
               D++  + SPP+ QVI  F +LYLVA+ QGGHKPCVQAFGADQFD Q P+E K +SSF
Sbjct  138  CQVDNELKSCSPPRSQVILLFISLYLVAIGQGGHKPCVQAFGADQFDEQHPKEHKDRSSF  197

Query  625  FNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FNWWYF MC G + TL ILNY+QDNLSW LGF
Sbjct  198  FNWWYFTMCAGCLATLSILNYIQDNLSWVLGF  229



>ref|XP_010245114.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nelumbo nucifera]
Length=577

 Score =   258 bits (659),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 144/221 (65%), Positives = 178/221 (81%), Gaps = 4/221 (2%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            S +E+P L +D+V+G VD++G    R ++G WRSASFIIGVE+AERF+YYGI+SNLISYL
Sbjct  7    SASESPLLGEDMVEGMVDYEGCRVTRFKSGGWRSASFIIGVEMAERFAYYGITSNLISYL  66

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPL QSTA AAANVNAW GV+S+LPLLGAF+AD++LGR+R I+ SSLLY L LG LTIS
Sbjct  67   TGPLRQSTAMAAANVNAWLGVSSMLPLLGAFVADAYLGRFRIILFSSLLYVLGLGMLTIS  126

Query  430  TVLP----FESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDP  597
             + P        +++  +   PQFQ++FFF +LYLVALAQGGHKPCVQAFGADQFD Q+P
Sbjct  127  AIFPSPSLLHCQNTKKNSSCTPQFQIVFFFASLYLVALAQGGHKPCVQAFGADQFDAQNP  186

Query  598  QECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             ECK+KSSFFNWWYF +   V ++LWILNY+QDN +W LGF
Sbjct  187  DECKSKSSFFNWWYFAINGSVFISLWILNYIQDNFNWILGF  227



>gb|KJB81309.1| hypothetical protein B456_013G138200 [Gossypium raimondii]
Length=562

 Score =   257 bits (657),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 154/222 (69%), Positives = 175/222 (79%), Gaps = 8/222 (4%)
 Frame = +1

Query  76   AETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTG  255
            AETP L  D V G +DFKGRP  RS +G W SASFII VEVAERF+YYGISSNLI+YLTG
Sbjct  7    AETPLL-DDSVKGCLDFKGRPVHRSSSGGWTSASFIIAVEVAERFAYYGISSNLITYLTG  65

Query  256  PLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTV  435
            PLG STAAAAA VNAWSGVA+LLPLLGAFLADSFLGRYRTI+++SL+Y L LG LT+S  
Sbjct  66   PLGLSTAAAAAQVNAWSGVATLLPLLGAFLADSFLGRYRTIILASLVYILGLGLLTLSAT  125

Query  436  LPFESSDSQNGA-------GSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQD  594
            LP  ++     A        S  Q+QVI FFF+LYLVA  QGGHKPCVQAFGADQFD + 
Sbjct  126  LPSVTTSGAPNADNVTLNTSSMLQYQVILFFFSLYLVAFGQGGHKPCVQAFGADQFDAEH  185

Query  595  PQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            P ECKAKSSFFNWWYF +  G+++TL ILNY+Q+NLSW LGF
Sbjct  186  PVECKAKSSFFNWWYFSIAAGILLTLLILNYIQENLSWVLGF  227



>ref|XP_010095905.1| putative peptide/nitrate transporter [Morus notabilis]
 gb|EXB62499.1| putative peptide/nitrate transporter [Morus notabilis]
Length=590

 Score =   258 bits (659),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 155/220 (70%), Positives = 182/220 (83%), Gaps = 4/220 (2%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            +D ETP L+ D VDG VD +GRP  RS++G WRSA FIIGVE+AERF+Y GI+SNLISYL
Sbjct  34   NDDETPLLN-DTVDGVVDHEGRPILRSKSGGWRSAGFIIGVEIAERFAYCGIASNLISYL  92

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLGQSTAAAAANVNAW G ASLLPLLGAF+ADSFLGRYRTI++++LLY L L  LT+S
Sbjct  93   TGPLGQSTAAAAANVNAWDGTASLLPLLGAFVADSFLGRYRTIILANLLYILGLALLTLS  152

Query  430  TVLP-FESSDSQNGAGSP--PQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQ  600
             +LP   +SD Q     P   Q QVI  F +LY+VA+AQGGHKPCVQAFGADQFD QDP+
Sbjct  153  AILPSLGASDCQTNEIMPCSSQIQVILLFVSLYIVAVAQGGHKPCVQAFGADQFDGQDPE  212

Query  601  ECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            ECKA+SSFFNWWYFG+CFG +VT+ IL+YVQDN+SW +GF
Sbjct  213  ECKARSSFFNWWYFGICFGFLVTVSILSYVQDNISWAIGF  252



>gb|KHN47085.1| Putative peptide/nitrate transporter [Glycine soja]
Length=563

 Score =   256 bits (655),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 151/217 (70%), Positives = 175/217 (81%), Gaps = 6/217 (3%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            S+AETP L + +  G V+FKG P  RS +G W++A+FII VEVAERF+YYGI+SNLI+YL
Sbjct  10   SEAETPLLSETLY-GVVNFKGLPVLRSTSGGWKAAAFIITVEVAERFAYYGINSNLINYL  68

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLGQST  AA NVN WSG ASLLPLLGAFLADSFLGRYRTIV++SL+Y L L  LT S
Sbjct  69   TGPLGQSTVTAAENVNLWSGTASLLPLLGAFLADSFLGRYRTIVLASLIYVLGLSLLTFS  128

Query  430  TVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECK  609
            T+LP  +SD     G   + Q+IFFFF+LYLVALAQGGHKPCVQAFGADQFD  DP+ECK
Sbjct  129  TILPVTTSD-----GEVARPQLIFFFFSLYLVALAQGGHKPCVQAFGADQFDVNDPEECK  183

Query  610  AKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            A+SSFFNWWYF    G+ VTL+ILNYVQDN+ W LGF
Sbjct  184  ARSSFFNWWYFAFSAGLFVTLFILNYVQDNVGWVLGF  220



>ref|XP_003523479.1| PREDICTED: probable peptide/nitrate transporter At1g22540 [Glycine 
max]
Length=563

 Score =   256 bits (655),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 151/217 (70%), Positives = 175/217 (81%), Gaps = 6/217 (3%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            S+AETP L + +  G V+FKG P  RS +G W++A+FII VEVAERF+YYGI+SNLI+YL
Sbjct  10   SEAETPLLSETLY-GVVNFKGLPVLRSTSGGWKAAAFIITVEVAERFAYYGINSNLINYL  68

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLGQST  AA NVN WSG ASLLPLLGAFLADSFLGRYRTIV++SL+Y L L  LT S
Sbjct  69   TGPLGQSTVTAAENVNLWSGTASLLPLLGAFLADSFLGRYRTIVLASLIYVLGLSLLTFS  128

Query  430  TVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECK  609
            T+LP  +SD     G   + Q+IFFFF+LYLVALAQGGHKPCVQAFGADQFD  DP+ECK
Sbjct  129  TILPVTTSD-----GEVARPQLIFFFFSLYLVALAQGGHKPCVQAFGADQFDVNDPEECK  183

Query  610  AKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            A+SSFFNWWYF    G+ VTL+ILNYVQDN+ W LGF
Sbjct  184  ARSSFFNWWYFAFSAGLFVTLFILNYVQDNVGWVLGF  220



>ref|XP_003634604.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X2 [Vitis 
vinifera]
Length=572

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 174/219 (79%), Gaps = 6/219 (3%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E+P L +D+VDG  D KGRPA RS +G WRSA FIIGVEVAERF+Y GI +NLI+YLTG 
Sbjct  11   ESPLL-EDIVDGYTDHKGRPARRSTSGCWRSAYFIIGVEVAERFAYSGIQANLINYLTGR  69

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            LG S A AA NVN WSG   LLPL+GAF+ADS+LGRYRTI+I+S LY L LG LT+S VL
Sbjct  70   LGLSMATAAENVNTWSGTGGLLPLVGAFVADSYLGRYRTIIIASFLYILGLGLLTLSAVL  129

Query  439  PFES-SDSQNG----AGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQE  603
            P  S SD Q      + SPPQ Q+I FFF+LYLVA+ QGGHKPC QAFGADQFD ++P+E
Sbjct  130  PSPSPSDCQKSNQITSCSPPQLQIILFFFSLYLVAVGQGGHKPCNQAFGADQFDGRNPEE  189

Query  604  CKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            CKAKSSFFNWWYFG+CFG ++   +L+Y+Q+NL+WGLGF
Sbjct  190  CKAKSSFFNWWYFGLCFGTVINYSVLSYIQENLNWGLGF  228



>ref|XP_006376225.1| hypothetical protein POPTR_0013s11120g [Populus trichocarpa]
 gb|ERP54022.1| hypothetical protein POPTR_0013s11120g [Populus trichocarpa]
Length=567

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 159/221 (72%), Positives = 180/221 (81%), Gaps = 4/221 (2%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            S  +TP L  D+VDGSVD+K RPA RS +G WRSASFIIGVEVAERF+YYGISSNLI+YL
Sbjct  3    SSNQTPLLSYDIVDGSVDYKSRPAYRSNSGGWRSASFIIGVEVAERFAYYGISSNLITYL  62

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLGQSTA AA NVN W+G ASLLPLLGAF+ADSFLGRYRTI+ +SL+Y L LG LT+S
Sbjct  63   TGPLGQSTATAAENVNVWAGTASLLPLLGAFVADSFLGRYRTIIFASLIYILGLGLLTLS  122

Query  430  TVLPFESS----DSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDP  597
             +LP  ++     S N   SP  FQ+I FFFALYLVA+ Q GHKPCVQAFGADQFD QDP
Sbjct  123  ALLPSHAAATGFRSTNLPSSPVPFQLILFFFALYLVAIGQSGHKPCVQAFGADQFDGQDP  182

Query  598  QECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            QE KAKSSFFNWWY  MC G +VTL +LNY+QDNL+WGLGF
Sbjct  183  QESKAKSSFFNWWYCFMCAGTVVTLLVLNYIQDNLNWGLGF  223



>ref|XP_010062425.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Eucalyptus grandis]
 gb|KCW69565.1| hypothetical protein EUGRSUZ_F02994 [Eucalyptus grandis]
Length=579

 Score =   256 bits (654),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 163/224 (73%), Positives = 186/224 (83%), Gaps = 8/224 (4%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            +DAETP L QD VDG+VD+ GRP ARS +G WRSA FIIGVEVAERF+YYGI+SNLI+YL
Sbjct  13   NDAETPLL-QDAVDGAVDYGGRPVARSASGGWRSAGFIIGVEVAERFAYYGIASNLITYL  71

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLGQSTAAAAANVNAWSG ASL PL+GAF+ADSFLGRYRTIV+SSLLY L LG LT+S
Sbjct  72   TGPLGQSTAAAAANVNAWSGTASLSPLIGAFIADSFLGRYRTIVVSSLLYILGLGLLTLS  131

Query  430  TVLP-FESSDSQNGAGS------PPQFQVIffffalylvalaQGGHKPCVQAFGADQFDT  588
             +LP   +SD Q+ +        PP +Q+  FFF+LYLVA AQGGHKPCVQAFGADQFD 
Sbjct  132  AMLPSLGTSDCQSNSAIQNLPCFPPLYQLALFFFSLYLVAFAQGGHKPCVQAFGADQFDG  191

Query  589  QDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            Q+P+ECKAKSSFFNWWYF MC G   TL I+NY+QDNL+WGLGF
Sbjct  192  QNPEECKAKSSFFNWWYFCMCGGTFATLLIVNYIQDNLNWGLGF  235



>ref|XP_010665397.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Vitis vinifera]
Length=572

 Score =   256 bits (653),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 157/226 (69%), Positives = 182/226 (81%), Gaps = 6/226 (3%)
 Frame = +1

Query  58   TTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNL  237
            ++I    ETP L  D VDG  D KGRPA RS +G WRSASFIIGVEVAERF+YYGI SNL
Sbjct  4    SSISGGTETPLL-DDTVDGFADHKGRPARRSSSGGWRSASFIIGVEVAERFAYYGIGSNL  62

Query  238  ISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGF  417
            IS+L GPLGQSTAAAAANVN WSG ++LLPLLGAF+AD++LGRY TI+++SL+Y L LG 
Sbjct  63   ISFLIGPLGQSTAAAAANVNTWSGTSTLLPLLGAFVADTYLGRYYTIIVASLIYILGLGL  122

Query  418  LTISTVLPFES-----SDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQF  582
            L +S VLP  S      + +  + SPPQ QVI FFFALYLVA+ QGGHKPCVQAFGADQF
Sbjct  123  LAVSAVLPSASPSECQKNDEIASCSPPQLQVILFFFALYLVAVGQGGHKPCVQAFGADQF  182

Query  583  DTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            D QDP E K+KSSFFNWWYF MCFG ++TL+ILNY+QDNL+WGLGF
Sbjct  183  DGQDPVEGKSKSSFFNWWYFSMCFGTLITLFILNYIQDNLNWGLGF  228



>ref|XP_008240575.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Prunus mume]
Length=572

 Score =   255 bits (651),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 160/219 (73%), Positives = 178/219 (81%), Gaps = 5/219 (2%)
 Frame = +1

Query  76   AETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTG  255
             +TP L  DVV+G+VD+KGRP  RSR+G WRSA FIIGVEVAERF+YYGIS NLI++LTG
Sbjct  11   VQTPLL-DDVVEGAVDYKGRPVHRSRSGGWRSAWFIIGVEVAERFAYYGISCNLITFLTG  69

Query  256  PLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTV  435
            PLGQSTA AA NVN WSG ASLLPLLGAF+ADSFLGRYRTIV +SLLY L LG LT+S V
Sbjct  70   PLGQSTATAAENVNIWSGTASLLPLLGAFVADSFLGRYRTIVFASLLYILGLGLLTLSAV  129

Query  436  LP-FESSDSQN---GAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQE  603
            LP    SD Q          QFQV+FFFF+LYLVA+AQGGHKPCVQAFGADQFD  DP+E
Sbjct  130  LPSLTGSDCQKINQSTSCSSQFQVLFFFFSLYLVAVAQGGHKPCVQAFGADQFDASDPEE  189

Query  604  CKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            CKAKSSFFNWWYF +CFG   TL +L Y+QDNLSWGLGF
Sbjct  190  CKAKSSFFNWWYFSLCFGTTFTLILLTYIQDNLSWGLGF  228



>gb|KHG19841.1| hypothetical protein F383_03296 [Gossypium arboreum]
Length=571

 Score =   254 bits (649),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 159/223 (71%), Positives = 181/223 (81%), Gaps = 6/223 (3%)
 Frame = +1

Query  67   LSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            LS A+TP L  D +D S+D+KGRP  RS +G WRSASFII VE+AERF+YYGISSNLI+Y
Sbjct  6    LSTAQTPLL-DDTIDASLDYKGRPVRRSNSGGWRSASFIIAVEIAERFAYYGISSNLITY  64

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTGPLG+STAAAAA VNAWSG ASLLPLLGAF+ADSFLGRYRTI+++SLLYTL LG L++
Sbjct  65   LTGPLGESTAAAAAQVNAWSGAASLLPLLGAFIADSFLGRYRTIILASLLYTLGLGLLSL  124

Query  427  STVLPFESSDSQNGA-----GSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQ  591
            S  LP  S+            S  QFQVI FFF+LYLVA  QGGHKPCVQAFGADQFD Q
Sbjct  125  SAALPSVSNSGDQSTDNTILSSSAQFQVILFFFSLYLVAFGQGGHKPCVQAFGADQFDRQ  184

Query  592  DPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            DP+ECKA+SSFFNWWYFG+C G  +TLWIL Y+QDNLSW LGF
Sbjct  185  DPEECKAQSSFFNWWYFGICAGTFITLWILTYIQDNLSWTLGF  227



>ref|XP_009362432.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Pyrus x bretschneideri]
Length=557

 Score =   253 bits (646),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 176/216 (81%), Gaps = 13/216 (6%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            DA+TP L  DVVDG+VD KGRP  RSR+G WRSA FIIGVEVAERF+YYGI SNLI++LT
Sbjct  12   DAQTPLL-DDVVDGAVDHKGRPVHRSRSGGWRSARFIIGVEVAERFAYYGIGSNLITFLT  70

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQSTA AA NVN WSG ASLLPLLGAF+ADSFLGRYRTIV +SLLY L LG LT+S 
Sbjct  71   GPLGQSTATAAENVNIWSGTASLLPLLGAFVADSFLGRYRTIVFASLLYILGLGLLTLSA  130

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
            VL            S  + QVIFFFF+LYLVA+AQGGHKPCVQAFGADQFD  DP+ECKA
Sbjct  131  VL------------SSSEIQVIFFFFSLYLVAVAQGGHKPCVQAFGADQFDVSDPEECKA  178

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KSSFFNWWYFG+C G  VTL +L Y+QDNLSWGLGF
Sbjct  179  KSSFFNWWYFGLCAGTSVTLILLTYIQDNLSWGLGF  214



>emb|CBI39334.3| unnamed protein product [Vitis vinifera]
Length=755

 Score =   256 bits (653),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 174/219 (79%), Gaps = 6/219 (3%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E+P L +D+VDG  D KGRPA RS +G WRSA FIIGVEVAERF+Y GI +NLI+YLTG 
Sbjct  11   ESPLL-EDIVDGYTDHKGRPARRSTSGCWRSAYFIIGVEVAERFAYSGIQANLINYLTGR  69

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            LG S A AA NVN WSG   LLPL+GAF+ADS+LGRYRTI+I+S LY L LG LT+S VL
Sbjct  70   LGLSMATAAENVNTWSGTGGLLPLVGAFVADSYLGRYRTIIIASFLYILGLGLLTLSAVL  129

Query  439  PFES-SDSQNG----AGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQE  603
            P  S SD Q      + SPPQ Q+I FFF+LYLVA+ QGGHKPC QAFGADQFD ++P+E
Sbjct  130  PSPSPSDCQKSNQITSCSPPQLQIILFFFSLYLVAVGQGGHKPCNQAFGADQFDGRNPEE  189

Query  604  CKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            CKAKSSFFNWWYFG+CFG ++   +L+Y+Q+NL+WGLGF
Sbjct  190  CKAKSSFFNWWYFGLCFGTVINYSVLSYIQENLNWGLGF  228


 Score = 75.1 bits (183),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 72/111 (65%), Gaps = 4/111 (4%)
 Frame = +1

Query  178  FIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSF  357
            F  G EVAERF+Y+GI SNLI++ T  LGQS   A  +VN W+G  SL+PL+GAF+ADS+
Sbjct  618  FHHGAEVAERFAYFGIQSNLINFFTDRLGQSNPTAGESVNIWTGTGSLMPLVGAFVADSY  677

Query  358  LGRYRTIVISSLLYTLALGFLTISTVLPFESSDS----QNGAGSPPQFQVI  498
            LGRY TI+ +SLLY L L  LT+S V P  S  +           PQ Q+I
Sbjct  678  LGRYATIINASLLYILGLVLLTLSAVFPALSPSNCPKRNKTISCSPQLQII  728



>ref|XP_008339153.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X1 [Malus 
domestica]
Length=684

 Score =   253 bits (645),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 176/216 (81%), Gaps = 13/216 (6%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            DA+TP L  DVVDG+VD KGRP  RSR+G WRSA FIIGVEVAERF+YYGI SNLI++LT
Sbjct  12   DAQTPLL-DDVVDGAVDHKGRPVHRSRSGGWRSARFIIGVEVAERFAYYGIGSNLITFLT  70

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQSTA AA NVN WSG ASLLPLLGAF+ADSFLGRYRTIV +SLLY L LG LT+S 
Sbjct  71   GPLGQSTATAAENVNIWSGTASLLPLLGAFVADSFLGRYRTIVYASLLYILGLGLLTLSA  130

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
            VL            S  + QVIFFFF+LYLVA+AQGGHKPCVQAFGADQFD  DP+ECKA
Sbjct  131  VL------------SSSEIQVIFFFFSLYLVAVAQGGHKPCVQAFGADQFDVSDPEECKA  178

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KSSFFNWWYFG+C G  VTL +L Y+QDNLSWGLGF
Sbjct  179  KSSFFNWWYFGLCAGTSVTLILLTYIQDNLSWGLGF  214


 Score =   131 bits (329),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 90/109 (83%), Gaps = 2/109 (2%)
 Frame = +1

Query  112  GSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaan  291
            G+VD KG P  R R+G WRSA FIIGVE+AERF+YYGISSNLI++LTGPLGQST  AA N
Sbjct  556  GTVDHKGXPVHRXRSGGWRSARFIIGVELAERFAYYGISSNLITFLTGPLGQSTVTAAEN  615

Query  292  vnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            VN WSG ASLLPLLGAF+ADSFLGRYRTIV +SLLY L    L +ST+L
Sbjct  616  VNIWSGTASLLPLLGAFVADSFLGRYRTIVFASLLYILVR--LPLSTIL  662



>ref|XP_008339154.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X2 [Malus 
domestica]
Length=676

 Score =   253 bits (645),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 160/216 (74%), Positives = 176/216 (81%), Gaps = 13/216 (6%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            DA+TP L  DVVDG+VD KGRP  RSR+G WRSA FIIGVEVAERF+YYGI SNLI++LT
Sbjct  12   DAQTPLL-DDVVDGAVDHKGRPVHRSRSGGWRSARFIIGVEVAERFAYYGIGSNLITFLT  70

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQSTA AA NVN WSG ASLLPLLGAF+ADSFLGRYRTIV +SLLY L LG LT+S 
Sbjct  71   GPLGQSTATAAENVNIWSGTASLLPLLGAFVADSFLGRYRTIVYASLLYILGLGLLTLSA  130

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
            VL            S  + QVIFFFF+LYLVA+AQGGHKPCVQAFGADQFD  DP+ECKA
Sbjct  131  VL------------SSSEIQVIFFFFSLYLVAVAQGGHKPCVQAFGADQFDVSDPEECKA  178

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KSSFFNWWYFG+C G  VTL +L Y+QDNLSWGLGF
Sbjct  179  KSSFFNWWYFGLCAGTSVTLILLTYIQDNLSWGLGF  214


 Score =   137 bits (345),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 85/120 (71%), Positives = 97/120 (81%), Gaps = 3/120 (3%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            +TP L  D V+G+VD KG P  R R+G WRSA FIIGVE+AERF+YYGISSNLI++LTGP
Sbjct  538  QTPLL-DDGVEGTVDHKGXPVHRXRSGGWRSARFIIGVELAERFAYYGISSNLITFLTGP  596

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            LGQST  AA NVN WSG ASLLPLLGAF+ADSFLGRYRTIV +SLLY L    L +ST+L
Sbjct  597  LGQSTVTAAENVNIWSGTASLLPLLGAFVADSFLGRYRTIVFASLLYILVR--LPLSTIL  654



>emb|CBI39328.3| unnamed protein product [Vitis vinifera]
Length=527

 Score =   249 bits (635),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 172/216 (80%), Gaps = 1/216 (0%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            D+ETPFL +D V+G VD++G PA RSR+G WRSASFIIGVE+AER +YYGIS NLISYLT
Sbjct  9    DSETPFL-EDAVEGVVDYRGVPAKRSRSGGWRSASFIIGVELAERIAYYGISFNLISYLT  67

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQS A AA NVN +SG   LLPLLGAF+ADSFLGRYRTIVI+SLLY L LG LT+S 
Sbjct  68   GPLGQSMAVAAQNVNTFSGAGCLLPLLGAFVADSFLGRYRTIVIASLLYILGLGLLTLSA  127

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
            +LP           +PPQFQV+ FFF+LYLV + Q GHKPC QAFGADQFD Q P+ECKA
Sbjct  128  MLPSLFPSFCQNIDNPPQFQVVLFFFSLYLVTVGQSGHKPCTQAFGADQFDGQHPEECKA  187

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KSSFFNWWYF +C G+ V   IL+Y+Q+NL+W LGF
Sbjct  188  KSSFFNWWYFALCSGISVAFLILSYIQENLNWVLGF  223



>ref|XP_007020109.1| Major facilitator superfamily protein, putative isoform 2 [Theobroma 
cacao]
 gb|EOY17334.1| Major facilitator superfamily protein, putative isoform 2 [Theobroma 
cacao]
Length=552

 Score =   249 bits (636),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 137/222 (62%), Positives = 171/222 (77%), Gaps = 5/222 (2%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            +  +TPFL  + ++ +VD+KGRPA ++ +G WRSASF+I  EVAERF+YYGISSNLI+YL
Sbjct  9    TQTQTPFLESETLNSTVDYKGRPAQKATSGGWRSASFLIAAEVAERFAYYGISSNLITYL  68

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLG ST++AA NVNAW G   LLP +GA++ADSFLG YRTI ISS++Y L LG LT+S
Sbjct  69   TGPLGLSTSSAAENVNAWLGTDLLLPFIGAYVADSFLGHYRTIFISSIIYVLGLGLLTVS  128

Query  430  TVLPFESSDSQNGAG-----SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQD  594
              LP  ++ S   A      SP Q QV  FFF+LYL+A+  GG KPC++AFGADQFD +D
Sbjct  129  ATLPSSNACSYPNANTVKSCSPSQLQVTVFFFSLYLIAIGLGGQKPCIEAFGADQFDGED  188

Query  595  PQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            P+E  AKSSFFNWW+FG C GV+V+L IL Y+QDNLSWGLGF
Sbjct  189  PEERNAKSSFFNWWFFGACAGVLVSLLILVYIQDNLSWGLGF  230



>ref|XP_010683224.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Beta vulgaris 
subsp. vulgaris]
Length=576

 Score =   249 bits (637),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 136/224 (61%), Positives = 172/224 (77%), Gaps = 7/224 (3%)
 Frame = +1

Query  70   SDAETPFL--HQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLIS  243
            S++  P L    D+VDG+VD+KGRPA R++ GRW+SASFIIG+E+AER +YYGI+SNLIS
Sbjct  11   SNSRIPLLLSEGDIVDGTVDYKGRPAIRTKHGRWKSASFIIGMEIAERIAYYGITSNLIS  70

Query  244  YLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLT  423
            YLTGPLG+STA+AAANVNAW+G   L P++GA +ADSFLGRY TIV+SS +Y L L  LT
Sbjct  71   YLTGPLGESTASAAANVNAWTGFGCLFPVVGAIVADSFLGRYLTIVMSSFIYILGLALLT  130

Query  424  ISTVLPFESSDSQNGAG-----SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDT  588
            +S +LP+ SS +            P FQ+I  FF+LYLV++ Q GH+PCVQAFGADQFD 
Sbjct  131  LSAILPYTSSVNYKKTTIGMLCDSPHFQIISIFFSLYLVSIGQSGHRPCVQAFGADQFDG  190

Query  589  QDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            Q+  E KAKSSFFNWWY GMC G ++ L ++NY+QDN+ WG GF
Sbjct  191  QNFHESKAKSSFFNWWYMGMCLGPLLVLSVINYIQDNVGWGFGF  234



>ref|XP_010665395.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Vitis vinifera]
Length=570

 Score =   249 bits (636),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 172/216 (80%), Gaps = 1/216 (0%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            D+ETPFL +D V+G VD++G PA RSR+G WRSASFIIGVE+AER +YYGIS NLISYLT
Sbjct  9    DSETPFL-EDAVEGVVDYRGVPAKRSRSGGWRSASFIIGVELAERIAYYGISFNLISYLT  67

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQS A AA NVN +SG   LLPLLGAF+ADSFLGRYRTIVI+SLLY L LG LT+S 
Sbjct  68   GPLGQSMAVAAQNVNTFSGAGCLLPLLGAFVADSFLGRYRTIVIASLLYILGLGLLTLSA  127

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
            +LP           +PPQFQV+ FFF+LYLV + Q GHKPC QAFGADQFD Q P+ECKA
Sbjct  128  MLPSLIPSFCQNIDNPPQFQVVLFFFSLYLVTIGQSGHKPCTQAFGADQFDGQHPEECKA  187

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KSSFFNWWYF +C G+ V   IL+Y+Q+NL+W LGF
Sbjct  188  KSSFFNWWYFALCSGISVAFLILSYIQENLNWVLGF  223



>ref|XP_007020104.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY17329.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=574

 Score =   249 bits (636),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 150/231 (65%), Positives = 178/231 (77%), Gaps = 7/231 (3%)
 Frame = +1

Query  43   MAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYG  222
            MA   TT   + + P L + VV+GSVD KG PA RS +G WRSASFII VEVAERF+ +G
Sbjct  1    MAIVSTT--CNTQDPLLEETVVNGSVDCKGCPARRSTSGGWRSASFIIAVEVAERFACFG  58

Query  223  ISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYT  402
            ISSNLI+YLTGPLGQSTA AA NVNAWSG A+LLPLLGAF+AD++LGRYRTI+ISSL+Y 
Sbjct  59   ISSNLITYLTGPLGQSTATAAENVNAWSGTATLLPLLGAFVADAYLGRYRTIIISSLIYA  118

Query  403  LALGFLTISTVLPFESS-DSQN----GAGSPPQFQVIffffalylvalaQGGHKPCVQAF  567
            L LG LT+S +L   S+ D QN     + S PQ  V  F F+LYLVA+ QGGHKPCVQAF
Sbjct  119  LGLGLLTLSAMLTSLSNLDCQNTNNITSCSTPQLLVFSFIFSLYLVAIGQGGHKPCVQAF  178

Query  568  GADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            GADQFD  DP+E  A+SSFFNWWYF +  GV+++L I+ Y+QDNLSW LGF
Sbjct  179  GADQFDGNDPKESIARSSFFNWWYFTLSTGVLLSLVIIVYIQDNLSWALGF  229



>ref|XP_011001079.1| PREDICTED: uncharacterized protein LOC105108458 [Populus euphratica]
Length=1132

 Score =   256 bits (655),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 152/223 (68%), Positives = 172/223 (77%), Gaps = 8/223 (4%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            SD +TP LH+ VVDG VD+ G P  RS +G WRSA FIIGVEVAER +YYGISSNLI+YL
Sbjct  30   SDTQTPLLHE-VVDGCVDYNGSPVYRSISGGWRSAFFIIGVEVAERSAYYGISSNLITYL  88

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TG LGQSTA AA NVN WSG   LLPLLGAF+ADSFLGRYRTIV++S +Y L L  LT+S
Sbjct  89   TGTLGQSTATAAENVNVWSGTTMLLPLLGAFIADSFLGRYRTIVVASCIYILGLSLLTLS  148

Query  430  TVLPFESSDS------QNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQ  591
             VLP  S DS        G  SP   QVI FFF+LY+VA+ QGGHKPCVQAFGADQFD Q
Sbjct  149  AVLP-SSRDSGCQTADAIGLCSPDHRQVIVFFFSLYIVAIGQGGHKPCVQAFGADQFDGQ  207

Query  592  DPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             P+E KAKSSFFNWWYF M  G+++ L ILNY+QDNL+WGLGF
Sbjct  208  HPEESKAKSSFFNWWYFSMNSGMVIALLILNYIQDNLNWGLGF  250


 Score =   218 bits (556),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 134/218 (61%), Positives = 160/218 (73%), Gaps = 8/218 (4%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            ETP L    VD SVD+KG     S +G W+ A  IIGVEVAER +Y+GIS NLI+YLTGP
Sbjct  576  ETPLLLPCAVDSSVDYKGF----SNSGGWKCAFLIIGVEVAERSAYFGISGNLITYLTGP  631

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            LGQST  AA N+N WSG A LLPLLGAF+ADSFLGRYRTI++++ +Y L L  LT+S VL
Sbjct  632  LGQSTVTAAENLNLWSGTAWLLPLLGAFVADSFLGRYRTIIVAASMYILGLSLLTLSAVL  691

Query  439  PFESSDSQNGAGS----PPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQEC  606
            P   ++  + A +     P   +I FFFALYLVA  QGG +PCVQAFGADQFD QDP+E 
Sbjct  692  PSVRANDCHSADTIQLCSPDPSLILFFFALYLVAFGQGGFRPCVQAFGADQFDGQDPEER  751

Query  607  KAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            K++SSFFNWW FGM  GV+V L  LNY+QDNL+WG GF
Sbjct  752  KSRSSFFNWWNFGMNAGVIVILPFLNYIQDNLNWGFGF  789



>ref|XP_011464750.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Fragaria vesca 
subsp. vesca]
Length=552

 Score =   248 bits (634),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 146/216 (68%), Positives = 168/216 (78%), Gaps = 13/216 (6%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            + +TP L  D+VDG+VDF G P  RS +G WR+ASFII VEVAER +YYGISSNLIS+LT
Sbjct  6    ETQTPLL-DDIVDGAVDFHGHPVRRSTSGGWRAASFIIWVEVAERVAYYGISSNLISFLT  64

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQS A AA NVN WSG ASLLPLLGAF+ADSFLGRYRTI+ +SL+Y L LG LT+S 
Sbjct  65   GPLGQSVATAAQNVNIWSGTASLLPLLGAFVADSFLGRYRTILAASLVYILGLGLLTVSA  124

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
            VLP              + QV+ FFF LYLVA+ QGGHKPCVQAFGADQFD   P E KA
Sbjct  125  VLP------------SSELQVLMFFFCLYLVAVGQGGHKPCVQAFGADQFDRNYPDESKA  172

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KSSFFNWWYFG+C G ++TL +L+Y+QDNLSWGLGF
Sbjct  173  KSSFFNWWYFGICAGPLLTLAVLDYIQDNLSWGLGF  208



>ref|XP_012084632.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Jatropha curcas]
 gb|KDP27340.1| hypothetical protein JCGZ_20272 [Jatropha curcas]
Length=569

 Score =   249 bits (636),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 154/223 (69%), Positives = 179/223 (80%), Gaps = 7/223 (3%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            SD +TP L+ D V+ +VD+KGRP  RSR+G WRSASFIIGVE+AERF+YYGI+SNLI+YL
Sbjct  8    SDIQTPLLY-DTVEPAVDYKGRPVFRSRSGGWRSASFIIGVEIAERFAYYGIASNLITYL  66

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TG LGQSTA AA NVNAWSG ASLLPL GAF+ADSFLGRYRTIV++SL+Y L LG LT+S
Sbjct  67   TGSLGQSTATAAENVNAWSGTASLLPLFGAFVADSFLGRYRTIVVASLIYILGLGLLTLS  126

Query  430  TVLPFESSDSQN------GAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQ  591
             +L    S S         + SP   QV+ FFF+LYLVAL QGGHKPCVQAFGADQFD Q
Sbjct  127  AMLASSHSASDCPSTNIIKSCSPSSCQVVLFFFSLYLVALGQGGHKPCVQAFGADQFDGQ  186

Query  592  DPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            DP+ECK+KSSFFNWWYF MC G +V+L  LNY+QDNL+W LGF
Sbjct  187  DPEECKSKSSFFNWWYFCMCGGTLVSLLFLNYIQDNLNWALGF  229



>ref|XP_010665399.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Vitis vinifera]
Length=570

 Score =   249 bits (635),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 172/216 (80%), Gaps = 1/216 (0%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            D+ETPFL +D V+G VD++G PA RSR+G WRSASFIIGVE+AER +YYGIS NLISYLT
Sbjct  9    DSETPFL-EDAVEGVVDYRGVPAKRSRSGGWRSASFIIGVELAERIAYYGISFNLISYLT  67

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQS A AA NVN +SG   LLPLLGAF+ADSFLGRYRTIVI+SLLY L LG LT+S 
Sbjct  68   GPLGQSMAVAAQNVNTFSGAGCLLPLLGAFVADSFLGRYRTIVIASLLYILGLGLLTLSA  127

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
            +LP           +PPQFQV+ FFF+LYLV + Q GHKPC QAFGADQFD Q P+ECKA
Sbjct  128  MLPSLFPSFCQNIDNPPQFQVVLFFFSLYLVTVGQSGHKPCTQAFGADQFDGQHPEECKA  187

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KSSFFNWWYF +C G+ V   IL+Y+Q+NL+W LGF
Sbjct  188  KSSFFNWWYFALCSGISVAFLILSYIQENLNWVLGF  223



>ref|XP_011001076.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Populus euphratica]
Length=567

 Score =   249 bits (635),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 157/221 (71%), Positives = 178/221 (81%), Gaps = 10/221 (5%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            +TP L  D+VDGSVD KGRPA RS +G WRSASFIIGVEVAERF+YYGISSNLI+YLTGP
Sbjct  6    QTPLLSYDIVDGSVDSKGRPAYRSNSGGWRSASFIIGVEVAERFAYYGISSNLITYLTGP  65

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            LGQSTA AA NVN W+G  SLLPLLGAF+ADSFLGRYRTI+ +SL+Y L LG LT+S +L
Sbjct  66   LGQSTATAAENVNVWAGTVSLLPLLGAFVADSFLGRYRTIIFASLIYILGLGLLTLSALL  125

Query  439  P-------FESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDP  597
            P       F S+D  +   SP  FQ+I FFFALYLVA+ Q GHKPCVQAFGADQFD QDP
Sbjct  126  PSGAAVAGFRSTDLPS---SPVPFQLILFFFALYLVAVGQSGHKPCVQAFGADQFDGQDP  182

Query  598  QECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             E KAKSSFFNWWY  MC G ++TL +LNY+QDNL+WGLGF
Sbjct  183  LESKAKSSFFNWWYCFMCAGTVITLLVLNYIQDNLNWGLGF  223



>ref|XP_007204887.1| hypothetical protein PRUPE_ppa003472mg [Prunus persica]
 gb|EMJ06086.1| hypothetical protein PRUPE_ppa003472mg [Prunus persica]
Length=572

 Score =   248 bits (634),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 158/219 (72%), Positives = 176/219 (80%), Gaps = 5/219 (2%)
 Frame = +1

Query  76   AETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTG  255
             +TP L  DVV+G+VD+KG P  RSR+G WRSA FIIGVEVAERF+YYGIS NLI++LTG
Sbjct  11   VQTPLL-DDVVEGAVDYKGLPVHRSRSGGWRSAWFIIGVEVAERFAYYGISCNLITFLTG  69

Query  256  PLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTV  435
            PLGQSTA AA NVN WSG ASLLPLLGAF+ADSFLGRYRTIV +SLLY L LG LT+S V
Sbjct  70   PLGQSTATAAENVNIWSGTASLLPLLGAFVADSFLGRYRTIVFASLLYILGLGLLTLSAV  129

Query  436  LP-FESSDSQN---GAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQE  603
            LP    S  Q          QFQV+FFFF+LYLVA+AQGGHKPCVQAFGADQFD  DP+E
Sbjct  130  LPSLTGSYCQKFNQSTSCSSQFQVLFFFFSLYLVAVAQGGHKPCVQAFGADQFDASDPEE  189

Query  604  CKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            CKAKSSFFNWWYF +CFG   TL +L Y+QDNLSWGLGF
Sbjct  190  CKAKSSFFNWWYFSLCFGTTFTLILLTYIQDNLSWGLGF  228



>ref|XP_007020105.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY17330.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=615

 Score =   249 bits (637),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 150/231 (65%), Positives = 178/231 (77%), Gaps = 7/231 (3%)
 Frame = +1

Query  43   MAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYG  222
            MA   TT   + + P L + VV+GSVD KG PA RS +G WRSASFII VEVAERF+ +G
Sbjct  1    MAIVSTT--CNTQDPLLEETVVNGSVDCKGCPARRSTSGGWRSASFIIAVEVAERFACFG  58

Query  223  ISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYT  402
            ISSNLI+YLTGPLGQSTA AA NVNAWSG A+LLPLLGAF+AD++LGRYRTI+ISSL+Y 
Sbjct  59   ISSNLITYLTGPLGQSTATAAENVNAWSGTATLLPLLGAFVADAYLGRYRTIIISSLIYA  118

Query  403  LALGFLTISTVLPFESS-DSQN----GAGSPPQFQVIffffalylvalaQGGHKPCVQAF  567
            L LG LT+S +L   S+ D QN     + S PQ  V  F F+LYLVA+ QGGHKPCVQAF
Sbjct  119  LGLGLLTLSAMLTSLSNLDCQNTNNITSCSTPQLLVFSFIFSLYLVAIGQGGHKPCVQAF  178

Query  568  GADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            GADQFD  DP+E  A+SSFFNWWYF +  GV+++L I+ Y+QDNLSW LGF
Sbjct  179  GADQFDGNDPKESIARSSFFNWWYFTLSTGVLLSLVIIVYIQDNLSWALGF  229



>ref|XP_010665405.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X1 [Vitis 
vinifera]
Length=584

 Score =   248 bits (632),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 146/231 (63%), Positives = 174/231 (75%), Gaps = 18/231 (8%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFII------------GVEVAERFSYYG  222
            E+P L +D+VDG  D KGRPA RS +G WRSA FII            GVEVAERF+Y G
Sbjct  11   ESPLL-EDIVDGYTDHKGRPARRSTSGCWRSAYFIIASSYRPRLYMEAGVEVAERFAYSG  69

Query  223  ISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYT  402
            I +NLI+YLTG LG S A AA NVN WSG   LLPL+GAF+ADS+LGRYRTI+I+S LY 
Sbjct  70   IQANLINYLTGRLGLSMATAAENVNTWSGTGGLLPLVGAFVADSYLGRYRTIIIASFLYI  129

Query  403  LALGFLTISTVLPFES-SDSQNG----AGSPPQFQVIffffalylvalaQGGHKPCVQAF  567
            L LG LT+S VLP  S SD Q      + SPPQ Q+I FFF+LYLVA+ QGGHKPC QAF
Sbjct  130  LGLGLLTLSAVLPSPSPSDCQKSNQITSCSPPQLQIILFFFSLYLVAVGQGGHKPCNQAF  189

Query  568  GADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            GADQFD ++P+ECKAKSSFFNWWYFG+CFG ++   +L+Y+Q+NL+WGLGF
Sbjct  190  GADQFDGRNPEECKAKSSFFNWWYFGLCFGTVINYSVLSYIQENLNWGLGF  240



>emb|CAN75422.1| hypothetical protein VITISV_011767 [Vitis vinifera]
Length=584

 Score =   247 bits (631),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 146/231 (63%), Positives = 174/231 (75%), Gaps = 18/231 (8%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFII------------GVEVAERFSYYG  222
            E+P L +D+VDG  D KGRPA RS +G WRSA FII            GVEVAERF+Y G
Sbjct  11   ESPLL-EDIVDGYTDHKGRPARRSTSGCWRSAYFIIASSYRPRLYMXAGVEVAERFAYSG  69

Query  223  ISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYT  402
            I +NLI+YLTG LG S A AA NVN WSG   LLPL+GAF+ADS+LGRYRTI+I+S LY 
Sbjct  70   IQANLINYLTGRLGLSMATAAENVNTWSGTGGLLPLVGAFVADSYLGRYRTIIIASFLYI  129

Query  403  LALGFLTISTVLPFES-SDSQNG----AGSPPQFQVIffffalylvalaQGGHKPCVQAF  567
            L LG LT+S VLP  S SD Q      + SPPQ Q+I FFF+LYLVA+ QGGHKPC QAF
Sbjct  130  LGLGLLTLSAVLPSPSPSDCQKSNQITSCSPPQLQIILFFFSLYLVAVGQGGHKPCNQAF  189

Query  568  GADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            GADQFD ++P+ECKAKSSFFNWWYFG+CFG ++   +L+Y+Q+NL+WGLGF
Sbjct  190  GADQFDGRNPEECKAKSSFFNWWYFGLCFGTVINYSVLSYIQENLNWGLGF  240



>emb|CAN66299.1| hypothetical protein VITISV_013344 [Vitis vinifera]
Length=570

 Score =   246 bits (628),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 171/216 (79%), Gaps = 1/216 (0%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            D+ETPFL +D V+G VD++G PA RSR+G WRSASFIIGVE+AER +YYGIS NLISYLT
Sbjct  9    DSETPFL-EDAVEGVVDYRGVPAKRSRSGGWRSASFIIGVELAERIAYYGISFNLISYLT  67

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQS A AA NVN +SG   LLPLLGAF+ADSFLGRYRTIVI+SLLY L LG LT+S 
Sbjct  68   GPLGQSMAVAAQNVNTFSGAGCLLPLLGAFVADSFLGRYRTIVIASLLYILGLGLLTLSA  127

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
            +LP           +PPQFQV+ FFF+LYLV + Q GHKPC QAFGADQFD Q P+ECKA
Sbjct  128  MLPSLFPSFCQNIDNPPQFQVVLFFFSLYLVTVGQSGHKPCTQAFGADQFDGQHPEECKA  187

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KSSFFNWWYF +C G+ V   IL+Y+Q+ L+W LGF
Sbjct  188  KSSFFNWWYFALCSGISVAFLILSYIQEXLNWVLGF  223



>ref|XP_002266023.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 [Vitis vinifera]
 emb|CBI39324.3| unnamed protein product [Vitis vinifera]
Length=572

 Score =   246 bits (628),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 157/231 (68%), Positives = 181/231 (78%), Gaps = 8/231 (3%)
 Frame = +1

Query  43   MAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYG  222
            MA +G  IL  A TP L  D +D +VD+KGRPA R  +GRWRSA FIIGVEVAERF+YYG
Sbjct  1    MAHSG--ILPHAHTPLL-DDTLDSAVDYKGRPARRCSSGRWRSACFIIGVEVAERFAYYG  57

Query  223  ISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYT  402
            I SNLI+YLTG LGQS A AA NVN WSG AS+LPLLGAF+ADS++GRY TIVI+SLLY 
Sbjct  58   IESNLINYLTGRLGQSMATAAQNVNTWSGTASMLPLLGAFVADSYVGRYPTIVIASLLYI  117

Query  403  LALGFLTISTVLP-FESS----DSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAF  567
            L LG LT+S VLP F  S    D +  + SPP  QVI FFFALYLVA+ QGGHKPCVQAF
Sbjct  118  LGLGLLTVSAVLPSFNPSHCQTDKEISSCSPPMLQVILFFFALYLVAVGQGGHKPCVQAF  177

Query  568  GADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            GADQFD ++P+E KAKSSFFNWWYF M  G+++   ILNY+QDNL+WGLGF
Sbjct  178  GADQFDGKNPEESKAKSSFFNWWYFCMSGGILINSSILNYIQDNLNWGLGF  228



>ref|XP_009415773.1| PREDICTED: uncharacterized protein LOC103996574 [Musa acuminata 
subsp. malaccensis]
Length=1023

 Score =   252 bits (643),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 168/201 (84%), Gaps = 0/201 (0%)
 Frame = +1

Query  118  VDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanvn  297
            VD++GRPA RS +G W SA FIIGVE+AERF++YGISSNLISYLTGPLG+S A AAA +N
Sbjct  5    VDYRGRPANRSTSGGWTSALFIIGVEIAERFAFYGISSNLISYLTGPLGESMAMAAAALN  64

Query  298  awsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSDSQNGAGS  477
            AW+GVAS+LPLLGAF+ADS+LGRYRTIVI+SLLY L LG LT+S++LP         A  
Sbjct  65   AWNGVASMLPLLGAFVADSYLGRYRTIVIASLLYILGLGTLTLSSMLPIFHPAKCGTACP  124

Query  478  PPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYFGMCFG  657
            PP+ QV  F+ +LYLVA+AQGGHKPCVQAFGADQFD  DPQE  A+SSFFNWWYFG+C G
Sbjct  125  PPRLQVALFYVSLYLVAIAQGGHKPCVQAFGADQFDQNDPQERVARSSFFNWWYFGICCG  184

Query  658  VMVTLWILNYVQDNLSWGLGF  720
            V+VTL IL+YVQDN+ WGLGF
Sbjct  185  VVVTLVILSYVQDNIGWGLGF  205


 Score =   246 bits (627),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 141/201 (70%), Positives = 166/201 (83%), Gaps = 0/201 (0%)
 Frame = +1

Query  118  VDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanvn  297
            VD++GRPA RS +G W SA FII VE+AERF++YGISSNLISYLTGPLG+STA AAA +N
Sbjct  512  VDYRGRPANRSTSGGWTSALFIIVVEIAERFAFYGISSNLISYLTGPLGESTAMAAAALN  571

Query  298  awsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSDSQNGAGS  477
            AW+GVAS+LPLLGAF+ADS+LGRYRTIVI++LLY L LG LT+S++L          A  
Sbjct  572  AWNGVASMLPLLGAFVADSYLGRYRTIVIATLLYILGLGTLTLSSMLRIVHPAKCGTACP  631

Query  478  PPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYFGMCFG  657
            PP  QV  F+ +LYLVA+AQGGHKPCVQAFGADQFD  DPQE  A+SSFFNWWYFG+C G
Sbjct  632  PPPLQVALFYVSLYLVAIAQGGHKPCVQAFGADQFDQNDPQERVARSSFFNWWYFGICCG  691

Query  658  VMVTLWILNYVQDNLSWGLGF  720
            V+VTL IL+YVQDN+ WGLGF
Sbjct  692  VVVTLVILSYVQDNIGWGLGF  712



>emb|CAN71099.1| hypothetical protein VITISV_000973 [Vitis vinifera]
Length=572

 Score =   245 bits (626),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 177/219 (81%), Gaps = 6/219 (3%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E+P L +D VDG  D KGRPA RS +G WRSA FIIGVEVAERF+YYGI +NLI+YLTG 
Sbjct  11   ESPLL-EDTVDGYTDHKGRPARRSTSGGWRSAYFIIGVEVAERFAYYGIQANLINYLTGR  69

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            LGQS A+AA NVN W+G  SLLPL+GAF+ADS+LGRYRTI+I+SLLY L LG LT+S VL
Sbjct  70   LGQSIASAAENVNTWTGTGSLLPLVGAFVADSYLGRYRTIIIASLLYILGLGLLTLSAVL  129

Query  439  PFES-----SDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQE  603
            P  S       +Q  + SPPQ Q+I FFF+LYLVA+ QGGHKPC QAFGADQFD ++P+E
Sbjct  130  PSPSPSDCKESNQITSCSPPQLQIILFFFSLYLVAVGQGGHKPCTQAFGADQFDGRNPEE  189

Query  604  CKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            CKAKSSFFNWWYFG+CFG ++T  +L Y+Q+NL+WGLGF
Sbjct  190  CKAKSSFFNWWYFGLCFGTVITYSVLXYIQENLNWGLGF  228



>gb|KGN52719.1| hypothetical protein Csa_5G652250 [Cucumis sativus]
Length=313

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 163/216 (75%), Gaps = 8/216 (4%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            +  TP L Q  V+G+VDFKGRP  R  +G WRSASF+IGVEVAERF+YYGI SNLI+YLT
Sbjct  2    ELPTPLLSQ-TVEGAVDFKGRPVLRFCSGGWRSASFMIGVEVAERFAYYGIGSNLITYLT  60

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQS A AA  VN WSG++ LL LLGAFLADSF GRYRTI+ SS +Y L L  L+ S 
Sbjct  61   GPLGQSVATAAETVNIWSGISMLLTLLGAFLADSFFGRYRTILFSSAIYVLGLSLLSFSA  120

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
            +LP  ++ SQN      QFQ++ FF +LYL+ + QGGHKPCVQAFGADQFD   PQE K+
Sbjct  121  MLP--TTSSQNS-----QFQLLLFFVSLYLIGIGQGGHKPCVQAFGADQFDALHPQEAKS  173

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KSSFFNWW+FG+C G  V + ++ Y ++NLSW LGF
Sbjct  174  KSSFFNWWFFGICAGTFVAILLVTYTEENLSWSLGF  209



>ref|XP_011464751.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Fragaria vesca 
subsp. vesca]
Length=557

 Score =   244 bits (623),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 150/213 (70%), Positives = 171/213 (80%), Gaps = 12/213 (6%)
 Frame = +1

Query  82   TPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPL  261
            TP L  DVVDG+ D+KG PA RS +G WRSASFIIGVEVAERF+YYGISSNLI++LTGPL
Sbjct  13   TPLLEDDVVDGAADYKGLPARRSTSGGWRSASFIIGVEVAERFAYYGISSNLITFLTGPL  72

Query  262  GQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLP  441
            GQSTA AA NVN WSG ASLLPLLG+ +ADSFLGRYRTI+ +SLLY L LG LT+S ++P
Sbjct  73   GQSTATAAENVNIWSGTASLLPLLGSVVADSFLGRYRTIIAASLLYILGLGLLTLSAMIP  132

Query  442  FESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSS  621
                          Q QV+ FFF+LYLVA  QGGHKPCVQAFGADQFD QDP+ECKAKSS
Sbjct  133  ------------SSQLQVLLFFFSLYLVAFGQGGHKPCVQAFGADQFDGQDPEECKAKSS  180

Query  622  FFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FFNWWYFG+C G + T+ +L Y+QDNLSWGLGF
Sbjct  181  FFNWWYFGVCAGGLFTVSVLAYIQDNLSWGLGF  213



>emb|CBI39335.3| unnamed protein product [Vitis vinifera]
Length=687

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 148/219 (68%), Positives = 177/219 (81%), Gaps = 6/219 (3%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E+P L +D VDG  D KGRPA RS +G WRSA FIIGVEVAERF+YYGI +NLI+YLTG 
Sbjct  154  ESPLL-EDTVDGYTDHKGRPARRSTSGGWRSAYFIIGVEVAERFAYYGIQANLINYLTGR  212

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            LGQS A+AA NVN W+G  SLLPL+GAF+ADS+LGRYRTI+I+SLLY L LG LT+S VL
Sbjct  213  LGQSIASAAENVNTWTGTGSLLPLVGAFVADSYLGRYRTIIIASLLYILGLGLLTLSAVL  272

Query  439  PFES-----SDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQE  603
            P  S       +Q  + SPPQ Q+I FFF+LYLVA+ QGGHKPC QAFGADQFD ++P+E
Sbjct  273  PSPSPSDCKESNQITSCSPPQLQIILFFFSLYLVAVGQGGHKPCTQAFGADQFDGRNPEE  332

Query  604  CKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            CKAKSSFFNWWYFG+CFG ++T  +L Y+Q+NL+WGLGF
Sbjct  333  CKAKSSFFNWWYFGLCFGTVITYSVLTYIQENLNWGLGF  371



>ref|XP_010095893.1| putative peptide/nitrate transporter [Morus notabilis]
 gb|EXB62487.1| putative peptide/nitrate transporter [Morus notabilis]
Length=569

 Score =   244 bits (622),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 155/220 (70%), Positives = 180/220 (82%), Gaps = 8/220 (4%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            DAETP L     + +VD+KGRPA R  +G WRSA+FIIGVE+ ERF+YYGIS NLI YLT
Sbjct  13   DAETPMLE----NIAVDYKGRPAYRFSSGGWRSAAFIIGVEIGERFAYYGISGNLIMYLT  68

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPL QSTA+AAA+VNAW GVASLLPLLGAF+AD+FLGRYRTI +++LLY LALG LT+S 
Sbjct  69   GPLRQSTASAAASVNAWGGVASLLPLLGAFVADTFLGRYRTIALATLLYILALGLLTLSA  128

Query  433  VLPFES-SDSQNG---AGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQ  600
            VL   S SDSQ     + SPP FQVI FFF+LYLVA AQGGHKPC QAFGADQFD  DP+
Sbjct  129  VLLSSSGSDSQTKDIVSCSPPLFQVILFFFSLYLVAFAQGGHKPCTQAFGADQFDGDDPE  188

Query  601  ECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            ECK+KSSFFNWWY G+CFG MVT+ I++Y+Q+NLSW LGF
Sbjct  189  ECKSKSSFFNWWYLGVCFGAMVTIAIVSYIQENLSWALGF  228



>ref|XP_010911895.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Elaeis guineensis]
Length=558

 Score =   243 bits (620),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 140/221 (63%), Positives = 172/221 (78%), Gaps = 5/221 (2%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            DA+        V G+VD++G P +RS +G W +A FIIGVE+AERF++YGISSNLI+YLT
Sbjct  2    DADPLLRKSATVAGAVDYRGLPVSRSSSGGWSAALFIIGVEIAERFAFYGISSNLITYLT  61

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQSTAAAAA +N WSGVAS+LPLLGAF+ADS+LGR+RTI+++SLLY L LG LT S+
Sbjct  62   GPLGQSTAAAAAAINTWSGVASMLPLLGAFVADSYLGRFRTIILASLLYILGLGMLTFSS  121

Query  433  VLPFESSDS-----QNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDP  597
             LP     +      + A  P   QV FF+ +LYL+A AQGGHKPCVQAFGADQFD  DP
Sbjct  122  ALPSIRPSTCGDTMDHTACRPSPAQVAFFYSSLYLIAFAQGGHKPCVQAFGADQFDQNDP  181

Query  598  QECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +EC  KSSFFNWWYFG+C G +VTL +L+Y+QDN+SWGLGF
Sbjct  182  KECMDKSSFFNWWYFGLCGGTVVTLVVLSYIQDNISWGLGF  222



>gb|ABR32185.1| peptide transporter [Hakea actites]
Length=579

 Score =   243 bits (620),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 175/211 (83%), Gaps = 3/211 (1%)
 Frame = +1

Query  97   QDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTa  276
             D V+GS+D+KGRPA+RS TGRWRS+ FIIGVE+AERFSY GI++NLI+YLTGPLGQST 
Sbjct  20   NDTVEGSIDYKGRPASRSNTGRWRSSGFIIGVEIAERFSYCGIAANLITYLTGPLGQSTV  79

Query  277  aaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLP-FESS  453
             AA NV  WSGVAS+LPLLGA LAD +LGRYRTI+ +SLLY L LG LT++ ++P F +S
Sbjct  80   TAAVNVTTWSGVASMLPLLGASLADGYLGRYRTIIFASLLYILGLGLLTLAAMIPSFTAS  139

Query  454  DSQNGAGS--PPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFF  627
              QN   S  PP++Q+I FF +LYLVALAQGGHKPCVQAFGADQFD + P+E K++SSFF
Sbjct  140  HCQNSTTSCYPPEYQIILFFCSLYLVALAQGGHKPCVQAFGADQFDGKHPEEIKSRSSFF  199

Query  628  NWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            NWWYFGMC G++ +  IL YVQDNL+WGLGF
Sbjct  200  NWWYFGMCGGIVFSNLILTYVQDNLNWGLGF  230



>ref|XP_007020108.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY17333.1| Major facilitator superfamily protein, putative isoform 1 [Theobroma 
cacao]
Length=1036

 Score =   248 bits (634),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 137/222 (62%), Positives = 171/222 (77%), Gaps = 5/222 (2%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            +  +TPFL  + ++ +VD+KGRPA ++ +G WRSASF+I  EVAERF+YYGISSNLI+YL
Sbjct  9    TQTQTPFLESETLNSTVDYKGRPAQKATSGGWRSASFLIAAEVAERFAYYGISSNLITYL  68

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLG ST++AA NVNAW G   LLP +GA++ADSFLG YRTI ISS++Y L LG LT+S
Sbjct  69   TGPLGLSTSSAAENVNAWLGTDLLLPFIGAYVADSFLGHYRTIFISSIIYVLGLGLLTVS  128

Query  430  TVLPFESSDSQNGAG-----SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQD  594
              LP  ++ S   A      SP Q QV  FFF+LYL+A+  GG KPC++AFGADQFD +D
Sbjct  129  ATLPSSNACSYPNANTVKSCSPSQLQVTVFFFSLYLIAIGLGGQKPCIEAFGADQFDGED  188

Query  595  PQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            P+E  AKSSFFNWW+FG C GV+V+L IL Y+QDNLSWGLGF
Sbjct  189  PEERNAKSSFFNWWFFGACAGVLVSLLILVYIQDNLSWGLGF  230


 Score =   182 bits (463),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 143/184 (78%), Gaps = 4/184 (2%)
 Frame = +1

Query  94   HQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQST  273
             Q    G VD+ G P  RS +G W+SASFII VEVAERF+YYGI++NLI+YLTGPLG S 
Sbjct  531  QQQRCTGCVDYNGSPVFRSNSGGWKSASFIIAVEVAERFAYYGIANNLITYLTGPLGLSM  590

Query  274  aaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESS  453
            A AA NVNAWSGV SLLPLLGAF+ADSFLGRYRTI++SS +Y L LG LT++ +LP  S+
Sbjct  591  AVAAENVNAWSGVGSLLPLLGAFVADSFLGRYRTILLSSAIYILGLGLLTLAAMLPSLST  650

Query  454  ----DSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSS  621
                ++ +      Q QVI FFFALYLVA+ QGGHKPCVQAFGADQFD QDP+E KA+SS
Sbjct  651  SGCLNTNSNTLCSTQNQVILFFFALYLVAVGQGGHKPCVQAFGADQFDKQDPKESKARSS  710

Query  622  FFNW  633
            FFNW
Sbjct  711  FFNW  714



>ref|XP_010095904.1| putative peptide/nitrate transporter [Morus notabilis]
 gb|EXB62498.1| putative peptide/nitrate transporter [Morus notabilis]
Length=561

 Score =   242 bits (617),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 177/219 (81%), Gaps = 4/219 (2%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            ++ E PFL+ D VDG VD +G PA RS++G W SA FIIGVEVAERF+YYGI +NLISYL
Sbjct  3    NEDEIPFLN-DTVDGVVDHEGHPAPRSKSGGWTSAGFIIGVEVAERFAYYGIEANLISYL  61

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TG LGQSTAAAAANVNAW G ASLLPLLGAF+ADSFLGRYRTI++++LLY L L  LT+S
Sbjct  62   TGSLGQSTAAAAANVNAWGGAASLLPLLGAFVADSFLGRYRTIILANLLYILGLALLTLS  121

Query  430  TVLPFESSDSQNGAGSP--PQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQE  603
             +LP   S+ Q     P   Q QVI FF +LY+VA+AQGGHKPCVQAFGADQFD QD +E
Sbjct  122  AMLP-SISECQINQDVPCSSQIQVILFFVSLYIVAVAQGGHKPCVQAFGADQFDGQDSEE  180

Query  604  CKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            CKA+SSFFNWWYFG+C G  VT+ IL+YVQDN+SW LGF
Sbjct  181  CKARSSFFNWWYFGICLGSSVTVSILSYVQDNISWALGF  219



>gb|KEH29316.1| peptide/nitrate transporter plant, partial [Medicago truncatula]
Length=498

 Score =   240 bits (612),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 163/207 (79%), Gaps = 7/207 (3%)
 Frame = +1

Query  100  DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaa  279
            D+VDG+VD++G+PA RS++G WRSA FIIGVEVAER SYYGI  NLISYLTGPL QSTA 
Sbjct  15   DLVDGAVDYRGQPAIRSKSGYWRSAWFIIGVEVAERVSYYGIQGNLISYLTGPLKQSTAK  74

Query  280  aaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSDS  459
            AA NVN W G ASLLPL GAF+ADSFLGRYRTI+++SL+Y + LG LT+S +LP  +  S
Sbjct  75   AAENVNVWVGTASLLPLFGAFIADSFLGRYRTIILASLIYIMGLGLLTLSAMLPSITFCS  134

Query  460  QNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWY  639
                   PQ QVI FF +LYL+A+ QGGHKPCVQAFGADQFD + P+E +A+SSFFNWWY
Sbjct  135  -------PQSQVILFFISLYLIAIGQGGHKPCVQAFGADQFDEKHPKEHRARSSFFNWWY  187

Query  640  FGMCFGVMVTLWILNYVQDNLSWGLGF  720
            F M  G   TL IL+Y+QDN SW +GF
Sbjct  188  FTMVAGASATLLILSYIQDNYSWVVGF  214



>ref|XP_010521165.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Tarenaya hassleriana]
Length=566

 Score =   241 bits (616),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 143/217 (66%), Positives = 165/217 (76%), Gaps = 1/217 (0%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            D     L    VDG VD++G PA R  TG WRSA  II VEVAERF+Y+GI SNLI+YLT
Sbjct  8    DESRASLLLSTVDGFVDYRGNPAVRPSTGGWRSAGLIICVEVAERFAYFGILSNLITYLT  67

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLG+STAAAAANVNAW G A LLPLL  F+ADSFLGR+RTI+++S LY L LG LT+S 
Sbjct  68   GPLGESTAAAAANVNAWDGSALLLPLLWGFVADSFLGRFRTILLASSLYILGLGLLTLSA  127

Query  433  VLP-FESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECK  609
            ++P   SSD +     P Q QVI FF +LYL+ALAQGG KPCVQAFGADQFD  DP+EC 
Sbjct  128  MIPSLGSSDCKGADSCPSQLQVIIFFCSLYLIALAQGGFKPCVQAFGADQFDRHDPEECN  187

Query  610  AKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +KSSFFNWW+FG C G +VTL I NY+QDNLSW LGF
Sbjct  188  SKSSFFNWWFFGSCAGTLVTLCISNYIQDNLSWALGF  224



>gb|KGN50307.1| hypothetical protein Csa_5G167000 [Cucumis sativus]
Length=378

 Score =   236 bits (602),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 144/219 (66%), Positives = 167/219 (76%), Gaps = 6/219 (3%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E P L  + V+G+V + G P  RS +G WRSAS IIGVEVAERF+YYG+SSNLI++LT  
Sbjct  2    EVPLL-DETVEGAVGYNGNPVCRSNSGGWRSASLIIGVEVAERFAYYGVSSNLINFLTDQ  60

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            L QST  AA NVNAWSG ASLLPLLGAFLADSFLGRY TIV+SS LY L LG LT+S ++
Sbjct  61   LQQSTVTAAKNVNAWSGTASLLPLLGAFLADSFLGRYWTIVLSSALYILGLGLLTMSALI  120

Query  439  PFESSDS-----QNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQE  603
            P  S+ +     ++   SP  FQVI FFF+LYLV LAQGGHKPCVQAFGADQFD Q P+E
Sbjct  121  PSPSTSACQQTEKSLPCSPNLFQVILFFFSLYLVGLAQGGHKPCVQAFGADQFDGQHPKE  180

Query  604  CKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             ++KSSFFNWWYFG+      T+ ILNYVQDNLSW LGF
Sbjct  181  SRSKSSFFNWWYFGISLATFATVNILNYVQDNLSWSLGF  219



>ref|XP_006473250.1| PREDICTED: probable peptide/nitrate transporter At1g72120-like 
isoform X2 [Citrus sinensis]
Length=468

 Score =   238 bits (606),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 143/223 (64%), Positives = 172/223 (77%), Gaps = 7/223 (3%)
 Frame = +1

Query  67   LSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            LS  ET  L ++ + G VD +GRP  R  +G WR+ASFIIGVEVAERF+YYGISSNLI+Y
Sbjct  6    LSTTET-LLPENTI-GFVDHQGRPIDRLNSGGWRAASFIIGVEVAERFAYYGISSNLITY  63

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTG LG+STA AAA VN WSG ASLLPLLGAFLADSFLGR+RTIV++SL+Y L L  +T+
Sbjct  64   LTGQLGESTATAAAAVNVWSGTASLLPLLGAFLADSFLGRFRTIVVASLIYILGLSMMTL  123

Query  427  STVLP-FESSDSQNG----AGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQ  591
              ++    SSD QN     + SP  FQ+I F F+LYLVA+ QGGHKPC QAFGADQFD Q
Sbjct  124  LALITLLSSSDCQNNNTAKSCSPHHFQIIVFIFSLYLVAIGQGGHKPCTQAFGADQFDAQ  183

Query  592  DPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +PQE +AKSSFFNWWYFG+ FG   T+ ++ Y+QDNL+W LGF
Sbjct  184  NPQERRAKSSFFNWWYFGISFGANSTILVVIYIQDNLNWALGF  226



>gb|ACN25499.1| unknown [Zea mays]
Length=279

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 173/225 (77%), Gaps = 9/225 (4%)
 Frame = +1

Query  73   DAETPFL--HQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            DA T  L      V G+VDF+GRPA+RS TGRW +A F++GVE+AERF+Y+G+S+NLISY
Sbjct  2    DANTLLLPCSDGAVAGAVDFRGRPASRSGTGRWSAAMFVLGVEIAERFAYHGVSANLISY  61

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTGPLG+STA AAA +NAWSGVA++LPLL A +AD++LGRYRTIV++SLL+ +++G LT+
Sbjct  62   LTGPLGESTAGAAAAINAWSGVATMLPLLMACVADAWLGRYRTIVLASLLFVVSMGMLTV  121

Query  427  STVLPFE-------SSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFD  585
            S +  F        +S S+  A SPP  QV  F+ +LYLVALA+ GHKPC QAFGADQFD
Sbjct  122  SALPAFHHDGCSSYASASRPLACSPPPVQVGVFYVSLYLVALAEAGHKPCAQAFGADQFD  181

Query  586  TQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
              DP+E  ++SSFFNWWYFGMC G  VT  + +Y+QDN+ WGLGF
Sbjct  182  QNDPKESASRSSFFNWWYFGMCSGTAVTTMVSSYIQDNVGWGLGF  226



>ref|XP_002319378.2| hypothetical protein POPTR_0013s11110g [Populus trichocarpa]
 gb|EEE95301.2| hypothetical protein POPTR_0013s11110g [Populus trichocarpa]
Length=571

 Score =   238 bits (608),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 147/228 (64%), Positives = 173/228 (76%), Gaps = 1/228 (0%)
 Frame = +1

Query  37   LSMAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSY  216
            +S++   ++   +  TP L+ D VD  VD+KG P  R  +G WRSASFIIGVEVAERF+Y
Sbjct  1    MSISNISSSETQEVRTPLLN-DTVDDCVDYKGNPVCRYNSGGWRSASFIIGVEVAERFAY  59

Query  217  YGISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLL  396
            YGISSNLI+YLTGPLGQST  AA NVN WSG ASLLPL GAF+ADSFLGR RTI+I+SL+
Sbjct  60   YGISSNLITYLTGPLGQSTVTAAKNVNVWSGTASLLPLFGAFVADSFLGRCRTIIIASLI  119

Query  397  YTLALGFLTISTVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGAD  576
            Y L LG LT+S +LP     S + + S    QVI FF ALYLVAL QGGHKPCV AFGAD
Sbjct  120  YILGLGLLTLSAMLPTSDCQSDSMSCSSNTLQVILFFIALYLVALGQGGHKPCVPAFGAD  179

Query  577  QFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            QFD QD +E K+KSSFFNWWYF M  G++V+L +L Y+QDNLSW LGF
Sbjct  180  QFDRQDTKEYKSKSSFFNWWYFFMSSGILVSLLVLTYIQDNLSWSLGF  227



>ref|XP_011656125.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 [Cucumis sativus]
Length=549

 Score =   238 bits (606),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 135/216 (63%), Positives = 163/216 (75%), Gaps = 8/216 (4%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            +  TP L Q  V+G+VDFKGRP  R  +G WRSASF+IGVEVAERF+YYGI SNLI+YLT
Sbjct  2    ELPTPLLSQ-TVEGAVDFKGRPVLRFCSGGWRSASFMIGVEVAERFAYYGIGSNLITYLT  60

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQS A AA  VN WSG++ LL LLGAFLADSF GRYRTI+ SS +Y L L  L+ S 
Sbjct  61   GPLGQSVATAAETVNIWSGISMLLTLLGAFLADSFFGRYRTILFSSAIYVLGLSLLSFSA  120

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
            +LP  ++ SQN      QFQ++ FF +LYL+ + QGGHKPCVQAFGADQFD   PQE K+
Sbjct  121  MLP--TTSSQNS-----QFQLLLFFVSLYLIGIGQGGHKPCVQAFGADQFDALHPQEAKS  173

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KSSFFNWW+FG+C G  V + ++ Y ++NLSW LGF
Sbjct  174  KSSFFNWWFFGICAGTFVAILLVTYTEENLSWSLGF  209



>ref|XP_006434674.1| hypothetical protein CICLE_v10000738mg [Citrus clementina]
 gb|ESR47914.1| hypothetical protein CICLE_v10000738mg [Citrus clementina]
Length=558

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 143/223 (64%), Positives = 172/223 (77%), Gaps = 7/223 (3%)
 Frame = +1

Query  67   LSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            LS  ET  L ++ + G VD +GRP  R  +G WR+ASFIIGVEVAERF+YYGISSNLI+Y
Sbjct  6    LSTTET-LLPENTI-GFVDHQGRPIDRLNSGGWRAASFIIGVEVAERFAYYGISSNLITY  63

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTG LG+STA AAA VN WSG ASLLPLLGAFLADSFLGR+RTIV++SL+Y L L  +T+
Sbjct  64   LTGQLGESTATAAAAVNVWSGTASLLPLLGAFLADSFLGRFRTIVVASLIYILGLSMMTL  123

Query  427  STVLP-FESSDSQNG----AGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQ  591
              ++    SSD QN     + SP  FQ+I F F+LYLVA+ QGGHKPC QAFGADQFD Q
Sbjct  124  LALITLLSSSDCQNNNTAKSCSPHNFQIIVFIFSLYLVAIGQGGHKPCTQAFGADQFDAQ  183

Query  592  DPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +PQE +AKSSFFNWWYFG+ FG   T+ ++ Y+QDNL+W LGF
Sbjct  184  NPQERRAKSSFFNWWYFGISFGANSTILVVIYIQDNLNWALGF  226



>ref|XP_006473249.1| PREDICTED: probable peptide/nitrate transporter At1g72120-like 
isoform X1 [Citrus sinensis]
 gb|KDO84008.1| hypothetical protein CISIN_1g008632mg [Citrus sinensis]
Length=558

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 143/223 (64%), Positives = 172/223 (77%), Gaps = 7/223 (3%)
 Frame = +1

Query  67   LSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            LS  ET  L ++ + G VD +GRP  R  +G WR+ASFIIGVEVAERF+YYGISSNLI+Y
Sbjct  6    LSTTET-LLPENTI-GFVDHQGRPIDRLNSGGWRAASFIIGVEVAERFAYYGISSNLITY  63

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTG LG+STA AAA VN WSG ASLLPLLGAFLADSFLGR+RTIV++SL+Y L L  +T+
Sbjct  64   LTGQLGESTATAAAAVNVWSGTASLLPLLGAFLADSFLGRFRTIVVASLIYILGLSMMTL  123

Query  427  STVLP-FESSDSQNG----AGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQ  591
              ++    SSD QN     + SP  FQ+I F F+LYLVA+ QGGHKPC QAFGADQFD Q
Sbjct  124  LALITLLSSSDCQNNNTAKSCSPHHFQIIVFIFSLYLVAIGQGGHKPCTQAFGADQFDAQ  183

Query  592  DPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +PQE +AKSSFFNWWYFG+ FG   T+ ++ Y+QDNL+W LGF
Sbjct  184  NPQERRAKSSFFNWWYFGISFGANSTILVVIYIQDNLNWALGF  226



>ref|XP_002265992.2| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Vitis vinifera]
Length=572

 Score =   237 bits (605),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 175/224 (78%), Gaps = 6/224 (3%)
 Frame = +1

Query  64   ILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLIS  243
            IL  A TP L  D ++ +VD+KGRPA R  +GRWRSA FIIGVEVAERF++YGI SNLI+
Sbjct  6    ILPHAHTPLL-DDTLNSAVDYKGRPARRCSSGRWRSACFIIGVEVAERFAFYGIESNLIN  64

Query  244  YLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLT  423
            YLTG LGQS A AA NVN W G A++LPLLGAF ADS++GRY TIVI+SLLY L LG LT
Sbjct  65   YLTGRLGQSMATAAQNVNTWFGTANMLPLLGAFAADSYVGRYPTIVIASLLYILGLGLLT  124

Query  424  ISTVLP-FESS----DSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDT  588
            +S VLP F  S    D +  + SPP  QVI FFFALYL A+ QGGHKPCVQAFGADQFD 
Sbjct  125  VSAVLPSFNPSHCRADKEISSCSPPMLQVILFFFALYLAAVGQGGHKPCVQAFGADQFDG  184

Query  589  QDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            Q+P+E KAKSSFFNWWYF M  G++++  IL+Y+QD+L+WGLGF
Sbjct  185  QNPEESKAKSSFFNWWYFCMNGGILISSSILSYIQDSLNWGLGF  228



>ref|XP_008459680.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Cucumis melo]
Length=549

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 164/216 (76%), Gaps = 8/216 (4%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            +  TP L Q  V+ +VDFKG+PA R  +G WRSASF+IGVEVAERF+YYGI SNLI+YLT
Sbjct  2    EQPTPLLSQ-TVESAVDFKGQPALRFCSGGWRSASFMIGVEVAERFAYYGIGSNLITYLT  60

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQS A AA  VN WSG++ LL LLGAFLADSF GRYRTI+ SS +Y L L  L+ S 
Sbjct  61   GPLGQSVATAAETVNIWSGISMLLTLLGAFLADSFFGRYRTILFSSAIYVLGLSLLSFSA  120

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
            +LP  ++ SQN      QFQ+IFFF +LYL+ + QGGHKPCVQAFGADQFD   PQE K+
Sbjct  121  MLP--TTSSQNS-----QFQLIFFFVSLYLIGIGQGGHKPCVQAFGADQFDALHPQEAKS  173

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KSSFFNWW+FG+C G  V + ++ Y ++NLSW LGF
Sbjct  174  KSSFFNWWFFGVCAGTFVAILLVTYTEENLSWSLGF  209



>gb|KGN50309.1| hypothetical protein Csa_5G167020 [Cucumis sativus]
Length=310

 Score =   229 bits (583),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 139/219 (63%), Positives = 162/219 (74%), Gaps = 6/219 (3%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E P L  + V+G VD+ G P  RS +G WRSAS II VE+AERF+Y+G+SSNLI++LT  
Sbjct  2    EVPLL-DETVEGVVDYHGHPVCRSISGGWRSASLIIAVEIAERFAYFGVSSNLINFLTDQ  60

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            L QSTA AA NVN WSG A+LLPLLGAFLAD FLGRYRTIV SS LY L LGFLT+   L
Sbjct  61   LHQSTATAAKNVNTWSGTATLLPLLGAFLADCFLGRYRTIVFSSALYILGLGFLTVYATL  120

Query  439  P----FESSDSQNG-AGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQE  603
            P        +++N    SP   QV+ FFF+LYLVA AQGGHKPCVQAFGADQFD Q P+E
Sbjct  121  PSPDISACQETENSLTCSPNLVQVMVFFFSLYLVAFAQGGHKPCVQAFGADQFDGQHPEE  180

Query  604  CKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             KAKSSFFNWWYFG+    + T+ I++YVQD LSW LGF
Sbjct  181  SKAKSSFFNWWYFGISLASLFTVNIMSYVQDYLSWSLGF  219



>ref|XP_008437003.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Cucumis melo]
 ref|XP_008437004.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Cucumis melo]
Length=563

 Score =   236 bits (601),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 165/219 (75%), Gaps = 6/219 (3%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E P L  + V+G+VD+ G P  RS +G WRSAS IIGVEVAERF+YYG+SSNLI++LT  
Sbjct  2    EVPLL-DETVEGAVDYNGNPVCRSNSGGWRSASLIIGVEVAERFAYYGVSSNLINFLTDQ  60

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            L QST  AA NVNAWSG ASLLPLLGAFLADSFLGRY TIV+SS LY L LG LT+S ++
Sbjct  61   LQQSTVTAAKNVNAWSGTASLLPLLGAFLADSFLGRYWTIVLSSALYILGLGLLTMSALI  120

Query  439  --PFESSDSQNGAG---SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQE  603
              P  S+  Q       SP  FQVI FFF+LYLV LAQGGHKPCVQAFGADQFD Q P+E
Sbjct  121  SSPSTSACQQTEKSLPCSPNLFQVILFFFSLYLVGLAQGGHKPCVQAFGADQFDGQHPEE  180

Query  604  CKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
              +KSSFFNWWYFG+      T+ ILNYVQDNLSW LGF
Sbjct  181  SISKSSFFNWWYFGISLATFATVNILNYVQDNLSWSLGF  219



>gb|KEH29313.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=503

 Score =   234 bits (596),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 163/207 (79%), Gaps = 7/207 (3%)
 Frame = +1

Query  100  DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaa  279
            D+VDG+VD++G+PA RS++G W SA FIIGVEVAER SY+G+  NLISYLTGPL QSTA 
Sbjct  15   DLVDGAVDYRGQPAIRSKSGYWLSAWFIIGVEVAERMSYFGVKGNLISYLTGPLKQSTAT  74

Query  280  aaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSDS  459
            AA NVN W+G ASLLPL GAF+ADSFLGRY TI+++SL+Y L LG LT+S +LP  +  S
Sbjct  75   AAKNVNVWAGTASLLPLFGAFIADSFLGRYHTIILASLIYVLGLGLLTLSAMLPSITIYS  134

Query  460  QNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWY  639
                   PQ QV+ FFF+LYLVA+ QGGHKPCVQAFGADQFD + P+E +A+SSFFNWWY
Sbjct  135  -------PQSQVMLFFFSLYLVAIGQGGHKPCVQAFGADQFDEKHPKEHRARSSFFNWWY  187

Query  640  FGMCFGVMVTLWILNYVQDNLSWGLGF  720
            F M  G   TL IL+Y+QDN SW LGF
Sbjct  188  FTMVAGASATLLILSYIQDNYSWVLGF  214



>ref|XP_010683004.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Beta vulgaris 
subsp. vulgaris]
Length=579

 Score =   235 bits (600),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 143/221 (65%), Positives = 170/221 (77%), Gaps = 8/221 (4%)
 Frame = +1

Query  82   TPFLHQD---VVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            TP L  D    V  +VD+K RPA RS+ GRW SA FII VE+AER +YYGIS+NLIS+LT
Sbjct  12   TPLLMADPPETVANTVDYKRRPAVRSKHGRWFSAFFIIWVEMAERLAYYGISANLISFLT  71

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            G L QSTA AAAN+NAWSGV+SLLP+LGA LADSFLG+Y TI+ SS++Y L LG LT+S 
Sbjct  72   GKLEQSTAMAAANINAWSGVSSLLPILGAVLADSFLGKYYTIIGSSIIYILGLGLLTLSA  131

Query  433  VLP----FESSDSQNGA-GSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDP  597
            +LP         S  GA G  P  Q++ FF ALYLVA+ QGGHKPCVQAFGADQFD +DP
Sbjct  132  MLPSLDCLNQGRSITGAPGCSPHLQIVIFFIALYLVAVGQGGHKPCVQAFGADQFDGEDP  191

Query  598  QECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +E KAKSSFFNWWYFG+C G ++ + +L+YVQDNLSWGLGF
Sbjct  192  RESKAKSSFFNWWYFGVCVGGLLGIGVLSYVQDNLSWGLGF  232



>ref|XP_011031497.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Populus euphratica]
Length=559

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 140/213 (66%), Positives = 167/213 (78%), Gaps = 5/213 (2%)
 Frame = +1

Query  97   QDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTa  276
            +  V+GSVD+KG P  RS +G WRSASFII VEVAERF+YYGISSNLI+YLTGPLGQSTA
Sbjct  5    EGTVNGSVDYKGNPVHRSTSGGWRSASFIIAVEVAERFAYYGISSNLITYLTGPLGQSTA  64

Query  277  aaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISS----LLYTLALGFLTISTVLPF  444
            +AAANVN WSG A+LLPLLGAF+ADSFLGRYRTI+ +S    L   L      ++TV   
Sbjct  65   SAAANVNTWSGTATLLPLLGAFVADSFLGRYRTIIAASLIYILGLGLLTLAAKLTTVNLH  124

Query  445  ESSDSQNGA-GSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSS  621
            +   +++    +PP+FQVI FFF++YLVA+ QGGHKPCVQAFG DQFD QDP+E KAKSS
Sbjct  125  DCRSTKDARLCAPPRFQVILFFFSVYLVAVGQGGHKPCVQAFGGDQFDGQDPKESKAKSS  184

Query  622  FFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FFNWWYF +  G+ VTL +L Y+QDNLSW LGF
Sbjct  185  FFNWWYFAISVGITVTLIVLVYIQDNLSWALGF  217



>emb|CBI39325.3| unnamed protein product [Vitis vinifera]
Length=2163

 Score =   244 bits (622),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 146/213 (69%), Positives = 169/213 (79%), Gaps = 1/213 (0%)
 Frame = +1

Query  82    TPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPL  261
             TPFL +D V+G VD++G PA RSR+G WRSASFIIGVE+AER +YYGIS NLISYLTGPL
Sbjct  1608  TPFL-EDAVEGVVDYRGVPAKRSRSGGWRSASFIIGVELAERIAYYGISFNLISYLTGPL  1666

Query  262   GQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLP  441
             GQS A AA NVN +SG   LLPLLGAF+ADSFLGRYRTIVI+SLLY L LG LT+S +LP
Sbjct  1667  GQSMAVAAQNVNTFSGAGCLLPLLGAFVADSFLGRYRTIVIASLLYILGLGLLTLSAMLP  1726

Query  442   FESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSS  621
                        +PPQFQV+ FFF+LYLV + Q GHKPC QAFGADQFD Q P+ECKAKSS
Sbjct  1727  SLIPSFCQNIDNPPQFQVVLFFFSLYLVTIGQSGHKPCTQAFGADQFDGQHPEECKAKSS  1786

Query  622   FFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             FFNWWYF +C G+ V   IL+Y+Q+NL+W LGF
Sbjct  1787  FFNWWYFALCSGISVAFLILSYIQENLNWVLGF  1819


 Score =   237 bits (604),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 148/224 (66%), Positives = 175/224 (78%), Gaps = 6/224 (3%)
 Frame = +1

Query  64   ILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLIS  243
            IL  A TP L  D ++ +VD+KGRPA R  +GRWRSA FIIGVEVAERF++YGI SNLI+
Sbjct  6    ILPHAHTPLL-DDTLNSAVDYKGRPARRCSSGRWRSACFIIGVEVAERFAFYGIESNLIN  64

Query  244  YLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLT  423
            YLTG LGQS A AA NVN W G A++LPLLGAF ADS++GRY TIVI+SLLY L LG LT
Sbjct  65   YLTGRLGQSMATAAQNVNTWFGTANMLPLLGAFAADSYVGRYPTIVIASLLYILGLGLLT  124

Query  424  ISTVLP-FESS----DSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDT  588
            +S VLP F  S    D +  + SPP  QVI FFFALYL A+ QGGHKPCVQAFGADQFD 
Sbjct  125  VSAVLPSFNPSHCRADKEISSCSPPMLQVILFFFALYLAAVGQGGHKPCVQAFGADQFDG  184

Query  589  QDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            Q+P+E KAKSSFFNWWYF M  G++++  IL+Y+QD+L+WGLGF
Sbjct  185  QNPEESKAKSSFFNWWYFCMNGGILISSSILSYIQDSLNWGLGF  228


 Score =   231 bits (590),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 142/197 (72%), Positives = 165/197 (84%), Gaps = 5/197 (3%)
 Frame = +1

Query  145  RSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanvnawsgvasLL  324
            RS +G WRSASFIIGVEVAERF+YYGI SNLIS+L GPLGQSTAAAAANVN WSG ++LL
Sbjct  570  RSSSGGWRSASFIIGVEVAERFAYYGIGSNLISFLIGPLGQSTAAAAANVNTWSGTSTLL  629

Query  325  PLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFES-----SDSQNGAGSPPQF  489
            PLLGAF+AD++LGRY TI+++SL+Y L LG L +S VLP  S      + +  + SPPQ 
Sbjct  630  PLLGAFVADTYLGRYYTIIVASLIYILGLGLLAVSAVLPSASPSECQKNDEIASCSPPQL  689

Query  490  QVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVT  669
            QVI FFFALYLVA+ QGGHKPCVQAFGADQFD QDP E K+KSSFFNWWYF MCFG ++T
Sbjct  690  QVILFFFALYLVAVGQGGHKPCVQAFGADQFDGQDPVEGKSKSSFFNWWYFSMCFGTLIT  749

Query  670  LWILNYVQDNLSWGLGF  720
            L+ILNY+QDNL+WGLGF
Sbjct  750  LFILNYIQDNLNWGLGF  766


 Score =   213 bits (543),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 137/234 (59%), Positives = 177/234 (76%), Gaps = 9/234 (4%)
 Frame = +1

Query  34    LLSMAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFS  213
             L  ++A G  I   +E P L  D VDG+VD KG PA RS +G W+SA FIIG+ V +RF+
Sbjct  1084  LAGLSAVGCLI---SEAPTL-DDTVDGAVDHKGDPAKRSFSGAWKSAYFIIGMAVVDRFA  1139

Query  214   YYGISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSL  393
             + GI +NLI+YLTG LG+STAAAAANVN WSG A+LLPLLGA +ADS+LG+YRTIVI+SL
Sbjct  1140  FKGIETNLINYLTGWLGESTAAAAANVNTWSGTATLLPLLGAAIADSYLGQYRTIVIASL  1199

Query  394   LYTLALGFLTISTVLPFE-----SSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCV  558
              Y L LG LT+S+V          + ++  + SP Q QV+FFFF+LY+VA+ QGG KPC+
Sbjct  1200  TYILGLGLLTVSSVFTSGSSSNCKNSNKTTSCSPSQLQVVFFFFSLYVVAIGQGGLKPCL  1259

Query  559   QAFGADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             QAFGA+QFD +D +ECKAKSSFFNWW+FG+  GV V+  I++Y++DN+SW LGF
Sbjct  1260  QAFGAEQFDQRDQEECKAKSSFFNWWFFGLAGGVSVSYLIMSYIEDNVSWILGF  1313



>ref|XP_003540022.1| PREDICTED: probable peptide/nitrate transporter At1g22540-like 
isoform 1 [Glycine max]
Length=560

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 135/206 (66%), Positives = 160/206 (78%), Gaps = 4/206 (2%)
 Frame = +1

Query  115  SVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanv  294
            +VD++G  + RS++G WRSA FIIGVEVAER +YYGI  NLI+YLTGPL Q+TA AA NV
Sbjct  20   AVDYRGGASVRSKSGSWRSAGFIIGVEVAERIAYYGIQGNLITYLTGPLHQTTATAAENV  79

Query  295  nawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFES-SDSQNG-  468
            N WSG ASLLPL GAFLADS LGRYRTI+++S +Y L LG LT+S +LP  + S+ Q G 
Sbjct  80   NIWSGTASLLPLFGAFLADSLLGRYRTIILASFIYILGLGLLTLSAMLPSPTGSECQVGN  139

Query  469  --AGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYF  642
                  PQ Q++ FF +LYLVA+ QGGHKPCVQAFGADQFD + P+E K +SSFFNWWYF
Sbjct  140  EFKSCSPQSQIVLFFISLYLVAIGQGGHKPCVQAFGADQFDEKHPKEYKDRSSFFNWWYF  199

Query  643  GMCFGVMVTLWILNYVQDNLSWGLGF  720
             MC G M TL ILNY+QDNLSW LGF
Sbjct  200  TMCAGCMATLSILNYIQDNLSWVLGF  225



>ref|XP_010062427.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Eucalyptus grandis]
 gb|KCW69568.1| hypothetical protein EUGRSUZ_F02995 [Eucalyptus grandis]
Length=571

 Score =   234 bits (598),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 174/222 (78%), Gaps = 6/222 (3%)
 Frame = +1

Query  73   DAETPFLHQ-DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            + E P L   D+V G+VD KGRPA RS +G WRSASFIIGVEVAERF+YYGI +NLISYL
Sbjct  13   EKERPLLSGGDIVGGAVDSKGRPARRSCSGGWRSASFIIGVEVAERFAYYGIEANLISYL  72

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLG+STAAAA NVNAWSG ASLLPL+GAF+ADS+LGRYRTI+I+S LY L L  LT+S
Sbjct  73   TGPLGESTAAAAENVNAWSGAASLLPLVGAFVADSYLGRYRTIIIASFLYILGLALLTLS  132

Query  430  TVL-PFESSDSQNGAG--SPP--QFQVIffffalylvalaQGGHKPCVQAFGADQFDTQD  594
             VL    +S+ QN     S P  +  V+ FF +LY+VA+ Q GHKPCVQAFGADQFD +D
Sbjct  133  AVLTSLGTSECQNTTKITSCPSSKLHVVLFFCSLYMVAIGQAGHKPCVQAFGADQFDGRD  192

Query  595  PQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            P E KAKSSFFNWW+F +C GV VTL +L Y+QDNL+W LGF
Sbjct  193  PVESKAKSSFFNWWFFCLCAGVTVTLVVLVYIQDNLNWSLGF  234



>ref|XP_009362428.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Pyrus x bretschneideri]
Length=557

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 150/216 (69%), Positives = 170/216 (79%), Gaps = 13/216 (6%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            D +TP L  D V+G+VD KGRP  R R+G WRSA FIIGVEVAERF+YYGISSNLI++LT
Sbjct  12   DTQTPLL-DDGVEGAVDHKGRPVHRYRSGGWRSARFIIGVEVAERFAYYGISSNLITFLT  70

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQST  AA NVN WSG ASLLPLLGAF+ADSFLGRYRTI  +SLLY L LG LT+S 
Sbjct  71   GPLGQSTVTAAENVNIWSGTASLLPLLGAFVADSFLGRYRTIYFASLLYILGLGLLTLSA  130

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
            VL            S  + QVIFFFF+LYLVA+AQGGHKPCVQAFGADQFD  DP+ECKA
Sbjct  131  VL------------SSSEIQVIFFFFSLYLVAVAQGGHKPCVQAFGADQFDVSDPEECKA  178

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KSSFFNWW+FG+  G  +T  +L Y+Q+NLSWGLGF
Sbjct  179  KSSFFNWWFFGLIAGTSLTFIVLTYIQENLSWGLGF  214



>gb|KCW69566.1| hypothetical protein EUGRSUZ_F02995 [Eucalyptus grandis]
Length=571

 Score =   234 bits (596),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 174/222 (78%), Gaps = 6/222 (3%)
 Frame = +1

Query  73   DAETPFLHQ-DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            + E P L   D+V G+VD KGRPA RS +G WRSASFIIGVEVAERF+YYGI +NLISYL
Sbjct  13   EKERPLLSGGDIVGGAVDSKGRPARRSCSGGWRSASFIIGVEVAERFAYYGIEANLISYL  72

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLG+STAAAA NVNAWSG ASLLPL+GAF+ADS+LGRYRTI+I+S LY L L  LT+S
Sbjct  73   TGPLGESTAAAAENVNAWSGAASLLPLVGAFVADSYLGRYRTIIIASFLYILGLALLTLS  132

Query  430  TVL-PFESSDSQNGAG--SPP--QFQVIffffalylvalaQGGHKPCVQAFGADQFDTQD  594
             VL    +S+ QN     S P  +  V+ FF +LY+VA+ Q GHKPCVQAFGADQFD +D
Sbjct  133  AVLTSLGTSECQNTTKITSCPSSKLHVVLFFCSLYMVAIGQAGHKPCVQAFGADQFDGRD  192

Query  595  PQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            P E KAKSSFFNWW+F +C GV VTL +L Y+QDNL+W LGF
Sbjct  193  PVESKAKSSFFNWWFFCLCAGVTVTLVVLVYIQDNLNWSLGF  234



>ref|XP_006376224.1| hypothetical protein POPTR_0013s11100g [Populus trichocarpa]
 gb|ERP54021.1| hypothetical protein POPTR_0013s11100g [Populus trichocarpa]
Length=565

 Score =   234 bits (596),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 145/228 (64%), Positives = 172/228 (75%), Gaps = 1/228 (0%)
 Frame = +1

Query  37   LSMAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSY  216
            +S++   ++   +  TP L+ D VD  VD+KG P  R  +G WRSASFIIGVEVAERF++
Sbjct  1    MSISNLSSSETQEVRTPLLN-DTVDDCVDYKGNPVCRYNSGGWRSASFIIGVEVAERFAF  59

Query  217  YGISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLL  396
            YGISSNLI YLTGPLGQST  AA NVN WSG ASLLPL GAF+ADSFLG+ RTI+I+SL+
Sbjct  60   YGISSNLIMYLTGPLGQSTITAAKNVNVWSGTASLLPLFGAFVADSFLGKCRTIIIASLI  119

Query  397  YTLALGFLTISTVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGAD  576
            Y L LG LT+S +LP     S + + S    QVI FF ALYLVAL QGGHKPCV AFGAD
Sbjct  120  YILGLGLLTLSAMLPTSDCQSDSMSCSSNTLQVILFFIALYLVALGQGGHKPCVPAFGAD  179

Query  577  QFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            QFD QD +E KAKSSFFNWWYF +  G++V+L +L Y+QDNLSW LGF
Sbjct  180  QFDRQDTKEYKAKSSFFNWWYFFVSSGILVSLLVLTYIQDNLSWSLGF  227



>gb|EYU22786.1| hypothetical protein MIMGU_mgv11b021031mg [Erythranthe guttata]
Length=532

 Score =   233 bits (593),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 146/218 (67%), Positives = 173/218 (79%), Gaps = 0/218 (0%)
 Frame = +1

Query  67   LSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            +S+AETP +  D++ GSVDF G PA RS++G W+SA+FIIGVEVAERF+YYGISSNLISY
Sbjct  6    ISEAETPLIDDDIIRGSVDFSGLPARRSKSGCWKSATFIIGVEVAERFAYYGISSNLISY  65

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTGPLGQSTA AA NVNAW+G A LLPLLGAF+ADSF GRYRTI+I+SL+Y L LG L++
Sbjct  66   LTGPLGQSTATAAENVNAWNGAAMLLPLLGAFVADSFWGRYRTIIIASLVYVLGLGLLSL  125

Query  427  STVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQEC  606
            S  L   +S +     S    QV  FF +LYLVALAQGGHKPCVQAFGADQFD  D +E 
Sbjct  126  SAALDSLNSKNNANKNSASPLQVTIFFISLYLVALAQGGHKPCVQAFGADQFDEHDEKEL  185

Query  607  KAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KAK SFFNWWYF M  G++V L ++NY+Q+NLSW LGF
Sbjct  186  KAKHSFFNWWYFSMNGGILVALLVVNYIQENLSWELGF  223



>ref|XP_012084631.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Jatropha curcas]
 gb|KDP27339.1| hypothetical protein JCGZ_20271 [Jatropha curcas]
Length=579

 Score =   233 bits (594),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 143/233 (61%), Positives = 174/233 (75%), Gaps = 6/233 (3%)
 Frame = +1

Query  37   LSMAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSY  216
            +++ +T  +   D ++P L  D V+ SVD+KGRPA +S +G W SA FIIGVEVAERF+Y
Sbjct  1    MAITSTSRSESPDIQSPLL-SDTVEASVDYKGRPAYKSNSGGWNSAFFIIGVEVAERFAY  59

Query  217  YGISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLL  396
             GI SNLI+YLTGPLGQSTA AA N NAWSG A LLPLLG F+ADSFLGRY TI+++ L+
Sbjct  60   TGIDSNLITYLTGPLGQSTATAAENANAWSGTALLLPLLGGFIADSFLGRYHTILVAFLI  119

Query  397  YTLALGFLTISTVLPFESS----DSQNGAG-SPPQFQVIffffalylvalaQGGHKPCVQ  561
            Y L LG L  S +L   S+    +++N A  SP   QV+ FFF+LYLVAL QGG KPC+Q
Sbjct  120  YVLGLGLLAASAILTSPSASDCPNTKNDASCSPYSIQVVLFFFSLYLVALGQGGQKPCIQ  179

Query  562  AFGADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            AFGADQFD QDP+E KAKSSFFNW YFG C G++ T  IL Y+QDNL+W LGF
Sbjct  180  AFGADQFDGQDPEEQKAKSSFFNWLYFGTCAGILATHLILVYIQDNLNWFLGF  232



>ref|XP_008783395.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Phoenix dactylifera]
Length=558

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 145/218 (67%), Positives = 178/218 (82%), Gaps = 6/218 (3%)
 Frame = +1

Query  85   PFLHQD-VVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPL  261
            P L Q   V G+VD++GRP +RS +G W SA FIIGVE+AERF++YGISSNLI+YLTGPL
Sbjct  5    PLLRQSATVAGAVDYRGRPVSRSSSGGWSSALFIIGVEIAERFAFYGISSNLITYLTGPL  64

Query  262  GQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLP  441
            G+STAAAAA VN WSGVAS+LPL+GAF+ADS+LGR+RTI+++SLLY + LG LT+S+VLP
Sbjct  65   GESTAAAAAAVNTWSGVASMLPLVGAFVADSYLGRFRTIILASLLYIMGLGMLTLSSVLP  124

Query  442  F----ESSDSQN-GAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQEC  606
                 +  D+ +  A  P   QV FF+F+LYLVA AQGGHKPCVQAFGADQFD  DP+EC
Sbjct  125  SIHAPKCGDTTDLTACRPSPAQVAFFYFSLYLVAFAQGGHKPCVQAFGADQFDQNDPKEC  184

Query  607  KAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
              KSSFFNWWYFG+C G +VTL I++Y+QDN+SWGLGF
Sbjct  185  MDKSSFFNWWYFGLCGGTVVTLVIVSYIQDNISWGLGF  222



>ref|XP_010665401.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Vitis vinifera]
 emb|CAN63509.1| hypothetical protein VITISV_031690 [Vitis vinifera]
Length=569

 Score =   232 bits (592),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 176/225 (78%), Gaps = 6/225 (3%)
 Frame = +1

Query  61   TILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLI  240
             +L   E+P L +D VDGSVD +G P+ RS +G WRSA FIIGVEVAERF+Y GI SNLI
Sbjct  3    NMLQSLESPLL-EDTVDGSVDHQGYPSKRSISGGWRSAIFIIGVEVAERFAYCGIGSNLI  61

Query  241  SYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFL  420
            +YLTGPLGQSTA AAANVN W+G A+LLPLLGAF+ADS+LGRYRTIV++SLLY L L  L
Sbjct  62   NYLTGPLGQSTAMAAANVNTWAGTATLLPLLGAFVADSYLGRYRTIVLASLLYILGLSLL  121

Query  421  TISTVLP-FESSDSQN----GAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFD  585
            T+S +LP   +  SQN       SPPQ Q++ FFF+LYLVA+ QGGHKPC QAFGADQFD
Sbjct  122  TLSAMLPSLIAFQSQNVDYFTLYSPPQLQIVLFFFSLYLVAVGQGGHKPCTQAFGADQFD  181

Query  586  TQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             Q+ +ECKAKSSFFNWW FG+  G  VT  I++Y+++N +WGLGF
Sbjct  182  GQNLEECKAKSSFFNWWLFGVSTGTSVTYVIVSYIEENFNWGLGF  226



>tpg|DAA56612.1| TPA: hypothetical protein ZEAMMB73_385814 [Zea mays]
Length=542

 Score =   231 bits (590),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 135/225 (60%), Positives = 173/225 (77%), Gaps = 9/225 (4%)
 Frame = +1

Query  73   DAETPFL--HQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            DA T  L      V G+VDF+GRPA+RS TGRW +A F++GVE+AERF+Y+G+S+NLISY
Sbjct  2    DANTLLLPCSDGAVAGAVDFRGRPASRSGTGRWSAAMFVLGVEIAERFAYHGVSANLISY  61

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTGPLG+STA AAA +NAWSGVA++LPLL A +AD++LGRYRTIV++SLL+ +++G LT+
Sbjct  62   LTGPLGESTAGAAAAINAWSGVATMLPLLMACVADAWLGRYRTIVLASLLFVVSMGMLTV  121

Query  427  STVLPFE-------SSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFD  585
            S +  F        +S S+  A SPP  QV  F+ +LYLVALA+ GHKPC QAFGADQFD
Sbjct  122  SALPAFHHDGCSSYASASRPLACSPPPVQVGVFYVSLYLVALAEAGHKPCAQAFGADQFD  181

Query  586  TQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
              DP+E  ++SSFFNWWYFGMC G  VT  + +Y+QDN+ WGLGF
Sbjct  182  QNDPKESASRSSFFNWWYFGMCSGTAVTTMVSSYIQDNVGWGLGF  226



>emb|CBI39329.3| unnamed protein product [Vitis vinifera]
Length=606

 Score =   232 bits (592),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 146/225 (65%), Positives = 176/225 (78%), Gaps = 6/225 (3%)
 Frame = +1

Query  61   TILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLI  240
             +L   E+P L +D VDGSVD +G P+ RS +G WRSA FIIGVEVAERF+Y GI SNLI
Sbjct  3    NMLQSLESPLL-EDTVDGSVDHQGYPSKRSISGGWRSAIFIIGVEVAERFAYCGIGSNLI  61

Query  241  SYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFL  420
            +YLTGPLGQSTA AAANVN W+G A+LLPLLGAF+ADS+LGRYRTIV++SLLY L L  L
Sbjct  62   NYLTGPLGQSTAMAAANVNTWAGTATLLPLLGAFVADSYLGRYRTIVLASLLYILGLSLL  121

Query  421  TISTVLP-FESSDSQN----GAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFD  585
            T+S +LP   +  SQN       SPPQ Q++ FFF+LYLVA+ QGGHKPC QAFGADQFD
Sbjct  122  TLSAMLPSLIAFQSQNVDYFTLYSPPQLQIVLFFFSLYLVAVGQGGHKPCTQAFGADQFD  181

Query  586  TQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             Q+ +ECKAKSSFFNWW FG+  G  VT  I++Y+++N +WGLGF
Sbjct  182  GQNLEECKAKSSFFNWWLFGVSTGTSVTYVIVSYIEENFNWGLGF  226



>ref|XP_011656158.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Cucumis sativus]
Length=910

 Score =   236 bits (602),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 144/219 (66%), Positives = 167/219 (76%), Gaps = 6/219 (3%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E P L  + V+G+V + G P  RS +G WRSAS IIGVEVAERF+YYG+SSNLI++LT  
Sbjct  2    EVPLL-DETVEGAVGYNGNPVCRSNSGGWRSASLIIGVEVAERFAYYGVSSNLINFLTDQ  60

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            L QST  AA NVNAWSG ASLLPLLGAFLADSFLGRY TIV+SS LY L LG LT+S ++
Sbjct  61   LQQSTVTAAKNVNAWSGTASLLPLLGAFLADSFLGRYWTIVLSSALYILGLGLLTMSALI  120

Query  439  PFESSDS-----QNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQE  603
            P  S+ +     ++   SP  FQVI FFF+LYLV LAQGGHKPCVQAFGADQFD Q P+E
Sbjct  121  PSPSTSACQQTEKSLPCSPNLFQVILFFFSLYLVGLAQGGHKPCVQAFGADQFDGQHPKE  180

Query  604  CKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             ++KSSFFNWWYFG+      T+ ILNYVQDNLSW LGF
Sbjct  181  SRSKSSFFNWWYFGISLATFATVNILNYVQDNLSWSLGF  219



>ref|XP_003566212.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Brachypodium distachyon]
Length=579

 Score =   231 bits (589),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 140/225 (62%), Positives = 179/225 (80%), Gaps = 6/225 (3%)
 Frame = +1

Query  64   ILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLIS  243
            +L+ A+   + +D    +VD +GRPA+R+ TGRWRSA FII VE+AERF++YG+S+NLIS
Sbjct  12   LLARADESAMAEDSAVAAVDHRGRPASRASTGRWRSALFIIAVEIAERFAFYGVSANLIS  71

Query  244  YLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLT  423
            YLTGPLG+  A AA+ +NAW+GVA LLPLLGA LADS+LGRYRTIVI+SLLY LALG L 
Sbjct  72   YLTGPLGEGNAKAASAINAWNGVAQLLPLLGAALADSWLGRYRTIVIASLLYVLALGVLA  131

Query  424  ISTVLP---FESSDSQNGAGS---PPQFQVIffffalylvalaQGGHKPCVQAFGADQFD  585
            +ST+L     + S++  GAG+   P   Q++FF+ +LY+VA+AQGGHKPCVQAFGADQFD
Sbjct  132  LSTLLSSGGHKCSNATAGAGTACPPSGLQMVFFYISLYMVAVAQGGHKPCVQAFGADQFD  191

Query  586  TQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
              DP+E  ++SSFFNWWYFGMC G  VTL +L+Y+QDN+ WGLGF
Sbjct  192  ASDPRESVSRSSFFNWWYFGMCAGTAVTLVVLSYIQDNIGWGLGF  236



>ref|XP_010062426.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Eucalyptus grandis]
Length=598

 Score =   231 bits (589),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 153/222 (69%), Positives = 178/222 (80%), Gaps = 6/222 (3%)
 Frame = +1

Query  73   DAETPFLHQ-DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            + E P L   D+V G+VD KGRPA RS +G WRSASFIIGVEVAERF+YYGIS+NLISYL
Sbjct  40   EKEHPLLGGGDIVGGAVDSKGRPARRSCSGGWRSASFIIGVEVAERFAYYGISANLISYL  99

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLG+STA AA NVNAWSG ASLLPL+GAF+ADS+LGRYRTI+I+SLLY L L  LT+S
Sbjct  100  TGPLGESTATAAENVNAWSGAASLLPLVGAFVADSYLGRYRTIIIASLLYILGLALLTLS  159

Query  430  TVL-PFESSDSQN----GAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQD  594
             VL    +S+ QN     + S  +  VI FFF+LY+VA+ Q GHKPCVQAFGADQFD QD
Sbjct  160  AVLISLGTSECQNTTKITSCSSSKLHVILFFFSLYMVAIGQAGHKPCVQAFGADQFDKQD  219

Query  595  PQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            P E KAKSSFFNWWYFG+C GV+VTL +L Y+QDNL+W LGF
Sbjct  220  PVESKAKSSFFNWWYFGLCAGVVVTLVVLVYIQDNLNWSLGF  261



>gb|KCW69567.1| hypothetical protein EUGRSUZ_F02995 [Eucalyptus grandis]
Length=571

 Score =   230 bits (586),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 153/222 (69%), Positives = 178/222 (80%), Gaps = 6/222 (3%)
 Frame = +1

Query  73   DAETPFLHQ-DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            + E P L   D+V G+VD KGRPA RS +G WRSASFIIGVEVAERF+YYGIS+NLISYL
Sbjct  13   EKEHPLLGGGDIVGGAVDSKGRPARRSCSGGWRSASFIIGVEVAERFAYYGISANLISYL  72

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLG+STA AA NVNAWSG ASLLPL+GAF+ADS+LGRYRTI+I+SLLY L L  LT+S
Sbjct  73   TGPLGESTATAAENVNAWSGAASLLPLVGAFVADSYLGRYRTIIIASLLYILGLALLTLS  132

Query  430  TVL-PFESSDSQN----GAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQD  594
             VL    +S+ QN     + S  +  VI FFF+LY+VA+ Q GHKPCVQAFGADQFD QD
Sbjct  133  AVLISLGTSECQNTTKITSCSSSKLHVILFFFSLYMVAIGQAGHKPCVQAFGADQFDKQD  192

Query  595  PQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            P E KAKSSFFNWWYFG+C GV+VTL +L Y+QDNL+W LGF
Sbjct  193  PVESKAKSSFFNWWYFGLCAGVVVTLVVLVYIQDNLNWSLGF  234



>gb|AFK47982.1| unknown [Medicago truncatula]
Length=400

 Score =   225 bits (574),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 167/216 (77%), Gaps = 12/216 (6%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            D ET  L  + VDG VDFKGRP  RS +G WR+A+FII VEVAERF+YYGI+SNLI+YLT
Sbjct  5    DCETRLL-LETVDGVVDFKGRPVLRSSSGGWRAAAFIISVEVAERFAYYGINSNLINYLT  63

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQSTA AA NVN WSG ASLLPLLGAFLADSFLGRYRTI+I+SL+Y LAL  LT+S 
Sbjct  64   GPLGQSTATAAENVNIWSGTASLLPLLGAFLADSFLGRYRTIIIASLVYILALSLLTLSA  123

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
             LP   SD           Q I FFF+LYLVA AQGGHKPCVQAFGADQFD   PQE ++
Sbjct  124  TLP---SDGDA--------QAILFFFSLYLVAFAQGGHKPCVQAFGADQFDINHPQERRS  172

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +SSFFNWWYF    G++VT+ ILNYVQDN+ W LGF
Sbjct  173  RSSFFNWWYFTFTAGLLVTVSILNYVQDNVGWVLGF  208



>ref|XP_010245116.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X2 [Nelumbo 
nucifera]
Length=578

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 177/222 (80%), Gaps = 5/222 (2%)
 Frame = +1

Query  70   SDAETPFLH--QDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLIS  243
            S +E+P L   +D+V+G VD+KGR   RS++G WRSASFIIGVE+AERF+YYGI+SNLIS
Sbjct  7    SISESPLLGGGEDMVEGMVDYKGRRVIRSKSGGWRSASFIIGVEMAERFAYYGIASNLIS  66

Query  244  YLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLT  423
            YLTGPL QSTA AAANVNAWSG AS+ PLLGAF+AD++LGR+RTI+ SSLLY L LG LT
Sbjct  67   YLTGPLRQSTATAAANVNAWSGAASMFPLLGAFVADAYLGRFRTILFSSLLYVLGLGLLT  126

Query  424  ISTVLP---FESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQD  594
            +S +LP   F  + +     S  QFQ+I FF +LYLVA+AQGGHKPCVQAFGADQFD ++
Sbjct  127  VSAILPSPSFPHNQNTKDHRSCLQFQIILFFVSLYLVAIAQGGHKPCVQAFGADQFDGRN  186

Query  595  PQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            P ECK+KSSFFNWWYFG      ++L ILNY+QDN +W LGF
Sbjct  187  PDECKSKSSFFNWWYFGFSGSSFISLLILNYIQDNFNWVLGF  228



>ref|XP_010245115.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X1 [Nelumbo 
nucifera]
Length=580

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 146/222 (66%), Positives = 177/222 (80%), Gaps = 5/222 (2%)
 Frame = +1

Query  70   SDAETPFLH--QDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLIS  243
            S +E+P L   +D+V+G VD+KGR   RS++G WRSASFIIGVE+AERF+YYGI+SNLIS
Sbjct  7    SISESPLLGGGEDMVEGMVDYKGRRVIRSKSGGWRSASFIIGVEMAERFAYYGIASNLIS  66

Query  244  YLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLT  423
            YLTGPL QSTA AAANVNAWSG AS+ PLLGAF+AD++LGR+RTI+ SSLLY L LG LT
Sbjct  67   YLTGPLRQSTATAAANVNAWSGAASMFPLLGAFVADAYLGRFRTILFSSLLYVLGLGLLT  126

Query  424  ISTVLP---FESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQD  594
            +S +LP   F  + +     S  QFQ+I FF +LYLVA+AQGGHKPCVQAFGADQFD ++
Sbjct  127  VSAILPSPSFPHNQNTKDHRSCLQFQIILFFVSLYLVAIAQGGHKPCVQAFGADQFDGRN  186

Query  595  PQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            P ECK+KSSFFNWWYFG      ++L ILNY+QDN +W LGF
Sbjct  187  PDECKSKSSFFNWWYFGFSGSSFISLLILNYIQDNFNWVLGF  228



>ref|XP_004499763.1| PREDICTED: probable peptide/nitrate transporter At1g22540-like 
isoform X1 [Cicer arietinum]
 ref|XP_004499764.1| PREDICTED: probable peptide/nitrate transporter At1g22540-like 
isoform X2 [Cicer arietinum]
Length=543

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 147/216 (68%), Positives = 171/216 (79%), Gaps = 12/216 (6%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            D+ETP L  + VDG VDFKGRP  RS +G W++A+FII VEVAERF+YYGI+SNLI+YLT
Sbjct  4    DSETPLL-LETVDGVVDFKGRPVLRSTSGGWKAAAFIISVEVAERFAYYGINSNLINYLT  62

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQSTA AA NVN WSG ASLLPLLGAFLADSFLGRYRTI+I+S++Y LAL  LT+S 
Sbjct  63   GPLGQSTATAAENVNIWSGTASLLPLLGAFLADSFLGRYRTILIASVIYILALSLLTLSA  122

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
             LP   SD ++ A        I FFF+LYLVA AQGGHKPCVQAFGADQFD   PQE K+
Sbjct  123  TLP---SDGESHA--------ILFFFSLYLVAFAQGGHKPCVQAFGADQFDINHPQERKS  171

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +SSFFNWWYF    G++V++ ILNYVQDN+ W LGF
Sbjct  172  RSSFFNWWYFTFTAGLLVSVSILNYVQDNIGWFLGF  207



>emb|CDY36663.1| BnaCnng07650D [Brassica napus]
Length=498

 Score =   226 bits (577),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 132/217 (61%), Positives = 169/217 (78%), Gaps = 1/217 (0%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            + AETP L + V+D +VD  G  A RS TGRW +A FIIGVEVAERF+YYGI+SNLISYL
Sbjct  3    TTAETPLLEEHVMD-AVDHDGLVADRSNTGRWTAAWFIIGVEVAERFAYYGIASNLISYL  61

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLGQSTA AAANVNAW+G++SLLP+LGAF+AD+FLGRYRTI+I+SL+Y L +G LT+S
Sbjct  62   TGPLGQSTAVAAANVNAWTGISSLLPVLGAFVADAFLGRYRTIIIASLIYVLGMGLLTLS  121

Query  430  TVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECK  609
             +L   S + +  + SP     + FFF+LYLVA+ Q GHKPCVQAFGADQFD +DP+E +
Sbjct  122  ALLVPISENKEVVSASPSSLLNVLFFFSLYLVAIGQSGHKPCVQAFGADQFDEKDPREQR  181

Query  610  AKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             +SSFFNWWY  M  G+ + + ++ Y+Q+ + W LGF
Sbjct  182  DRSSFFNWWYLSMSAGICLAIVVVVYIQEAVGWALGF  218



>ref|XP_002325970.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|EEF00352.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=596

 Score =   229 bits (583),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 147/249 (59%), Positives = 175/249 (70%), Gaps = 22/249 (9%)
 Frame = +1

Query  37   LSMAATGTTILSDAETPFLH--QDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERF  210
            LS  ++GT   S A TP +    D V+GSVD+KG P  RS +G WRSASFII VEVAERF
Sbjct  6    LSNISSGTE-RSSAATPLIEAGDDSVNGSVDYKGNPVHRSTSGGWRSASFIIAVEVAERF  64

Query  211  SYYGISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISS  390
            +Y+GISSNLI+YLTGPLGQSTA+AAANVN WSG A+LLPLLGAF+ADSFLGRYRTI+ +S
Sbjct  65   AYFGISSNLITYLTGPLGQSTASAAANVNTWSGTATLLPLLGAFVADSFLGRYRTIIAAS  124

Query  391  LLYTLALGFLTISTVLPFES---------------SDSQNGA----GSPPQFQVIffffa  513
            L+Y L+      S ++ +                  D QN       +P QFQV  FFF+
Sbjct  125  LIYILSCVRFAWSGIIRWRGLGLLTLAATLTSDSVHDFQNIKDAMLSAPSQFQVTLFFFS  184

Query  514  lylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQ  693
            +YLVA  QGGHKPC  AFGADQFD Q+P+E KAKSSFFNWWYF    GV +TL ++ Y+Q
Sbjct  185  IYLVAFGQGGHKPCALAFGADQFDGQNPKESKAKSSFFNWWYFYSSVGVNLTLVVMVYIQ  244

Query  694  DNLSWGLGF  720
            DNLSW LGF
Sbjct  245  DNLSWALGF  253



>gb|EYU22785.1| hypothetical protein MIMGU_mgv1a004125mg [Erythranthe guttata]
Length=543

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 151/224 (67%), Positives = 175/224 (78%), Gaps = 11/224 (5%)
 Frame = +1

Query  49   ATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGIS  228
            ATG+ +L DAETP L  D V G VD KGRPA RS++G W+SASFIIGVE+AERF+YYGIS
Sbjct  10   ATGSDLL-DAETPLL-DDAVRGFVDLKGRPAVRSKSGCWKSASFIIGVEMAERFAYYGIS  67

Query  229  SNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLA  408
            SNLI YLTGPLGQSTA AAANVNAWSG A L PL+GAF+ADSF G+YR+IVI+SL+Y L 
Sbjct  68   SNLIIYLTGPLGQSTATAAANVNAWSGTAFLSPLVGAFIADSFWGQYRSIVIASLVYILG  127

Query  409  LGFLTISTVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDT  588
            LG LT+S  L   SS S        Q QVIFFF +LYLVALAQGGHKP VQAFGA QFD 
Sbjct  128  LGLLTLSAAL--RSSISS-------QLQVIFFFLSLYLVALAQGGHKPSVQAFGAYQFDE  178

Query  589  QDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            ++ +E KAKSSFFNWW F +   V++ L +L+YVQ+NLSW LGF
Sbjct  179  ENERERKAKSSFFNWWNFFLSTSVLIGLLVLSYVQENLSWELGF  222



>ref|XP_010272857.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nelumbo nucifera]
Length=579

 Score =   228 bits (582),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 146/220 (66%), Positives = 177/220 (80%), Gaps = 6/220 (3%)
 Frame = +1

Query  79   ETPFLHQ-DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTG  255
            ETP L + D V+G VD+KGR   RS++G WRSA FIIGVE+AER SYYGISSNLISYLTG
Sbjct  10   ETPLLGRGDTVEGMVDYKGRRVIRSKSGGWRSAIFIIGVEMAERCSYYGISSNLISYLTG  69

Query  256  PLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTV  435
            PLGQSTA AAAN NAWSG  S+LPLLG F+AD++LGR+RTI++SSLLY L LG LT+S +
Sbjct  70   PLGQSTATAAANKNAWSGAVSMLPLLGGFVADAYLGRFRTILVSSLLYILGLGLLTVSAI  129

Query  436  LPFES----SDSQNGAGSPP-QFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQ  600
             P  S     +++N    PP QFQV FFF +LYLVALAQGGHKPCVQAFGADQFD  +P+
Sbjct  130  HPSPSLPYCQNTRNHISLPPSQFQVFFFFASLYLVALAQGGHKPCVQAFGADQFDGWNPR  189

Query  601  ECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            EC++KSSFFNWW+FG+C    +++ IL+Y+QDNL+W LGF
Sbjct  190  ECRSKSSFFNWWFFGICSSSFISIVILSYIQDNLNWVLGF  229



>ref|XP_002456710.1| hypothetical protein SORBIDRAFT_03g041190 [Sorghum bicolor]
 gb|EES01830.1| hypothetical protein SORBIDRAFT_03g041190 [Sorghum bicolor]
Length=541

 Score =   227 bits (579),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 134/223 (60%), Positives = 171/223 (77%), Gaps = 7/223 (3%)
 Frame = +1

Query  73   DAETPFL--HQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            DA T  L      V G+VDF+GRPA+RS TGRW +A F++GVE+AERF+Y+G+S+NLISY
Sbjct  2    DANTLLLPCSDGAVAGAVDFRGRPASRSGTGRWSAAMFVLGVEIAERFAYHGVSANLISY  61

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTGPLG+STA AAA +NAWSGVA++LPLL A +AD++LGRYRTIV++SLL+ +++G LT+
Sbjct  62   LTGPLGESTAGAAAAINAWSGVATMLPLLMACVADAWLGRYRTIVLASLLFVVSMGMLTV  121

Query  427  STVLPFE-----SSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQ  591
            S +  F      S  S + A SP   QV  F+ +LYLVALA+ GHKPC QAFGADQFD  
Sbjct  122  SALPAFHHDGCSSYASSSLACSPSPAQVGVFYVSLYLVALAEAGHKPCAQAFGADQFDQN  181

Query  592  DPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            DP+E  ++SSFFNWWYFGMC G  VT  + +Y+QDN+ WGLGF
Sbjct  182  DPKESVSRSSFFNWWYFGMCSGTAVTTMVSSYIQDNVGWGLGF  224



>ref|XP_009420953.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 [Musa acuminata subsp. 
malaccensis]
Length=536

 Score =   226 bits (577),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 170/213 (80%), Gaps = 6/213 (3%)
 Frame = +1

Query  100  DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaa  279
            D V G++D++GRPA+RS +GRW SA FII VE+AERF++YG+SSNLISYLTGPLG+STA+
Sbjct  13   DYVVGAIDYRGRPASRSASGRWTSALFIIAVEIAERFAFYGVSSNLISYLTGPLGESTAS  72

Query  280  aaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFES---  450
            AAA +NAW+GVA++LPLLGAFLADS+LGRYRTIVI+SLLY L+L  LT+S++LP      
Sbjct  73   AAAAINAWNGVAAMLPLLGAFLADSYLGRYRTIVIASLLYMLSLAMLTLSSLLPSLHLAK  132

Query  451  --SDSQNGAGSPPQ-FQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSS  621
                + + AG PP    V  F+ +LYL+A AQGGHKPCVQAFGADQFD   P EC AKSS
Sbjct  133  CGDTTVDPAGCPPSPSSVALFYASLYLMAFAQGGHKPCVQAFGADQFDENHPGECAAKSS  192

Query  622  FFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FFNWWY G   GV+V + +L+YVQD +SWGLGF
Sbjct  193  FFNWWYLGFSCGVLVAVVVLSYVQDYISWGLGF  225



>ref|XP_002325969.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|EEF00351.2| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=1093

 Score =   233 bits (594),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 147/210 (70%), Positives = 169/210 (80%), Gaps = 2/210 (1%)
 Frame = +1

Query  91   LHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQS  270
            L  D+VDGSVD KGRP  RS +G WRSA FIIGVEVAERF+YYGISSNLI+YLTGPLGQS
Sbjct  542  LLYDIVDGSVDHKGRPVYRSNSGGWRSAGFIIGVEVAERFAYYGISSNLITYLTGPLGQS  601

Query  271  TaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFES  450
            TA AA NVN W+G A+LLP+LGAF+ADSFLGRY TI+++SL+Y L LG LT+S +L   +
Sbjct  602  TATAAENVNLWAGTATLLPILGAFVADSFLGRYTTIIVASLIYILGLGLLTLSALLSTHT  661

Query  451  SDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFN  630
              + +   SPP FQ+I FFFALYLVA+ + GHKPC QAFGADQFD  DPQE KAKSSFFN
Sbjct  662  --APDLPCSPPPFQLILFFFALYLVAIGESGHKPCAQAFGADQFDGHDPQESKAKSSFFN  719

Query  631  WWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            WWY     G MVTL ILNY+QDNL+WGLGF
Sbjct  720  WWYCCKSGGTMVTLLILNYIQDNLNWGLGF  749


 Score =   233 bits (594),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 138/213 (65%), Positives = 166/213 (78%), Gaps = 5/213 (2%)
 Frame = +1

Query  97   QDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTa  276
            +  V+GSVD+KG P  RS +G WRSASFII VEVAERF+YYGISSNLI+YLTGPLGQSTA
Sbjct  5    EGTVNGSVDYKGNPVHRSGSGGWRSASFIIAVEVAERFAYYGISSNLITYLTGPLGQSTA  64

Query  277  aaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISS----LLYTLALGFLTISTVLPF  444
            +AA NVN WSG A+LLPLLGAF+ADSFLGRYRTI+ +S    L   L      +++V   
Sbjct  65   SAAVNVNTWSGTATLLPLLGAFVADSFLGRYRTIIAASLIYILGLGLLTLAAKLTSVNLH  124

Query  445  ESSDSQNGA-GSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSS  621
            +   +++    +PP+FQVI FFF++YLVA+ QGGHKPCVQAFG DQFD QDP+E KAKSS
Sbjct  125  DCRSTKDATLCAPPRFQVILFFFSVYLVAVGQGGHKPCVQAFGGDQFDGQDPKESKAKSS  184

Query  622  FFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FFNWWYF +  G+ VTL +L Y+QDNLSW LGF
Sbjct  185  FFNWWYFAISVGITVTLIVLVYIQDNLSWALGF  217



>ref|XP_006645087.1| PREDICTED: probable peptide/nitrate transporter At1g22540-like 
[Oryza brachyantha]
Length=544

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 127/216 (59%), Positives = 168/216 (78%), Gaps = 8/216 (4%)
 Frame = +1

Query  97   QDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTa  276
            +  V G+VDF+GR A+R+ TGRW +A F++GVE+AERF+Y+G+S+NLISYLTGPLG+STA
Sbjct  16   EGAVAGAVDFRGRAASRASTGRWSAAMFVLGVEIAERFAYHGVSANLISYLTGPLGESTA  75

Query  277  aaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLP-----  441
             AAA +N WSGVA++LPLL A +AD++LGRYRTIV++SLL+ +++G LT+S+ LP     
Sbjct  76   GAAAAINLWSGVATMLPLLVACVADAWLGRYRTIVLASLLFVVSMGMLTLSSALPAFHGG  135

Query  442  ---FESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
                 S  S++ A SP   QV  F+ +LYLVALA+ GHKPC QAFGADQFD  DP+E  +
Sbjct  136  GGGGCSYTSKSLACSPSTAQVAIFYVSLYLVALAEAGHKPCAQAFGADQFDQNDPKESVS  195

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +SSFFNWWYFGMC G  +T  + +Y+QDN+ WGLGF
Sbjct  196  RSSFFNWWYFGMCSGTAMTTMVSSYIQDNIGWGLGF  231



>ref|XP_008437001.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Cucumis melo]
 ref|XP_008437002.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Cucumis melo]
Length=585

 Score =   226 bits (577),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 165/224 (74%), Gaps = 6/224 (3%)
 Frame = +1

Query  64   ILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLIS  243
            + +  E P L  ++V+G+VD+ G P  R  +G WRSAS IIGVE+AERF++YG SSNLI+
Sbjct  1    MFNKMEAPLL-DEMVEGAVDYNGHPVCRFTSGGWRSASLIIGVEIAERFAFYGASSNLIN  59

Query  244  YLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLT  423
            +LT  L QSTA AA N+NAWSG A+LLPLLGAFLAD FLGRYRTI+ISS LY L LG LT
Sbjct  60   FLTDQLQQSTARAAKNINAWSGTAALLPLLGAFLADCFLGRYRTIIISSALYVLGLGLLT  119

Query  424  ISTVLP-FESSDSQNGAG----SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDT  588
            +S  LP    S  Q        SP   QVI FFF+LYLVA AQGGHKPCVQAFGADQFD 
Sbjct  120  VSATLPSLGISACQQTEKFLPCSPNPVQVILFFFSLYLVAFAQGGHKPCVQAFGADQFDG  179

Query  589  QDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            Q P+E KAKSSFFNWWYFG+     +T+ +++YVQD LSW LGF
Sbjct  180  QHPEESKAKSSFFNWWYFGISLAGFLTVNVMSYVQDYLSWSLGF  223



>ref|XP_003597990.1| Peptide transporter PTR3-A [Medicago truncatula]
 gb|AES68241.1| peptide/nitrate transporter plant [Medicago truncatula]
Length=547

 Score =   226 bits (575),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 167/216 (77%), Gaps = 12/216 (6%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            D ET  L  + VDG VDFKGRP  RS +G WR+A+FII VEVAERF+YYGI+SNLI+YLT
Sbjct  5    DCETRLL-LETVDGVVDFKGRPVLRSSSGGWRAAAFIISVEVAERFAYYGINSNLINYLT  63

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQSTA AA NVN WSG ASLLPLLGAFLADSFLGRYRTI+I+SL+Y LAL  LT+S 
Sbjct  64   GPLGQSTATAAENVNIWSGTASLLPLLGAFLADSFLGRYRTIIIASLVYILALSLLTLSA  123

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
             LP   SD           Q I FFF+LYLVA AQGGHKPCVQAFGADQFD   PQE ++
Sbjct  124  TLP---SDGDA--------QAILFFFSLYLVAFAQGGHKPCVQAFGADQFDINHPQERRS  172

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +SSFFNWWYF    G++VT+ ILNYVQDN+ W LGF
Sbjct  173  RSSFFNWWYFTFTAGLLVTVSILNYVQDNVGWVLGF  208



>gb|ACJ85853.1| unknown [Medicago truncatula]
Length=547

 Score =   225 bits (574),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 148/216 (69%), Positives = 167/216 (77%), Gaps = 12/216 (6%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            D ET  L  + VDG VDFKGRP  RS +G WR+A+FII VEVAERF+YYGI+SNLI+YLT
Sbjct  5    DCETRLL-LETVDGVVDFKGRPVLRSSSGGWRAAAFIISVEVAERFAYYGINSNLINYLT  63

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLGQSTA AA NVN WSG ASLLPLLGAFLADSFLGRYRTI+I+SL+Y LAL  LT+S 
Sbjct  64   GPLGQSTATAAENVNIWSGTASLLPLLGAFLADSFLGRYRTIIIASLVYILALSLLTLSA  123

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
             LP   SD           Q I FFF+LYLVA AQGGHKPCVQAFGADQFD   PQE ++
Sbjct  124  TLP---SDGDA--------QAILFFFSLYLVAFAQGGHKPCVQAFGADQFDINHPQERRS  172

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +SSFFNWWYF    G++VT+ ILNYVQDN+ W LGF
Sbjct  173  RSSFFNWWYFTFTAGLLVTVSILNYVQDNVGWVLGF  208



>ref|XP_002521802.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF40612.1| oligopeptide transporter, putative [Ricinus communis]
Length=393

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 142/231 (61%), Positives = 172/231 (74%), Gaps = 17/231 (7%)
 Frame = +1

Query  37   LSMAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSY  216
            +++A+  +   ++A+TP L+ DVV+GSVD+K     R  +G WRSAS II          
Sbjct  1    MAIASIISESTAEAQTPLLY-DVVEGSVDYKAGAVFRYNSGGWRSASLII----------  49

Query  217  YGISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLL  396
               +SNLI+YLTGPLGQSTA AA NVNAWSG ASLLPLLGA +AD+FLGRYRTI+++SL+
Sbjct  50   ---ASNLITYLTGPLGQSTAFAAENVNAWSGTASLLPLLGASIADTFLGRYRTIIVASLI  106

Query  397  YTLALGFLTISTVLPFES---SDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAF  567
            Y L LG LT+S VLP  S   S     + SP   QV+ FF +LYLVAL QGGHKPCVQAF
Sbjct  107  YILGLGLLTLSAVLPSLSDCPSTKSTASCSPNPIQVVLFFSSLYLVALGQGGHKPCVQAF  166

Query  568  GADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            GADQFD QDP+ECK KSSFFNWWYF MC G ++TLW+LNY+QDNL+WGLGF
Sbjct  167  GADQFDGQDPKECKGKSSFFNWWYFCMCGGTLITLWVLNYIQDNLNWGLGF  217



>ref|XP_011654838.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Cucumis sativus]
Length=565

 Score =   225 bits (574),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 135/219 (62%), Positives = 161/219 (74%), Gaps = 6/219 (3%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E P L  + V+G+VD+ G P  R  +G WRSAS IIGVEVAERF++YG SSNLI++LT  
Sbjct  2    EAPLL-DETVEGAVDYNGHPVCRFNSGGWRSASLIIGVEVAERFAFYGASSNLINFLTDQ  60

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            L QSTA AA NVN WSG A+LLPLLGAFLAD FLGRYRTIV+SS LY L LG LT+S  L
Sbjct  61   LQQSTAMAAKNVNIWSGTAALLPLLGAFLADCFLGRYRTIVLSSALYVLGLGLLTLSAAL  120

Query  439  PFESSDSQNGAG-----SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQE  603
            P     + +        SP   QVI FFF+LYL+A  +GGH+PC+QAFGADQFD Q P+E
Sbjct  121  PSLGISACHETEKFLPCSPNPVQVILFFFSLYLLACGKGGHEPCIQAFGADQFDGQHPEE  180

Query  604  CKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             KAKSSFFNWWY G+    ++T+ I++YVQDNLSW LGF
Sbjct  181  RKAKSSFFNWWYLGISLACLLTVNIMSYVQDNLSWSLGF  219



>ref|NP_001044938.2| Os01g0871500 [Oryza sativa Japonica Group]
 dbj|BAD81722.1| putative oligopeptide transporter [Oryza sativa Japonica Group]
 dbj|BAD82709.1| putative oligopeptide transporter [Oryza sativa Japonica Group]
 gb|EEC71879.1| hypothetical protein OsI_04603 [Oryza sativa Indica Group]
 gb|EEE55742.1| hypothetical protein OsJ_04242 [Oryza sativa Japonica Group]
 dbj|BAF06852.2| Os01g0871500 [Oryza sativa Japonica Group]
Length=545

 Score =   224 bits (572),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 125/215 (58%), Positives = 168/215 (78%), Gaps = 7/215 (3%)
 Frame = +1

Query  97   QDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTa  276
            +  V G+VDF+GRPA+R+ TGRW +A F++GVE+AERF+Y+G+S+NLISYLTGPLG+STA
Sbjct  16   EGAVAGAVDFRGRPASRASTGRWSAAMFVLGVEIAERFAYHGVSANLISYLTGPLGESTA  75

Query  277  aaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSD  456
             AAA +N WSGVA++LPLL A +AD++LGRYRTIV++SLL+ +++G LT+S+ LP    D
Sbjct  76   GAAAAINLWSGVATMLPLLVACVADAWLGRYRTIVLASLLFVVSMGMLTLSSALPAFHGD  135

Query  457  -------SQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAK  615
                   S++ + +P   QV  F+ +LYLVALA+ GHKPC QAFGADQFD  D +E  ++
Sbjct  136  GGGCSYTSKSLSCAPSTAQVAIFYVSLYLVALAEAGHKPCAQAFGADQFDQNDAKESVSR  195

Query  616  SSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            SSFFNWWYFGMC G  +T  + +Y+QDN+ WGLGF
Sbjct  196  SSFFNWWYFGMCSGTAMTTMVSSYIQDNIGWGLGF  230



>dbj|BAK03342.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=551

 Score =   224 bits (572),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 165/211 (78%), Gaps = 6/211 (3%)
 Frame = +1

Query  106  VDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaa  285
            V G VDF+G PA R+ TGRW +A F++GVE+AERF+Y+G+S+NLISYLTGPLG+STA AA
Sbjct  16   VPGVVDFRGGPAPRASTGRWSAAMFVLGVEIAERFAYHGVSANLISYLTGPLGESTAGAA  75

Query  286  anvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSD---  456
            A +NAWSGVA++LPLL A +AD++LGR+RTIV++S+L+ +++G LT+S+ LP   SD   
Sbjct  76   AAINAWSGVATMLPLLVACVADAWLGRFRTIVLASILFVVSMGMLTLSSALPVFHSDGCT  135

Query  457  ---SQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFF  627
               S +GA SP   QV  F+ +LYLVALA+ GHKPC QAFGADQFD   P+E  ++SSFF
Sbjct  136  SFTSLSGACSPSPVQVTIFYVSLYLVALAEAGHKPCAQAFGADQFDQHHPEESVSRSSFF  195

Query  628  NWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            NWWYFGMC G   T  + +Y+QDN+ WGLGF
Sbjct  196  NWWYFGMCSGTAATTMVSSYIQDNIGWGLGF  226



>emb|CDM85179.1| unnamed protein product [Triticum aestivum]
Length=549

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 165/211 (78%), Gaps = 6/211 (3%)
 Frame = +1

Query  106  VDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaa  285
            V G VDF+G PA R+ TGRW +A F++GVE+AERF+Y+G+S+NLISYLTGPLG+STA AA
Sbjct  16   VPGVVDFRGGPAPRASTGRWSAAMFVLGVEIAERFAYHGVSANLISYLTGPLGESTAGAA  75

Query  286  anvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSD---  456
            A +NAWSGVA++LPLL A +AD++LGR+RTIV++S+L+ +++G LT+S+ LP   SD   
Sbjct  76   AAINAWSGVATMLPLLVACVADAWLGRFRTIVLASVLFVVSMGMLTLSSALPVFHSDGCT  135

Query  457  ---SQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFF  627
               S +GA SP   QV  F+ +LYLVALA+ GHKPC QAFGADQFD   P+E  ++SSFF
Sbjct  136  SFTSLSGACSPSPVQVTIFYVSLYLVALAEAGHKPCAQAFGADQFDQHHPEESVSRSSFF  195

Query  628  NWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            NWWYFGMC G   T  + +Y+QDN+ WGLGF
Sbjct  196  NWWYFGMCSGTAATTMVSSYIQDNIGWGLGF  226



>emb|CDX68286.1| BnaA07g23260D [Brassica napus]
Length=379

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 166/217 (76%), Gaps = 1/217 (0%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            +  ETP L + V+D +VD  G  A RS TGRW +A FIIGVEVAERF+YYGI+SNLISYL
Sbjct  3    TTVETPLLEEHVMD-AVDHDGLVADRSNTGRWTAAWFIIGVEVAERFAYYGIASNLISYL  61

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLGQSTA AAANVNAWSG++SLLP+LGAF+AD+FLGRYRTI+I+SL+Y L +  LT+S
Sbjct  62   TGPLGQSTAVAAANVNAWSGISSLLPVLGAFVADAFLGRYRTIIIASLVYVLGMALLTLS  121

Query  430  TVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECK  609
             +L   S + +  + SP     + FFF+LYLVA+ Q GHKPCVQAFGADQFD +D QE +
Sbjct  122  ALLVPISENKEVVSASPSSLLNVLFFFSLYLVAVGQSGHKPCVQAFGADQFDEKDTQEKR  181

Query  610  AKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             +SSFFNWWY  +  G+ + + ++ Y+Q+ + W LGF
Sbjct  182  ERSSFFNWWYLSLSAGICLAIVVVVYIQEAVGWALGF  218



>ref|XP_012075471.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Jatropha curcas]
 gb|KDP35100.1| hypothetical protein JCGZ_10942 [Jatropha curcas]
Length=552

 Score =   224 bits (571),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 133/219 (61%), Positives = 162/219 (74%), Gaps = 7/219 (3%)
 Frame = +1

Query  64   ILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLIS  243
            + +D  +P + +D V+GSVD+ GRP  RS +G WRSASFII  EVAERF+YYGI+SNLI+
Sbjct  5    VTADNTSPLMEEDTVNGSVDYNGRPVYRSSSGGWRSASFIIAAEVAERFAYYGIASNLIT  64

Query  244  YLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLT  423
            YLTG LGQS AAAA NVN WSG  +LLPLLGA +ADSFLGRYRTI+ +S++Y L LG LT
Sbjct  65   YLTGSLGQSMAAAAENVNTWSGTTTLLPLLGAVVADSFLGRYRTIIYASIIYILGLGLLT  124

Query  424  ISTVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQE  603
            +S  L   S D      SPP  QVI FFF+LYLVA+ QGGHKPCVQAFGADQFD Q P+E
Sbjct  125  VSGAL--TSHDV-----SPPWSQVILFFFSLYLVAVGQGGHKPCVQAFGADQFDGQHPKE  177

Query  604  CKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             + KSSFFNW+Y     G+ + L  + Y+Q+N+ W  GF
Sbjct  178  SREKSSFFNWYYCTSSAGINLALIAVVYIQENVDWVFGF  216



>ref|XP_011656124.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Cucumis sativus]
Length=568

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 163/221 (74%), Gaps = 6/221 (3%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            D  TP L  D+VDG+VD+KG+P  RS +  WRSASFIIG+EVAERFS+YGI +NLI+YLT
Sbjct  8    DHATPLL-TDMVDGAVDYKGQPLLRSSSATWRSASFIIGMEVAERFSFYGIGANLITYLT  66

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLG S  AAA  VN W+  + LL L GAFLADSF GRYRTIV +S+ Y L LG L +ST
Sbjct  67   GPLGISVVAAAEIVNVWAATSMLLTLFGAFLADSFFGRYRTIVFASISYILGLGLLVLST  126

Query  433  VLPFESSD-----SQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDP  597
            +LP  SS      ++    S P+  +I FF +L L+ +AQGGH+PCVQAFGADQFD Q+P
Sbjct  127  LLPTPSSSICAILNKFTPCSSPKLHLILFFLSLCLIGIAQGGHRPCVQAFGADQFDPQNP  186

Query  598  QECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            QE K KSSFFNWWYFG CFG++  +  ++Y Q+NLSW +GF
Sbjct  187  QEAKFKSSFFNWWYFGACFGIVAAIPTVSYAQENLSWAVGF  227



>ref|XP_007020107.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY17332.1| Major facilitator superfamily protein isoform 2 [Theobroma cacao]
Length=573

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 150/231 (65%), Positives = 178/231 (77%), Gaps = 7/231 (3%)
 Frame = +1

Query  43   MAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYG  222
            MA   TT   + + P L + VV+GSVD KG PA RS +G WRSASFII VEVAERF+ +G
Sbjct  1    MAIVSTT--CNTQDPLLEETVVNGSVDCKGCPARRSTSGGWRSASFIIAVEVAERFACFG  58

Query  223  ISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYT  402
            ISSNLI+YLTGPLGQSTA AA NVNAWSG A+LLPLLGAF+AD++LGRYRTI+ISSL+Y 
Sbjct  59   ISSNLITYLTGPLGQSTATAAENVNAWSGTATLLPLLGAFVADAYLGRYRTIIISSLIYI  118

Query  403  LALGFLTISTVLPFESS-DSQN----GAGSPPQFQVIffffalylvalaQGGHKPCVQAF  567
            L LG LT+S +L   S+ D QN     + S PQ  V  F F+LYLVA+ QGGHKPCVQAF
Sbjct  119  LGLGLLTLSAMLTSLSNLDCQNTNNITSCSTPQILVFSFIFSLYLVAIGQGGHKPCVQAF  178

Query  568  GADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            GADQFD  DP+E  A+SSFFNWWYF +  GV+++L I+ Y+QDNLSW LGF
Sbjct  179  GADQFDGNDPKESIARSSFFNWWYFTLSTGVLLSLVIIVYIQDNLSWALGF  229



>gb|KGN52718.1| hypothetical protein Csa_5G652240 [Cucumis sativus]
Length=585

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 132/221 (60%), Positives = 163/221 (74%), Gaps = 6/221 (3%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            D  TP L  D+VDG+VD+KG+P  RS +  WRSASFIIG+EVAERFS+YGI +NLI+YLT
Sbjct  8    DHATPLL-TDMVDGAVDYKGQPLLRSSSATWRSASFIIGMEVAERFSFYGIGANLITYLT  66

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLG S  AAA  VN W+  + LL L GAFLADSF GRYRTIV +S+ Y L LG L +ST
Sbjct  67   GPLGISVVAAAEIVNVWAATSMLLTLFGAFLADSFFGRYRTIVFASISYILGLGLLVLST  126

Query  433  VLPFESSD-----SQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDP  597
            +LP  SS      ++    S P+  +I FF +L L+ +AQGGH+PCVQAFGADQFD Q+P
Sbjct  127  LLPTPSSSICAILNKFTPCSSPKLHLILFFLSLCLIGIAQGGHRPCVQAFGADQFDPQNP  186

Query  598  QECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            QE K KSSFFNWWYFG CFG++  +  ++Y Q+NLSW +GF
Sbjct  187  QEAKFKSSFFNWWYFGACFGIVAAIPTVSYAQENLSWAVGF  227



>ref|XP_007020106.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY17331.1| Major facilitator superfamily protein isoform 1 [Theobroma cacao]
Length=573

 Score =   224 bits (570),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 150/231 (65%), Positives = 177/231 (77%), Gaps = 7/231 (3%)
 Frame = +1

Query  43   MAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYG  222
            MA   TT   + + P L   VV GSVD +G PA RS +G WRSASFII VEVAERF+Y+G
Sbjct  1    MAIVSTT--CNTQAPLLEDTVVYGSVDCQGCPARRSTSGGWRSASFIIAVEVAERFAYFG  58

Query  223  ISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYT  402
            ISSNLI+YLTGPLGQSTA AA NVNAWSG A+LLPLLGAF+AD++LGRYRTI+ISSL+Y 
Sbjct  59   ISSNLITYLTGPLGQSTATAAENVNAWSGTATLLPLLGAFVADAYLGRYRTIIISSLIYI  118

Query  403  LALGFLTISTVLPFESS-DSQN----GAGSPPQFQVIffffalylvalaQGGHKPCVQAF  567
            L LG LT+S +L   S+ D QN     + S PQ  V  F F+LYLVA+ QGGHKPCVQAF
Sbjct  119  LGLGLLTLSAMLTSLSNLDCQNTNNITSCSTPQILVFSFIFSLYLVAIGQGGHKPCVQAF  178

Query  568  GADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            GADQFD  DP+E  A+SSFFNWWYF +  GV+++L I+ Y+QDNLSW LGF
Sbjct  179  GADQFDGNDPKESIARSSFFNWWYFTLSTGVLLSLVIIVYIQDNLSWALGF  229



>ref|XP_004506379.1| PREDICTED: probable peptide/nitrate transporter At1g22540-like 
[Cicer arietinum]
Length=570

 Score =   223 bits (569),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 144/230 (63%), Positives = 166/230 (72%), Gaps = 10/230 (4%)
 Frame = +1

Query  43   MAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYG  222
            MA T   +L D         VVDG VD+KG+P  RS++G WRSA +IIGVEVAER SYYG
Sbjct  1    MAETEDVLLED------ELAVVDGVVDYKGQPVIRSKSGYWRSAWYIIGVEVAERVSYYG  54

Query  223  ISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYT  402
            I  NLISYLTGPL QSTA AA NVN W+G ASLLPL GAF+ADS LGRY TI+++SL+Y 
Sbjct  55   IQGNLISYLTGPLNQSTATAAENVNIWAGTASLLPLFGAFVADSLLGRYHTIILASLIYI  114

Query  403  LALGFLTISTVLP-FESSDSQNGAG---SPPQFQVIffffalylvalaQGGHKPCVQAFG  570
            L LG LT+S +LP    S  Q  +       Q QV+ FF +LYLVA+ QGGHKPCVQAFG
Sbjct  115  LGLGLLTLSAMLPSLTKSKCQVDSKFIFCSSQSQVVLFFISLYLVAIGQGGHKPCVQAFG  174

Query  571  ADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            ADQFD Q P+E KA+SSFFNWWYF M  G  VTL +LNY+QDN SW LGF
Sbjct  175  ADQFDEQHPKELKARSSFFNWWYFTMVAGCTVTLAVLNYIQDNYSWVLGF  224



>gb|KEH29309.1| proton-dependent oligopeptide transport family protein [Medicago 
truncatula]
Length=557

 Score =   222 bits (566),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 161/206 (78%), Gaps = 7/206 (3%)
 Frame = +1

Query  103  VVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaa  282
            VVDG VD++G+PA RS+TG WRSA FIIGVE+AER SYYGI  NLISYLTGPL QSTA A
Sbjct  15   VVDGVVDYRGQPAVRSKTGYWRSAWFIIGVEMAERASYYGIQGNLISYLTGPLKQSTAKA  74

Query  283  aanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSDSQ  462
            A NVN W+G ASLLPL GAF+ADSFLGRYRTI+++SL+Y L LG LT+S +LP  +S S 
Sbjct  75   AENVNIWAGTASLLPLFGAFIADSFLGRYRTIMLASLIYILGLGLLTLSAMLPSLTSCST  134

Query  463  NGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYF  642
                   Q QVI FF +LYLVA+ QGGHKPCVQAFGADQFD + P+E KA+SSFFNWWYF
Sbjct  135  -------QSQVILFFISLYLVAIGQGGHKPCVQAFGADQFDEKYPKEHKARSSFFNWWYF  187

Query  643  GMCFGVMVTLWILNYVQDNLSWGLGF  720
             M  G   TL IL Y+QDN SW LGF
Sbjct  188  TMVAGAAATLSILTYIQDNYSWVLGF  213



>gb|AFW78190.1| hypothetical protein ZEAMMB73_551902 [Zea mays]
Length=567

 Score =   222 bits (566),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 128/202 (63%), Positives = 158/202 (78%), Gaps = 4/202 (2%)
 Frame = +1

Query  127  KGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanvnaws  306
            +GRPA+R+ TG W+SASFII VE+AERFS+YG+S+NLI++LTGPLG+  AAAAA +NAW+
Sbjct  27   RGRPASRATTGGWKSASFIIAVEIAERFSFYGVSANLITFLTGPLGEGVAAAAAAINAWN  86

Query  307  gvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSDSQNGAG----  474
            G A LLPLLG  LAD +LGRYRTIV++S++Y L LG L  ST L   S      AG    
Sbjct  87   GTAQLLPLLGGTLADKWLGRYRTIVLASVVYILGLGMLAFSTFLSSGSGHQCTAAGGQIC  146

Query  475  SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYFGMCF  654
            +P   +V FF+ +LY+VA+AQGGHKPCVQAFGADQFD  DP+E  ++SSFFNWWYFGMC 
Sbjct  147  APSGLKVTFFYVSLYIVAVAQGGHKPCVQAFGADQFDQTDPKETVSRSSFFNWWYFGMCA  206

Query  655  GVMVTLWILNYVQDNLSWGLGF  720
            G  VTL +L+YVQDN+ WGLGF
Sbjct  207  GTAVTLVLLSYVQDNIGWGLGF  228



>ref|XP_010428074.1| PREDICTED: protein NRT1/ PTR FAMILY 5.14 [Camelina sativa]
Length=566

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 133/215 (62%), Positives = 163/215 (76%), Gaps = 1/215 (0%)
 Frame = +1

Query  79   ETPFL-HQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTG  255
            ET  L  ++ V  +VD +G  A RS TGRWR+A FIIGVEVAERF+YYGI+SNLISYLTG
Sbjct  6    ETSLLKEEEYVTDAVDHRGISARRSNTGRWRAAWFIIGVEVAERFAYYGIASNLISYLTG  65

Query  256  PLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTV  435
            PLGQSTAAAAANVNAWSG+A+LLPLLGAF+AD+FLGRYRTI+++SL+Y L L FLT+S  
Sbjct  66   PLGQSTAAAAANVNAWSGIATLLPLLGAFVADAFLGRYRTIIVASLIYVLGLAFLTLSAF  125

Query  436  LPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAK  615
            +   S + +  + SP       FFF+LYLVA+ Q GHKPCVQAFGADQFD +DPQE   +
Sbjct  126  MIPNSDEGEVTSSSPSSLLNALFFFSLYLVAIGQSGHKPCVQAFGADQFDEKDPQEKSDR  185

Query  616  SSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            SSFFNWWY  M  G+ + + ++ Y+Q   SW  GF
Sbjct  186  SSFFNWWYLSMSAGICLAILVVVYIQQEFSWAFGF  220



>ref|XP_010428067.1| PREDICTED: protein NRT1/ PTR FAMILY 5.13-like isoform X1 [Camelina 
sativa]
Length=558

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 133/214 (62%), Positives = 162/214 (76%), Gaps = 3/214 (1%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E   L ++ V G+VD +G  A RS TGRWR+A FIIGVEVAERF+Y+GI+SNLISYLTGP
Sbjct  6    EATLLTEEYVTGAVDHRGIAARRSNTGRWRAAWFIIGVEVAERFAYFGIASNLISYLTGP  65

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            LGQSTA AA NVNAWSG+A+LLPLLGAF+AD+FLGRYRTI+ISS +Y L L FLT+S   
Sbjct  66   LGQSTAVAAVNVNAWSGIATLLPLLGAFVADAFLGRYRTIIISSFIYVLGLAFLTLSA--  123

Query  439  PFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKS  618
             F   ++  G+ SP      FFFF+LYLVA+ Q GHKPCVQAFGADQFD +D QE   +S
Sbjct  124  -FLIPNTTEGSSSPSSLLNAFFFFSLYLVAIGQSGHKPCVQAFGADQFDEKDSQERSDRS  182

Query  619  SFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            SFFNWWY  M  G+ + + ++ Y+Q+  SW LGF
Sbjct  183  SFFNWWYLSMSAGIGLAILVVVYIQEYFSWALGF  216



>emb|CBI39330.3| unnamed protein product [Vitis vinifera]
Length=572

 Score =   222 bits (565),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 177/224 (79%), Gaps = 6/224 (3%)
 Frame = +1

Query  64   ILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLIS  243
            IL  +ET  L +D VDG++D KG PA RS +G WRSA FIIG EV ERF+YYGI +NLI+
Sbjct  6    ILGGSET-LLVEDSVDGTIDHKGCPAKRSSSGGWRSAYFIIGAEVLERFAYYGIGTNLIN  64

Query  244  YLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLT  423
            YLTGPLGQSTA AAANVN+W G ++++ LLGAF+ADS+LGRYRTIVI+SLLY L LG LT
Sbjct  65   YLTGPLGQSTAVAAANVNSWFGTSTIVTLLGAFVADSYLGRYRTIVIASLLYILGLGLLT  124

Query  424  ISTVLPFESS-DSQN----GAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDT  588
            +S VLPF+S+ D QN     + SPP+ ++IFFF +LYLVA+AQGG+KPC QA GADQFD 
Sbjct  125  LSAVLPFQSTFDCQNTHQSTSCSPPELRIIFFFISLYLVAVAQGGYKPCTQALGADQFDG  184

Query  589  QDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            Q+ +E KAKSSFFNWW F +     V+  IL+Y+QDNLSWGLGF
Sbjct  185  QNREENKAKSSFFNWWLFCLSACTSVSYVILSYIQDNLSWGLGF  228



>ref|XP_002521809.1| oligopeptide transporter, putative [Ricinus communis]
 gb|EEF40619.1| oligopeptide transporter, putative [Ricinus communis]
Length=1070

 Score =   227 bits (578),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 134/210 (64%), Positives = 165/210 (79%), Gaps = 5/210 (2%)
 Frame = +1

Query  106  VDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaa  285
            +DGSVD++GRP  RS +G WRSASFI  VEVAERF+YYGISSNLI+YLTG LGQSTAAAA
Sbjct  567  IDGSVDYEGRPVHRSISGGWRSASFITAVEVAERFAYYGISSNLITYLTGSLGQSTAAAA  626

Query  286  anvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL-PFESSDSQ  462
             +VN WSGVA+LLPLLG  +AD FLGRY TI+++SL+Y L LG LT+S  L   ++ D +
Sbjct  627  ESVNTWSGVAALLPLLGGVVADFFLGRYLTIILASLVYILGLGMLTLSAALTSLDAHDCK  686

Query  463  N----GAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFN  630
                  + SPP + VI FFF+LYLVA+ QGGHKPCVQAFGADQFD + P E  AKSSFFN
Sbjct  687  TTKTGTSCSPPWYHVILFFFSLYLVAIGQGGHKPCVQAFGADQFDGKHPNESIAKSSFFN  746

Query  631  WWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            WW+F +  G++VTL ++ Y+Q+NL+W LGF
Sbjct  747  WWFFSLSAGIIVTLMVVVYIQENLNWVLGF  776


 Score =   218 bits (556),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 140/211 (66%), Positives = 169/211 (80%), Gaps = 6/211 (3%)
 Frame = +1

Query  91   LHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQS  270
            L +D VDGSVD+ GRPA RS +G WRS+SFII VEVAERF+Y+GISSNLI+YLTG LGQS
Sbjct  24   LLEDKVDGSVDYNGRPAHRSSSGGWRSSSFIIAVEVAERFAYFGISSNLITYLTGYLGQS  83

Query  271  TaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFES  450
            TA AA NVN WSG A+LLPLLGA +ADSFLGRY TI++SS++Y L LG LT+S      +
Sbjct  84   TATAAENVNTWSGTATLLPLLGAAIADSFLGRYCTIIVSSVIYVLGLGLLTLSA-----A  138

Query  451  SDSQNGAG-SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFF  627
            S S +G   SPP +QVI FFF+LYLVA+ QGGHKPCV AFGADQFD +DP+E  AKSSFF
Sbjct  139  STSLDGKSCSPPWYQVILFFFSLYLVAVGQGGHKPCVLAFGADQFDGKDPRESIAKSSFF  198

Query  628  NWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            NWWYF +  G+ +TL ++ Y+Q+NL+W LGF
Sbjct  199  NWWYFSLSVGITLTLVVVVYIQENLNWVLGF  229



>ref|XP_009127898.1| PREDICTED: protein NRT1/ PTR FAMILY 5.13-like isoform X1 [Brassica 
rapa]
Length=522

 Score =   220 bits (561),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 168/221 (76%), Gaps = 5/221 (2%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            S AETP L + V D +VD    PA RS TGRW +A FIIGVEVAERF+YYGI+SNLI+YL
Sbjct  3    STAETPLLEEYVTD-AVDHGELPAGRSSTGRWSAAWFIIGVEVAERFAYYGIASNLINYL  61

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLG STA AA+NVNAWSG++ LLP+LGAF+AD+FLGRYRTI+I+SL+Y L L  LT+S
Sbjct  62   TGPLGLSTAVAASNVNAWSGISCLLPVLGAFVADAFLGRYRTIIIASLVYVLGLALLTLS  121

Query  430  TVLPFESSDSQNGA----GSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDP  597
            T L   S+ S++ A     SP     + FFF+LYLVA+ Q GHKPCVQAFGADQFD +DP
Sbjct  122  TCLVPISTPSEHIASVASSSPSSLLNLLFFFSLYLVAIGQSGHKPCVQAFGADQFDEKDP  181

Query  598  QECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +E   +SSFFNWWY  MC GV + + ++ Y+Q+ +SW LGF
Sbjct  182  KERLERSSFFNWWYLSMCAGVSLAILVVVYIQEAVSWALGF  222



>gb|KEH29306.1| proton-dependent oligopeptide transport family protein [Medicago 
truncatula]
 gb|KEH29307.1| proton-dependent oligopeptide transport family protein [Medicago 
truncatula]
Length=559

 Score =   221 bits (563),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 162/206 (79%), Gaps = 7/206 (3%)
 Frame = +1

Query  103  VVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaa  282
            +VDG VD KG+ A RS+TG WRSA FIIGVEVAER SYYGI  NLISYLTGPL QSTA A
Sbjct  15   LVDGVVDCKGQQAVRSKTGYWRSAWFIIGVEVAERVSYYGIQGNLISYLTGPLKQSTATA  74

Query  283  aanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSDSQ  462
            A NVN W+GVASLLPL GAF+ADSFLGRYRTI+++SL+Y L LG LT+S +LP  +S S 
Sbjct  75   AENVNIWAGVASLLPLFGAFVADSFLGRYRTIILASLIYILGLGLLTLSAMLPSLTSCS-  133

Query  463  NGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYF  642
                  P+ QVI FF +LYLVA+ QGGHKPCVQAFGADQFD + P+E +A+SSFFNWWYF
Sbjct  134  ------PESQVILFFISLYLVAIGQGGHKPCVQAFGADQFDEKHPKEHRARSSFFNWWYF  187

Query  643  GMCFGVMVTLWILNYVQDNLSWGLGF  720
             M  G    L ILNY+QDN+SW LGF
Sbjct  188  TMIAGCTSILTILNYIQDNISWVLGF  213



>ref|XP_010272859.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Nelumbo nucifera]
Length=578

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 141/223 (63%), Positives = 178/223 (80%), Gaps = 6/223 (3%)
 Frame = +1

Query  70   SDAETPFLHQ-DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            S +ETP L   + V+G VD++GR   RS++G WRSA FIIGVE+AER SYYGISSNLISY
Sbjct  7    STSETPLLGGGETVEGMVDYEGRRVIRSKSGGWRSAIFIIGVEMAERGSYYGISSNLISY  66

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTGPLGQSTA AAAN+NAWSG  S+LP+LG F+AD++LGR+RTI+ +SLLY L LG LT 
Sbjct  67   LTGPLGQSTATAAANMNAWSGAVSMLPMLGGFVADAYLGRFRTILFASLLYILGLGLLTT  126

Query  427  STVLPFES----SDSQNGAGSPP-QFQVIffffalylvalaQGGHKPCVQAFGADQFDTQ  591
            S + P  S     +++N +  PP QFQ+ FFF +LYLVALAQGGHKPCVQAFGADQF+ +
Sbjct  127  SVIHPSPSLPHCQNTRNHSSCPPSQFQIFFFFGSLYLVALAQGGHKPCVQAFGADQFEGR  186

Query  592  DPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +P+ECK+KSSFFNWW FG+C    +++ +L+Y+QDNL+W LGF
Sbjct  187  NPEECKSKSSFFNWWVFGVCSSTFISVVVLSYIQDNLNWDLGF  229



>gb|KJB29710.1| hypothetical protein B456_005G116000 [Gossypium raimondii]
Length=504

 Score =   219 bits (557),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 138/196 (70%), Positives = 157/196 (80%), Gaps = 6/196 (3%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            S A+TP L  D +DG +D+KGRP  RS +G W SASFII VE+AERF+YYGISSNLI+YL
Sbjct  7    SAAQTPLLD-DTIDGCLDYKGRPVRRSSSGCWISASFIIVVEIAERFAYYGISSNLITYL  65

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLG+STA AAA VNAW+G ASLLPLLGAF+ADSFLGRYRTI+++SL+Y L LG L +S
Sbjct  66   TGPLGESTATAAAQVNAWNGAASLLPLLGAFIADSFLGRYRTIILASLVYILGLGLLALS  125

Query  430  TVL-PFESSDSQN----GAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQD  594
              L    SS  QN       S  QFQVI FF +LYLVA AQGGHKPCVQAFGADQFDTQD
Sbjct  126  ATLGSISSSGGQNADDIALSSSLQFQVILFFSSLYLVAFAQGGHKPCVQAFGADQFDTQD  185

Query  595  PQECKAKSSFFNWWYF  642
            P+ECKAK+SFFNWWYF
Sbjct  186  PEECKAKTSFFNWWYF  201



>emb|CDY03659.1| BnaA02g15780D [Brassica napus]
Length=522

 Score =   219 bits (558),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 135/221 (61%), Positives = 167/221 (76%), Gaps = 5/221 (2%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            S AETP L + V D +VD    PA RS TGRW +A FIIGVEVAERF+YYGI+SNLI+YL
Sbjct  3    STAETPLLEEYVTD-AVDHGELPAGRSSTGRWSAAWFIIGVEVAERFAYYGIASNLINYL  61

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLG STA AA+NVNAWSG++ LLP+LGAF+AD+FLGRYRTI+I+SL+Y L L  LT+S
Sbjct  62   TGPLGLSTAVAASNVNAWSGISCLLPVLGAFVADAFLGRYRTIIIASLVYVLGLALLTLS  121

Query  430  TVLPFESSDSQNGA----GSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDP  597
            T L   S+ S++ A     SP     + FFF+LYLVA+ Q GHKPCVQAFGADQFD +DP
Sbjct  122  TCLVPISTPSEHIASVASSSPSSLLNLLFFFSLYLVAIGQSGHKPCVQAFGADQFDEKDP  181

Query  598  QECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +E   +SSFFNWWY  MC GV + + ++ Y+Q+ +SW  GF
Sbjct  182  KERLERSSFFNWWYLSMCAGVTLAILVVVYIQEAVSWAFGF  222



>gb|KFK44350.1| hypothetical protein AALP_AA1G246200 [Arabis alpina]
Length=565

 Score =   220 bits (560),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 127/220 (58%), Positives = 167/220 (76%), Gaps = 2/220 (1%)
 Frame = +1

Query  67   LSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            + + E  FL +D V  SVD +G PA +S TG WRS+ FIIGVEVAERF+Y+GI+SNLI+Y
Sbjct  3    IPEQEVTFLEEDDVSDSVDHRGFPAGKSSTGGWRSSWFIIGVEVAERFAYFGIASNLITY  62

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTGPLGQSTA AA NVN WSG AS+LP+LGAF+AD++LGRYRTI+++S +Y + LG LT+
Sbjct  63   LTGPLGQSTATAAVNVNTWSGTASILPILGAFVADAYLGRYRTILVASFIYIIGLGLLTL  122

Query  427  STVLPFES-SDSQNGAGSPPQFQV-IffffalylvalaQGGHKPCVQAFGADQFDTQDPQ  600
            S+ L      + +N   + P F V I FF +LYLVA+ QGGHKPCVQAFGADQFD+ D +
Sbjct  123  SSFLIIMGLVEKRNDVSAKPSFWVNILFFCSLYLVAIGQGGHKPCVQAFGADQFDSGDSK  182

Query  601  ECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            E  ++ SFFNWW+  +  G+ +++ ++ YVQDN+SW LGF
Sbjct  183  ERISRGSFFNWWFLSLSAGITLSIIVVVYVQDNVSWALGF  222



>ref|XP_006302084.1| hypothetical protein CARUB_v10020071mg [Capsella rubella]
 gb|EOA34982.1| hypothetical protein CARUB_v10020071mg [Capsella rubella]
Length=564

 Score =   219 bits (559),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 135/211 (64%), Positives = 163/211 (77%), Gaps = 3/211 (1%)
 Frame = +1

Query  94   HQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQST  273
             ++ V  +VD +G  A RS TGRWR+A FIIGVEVAERF+YYGI SNLISYLTGPLGQST
Sbjct  14   EEEYVTDAVDHRGIAARRSSTGRWRAAWFIIGVEVAERFAYYGIGSNLISYLTGPLGQST  73

Query  274  aaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL-PFES  450
            AAAAANVNAWSG+A++LPLLGAF+AD+FLGRYRTI+I+SL+Y L L FLT+S  L P  S
Sbjct  74   AAAAANVNAWSGIATVLPLLGAFVADAFLGRYRTIIIASLIYVLGLAFLTLSAFLVPMTS  133

Query  451  SDSQNGAGSPPQFQV-IffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFF  627
             DS     SPP F +   FFF+LYLVA+ Q GHKPCVQAFGADQFD +D QE   +SSFF
Sbjct  134  KDSTQ-VTSPPSFLLNALFFFSLYLVAIGQSGHKPCVQAFGADQFDEKDSQEIFDRSSFF  192

Query  628  NWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            NWWY  M  G+ + + ++ Y+Q+  SW +GF
Sbjct  193  NWWYLSMSAGICLAILVVVYIQEEFSWAVGF  223



>emb|CDY65668.1| BnaCnng48110D [Brassica napus]
Length=522

 Score =   218 bits (556),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 136/221 (62%), Positives = 166/221 (75%), Gaps = 5/221 (2%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            S AETP L + V D +VD    P  RS TGRW +A FIIGVEVAERF+YYGI+SNLISYL
Sbjct  3    STAETPLLEEYVTD-AVDHGELPVGRSSTGRWSAAWFIIGVEVAERFAYYGIASNLISYL  61

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLG STA AA+NVNAWSG+A LLP+LGAF+AD+FLGRYRTI+I+SL+Y L L  LT+S
Sbjct  62   TGPLGLSTAVAASNVNAWSGIACLLPVLGAFVADAFLGRYRTIIIASLVYILGLALLTLS  121

Query  430  TVLPFESSDSQNGA----GSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDP  597
              L   S+ S++ A     SP     + FFF+LYLVA+ Q GHKPCVQAFGADQFD +DP
Sbjct  122  ACLVPISTPSEHIARVVSSSPSSLLNLLFFFSLYLVAIGQSGHKPCVQAFGADQFDEKDP  181

Query  598  QECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +E   +SSFFNWWY  MC GV + + ++ Y+Q+ +SW LGF
Sbjct  182  KERLERSSFFNWWYLSMCAGVSLAILVVVYIQEAVSWALGF  222



>ref|XP_010498731.1| PREDICTED: protein NRT1/ PTR FAMILY 5.15 isoform X2 [Camelina 
sativa]
Length=544

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 164/219 (75%), Gaps = 15/219 (7%)
 Frame = +1

Query  67   LSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            +S+ E   L +D V  SVD++GRPA +S TG WRSA FIIGVEV ERF+Y+GI+ NLI+Y
Sbjct  3    ISEDEVALL-EDYVSESVDYRGRPAVKSSTGGWRSAWFIIGVEVGERFAYFGIACNLITY  61

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTGPLGQSTA AA NVN WSG ASLLP+LGAFLAD++LGRYRTI+++SL+Y L LG LT+
Sbjct  62   LTGPLGQSTATAAVNVNTWSGTASLLPILGAFLADAYLGRYRTILLASLVYILGLGLLTL  121

Query  427  STVLPFESSDSQNGAGSPPQFQV-IffffalylvalaQGGHKPCVQAFGADQFDTQDPQE  603
            S             A + P F V I FF +LYLVA+ QGGHKPCVQAFGADQFD +DP+E
Sbjct  122  S-------------ASAKPSFWVNILFFCSLYLVAIGQGGHKPCVQAFGADQFDAEDPKE  168

Query  604  CKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
              A+ SFFNWW+  +  G+ +++ ++ YVQ+N++W  GF
Sbjct  169  VIARGSFFNWWFLSLSAGISLSIIVVAYVQENVNWAFGF  207



>ref|XP_010498730.1| PREDICTED: protein NRT1/ PTR FAMILY 5.15 isoform X1 [Camelina 
sativa]
Length=550

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 129/219 (59%), Positives = 164/219 (75%), Gaps = 15/219 (7%)
 Frame = +1

Query  67   LSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            +S+ E   L +D V  SVD++GRPA +S TG WRSA FIIGVEV ERF+Y+GI+ NLI+Y
Sbjct  3    ISEDEVALL-EDYVSESVDYRGRPAVKSSTGGWRSAWFIIGVEVGERFAYFGIACNLITY  61

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTGPLGQSTA AA NVN WSG ASLLP+LGAFLAD++LGRYRTI+++SL+Y L LG LT+
Sbjct  62   LTGPLGQSTATAAVNVNTWSGTASLLPILGAFLADAYLGRYRTILLASLVYILGLGLLTL  121

Query  427  STVLPFESSDSQNGAGSPPQFQV-IffffalylvalaQGGHKPCVQAFGADQFDTQDPQE  603
            S             A + P F V I FF +LYLVA+ QGGHKPCVQAFGADQFD +DP+E
Sbjct  122  S-------------ASAKPSFWVNILFFCSLYLVAIGQGGHKPCVQAFGADQFDAEDPKE  168

Query  604  CKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
              A+ SFFNWW+  +  G+ +++ ++ YVQ+N++W  GF
Sbjct  169  VIARGSFFNWWFLSLSAGISLSIIVVAYVQENVNWAFGF  207



>ref|XP_004516135.1| PREDICTED: probable peptide/nitrate transporter At1g22540-like 
[Cicer arietinum]
Length=570

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 140/224 (63%), Positives = 166/224 (74%), Gaps = 6/224 (3%)
 Frame = +1

Query  67   LSDAETPFLHQD--VVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLI  240
            +++ E   L  +  VVDG VD+KG+P  RS++G WRSA +IIGVEVAER SYYGI  NLI
Sbjct  1    MAETEDVLLEGELAVVDGVVDYKGQPVIRSKSGYWRSAWYIIGVEVAERVSYYGIQGNLI  60

Query  241  SYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFL  420
            SYLTGPL QSTA AA NVN W+G ASLLPL GAF+ADS LGRY TI+++SL+Y L LG L
Sbjct  61   SYLTGPLNQSTATAAENVNIWAGTASLLPLFGAFVADSLLGRYHTIILASLIYILGLGLL  120

Query  421  TISTVLP-FESSDSQNGAG---SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDT  588
            T+S +LP    S  Q  +       Q QVI FF +LYLVA+ QGGHKPCVQAFGADQFD 
Sbjct  121  TLSAMLPSLTKSKCQVDSKFIFCSSQSQVILFFISLYLVAIGQGGHKPCVQAFGADQFDE  180

Query  589  QDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            + P+E KA+SSFFNWW+F M  G  VTL +LNY+QDN SW LGF
Sbjct  181  KHPKELKARSSFFNWWFFTMVAGCTVTLAVLNYIQDNYSWVLGF  224



>ref|XP_002887413.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH63672.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=1080

 Score =   224 bits (571),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 131/218 (60%), Positives = 167/218 (77%), Gaps = 4/218 (2%)
 Frame = +1

Query  67   LSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            ++ A   +L ++ V  +VD +G  A RS TGRWR+A FIIGVEVAERF+YYGI SNLISY
Sbjct  524  MTTASDIYLQEEYVTDAVDHRGFAAKRSNTGRWRAALFIIGVEVAERFAYYGIGSNLISY  583

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTGPLGQSTA AAANVNAWSG+A+LLP+LGAF+AD+FLGRYRTI+I++L+Y L L FLT+
Sbjct  584  LTGPLGQSTAVAAANVNAWSGIATLLPVLGAFVADAFLGRYRTIIIATLIYVLGLAFLTL  643

Query  427  STVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQEC  606
            S  L   +++      S P F    FFF+LYLVA+ Q GHKPCVQAFGADQFD ++ QE 
Sbjct  644  SAFLIPNTTE----VTSTPSFLNALFFFSLYLVAIGQSGHKPCVQAFGADQFDEKNQQEN  699

Query  607  KAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
              +SSFFNWWY  MC G+ + + ++ Y+Q+N+SW +GF
Sbjct  700  TDRSSFFNWWYLSMCAGIALAILVVVYIQENVSWAVGF  737


 Score =   179 bits (453),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 119/212 (56%), Positives = 146/212 (69%), Gaps = 15/212 (7%)
 Frame = +1

Query  91   LHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQS  270
            L ++ V  +VD +G  A RS TGRWR+A FIIGVEVAERF+YYGI SNLISYLTGPLGQS
Sbjct  9    LQEEYVTDTVDHRGFAAKRSNTGRWRAALFIIGVEVAERFAYYGIGSNLISYLTGPLGQS  68

Query  271  TaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST-VLPFE  447
            TA AAANVNAWSGVA+LLP LGAF+AD+FLGRYRTI+I+SL+Y L L FLT+S  ++P  
Sbjct  69   TAVAAANVNAWSGVATLLPALGAFVADAFLGRYRTIIIASLIYVLGLAFLTLSAFLIPIS  128

Query  448  -SSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSF  624
             S +S     SP       FFF+LYLVA+ Q GHKP               QE   +SSF
Sbjct  129  CSENSTEVISSPSSLLNALFFFSLYLVAIGQSGHKPY-------------SQEISDRSSF  175

Query  625  FNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FNWWY  +  G+ + + ++ Y+Q+  SW  GF
Sbjct  176  FNWWYLSLSAGICLAILVVVYIQEEFSWAFGF  207



>gb|KFK44351.1| hypothetical protein AALP_AA1G246300 [Arabis alpina]
Length=565

 Score =   218 bits (556),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 123/220 (56%), Positives = 166/220 (75%), Gaps = 2/220 (1%)
 Frame = +1

Query  67   LSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            +++ E  FL +D V  SVD +G PA +  TG WRSA FIIGVEVAERF+Y+GI+ NLI+Y
Sbjct  3    IAEEEVAFLEEDYVSDSVDHRGLPAGKYSTGGWRSAWFIIGVEVAERFAYFGIACNLITY  62

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTGPLGQSTA AA NVN WSG AS+LP+LGAF+AD++LGRYRTI+ +SL+Y + LG LT+
Sbjct  63   LTGPLGQSTATAAVNVNTWSGTASMLPILGAFVADAYLGRYRTILAASLIYIVGLGLLTL  122

Query  427  STVLPFE--SSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQ  600
            S  L     S  S++ +  P  +  + FF +LYLVA+ QGGHKPCVQAFGADQFD++DP+
Sbjct  123  SASLIIMGLSEQSKDVSAKPSFWVNVLFFCSLYLVAIGQGGHKPCVQAFGADQFDSEDPK  182

Query  601  ECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            E  ++ SFFNWW+  +  G+ +++ ++ YVQ+N++W  GF
Sbjct  183  EVISRGSFFNWWFLSLSVGISLSIILVAYVQENVNWAFGF  222



>ref|XP_006390702.1| hypothetical protein EUTSA_v10018554mg [Eutrema salsugineum]
 gb|ESQ27988.1| hypothetical protein EUTSA_v10018554mg [Eutrema salsugineum]
Length=444

 Score =   216 bits (549),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 166/218 (76%), Gaps = 2/218 (1%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            + AETP   + V+D +VD  G  A RS TGRWR+A FIIGVEVAERF+YYGI+SNLISYL
Sbjct  3    TSAETPLQEEYVID-AVDHDGLAAGRSNTGRWRAAWFIIGVEVAERFAYYGIASNLISYL  61

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPL QSTA AAANVNAWSG++ LLP+LGAF+AD+FLGRYRTI+I+SL+Y L +  LT+S
Sbjct  62   TGPLRQSTAVAAANVNAWSGISCLLPVLGAFVADAFLGRYRTIIIASLIYVLGMALLTLS  121

Query  430  TVL-PFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQEC  606
             +L P  S +++  + S      + FFF+LYLVA+ Q GHKPCVQAFGADQFD +DP E 
Sbjct  122  ALLVPITSENTEVTSSSTSSLLNVLFFFSLYLVAIGQSGHKPCVQAFGADQFDEKDPIEK  181

Query  607  KAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            + + SFFNWWY  +  G+ + + ++ Y+Q+ +SW LGF
Sbjct  182  RDRGSFFNWWYLSLSAGICLAIVVVVYIQEAVSWALGF  219



>ref|XP_011031498.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Populus euphratica]
 ref|XP_011031499.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Populus euphratica]
Length=582

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 147/235 (63%), Positives = 174/235 (74%), Gaps = 8/235 (3%)
 Frame = +1

Query  37   LSMAATGTTILSDAETPFLH--QDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERF  210
            LS  ++GT   S A  P +    D V+GSVD+KG P  RS +G WRSASFII VEVAERF
Sbjct  6    LSNISSGTE-RSSAAAPLVEAGDDSVNGSVDYKGNPVHRSTSGGWRSASFIIAVEVAERF  64

Query  211  SYYGISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISS  390
            +YYGISSNLI+YLTGPLGQSTA+AAANVN WSG A+LLPLLGAF+ADSFLGRYRTI+ +S
Sbjct  65   AYYGISSNLITYLTGPLGQSTASAAANVNTWSGTATLLPLLGAFVADSFLGRYRTIIAAS  124

Query  391  LLYTLALGFLTISTVLPFESSD-----SQNGAGSPPQFQVIffffalylvalaQGGHKPC  555
            L+Y L LG LT++  L  +S        +    +P QFQV  FFF++YLVA  QGGHKPC
Sbjct  125  LIYILGLGLLTLAATLTSDSVHDFPNIKEAMLSAPSQFQVTLFFFSIYLVAFGQGGHKPC  184

Query  556  VQAFGADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
              AFGADQFD Q+PQE KAKSSFFNWW F    G+ +T  ++ Y+QDNLSW LGF
Sbjct  185  ALAFGADQFDGQNPQESKAKSSFFNWWCFCSSVGIALTHVVMVYIQDNLSWALGF  239



>ref|XP_010233562.1| PREDICTED: uncharacterized protein LOC100831418 [Brachypodium 
distachyon]
Length=1173

 Score =   224 bits (570),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 128/211 (61%), Positives = 165/211 (78%), Gaps = 6/211 (3%)
 Frame = +1

Query  106  VDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaa  285
            V G VDF+G PA R+ TGRW +A F++GVE+AERF+Y+G+S+NLISYLTGPLG+STA AA
Sbjct  17   VPGVVDFRGGPAPRASTGRWSAAMFVLGVEIAERFAYHGVSANLISYLTGPLGESTAGAA  76

Query  286  anvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSD---  456
            A +NAWSGVA++LPLL A +AD++LGRYRTIV++SLL+ +++G LT+S+ LP   SD   
Sbjct  77   AAINAWSGVATMLPLLVACVADAWLGRYRTIVLASLLFVVSMGMLTLSSALPAFHSDGCS  136

Query  457  ---SQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFF  627
               S++ A SP   QV  F+ +LYLVALA+ GHKPC QAFGADQFD   P+E  ++SSFF
Sbjct  137  SFTSKSLACSPSPVQVTIFYISLYLVALAEAGHKPCAQAFGADQFDQHHPKESVSRSSFF  196

Query  628  NWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            NWWYFGMC G   T  + +Y+QDN+ WGLGF
Sbjct  197  NWWYFGMCSGTAATTMVSSYIQDNIGWGLGF  227


 Score =   197 bits (500),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 154/207 (74%), Gaps = 10/207 (5%)
 Frame = +1

Query  100  DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaa  279
            D V G+ D++G+PA+R+ TG W+S+ F++ +E+AERF+Y G++SNLI YLTGPLGQ  A 
Sbjct  648  DTVSGAADYRGQPASRAATGGWKSSIFVMAMEIAERFAYKGVASNLIQYLTGPLGQPMAR  707

Query  280  aaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSDS  459
            AAA+++AW GV+ +LPL  A +AD++LGRYR IV++S+L+ L++G L++S+ +       
Sbjct  708  AAASIDAWKGVSQMLPLPLACIADAWLGRYRAIVLASILFILSMGTLSLSSAVRI-----  762

Query  460  QNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWY  639
              GAG      V  F+ ALYLVAL +G HKPC QAF ADQFD +DP+E  A+SSFFNWWY
Sbjct  763  -FGAGG----HVAVFYVALYLVALGEGAHKPCAQAFAADQFDDKDPKESVARSSFFNWWY  817

Query  640  FGMCFGVMVTLWILNYVQDNLSWGLGF  720
             GMC G  VT+ + +YVQDN+ WGLGF
Sbjct  818  LGMCSGTAVTIMVSSYVQDNVGWGLGF  844



>gb|KEH29312.1| proton-dependent oligopeptide transport family protein, partial 
[Medicago truncatula]
Length=533

 Score =   217 bits (552),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 140/206 (68%), Positives = 163/206 (79%), Gaps = 7/206 (3%)
 Frame = +1

Query  103  VVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaa  282
            +VDG+VD+ G+PA R ++G WRSA FIIGVEVAER SYYGI  NLISYLTGPL QSTA A
Sbjct  15   LVDGAVDYNGQPAVRFKSGYWRSAWFIIGVEVAERVSYYGIQGNLISYLTGPLKQSTATA  74

Query  283  aanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSDSQ  462
            A NVN W+G ASLLPLLGAF+ADSFLGRYRTI+++SL+Y L LG LT+S +LP  +  S 
Sbjct  75   AKNVNVWAGTASLLPLLGAFVADSFLGRYRTIILASLIYILGLGLLTLSALLPSLTFCS-  133

Query  463  NGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYF  642
                  PQ QVI FF +LYLVA+ QGGHKPCVQAFGADQFD + P+E +A+SSFFNWWYF
Sbjct  134  ------PQSQVILFFISLYLVAIGQGGHKPCVQAFGADQFDEKHPKEHEARSSFFNWWYF  187

Query  643  GMCFGVMVTLWILNYVQDNLSWGLGF  720
             M  G   TL ILNY+QDN+SW LGF
Sbjct  188  TMIAGCTATLTILNYIQDNISWVLGF  213



>ref|XP_009104877.1| PREDICTED: protein NRT1/ PTR FAMILY 5.14-like [Brassica rapa]
Length=558

 Score =   217 bits (552),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 129/217 (59%), Positives = 168/217 (77%), Gaps = 3/217 (1%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            + A TP L + V+D +VD  G  A RS TGRW +A FIIGVEVAERF+YYGI+SNLISYL
Sbjct  3    TTAATPLLEEHVMD-AVDHDGLVADRSNTGRWTAAWFIIGVEVAERFAYYGIASNLISYL  61

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLGQSTA AAANVNAWSG+++LLP+LGAF+AD+FLGRYRTI+I+SL+Y L +  LT+S
Sbjct  62   TGPLGQSTAVAAANVNAWSGISALLPVLGAFVADAFLGRYRTIIIASLIYVLGMALLTLS  121

Query  430  TVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECK  609
             +L   +S+++  A S      + FFF+LYLVA+ Q GHKPCVQAFGADQFD +DP+E +
Sbjct  122  ALLVPITSENEKVASS--SLLNVLFFFSLYLVAIGQSGHKPCVQAFGADQFDEKDPREQR  179

Query  610  AKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             +SSFFNWWY  +  G+ + + ++ Y+Q+ + W LGF
Sbjct  180  DRSSFFNWWYLSLSAGICLAIVVVVYIQEAVGWALGF  216



>ref|NP_001117585.1| putative peptide/nitrate transporter [Arabidopsis thaliana]
 sp|Q0WSZ6.2|PTR23_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 5.13; Short=AtNPF5.13; 
AltName: Full=Nitrate transporter 1.16 [Arabidopsis thaliana]
 gb|AEE35277.1| putative peptide/nitrate transporter [Arabidopsis thaliana]
Length=561

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 129/210 (61%), Positives = 160/210 (76%), Gaps = 3/210 (1%)
 Frame = +1

Query  91   LHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQS  270
            L ++ V  +VD +G  A RS TGRWR+A FIIGVEVAERF+ YGI SNLISYLTGPLGQS
Sbjct  9    LQEEYVIDAVDHRGFSARRSITGRWRAAWFIIGVEVAERFANYGIGSNLISYLTGPLGQS  68

Query  271  TaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFES  450
            TA AAANVNAWSG++++LPLLGAF+AD+FLGRY TI+I+S +Y L L FLT+S    F  
Sbjct  69   TAVAAANVNAWSGISTILPLLGAFVADAFLGRYITIIIASFIYVLGLAFLTLSA---FLI  125

Query  451  SDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFN  630
             ++     SP  F    FFF+LYLVA+ Q GHKPCVQAFGADQFD ++PQE   +SSFFN
Sbjct  126  PNNTEVTSSPSSFLNALFFFSLYLVAIGQSGHKPCVQAFGADQFDEKNPQENSDRSSFFN  185

Query  631  WWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            WWY  MC G+ + + ++ Y+Q+N+SW LGF
Sbjct  186  WWYLSMCAGIGLAILVVVYIQENVSWALGF  215



>ref|XP_010665459.1| PREDICTED: uncharacterized protein LOC100854586 [Vitis vinifera]
Length=1091

 Score =   221 bits (564),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 145/224 (65%), Positives = 177/224 (79%), Gaps = 6/224 (3%)
 Frame = +1

Query  64   ILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLIS  243
            IL  +ET  L +D VDG++D KG PA RS +G WRSA FIIG EV ERF+YYGI +NLI+
Sbjct  6    ILGGSET-LLVEDSVDGTIDHKGCPAKRSSSGGWRSAYFIIGAEVLERFAYYGIGTNLIN  64

Query  244  YLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLT  423
            YLTGPLGQSTA AAANVN+W G ++++ LLGAF+ADS+LGRYRTIVI+SLLY L LG LT
Sbjct  65   YLTGPLGQSTAVAAANVNSWFGTSTIVTLLGAFVADSYLGRYRTIVIASLLYILGLGLLT  124

Query  424  ISTVLPFESS-DSQN----GAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDT  588
            +S VLPF+S+ D QN     + SPP+ ++IFFF +LYLVA+AQGG+KPC QA GADQFD 
Sbjct  125  LSAVLPFQSTFDCQNTHQSTSCSPPELRIIFFFISLYLVAVAQGGYKPCTQALGADQFDG  184

Query  589  QDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            Q+ +E KAKSSFFNWW F +     V+  IL+Y+QDNLSWGLGF
Sbjct  185  QNREENKAKSSFFNWWLFCLSACTSVSYVILSYIQDNLSWGLGF  228


 Score =   197 bits (502),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 134/195 (69%), Positives = 155/195 (79%), Gaps = 7/195 (4%)
 Frame = +1

Query  64   ILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLIS  243
            I+   E+P L +D +D  VD KG PA RS +G WRSA FIIG EVAER +YYGI SNLI+
Sbjct  579  IVEGRESPVL-EDTIDRMVDHKGCPATRSSSGAWRSAYFIIGAEVAERIAYYGIGSNLIN  637

Query  244  YLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLT  423
            YLTGPLGQSTA AAANVN WSG A+LLPLLGAF+AD++LGRYRTIVI+SLLY L LG LT
Sbjct  638  YLTGPLGQSTAMAAANVNTWSGTATLLPLLGAFVADTYLGRYRTIVIASLLYILGLGLLT  697

Query  424  ISTVLPF-ESSDSQNG----AGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDT  588
            +S VLP+   SD QN     + SPPQ  VI FFF+LYLVA+ +GGHKPC+QAFGADQFD 
Sbjct  698  LSAVLPYLRPSDCQNSDKITSCSPPQIPVI-FFFSLYLVAVGEGGHKPCIQAFGADQFDG  756

Query  589  QDPQECKAKSSFFNW  633
             +P+ECKAKSSFFNW
Sbjct  757  NNPEECKAKSSFFNW  771



>gb|KFK41627.1| hypothetical protein AALP_AA2G152300 [Arabis alpina]
Length=565

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 131/224 (58%), Positives = 163/224 (73%), Gaps = 6/224 (3%)
 Frame = +1

Query  64   ILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLIS  243
            +++  ETP L   V+D +VD  G  A +S TGRW++A FIIGVEV ERF+YYGI+SNLIS
Sbjct  1    MVTTEETPLLEDYVID-AVDHAGLAAGKSSTGRWKAAWFIIGVEVGERFAYYGIASNLIS  59

Query  244  YLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLT  423
            YLTGPLGQSTA AA NVNAWSG++SLLP+LGAF+AD+FLGRY+TI+I+SL+Y L L  LT
Sbjct  60   YLTGPLGQSTAVAATNVNAWSGISSLLPVLGAFVADAFLGRYQTIIIASLIYVLGLALLT  119

Query  424  ISTVL-PFESSDSQNGAG----SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDT  588
            +S  L P  S   QN       +      + FFF+LYLVA+ Q GHKPCVQAFGADQFD 
Sbjct  120  LSAFLVPISSPTDQNVENGEVLTTSSLLNVLFFFSLYLVAIGQSGHKPCVQAFGADQFDE  179

Query  589  QDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             DP+E   +SSFFNWWY  M  G+ + + ++ YVQ+  SW LGF
Sbjct  180  NDPKEKPDRSSFFNWWYLSMSAGICLAVIVVVYVQEAFSWALGF  223



>gb|ACL52999.1| unknown [Zea mays]
 gb|AFW78189.1| peptide transporter PTR2-B [Zea mays]
Length=565

 Score =   215 bits (547),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 138/222 (62%), Positives = 169/222 (76%), Gaps = 5/222 (2%)
 Frame = +1

Query  70   SDAETPFLHQD-VVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            SD+++  +  + + D ++D+ GRPA R  TG WRSA FII VE+AERF++YG+S+NLI+Y
Sbjct  5    SDSDSLLVRAEGMRDAALDYHGRPADRGATGGWRSALFIIAVEIAERFTFYGVSANLINY  64

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTGPLGQ TAAAAA +NAW+GVA LLPLLG  LAD +LGRYRTIVI+SLLY L LG L  
Sbjct  65   LTGPLGQGTAAAAAAINAWNGVAQLLPLLGGALADKWLGRYRTIVIASLLYILGLGMLAF  124

Query  427  STVLPFESSDSQNGAG----SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQD  594
            ST L   S      AG    +P   +V FF+ +LY+VA+AQGGHKPCVQAFGADQFD  D
Sbjct  125  STFLSSGSGHQCTAAGGQICAPSGLKVTFFYVSLYIVAVAQGGHKPCVQAFGADQFDQTD  184

Query  595  PQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            P+E  ++SSFFNWWYFGMC G  VTL +L+YVQDN+ WGLGF
Sbjct  185  PKETVSRSSFFNWWYFGMCAGTAVTLVLLSYVQDNIGWGLGF  226



>ref|XP_004970733.1| PREDICTED: probable peptide/nitrate transporter At1g22540-like 
[Setaria italica]
Length=549

 Score =   214 bits (545),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 157/206 (76%), Gaps = 4/206 (2%)
 Frame = +1

Query  115  SVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanv  294
            ++D  GRPA+R  TGRW +A FIIGVE++ERF++ GIS NLISYLTGPLGQSTA+AAA +
Sbjct  15   ALDHVGRPASRLTTGRWPAAVFIIGVEISERFAFAGISGNLISYLTGPLGQSTASAAAAI  74

Query  295  nawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL----PFESSDSQ  462
            NAW G A +LPLLGA +ADS+LGRYR I+ +SLLY L LG LT+S+      P E  D+ 
Sbjct  75   NAWIGAALMLPLLGAAVADSWLGRYRAIISASLLYILGLGMLTLSSTFVPQQPSEFGDNV  134

Query  463  NGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYF  642
            + + S     + FF+ +LY+VA AQGGHKPCVQAFGADQFD  DP+EC ++SSFFNWWYF
Sbjct  135  DSSVSWMSIHLAFFYVSLYVVACAQGGHKPCVQAFGADQFDENDPEECASRSSFFNWWYF  194

Query  643  GMCFGVMVTLWILNYVQDNLSWGLGF  720
            G     +VT+ ILNY+QDN+SW  GF
Sbjct  195  GAYGSNIVTVSILNYIQDNISWQFGF  220



>dbj|BAJ86454.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=578

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 164/216 (76%), Gaps = 7/216 (3%)
 Frame = +1

Query  94   HQDVVDGS-VDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQS  270
              D +D + VD +GRPA R+ TGRWRSA FII VE+AERFS+YG+S+NLISYLTGPLG+ 
Sbjct  21   EDDGIDAAAVDHRGRPAPRASTGRWRSALFIIAVEIAERFSFYGVSANLISYLTGPLGEG  80

Query  271  TaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFES  450
             A AA+ +NAW+GVA LLPLLGA LADS+ GRYRTIV++SLLYTL LG L +ST+L   S
Sbjct  81   NAKAASAINAWNGVAQLLPLLGAALADSWFGRYRTIVVASLLYTLGLGMLALSTLLSSGS  140

Query  451  SDSQN----GAGSPPQ--FQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
                N    G   PP    Q+  F+ +LYLVA+AQGGHKPCVQAFGADQFD   P+E  +
Sbjct  141  HKCSNITAGGTPCPPPSGLQMAAFYTSLYLVAVAQGGHKPCVQAFGADQFDPSHPREAVS  200

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +SSFFNWWYFG+C G  VTL  L+Y+QDN+ WGLGF
Sbjct  201  RSSFFNWWYFGICAGTAVTLIFLSYIQDNVGWGLGF  236



>ref|XP_008459724.1| PREDICTED: uncharacterized protein LOC103498766 [Cucumis melo]
Length=1169

 Score =   220 bits (561),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 131/221 (59%), Positives = 163/221 (74%), Gaps = 6/221 (3%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            D  TP L  D+VDG+VD+KG+P  RS +  WRSASFIIG+EVAERF++YGI +NLI+YLT
Sbjct  8    DHATPLL-TDMVDGAVDYKGQPLLRSSSATWRSASFIIGMEVAERFAFYGIGANLITYLT  66

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPL  S  AAA  VN W+G + LL L GAFLADSF GRYRTIV +S+ Y L LG L +ST
Sbjct  67   GPLRISVVAAAEIVNVWAGTSMLLTLFGAFLADSFFGRYRTIVFASISYILGLGLLVLST  126

Query  433  VLPFESSD-----SQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDP  597
            +LP  SS      ++    S P+  +I FF +L L+ +AQGGH+PCVQAFGADQFD Q+P
Sbjct  127  LLPTASSSICAIPNKFAPCSSPKLHLILFFLSLCLIGIAQGGHRPCVQAFGADQFDPQNP  186

Query  598  QECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            QE K KSSFFNWWYFG CFG++  +  ++Y Q+NLSW +GF
Sbjct  187  QEAKFKSSFFNWWYFGACFGIVAAIPTISYAQENLSWAVGF  227


 Score =   191 bits (486),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 118/200 (59%), Positives = 144/200 (72%), Gaps = 8/200 (4%)
 Frame = +1

Query  145  RSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanvnawsgvasLL  324
            RS++G WR+A  IIGVE+AERF+++GIS+NL+SYLT  + QS A+AA NVN W G ASLL
Sbjct  624  RSQSGGWRAAGVIIGVEIAERFAFFGISTNLVSYLTVEMEQSMASAAQNVNLWIGTASLL  683

Query  325  PLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESS--------DSQNGAGSP  480
            PL+ A  ADSFLGRY TI+++S LY L LG LT+S +L   SS         +  GA + 
Sbjct  684  PLVAASFADSFLGRYLTIILASALYILGLGLLTLSAMLASPSSFQGSGSAASAATGASAR  743

Query  481  PQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYFGMCFGV  660
            P   V+ FF +LYLVA AQGGHKPC+QAFG DQFD +DPQEC AK SFFNWWYF    G 
Sbjct  744  PVLHVVLFFSSLYLVAFAQGGHKPCLQAFGCDQFDGEDPQECIAKCSFFNWWYFATTLGS  803

Query  661  MVTLWILNYVQDNLSWGLGF  720
             + L IL+Y+QDNL W LGF
Sbjct  804  FIALIILSYIQDNLGWCLGF  823



>gb|KEH16161.1| proton-dependent oligopeptide transport family protein [Medicago 
truncatula]
Length=557

 Score =   213 bits (543),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 143/224 (64%), Positives = 166/224 (74%), Gaps = 12/224 (5%)
 Frame = +1

Query  49   ATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGIS  228
            A    +L +AE        VDG VD++G+PA RS++G WRSA FIIGVEVAER SY GI 
Sbjct  2    AESNEVLLEAELA-----TVDGVVDYRGQPAVRSKSGYWRSAWFIIGVEVAERISYIGIK  56

Query  229  SNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLA  408
             NLISYLTGPL QSTA AA NVN W+G ASLLPLLGAF+ADSFLGRY TI+++SL+Y L 
Sbjct  57   GNLISYLTGPLKQSTATAAKNVNIWAGTASLLPLLGAFVADSFLGRYHTIILASLIYILG  116

Query  409  LGFLTISTVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDT  588
            LG LT+ST+LP  +S S        Q QVI FF +LYLVA+ QGGHKPCVQAFGADQFD 
Sbjct  117  LGLLTLSTILPSLASCST-------QSQVILFFISLYLVAIGQGGHKPCVQAFGADQFDE  169

Query  589  QDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            + P+E +A+SSFFNWWYF M  G   TL IL Y+QDN SW LGF
Sbjct  170  KYPEEHRARSSFFNWWYFTMVAGATATLPILTYIQDNYSWVLGF  213



>ref|XP_002456716.1| hypothetical protein SORBIDRAFT_03g041260 [Sorghum bicolor]
 gb|EES01836.1| hypothetical protein SORBIDRAFT_03g041260 [Sorghum bicolor]
Length=364

 Score =   209 bits (531),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 129/222 (58%), Positives = 163/222 (73%), Gaps = 6/222 (3%)
 Frame = +1

Query  67   LSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            +  A  P L Q     ++D  GRP +R  TGRW +A FIIGVE++ERF++ GIS NLI+Y
Sbjct  1    MDAAAEPLLPQPAT--ALDHLGRPVSRHTTGRWSAAVFIIGVEISERFAFGGISGNLITY  58

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTGPLGQSTA+AAA +NAWSG A +LPLLGA +ADS+LGRYRTI+ +SLLY L LG LT+
Sbjct  59   LTGPLGQSTASAAAAINAWSGAALILPLLGAAVADSWLGRYRTIISASLLYILGLGMLTL  118

Query  427  STVL----PFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQD  594
            S++     P +  DS   + S     + FF+ +LY+VA AQGGHKPCVQAFGADQFD  D
Sbjct  119  SSIFVPQQPAQFGDSIGSSISSMGIHLAFFYVSLYIVACAQGGHKPCVQAFGADQFDEND  178

Query  595  PQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            P+EC ++SSFFNWWYFG     ++T+ ILNY+QDN+SW  GF
Sbjct  179  PEECASRSSFFNWWYFGAYGANVITVSILNYIQDNISWQFGF  220



>ref|XP_010665406.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X3 [Vitis 
vinifera]
Length=530

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 123/183 (67%), Positives = 147/183 (80%), Gaps = 5/183 (3%)
 Frame = +1

Query  187  GVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGR  366
            GVEVAERF+Y GI +NLI+YLTG LG S A AA NVN WSG   LLPL+GAF+ADS+LGR
Sbjct  4    GVEVAERFAYSGIQANLINYLTGRLGLSMATAAENVNTWSGTGGLLPLVGAFVADSYLGR  63

Query  367  YRTIVISSLLYTLALGFLTISTVLPFES-SDSQNG----AGSPPQFQVIffffalylval  531
            YRTI+I+S LY L LG LT+S VLP  S SD Q      + SPPQ Q+I FFF+LYLVA+
Sbjct  64   YRTIIIASFLYILGLGLLTLSAVLPSPSPSDCQKSNQITSCSPPQLQIILFFFSLYLVAV  123

Query  532  aQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWG  711
             QGGHKPC QAFGADQFD ++P+ECKAKSSFFNWWYFG+CFG ++   +L+Y+Q+NL+WG
Sbjct  124  GQGGHKPCNQAFGADQFDGRNPEECKAKSSFFNWWYFGLCFGTVINYSVLSYIQENLNWG  183

Query  712  LGF  720
            LGF
Sbjct  184  LGF  186



>ref|XP_010665396.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Vitis vinifera]
Length=563

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 133/220 (60%), Positives = 171/220 (78%), Gaps = 6/220 (3%)
 Frame = +1

Query  76   AETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTG  255
            +E P L  D VDG+VD KG PA RS +G W+SA FIIG+ V +RF++ GI +NLI+YLTG
Sbjct  7    SEAPTL-DDTVDGAVDHKGDPAKRSFSGAWKSAYFIIGMAVVDRFAFKGIETNLINYLTG  65

Query  256  PLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTV  435
             LG+STAAAAANVN WSG A+LLPLLGA +ADS+LG+YRTIVI+SL Y L LG LT+S+V
Sbjct  66   WLGESTAAAAANVNTWSGTATLLPLLGAAIADSYLGQYRTIVIASLTYILGLGLLTVSSV  125

Query  436  LPFE-----SSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQ  600
                      + ++  + SP Q QV+FFFF+LY+VA+ QGG KPC+QAFGA+QFD +D +
Sbjct  126  FTSGSSSNCKNSNKTTSCSPSQLQVVFFFFSLYVVAIGQGGLKPCLQAFGAEQFDQRDQE  185

Query  601  ECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            ECKAKSSFFNWW+FG+  GV V+  I++Y++DN+SW LGF
Sbjct  186  ECKAKSSFFNWWFFGLAGGVSVSYLIMSYIEDNVSWILGF  225



>ref|XP_008437711.1| PREDICTED: uncharacterized protein LOC103483057 [Cucumis melo]
Length=1156

 Score =   218 bits (556),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 138/219 (63%), Positives = 160/219 (73%), Gaps = 6/219 (3%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E P L  + V+G VD+ G P +R   G WRSAS II VE+AERF+Y G+SSNLI++LT  
Sbjct  2    EVPLL-DETVEGVVDYHGHPVSRYNFGGWRSASLIIVVEIAERFAYLGVSSNLINFLTDQ  60

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            L QSTA AA NVNAWSG A+LLPLLGAFLAD FLGRYRTIV+SS LY L LG LT+S  L
Sbjct  61   LQQSTAMAAKNVNAWSGTAALLPLLGAFLADCFLGRYRTIVLSSALYILGLGLLTVSATL  120

Query  439  P----FESSDSQNG-AGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQE  603
            P        +++N    SP   QVI FFF+LYLVA AQGGHKPCVQAFGADQFD Q P+E
Sbjct  121  PSPDISACQETENSLPCSPNLVQVILFFFSLYLVAFAQGGHKPCVQAFGADQFDGQHPEE  180

Query  604  CKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             KAKSSFFNWWY G+      T+ I++YVQ+ LSW LGF
Sbjct  181  SKAKSSFFNWWYLGISLAGFSTVNIMSYVQEYLSWSLGF  219


 Score =   105 bits (263),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +1

Query  475  SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYFGMCF  654
            SP   QVI FFF+LYLVA A+GGH+PC+QA GADQFD Q P+E KAKSSFFNWWY G+  
Sbjct  731  SPNLVQVILFFFSLYLVAFAKGGHEPCIQALGADQFDEQHPEERKAKSSFFNWWYLGISL  790

Query  655  GVMVTLWILNYVQDNLSWGLGF  720
            G + T+ I++YVQDNLSW LGF
Sbjct  791  GTLSTINIMSYVQDNLSWSLGF  812



>ref|XP_010460013.1| PREDICTED: protein NRT1/ PTR FAMILY 5.16-like [Camelina sativa]
Length=564

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 126/216 (58%), Positives = 161/216 (75%), Gaps = 2/216 (1%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E   L +D V  SVD +G PA +S TG WRSA +IIGVEV ERF+Y+GISSNLI+YLTGP
Sbjct  6    EKVSLIEDFVSDSVDHRGLPAGKSTTGGWRSAWYIIGVEVGERFAYFGISSNLITYLTGP  65

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            LGQSTA AA NVN WSG AS+  +LGAF AD++LGRYRTIV++S +Y L LG LT+S VL
Sbjct  66   LGQSTAIAAVNVNTWSGTASMFTVLGAFTADAYLGRYRTIVVASFIYILGLGLLTLSAVL  125

Query  439  PFES-SDSQNGAGSPPQFQV-IffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
                 S+ ++   + P F V I FF +LYLVA+ QGGHKPCVQAFGADQFD +D +E  +
Sbjct  126  ILMGLSEKRSDVSTKPSFWVNILFFCSLYLVAMGQGGHKPCVQAFGADQFDVEDRKERIS  185

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            + SFFNWW+  +  G+ +++ ++ YVQDN++W LGF
Sbjct  186  RGSFFNWWFLSLSAGITLSIIVVVYVQDNVNWALGF  221



>emb|CDM83970.1| unnamed protein product [Triticum aestivum]
Length=524

 Score =   211 bits (538),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 123/211 (58%), Positives = 160/211 (76%), Gaps = 6/211 (3%)
 Frame = +1

Query  106  VDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaa  285
            V G VDF+G PA  + TGRW +A F++GVE+AERF+Y+G+S+N ISYLTGPLG+STA AA
Sbjct  16   VPGVVDFRGGPAPHASTGRWSAAMFVLGVEIAERFAYHGVSANFISYLTGPLGESTAGAA  75

Query  286  anvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSD---  456
            A +NAWSGVA++LPLL A +AD++LGR+RTIV++S+L+ +++G LT+S+ LP   SD   
Sbjct  76   AAINAWSGVATMLPLLVACVADAWLGRFRTIVLASVLFVVSMGMLTLSSALPVFHSDGCT  135

Query  457  ---SQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFF  627
               S +GA SP   QV  F+ +LYLVALA+ GHKP  QAFG DQFD   P+E  ++SSFF
Sbjct  136  SFTSLSGACSPSPVQVTIFYVSLYLVALAEAGHKPWAQAFGTDQFDQHHPEESVSRSSFF  195

Query  628  NWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            NWWYFGMC G   T    +Y+QDN+ WGLGF
Sbjct  196  NWWYFGMCSGTAATTMASSYIQDNIGWGLGF  226



>ref|XP_004972267.1| PREDICTED: probable peptide/nitrate transporter At1g22540-like 
[Setaria italica]
Length=540

 Score =   212 bits (539),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 130/229 (57%), Positives = 167/229 (73%), Gaps = 17/229 (7%)
 Frame = +1

Query  73   DAETPFL--HQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            DA T  L      V G+VDF+GRPA+RS TGRW +A F++GVE+AERF+Y+G+S+NLISY
Sbjct  2    DANTLLLPCSDGAVAGAVDFRGRPASRSGTGRWSAAMFVLGVEIAERFAYHGVSANLISY  61

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTL---ALGF  417
            LTGPLG+STA AAA +NAWSGVA++LPLL A +AD++LGRYRTIV++SLL+ +   ++G 
Sbjct  62   LTGPLGESTAGAAAAINAWSGVATMLPLLMACVADAWLGRYRTIVLASLLFVVVSSSMGM  121

Query  418  LTISTVLPFESSDSQNGAGSPPQ--------FQVIffffalylvalaQGGHKPCVQAFGA  573
            LT+S +  F     Q+G               QV  F+ +LYLVALA+ GHKPC QAFGA
Sbjct  122  LTVSALPVFH----QDGCSYSSSSLACSPSPVQVAIFYVSLYLVALAEAGHKPCAQAFGA  177

Query  574  DQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            DQFD  DP+E  ++SSFFNWWYFGMC G   T  + +Y+QDN+ WGLGF
Sbjct  178  DQFDQHDPKESVSRSSFFNWWYFGMCSGTAATTMVSSYIQDNVGWGLGF  226



>gb|EYU27212.1| hypothetical protein MIMGU_mgv1a017651mg, partial [Erythranthe 
guttata]
Length=548

 Score =   212 bits (539),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 126/206 (61%), Positives = 156/206 (76%), Gaps = 10/206 (5%)
 Frame = +1

Query  103  VVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaa  282
            +V+G +D +GRPA RS++G WRSA +IIG    ERF+YYGISSNLI+YLTGPLGQSTAAA
Sbjct  3    IVNGMMDHEGRPAKRSQSGYWRSACYIIGAGATERFAYYGISSNLITYLTGPLGQSTAAA  62

Query  283  aanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSDSQ  462
            AA++N W+G   LLPLLGAF+A+SFLGRYRTIV+SS+LY LALG LT S  L F      
Sbjct  63   AASINIWTGTGLLLPLLGAFVAESFLGRYRTIVLSSMLYILALGLLTTSAFLDFR-----  117

Query  463  NGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYF  642
                 P +  V+ FF +LYL+AL QG +KPC+ AFGADQFD   PQE +++SSFFNWWYF
Sbjct  118  -----PNELDVLLFFGSLYLMALGQGAYKPCILAFGADQFDDNHPQELRSRSSFFNWWYF  172

Query  643  GMCFGVMVTLWILNYVQDNLSWGLGF  720
              C G +  L +LNY+QDN+SW +GF
Sbjct  173  SSCAGPLAALLVLNYIQDNISWAIGF  198



>ref|XP_004963750.1| PREDICTED: uncharacterized protein LOC101758083 [Setaria italica]
Length=1223

 Score =   218 bits (555),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 135/210 (64%), Positives = 165/210 (79%), Gaps = 7/210 (3%)
 Frame = +1

Query  109  DGSVDFKGRPAARS-RTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaa  285
             G+V +  RP   S ++G WRSA FII VEVAERF+YYGISSNLISYLTGPLGQ+TAAAA
Sbjct  687  KGAVHYSDRPKHFSVQSGGWRSALFIIWVEVAERFAYYGISSNLISYLTGPLGQTTAAAA  746

Query  286  anvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFE-----S  450
            A VNAWSG AS+LPLLGA +ADS+LGRYRTIV SS+LYT+ LG LT+S++ P       +
Sbjct  747  AAVNAWSGAASMLPLLGAAVADSWLGRYRTIVASSVLYTMGLGMLTLSSMFPSPQQCGVA  806

Query  451  SDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFN  630
            +DS+ GA  P   Q +FF+ +LYLVA+AQ GHKPCVQAFGADQFD  DP E  +++SFFN
Sbjct  807  ADSR-GACPPSSLQTVFFYISLYLVAIAQSGHKPCVQAFGADQFDATDPDESSSRASFFN  865

Query  631  WWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            WWYFG+C    +T+ I++YVQDN+SW LGF
Sbjct  866  WWYFGICVSGTMTVAIMSYVQDNVSWALGF  895


 Score =   211 bits (538),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 136/216 (63%), Positives = 165/216 (76%), Gaps = 10/216 (5%)
 Frame = +1

Query  103  VVDGSV----DFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQS  270
            + DGSV    D  GRPA+R+ TG WRSASFII VE+AERF++YG+S+NLI+YLTGPLG+ 
Sbjct  126  IADGSVVEAVDHHGRPASRATTGGWRSASFIIAVEIAERFAFYGVSANLITYLTGPLGEG  185

Query  271  TaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLP---  441
             AAAA+ +NAW+G A LLPLLG  LADS LGRYRTIV++SL+Y L LG L +ST+L    
Sbjct  186  VAAAASALNAWNGTAQLLPLLGGALADSCLGRYRTIVLASLVYILGLGMLALSTLLSSGG  245

Query  442  ---FESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
                 S+ +   A +P   QV FF+ +LY+VALAQGGHKPCVQAFGADQFD  DP+E  +
Sbjct  246  HHQCASATAGGQACAPSTLQVSFFYVSLYIVALAQGGHKPCVQAFGADQFDQSDPKESVS  305

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +SSFFNWWYFGMC G  VTL  L+YVQDN+ WGLGF
Sbjct  306  RSSFFNWWYFGMCAGTAVTLVFLSYVQDNIGWGLGF  341



>ref|XP_006390700.1| hypothetical protein EUTSA_v10018035mg [Eutrema salsugineum]
 gb|ESQ27986.1| hypothetical protein EUTSA_v10018035mg [Eutrema salsugineum]
Length=1120

 Score =   217 bits (553),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 130/217 (60%), Positives = 162/217 (75%), Gaps = 1/217 (0%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
            S A  P L  D V  +VD  G  A R  TGRWR+A FIIGVEVAERF+YYGI+SNLISYL
Sbjct  3    SSANIPLL-DDYVYNAVDHGGLAAGRFNTGRWRAAWFIIGVEVAERFAYYGIASNLISYL  61

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLGQSTA AAANVNAWSG++ LLP++GAF AD+FLGRYRTI+I+SL+Y L +  LT S
Sbjct  62   TGPLGQSTAVAAANVNAWSGISCLLPIIGAFFADAFLGRYRTIIIASLIYILGMALLTFS  121

Query  430  TVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECK  609
             +L   +S++   A S      + FFF+LYLVA+ Q GHKPCVQAFGADQFD +DP+E +
Sbjct  122  ALLVPLTSENTEVASSHSSLLNVLFFFSLYLVAIGQSGHKPCVQAFGADQFDEKDPKEKR  181

Query  610  AKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             +SSFFNWWY  M  G+ + + ++ Y+Q+ +SW LGF
Sbjct  182  DRSSFFNWWYLSMSAGICLAIVVVVYIQEAVSWALGF  218


 Score =   189 bits (479),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 137/189 (72%), Gaps = 7/189 (4%)
 Frame = +1

Query  154  TGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLL  333
            +G W+SA  II VE+AERF+Y+GI+SNLI+YLTGPLG+STA+AA NVNAW G  + LPLL
Sbjct  545  SGGWKSARVIICVEMAERFAYFGITSNLITYLTGPLGESTASAAENVNAWIGTMAFLPLL  604

Query  334  GAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSDSQNGAGSPPQFQVIffffa  513
             AF+ADSFLGRYRTI+ISS LY L LG L+ S ++P  S DS        Q QV  F  +
Sbjct  605  WAFVADSFLGRYRTIIISSSLYILGLGLLSFSAMIPSHSKDSN-------QLQVTLFVSS  657

Query  514  lylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQ  693
            L LVA+ Q G+KPCV+ FGADQFD  D  E KAKSS+FNW  FG C  +  T  + +Y+Q
Sbjct  658  LCLVAIGQSGYKPCVKVFGADQFDGNDLVEAKAKSSYFNWLMFGSCISISTTRLVSSYIQ  717

Query  694  DNLSWGLGF  720
            +NLSW LGF
Sbjct  718  ENLSWSLGF  726



>ref|XP_011001077.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Populus euphratica]
Length=565

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 138/220 (63%), Positives = 165/220 (75%), Gaps = 8/220 (4%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            ETP L  + V+ SVD+KGRP  R  +G W+S  FII VEVAER +Y+GI+ NLI+YLTGP
Sbjct  4    ETPLLLDNPVEDSVDYKGRPVYRFNSGGWKSTLFIIVVEVAERSAYHGIAGNLITYLTGP  63

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            LGQST  AA N+N WSG A LLPLLGAF+ADSF+GRYRTIV+S+L+Y L LG L +S VL
Sbjct  64   LGQSTVTAAENMNVWSGTAWLLPLLGAFVADSFIGRYRTIVVSTLIYILGLGLLALSAVL  123

Query  439  P------FESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQ  600
            P       +SSD+       P   +I FFFALYLVA+ QGG + CVQAFGADQFD QDP+
Sbjct  124  PALGSSGCQSSDTARSCSPDP--VLILFFFALYLVAIGQGGFRACVQAFGADQFDGQDPE  181

Query  601  ECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            E KAKSSFFNWWYF M  G++V L  LNY+QDN++WGLGF
Sbjct  182  ERKAKSSFFNWWYFFMNAGLIVVLPALNYIQDNINWGLGF  221



>ref|XP_010665403.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Vitis vinifera]
Length=573

 Score =   212 bits (539),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 143/231 (62%), Positives = 178/231 (77%), Gaps = 8/231 (3%)
 Frame = +1

Query  43   MAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYG  222
            MA  G  +L   ++P L +D V G++D KGRPA RS +GRWR+A FI+G  VAERF+Y+G
Sbjct  1    MAMNG--LLEGPQSPLL-EDTVVGAIDNKGRPARRSTSGRWRAACFIVGAAVAERFAYFG  57

Query  223  ISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYT  402
            I +NLI+YLTG LGQSTAAAA NVN W GV++LLPL+GAF+AD ++GRYRTIV +SLLY 
Sbjct  58   IEANLINYLTGQLGQSTAAAAKNVNTWFGVSALLPLVGAFVADCYVGRYRTIVAASLLYV  117

Query  403  LALGFLTISTVLPFES-SDSQNG----AGSPPQFQVIffffalylvalaQGGHKPCVQAF  567
            L LG LT+S V   +S SD QN     + SP + QV+FFFF+LYLVA+A GGHK C QAF
Sbjct  118  LGLGLLTLSAVYSSQSLSDCQNTEKIMSCSPSRPQVLFFFFSLYLVAVAGGGHKTCNQAF  177

Query  568  GADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            GADQFD QDP+ECKAKSSFFNW  F +C G+ V++  L+Y+QDNL+W LGF
Sbjct  178  GADQFDGQDPEECKAKSSFFNWCSFCLCIGLSVSMLTLSYIQDNLNWVLGF  228



>ref|XP_010231334.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Brachypodium distachyon]
Length=534

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 154/200 (77%), Gaps = 10/200 (5%)
 Frame = +1

Query  145  RSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanvnawsgvasLL  324
            R  TG WRSA FII VEVAERF+YYGISSNLISYLTGPLG+STAAAAA VNAW+G AS+L
Sbjct  19   RRATGGWRSALFIIWVEVAERFAYYGISSNLISYLTGPLGESTAAAAAAVNAWAGAASML  78

Query  325  PLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSDSQNGAGS--------P  480
            PLLGA +ADS+LGRYRTIV SS+LY   LG L +S++  F S +SQ    S        P
Sbjct  79   PLLGAAVADSWLGRYRTIVASSVLYIAGLGMLALSSM--FSSPESQQCKVSTDGRRVCPP  136

Query  481  PQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYFGMCFGV  660
               Q  FF+ +LYLVA+AQ GHKPCVQAFGADQFDT DP E  ++SSFFNWWYFG+C   
Sbjct  137  SSLQTTFFYASLYLVAIAQSGHKPCVQAFGADQFDTADPSELSSRSSFFNWWYFGICASA  196

Query  661  MVTLWILNYVQDNLSWGLGF  720
             VT+ +++YVQDN+SWGLGF
Sbjct  197  TVTVALMSYVQDNVSWGLGF  216



>gb|AAG51133.1|AC069273_4 oligopeptide transporter, putative [Arabidopsis thaliana]
Length=1095

 Score =   216 bits (551),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 134/229 (59%), Positives = 168/229 (73%), Gaps = 9/229 (4%)
 Frame = +1

Query  34   LLSMAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFS  213
            LL++  T T+  S      L ++ V  +VD +G  A RS TGRWR+A FIIGVEVAERF+
Sbjct  530  LLAIKMTTTSKTS------LQEEYVIDAVDHRGFSARRSITGRWRAAWFIIGVEVAERFA  583

Query  214  YYGISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSL  393
             YGI SNLISYLTGPLGQSTA AAANVNAWSG++++LPLLGAF+AD+FLGRY TI+I+S 
Sbjct  584  NYGIGSNLISYLTGPLGQSTAVAAANVNAWSGISTILPLLGAFVADAFLGRYITIIIASF  643

Query  394  LYTLALGFLTISTVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGA  573
            +Y L L FLT+S    F   ++     SP  F    FFF+LYLVA+ Q GHKPCVQAFGA
Sbjct  644  IYVLGLAFLTLSA---FLIPNNTEVTSSPSSFLNALFFFSLYLVAIGQSGHKPCVQAFGA  700

Query  574  DQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            DQFD ++PQE   +SSFFNWWY  MC G+ + + ++ Y+Q+N+SW LGF
Sbjct  701  DQFDEKNPQENSDRSSFFNWWYLSMCAGIGLAILVVVYIQENVSWALGF  749


 Score =   210 bits (535),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 157/210 (75%), Gaps = 3/210 (1%)
 Frame = +1

Query  91   LHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQS  270
            L ++ V  +VD +G  A RS TGRWR+A FIIGVEVAERF+YYGI SNLISYLTGPLG+S
Sbjct  9    LQEEYVTDAVDHRGLAARRSNTGRWRAALFIIGVEVAERFAYYGIGSNLISYLTGPLGES  68

Query  271  TaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFES  450
            TA AAANVNAWSG+A+LLP+LGAF+AD+FLGRYRTI+ISSL+Y L L FLT+S    F  
Sbjct  69   TAVAAANVNAWSGIATLLPVLGAFVADAFLGRYRTIIISSLIYVLGLAFLTLSA---FLI  125

Query  451  SDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFN  630
             ++     S   F  + FFF+LYLVA+ Q GHKPCVQAFGADQFD +D QE   +SSFFN
Sbjct  126  PNTTEVTSSTSSFLNVLFFFSLYLVAIGQSGHKPCVQAFGADQFDEKDSQEKSDRSSFFN  185

Query  631  WWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            WWY  +  G+   + ++ Y+Q+  SW  GF
Sbjct  186  WWYLSLSAGICFAILVVVYIQEEFSWAFGF  215



>ref|XP_010665398.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Vitis vinifera]
Length=569

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 164/212 (77%), Gaps = 5/212 (2%)
 Frame = +1

Query  100  DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaa  279
            D VDG+VD KG PA RS +G W+SA FIIG+ V ERF + GI +NLI+YLTG LG+ST A
Sbjct  14   DTVDGAVDDKGDPAKRSFSGAWKSAYFIIGMAVVERFVFKGIETNLINYLTGWLGESTVA  73

Query  280  aaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSD-  456
            AAANVN WSG ++LLPLLGA +ADS+LG+YRTIVI+S+ Y L LG LT+S VL   SS  
Sbjct  74   AAANVNTWSGTSTLLPLLGASIADSYLGQYRTIVIASVTYILGLGLLTLSAVLTSGSSSN  133

Query  457  ----SQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSF  624
                ++  + S  + QV FFFF+LY+VA+AQGG KPC+QAFGA+QFD +D +ECKAKSSF
Sbjct  134  CKNRNKTTSCSHSELQVFFFFFSLYVVAIAQGGLKPCLQAFGAEQFDQRDQEECKAKSSF  193

Query  625  FNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FNWWYFG+  G  V+  I++Y+++N+SW LGF
Sbjct  194  FNWWYFGLAGGAAVSYLIMSYIEENVSWILGF  225



>ref|XP_011464753.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Fragaria vesca 
subsp. vesca]
Length=567

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 129/221 (58%), Positives = 157/221 (71%), Gaps = 7/221 (3%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSR---TGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
             TP L  D+     + K       R   TG WRSASFIIGV  AERF++YG+SSNLI++L
Sbjct  7    NTPLLDHDIEVAVSESKASSPTSIRSSTTGGWRSASFIIGVGFAERFAFYGVSSNLITFL  66

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            +GPLG+STA AA +VN WSG A+LLP+LGA +ADS+LGRYRTI+ S++LY L LG L  S
Sbjct  67   SGPLGESTATAAVHVNTWSGTAALLPMLGAIVADSYLGRYRTILFSTMLYILGLGLLAFS  126

Query  430  TVLP----FESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDP  597
             +LP    F    +        Q +VIFF+F+LYLVAL QGG+KPC+QAFGADQF+ QDP
Sbjct  127  AMLPSLSGFACEKTSEFTSCYSQLEVIFFYFSLYLVALGQGGNKPCIQAFGADQFNGQDP  186

Query  598  QECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             E KAKSSFFNWWYFG+C G + T  I +YVQDN SW LGF
Sbjct  187  VESKAKSSFFNWWYFGICSGSLCTRLISSYVQDNFSWVLGF  227



>ref|XP_002265311.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10 isoform X1 [Vitis vinifera]
 emb|CBI39336.3| unnamed protein product [Vitis vinifera]
Length=574

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 135/215 (63%), Positives = 166/215 (77%), Gaps = 5/215 (2%)
 Frame = +1

Query  91   LHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQS  270
            L +D VDGS+D KGRPA R  +G WRSA FI+G EVA RF+Y+GI SNLI++LT  LGQS
Sbjct  12   LLEDTVDGSIDHKGRPAKRPTSGGWRSAYFIMGAEVAGRFAYFGIQSNLINFLTDRLGQS  71

Query  271  TaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFES  450
              +AA +VN W+G  SL+PL+GAF+ADS++GRY TI+I+SLLY L LG LT+S VLP  S
Sbjct  72   VPSAAESVNTWTGTGSLMPLVGAFVADSYIGRYATIIIASLLYILGLGLLTLSAVLPVPS  131

Query  451  -SDSQNGAG----SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAK  615
             SD Q        SPPQ Q+IFFFF+LYLVA+  GGHKPC+QAFGADQFD ++P EC AK
Sbjct  132  HSDCQKSNKTIPCSPPQLQMIFFFFSLYLVAVGLGGHKPCIQAFGADQFDGRNPVECIAK  191

Query  616  SSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            SSFFNWW FG+    +VT  +L+Y+QDNL+WGLGF
Sbjct  192  SSFFNWWIFGVFSVTIVTQSVLSYIQDNLNWGLGF  226



>ref|XP_006376226.1| hypothetical protein POPTR_0013s11130g [Populus trichocarpa]
 gb|ERP54023.1| hypothetical protein POPTR_0013s11130g [Populus trichocarpa]
Length=565

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 139/220 (63%), Positives = 163/220 (74%), Gaps = 8/220 (4%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            ETP L    V+ SVD+KGRP  R  +G W+S  FII VEVAER +YYGI+ NLI+YLTGP
Sbjct  4    ETPLLLDTPVEDSVDYKGRPVYRFNSGGWKSTLFIIVVEVAERSAYYGIAGNLITYLTGP  63

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            LGQST  AA N+N WSG A LLPLLGAF+ADSF+GRYRTIV+S+L+Y L LG L +S VL
Sbjct  64   LGQSTVTAAENMNVWSGTAWLLPLLGAFVADSFIGRYRTIVVSTLIYILGLGLLALSAVL  123

Query  439  P------FESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQ  600
            P       +SSDS       P   +I FFFALYLVAL QGG +PCVQAFGADQFD QDP+
Sbjct  124  PPLGSSGCQSSDSAGSCSPDP--VLILFFFALYLVALGQGGFRPCVQAFGADQFDAQDPE  181

Query  601  ECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            E KAKSSFFNWW+F M  G++  L  LNY+QDN++W LGF
Sbjct  182  ERKAKSSFFNWWHFFMNAGLIAVLPALNYIQDNINWVLGF  221



>ref|XP_006304654.1| hypothetical protein CARUB_v10011811mg [Capsella rubella]
 gb|EOA37552.1| hypothetical protein CARUB_v10011811mg [Capsella rubella]
Length=564

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 128/209 (61%), Positives = 166/209 (79%), Gaps = 2/209 (1%)
 Frame = +1

Query  100  DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaa  279
            D V  SVD +GRPA +S TG WRSA FIIGVEVAERF+Y+GI+ NLI+YLTGPLGQSTA 
Sbjct  13   DHVSDSVDHRGRPAVKSSTGGWRSAWFIIGVEVAERFAYFGIACNLITYLTGPLGQSTAT  72

Query  280  aaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS-TVLPFESSD  456
            AA NVN WSG AS+LP+LGAF+AD++LGRYRTI+++SL+Y L LG LT+S +++    S+
Sbjct  73   AAVNVNTWSGTASMLPILGAFVADAYLGRYRTILVASLIYILGLGLLTLSASLIIMGISE  132

Query  457  SQNGAGSPPQFQV-IffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNW  633
             +NGA + P F V I FF +LYLVA+ QGGHKPCVQAFGADQFD +DP+E  A+ SFFNW
Sbjct  133  QRNGASAKPSFWVNILFFCSLYLVAIGQGGHKPCVQAFGADQFDAEDPKEVIARGSFFNW  192

Query  634  WYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            W+  +  G+ +++ ++ YVQ+N++W  GF
Sbjct  193  WFLSLSAGISLSIIVVAYVQENVNWAYGF  221



>ref|NP_001147980.1| LOC100281589 [Zea mays]
 gb|ACG29313.1| peptide transporter PTR2-B [Zea mays]
Length=564

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 134/221 (61%), Positives = 167/221 (76%), Gaps = 4/221 (2%)
 Frame = +1

Query  70   SDAETPFLHQD-VVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            SD+++  +  + + D ++D+ GRPA R  TG WRSA FII VE+AERF++YG+S+NLI+Y
Sbjct  5    SDSDSLLVRAEGMRDAALDYHGRPADRGATGGWRSALFIIAVEIAERFTFYGVSANLINY  64

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTGPLG+ TAAAAA +NAW+GVA LLPLLG  LAD +LGRYRTIVI+SLLY L LG L  
Sbjct  65   LTGPLGEGTAAAAAAINAWNGVAQLLPLLGGALADKWLGRYRTIVIASLLYILGLGMLAF  124

Query  427  STVLPFESSDSQNGAG---SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDP  597
            ST+L           G   +P   +V FF+ +LY+VA+AQGGHKPCVQAFGADQFD  DP
Sbjct  125  STLLSGSGHQCTAAGGQICAPSGLKVTFFYVSLYIVAVAQGGHKPCVQAFGADQFDQTDP  184

Query  598  QECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +E  ++SSFFNWWYFGMC G  V L +L+YVQDN+ WGLGF
Sbjct  185  KETVSRSSFFNWWYFGMCAGTAVMLVLLSYVQDNIGWGLGF  225



>ref|XP_002441154.1| hypothetical protein SORBIDRAFT_09g021330 [Sorghum bicolor]
 gb|EES19584.1| hypothetical protein SORBIDRAFT_09g021330 [Sorghum bicolor]
Length=571

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 161/209 (77%), Gaps = 6/209 (3%)
 Frame = +1

Query  112  GSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaan  291
             ++D++GRPA R  TG WRSA FII VE+AERF++YG+SSNLI+YLTGPLG+ TAAAAA 
Sbjct  27   AALDYRGRPADRGATGGWRSALFIIAVEIAERFTFYGVSSNLINYLTGPLGEGTAAAAAA  86

Query  292  vnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFES------S  453
            +NAW+GVA LLPLLG  LAD +LGRYRTIVI+SLLY L LG L  ST+L   S      +
Sbjct  87   INAWNGVAQLLPLLGGALADKWLGRYRTIVIASLLYVLGLGMLAFSTMLSSGSGHQCTTA  146

Query  454  DSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNW  633
              Q    +P   +  FF+ +LY+VA+AQGGHKPCVQAFGADQFD  DP+E  ++SSFFNW
Sbjct  147  RGQTQTCAPSTLKATFFYVSLYIVAVAQGGHKPCVQAFGADQFDQSDPKETVSRSSFFNW  206

Query  634  WYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            WYFGMC G  VTL +L+YVQDN+ WGLGF
Sbjct  207  WYFGMCAGTAVTLVLLSYVQDNIGWGLGF  235



>ref|NP_177357.2| putative peptide/nitrate transporter [Arabidopsis thaliana]
 sp|Q8VZE2.2|PTR22_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 5.14; Short=AtNPF5.14; 
AltName: Full=Nitrate transporter 1.15 [Arabidopsis thaliana]
 gb|AEE35276.1| putative peptide/nitrate transporter [Arabidopsis thaliana]
Length=557

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 157/210 (75%), Gaps = 3/210 (1%)
 Frame = +1

Query  91   LHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQS  270
            L ++ V  +VD +G  A RS TGRWR+A FIIGVEVAERF+YYGI SNLISYLTGPLG+S
Sbjct  9    LQEEYVTDAVDHRGLAARRSNTGRWRAALFIIGVEVAERFAYYGIGSNLISYLTGPLGES  68

Query  271  TaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFES  450
            TA AAANVNAWSG+A+LLP+LGAF+AD+FLGRYRTI+ISSL+Y L L FLT+S    F  
Sbjct  69   TAVAAANVNAWSGIATLLPVLGAFVADAFLGRYRTIIISSLIYVLGLAFLTLSA---FLI  125

Query  451  SDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFN  630
             ++     S   F  + FFF+LYLVA+ Q GHKPCVQAFGADQFD +D QE   +SSFFN
Sbjct  126  PNTTEVTSSTSSFLNVLFFFSLYLVAIGQSGHKPCVQAFGADQFDEKDSQEKSDRSSFFN  185

Query  631  WWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            WWY  +  G+   + ++ Y+Q+  SW  GF
Sbjct  186  WWYLSLSAGICFAILVVVYIQEEFSWAFGF  215



>gb|AAL57662.1| At1g72120/F28P5_2 [Arabidopsis thaliana]
 gb|AAN46774.1| At1g72120/F28P5_2 [Arabidopsis thaliana]
Length=557

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 128/210 (61%), Positives = 157/210 (75%), Gaps = 3/210 (1%)
 Frame = +1

Query  91   LHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQS  270
            L ++ V  +VD +G  A RS TGRWR+A FIIGVEVAERF+YYGI SNLISYLTGPLG+S
Sbjct  9    LQEEYVTDAVDHRGLDARRSNTGRWRAALFIIGVEVAERFAYYGIGSNLISYLTGPLGES  68

Query  271  TaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFES  450
            TA AAANVNAWSG+A+LLP+LGAF+AD+FLGRYRTI+ISSL+Y L L FLT+S    F  
Sbjct  69   TAVAAANVNAWSGIATLLPVLGAFVADAFLGRYRTIIISSLIYVLGLAFLTLSA---FLI  125

Query  451  SDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFN  630
             ++     S   F  + FFF+LYLVA+ Q GHKPCVQAFGADQFD +D QE   +SSFFN
Sbjct  126  PNTTEVTSSTSSFLNVLFFFSLYLVAIGQSGHKPCVQAFGADQFDEKDSQEKSDRSSFFN  185

Query  631  WWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            WWY  +  G+   + ++ Y+Q+  SW  GF
Sbjct  186  WWYLSLSAGICFAILVVVYIQEEFSWAFGF  215



>dbj|BAK04766.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=537

 Score =   209 bits (532),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 131/195 (67%), Positives = 152/195 (78%), Gaps = 6/195 (3%)
 Frame = +1

Query  154  TGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLL  333
            TG WRSA FII VEVAERF+YYGISSNLISYLTGPLG+STAAAAA VNAWSG AS+LPLL
Sbjct  25   TGGWRSALFIIWVEVAERFAYYGISSNLISYLTGPLGESTAAAAAAVNAWSGAASMLPLL  84

Query  334  GAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFE-----SSDSQNGAGSPP-QFQV  495
            GA +ADS+LGRYRTIV SSLLY   LG LT+S++LP       +  +Q     PP   Q 
Sbjct  85   GAAVADSWLGRYRTIVASSLLYITGLGMLTLSSMLPSPEGQQCTVSAQGRRECPPSSLQT  144

Query  496  IffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLW  675
             FF+ +LYLVA+AQ GHKPCVQAFGADQFD  DP E  ++ SFFNWWYFG+C    VT+ 
Sbjct  145  AFFYVSLYLVAIAQSGHKPCVQAFGADQFDVTDPSESSSRGSFFNWWYFGICGSATVTVA  204

Query  676  ILNYVQDNLSWGLGF  720
            +++YVQDN+SWGLGF
Sbjct  205  LMSYVQDNVSWGLGF  219



>ref|XP_010414831.1| PREDICTED: protein NRT1/ PTR FAMILY 5.13-like isoform X1 [Camelina 
sativa]
Length=552

 Score =   209 bits (532),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 161/209 (77%), Gaps = 4/209 (2%)
 Frame = +1

Query  94   HQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQST  273
             + V+D +VD +G  A RS TGR R+A FIIGVEVAERF++YGI SNLISYLTGPLGQST
Sbjct  6    EERVID-AVDHRGFDARRSNTGRRRAAWFIIGVEVAERFAHYGIGSNLISYLTGPLGQST  64

Query  274  aaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESS  453
            A AAANVNAWSG++++LP+LGAF+AD+FLGRYRTI+I+SL+Y L L FLT S    F   
Sbjct  65   AVAAANVNAWSGISTILPVLGAFVADAFLGRYRTIIIASLIYVLGLAFLTSSA---FMIP  121

Query  454  DSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNW  633
            ++     SP  F    FFF+LYLVA+ Q GHKPCVQAFGADQFD ++ QE + +SSFFNW
Sbjct  122  NTTEVTSSPSSFVNALFFFSLYLVAIGQSGHKPCVQAFGADQFDEKNLQEYRDRSSFFNW  181

Query  634  WYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            WYF +C G+ + + ++ Y+Q+ +SW LGF
Sbjct  182  WYFSICAGISLVILVVVYIQEYVSWALGF  210



>gb|EYU28220.1| hypothetical protein MIMGU_mgv1a020668mg, partial [Erythranthe 
guttata]
Length=549

 Score =   209 bits (532),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 124/209 (59%), Positives = 155/209 (74%), Gaps = 10/209 (5%)
 Frame = +1

Query  94   HQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQST  273
               +V+G +D +GRPA RS++G WRS+ +IIG    ERF+YYGISSNLI+YLTGPLGQST
Sbjct  5    ENGIVNGMMDHEGRPAKRSQSGYWRSSCYIIGAGATERFAYYGISSNLITYLTGPLGQST  64

Query  274  aaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESS  453
            AAAAA++N W+G   LLPLLGAF+A+SFLGRYR IV+SS+LY LALG LT S  L F   
Sbjct  65   AAAAASINIWTGTGLLLPLLGAFVAESFLGRYRAIVLSSMLYILALGLLTTSAFLDFR--  122

Query  454  DSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNW  633
                    P +  V+ FF +LYL+AL QG +KPC+ AFGADQFD   PQE +++SSFFNW
Sbjct  123  --------PNELDVLLFFGSLYLMALGQGAYKPCILAFGADQFDDNHPQELRSRSSFFNW  174

Query  634  WYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            WYF  C G +  L +LNY+QDN+SW +GF
Sbjct  175  WYFSSCAGPLAALLVLNYIQDNISWAIGF  203



>ref|XP_010911915.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 5.10-like 
[Elaeis guineensis]
Length=772

 Score =   212 bits (540),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 170/218 (78%), Gaps = 6/218 (3%)
 Frame = +1

Query  85   PFLHQDV-VDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPL  261
            P L Q   V G+VD++G   +RS +G W SA FIIGVE+AERF++YG SSNLI+YLTG L
Sbjct  5    PLLRQSTTVAGAVDYRGLSISRSSSGGWSSALFIIGVEIAERFAFYGTSSNLITYLTGSL  64

Query  262  GQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL-  438
            G+STAAAAA VN WSGVA +LPLLGAF+ADS+LGR+RTI+++SLLY L LG LT+S+VL 
Sbjct  65   GESTAAAAAAVNTWSGVACMLPLLGAFIADSYLGRFRTIILASLLYILGLGMLTLSSVLP  124

Query  439  ---PFESSDSQN-GAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQEC  606
               P    D+ +  A  P   QV FF+F+LYL+A AQGGHKPCVQAFGADQFD  DP+E 
Sbjct  125  SIHPSTCGDTMDPTACRPSPAQVAFFYFSLYLIAFAQGGHKPCVQAFGADQFDQNDPKES  184

Query  607  KAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
              KSSFFNWW+FGMC G+++T   L+Y+QDN+SWGLGF
Sbjct  185  MDKSSFFNWWFFGMCGGIVLTTVTLSYIQDNISWGLGF  222



>dbj|BAJ94112.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93002.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=549

 Score =   208 bits (529),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 133/218 (61%), Positives = 162/218 (74%), Gaps = 8/218 (4%)
 Frame = +1

Query  85   PFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLG  264
            P L Q     +VD  GRP +R  +G W +A FIIGVE++ERF+Y GIS NLI+YLTGPLG
Sbjct  7    PLLPQPA--AAVDHLGRPVSRLTSGSWPAAFFIIGVEISERFAYTGISGNLITYLTGPLG  64

Query  265  QSTaaaaanvnawsgvasLLPLLG-AFLADSFLGRYRTIVISSLLYTLALGFLTISTVL-  438
            QSTA+AAA +NAWSGVA LLPLLG A +ADS+LGRYRT+V +SLLY L LG LT+S++L 
Sbjct  65   QSTASAAATINAWSGVALLLPLLGVAAVADSWLGRYRTVVCASLLYILGLGMLTLSSILA  124

Query  439  ---PFESSDSQNGA-GSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQEC  606
               P +  D  + A  S     + FF+ +LY+VA AQGGHKPCVQAFGADQFD  DPQE 
Sbjct  125  TQLPAKFGDRMDSALYSTSTAHLPFFYISLYMVAFAQGGHKPCVQAFGADQFDENDPQEY  184

Query  607  KAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             ++SSFFNWWYFG   G +VT+ ILNY+QDN+SW  GF
Sbjct  185  ASRSSFFNWWYFGTYGGTLVTVSILNYIQDNISWQYGF  222



>ref|XP_010428072.1| PREDICTED: protein NRT1/ PTR FAMILY 5.13-like [Camelina sativa]
Length=555

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 161/208 (77%), Gaps = 3/208 (1%)
 Frame = +1

Query  97   QDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTa  276
            ++ V  +VD +G  A RS+TGRWR+A FIIGVEVAERF++YGI SNLISYLTGPL QSTA
Sbjct  6    KECVIDAVDHRGFDARRSKTGRWRAAWFIIGVEVAERFAHYGIGSNLISYLTGPLCQSTA  65

Query  277  aaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSD  456
             AAANVNAWSG++++LP+LGAF+AD+FLGRYRTI+I+SL+Y L L FLT+S    F   +
Sbjct  66   VAAANVNAWSGISTILPVLGAFVADAFLGRYRTIIIASLVYVLGLAFLTLSA---FMIPN  122

Query  457  SQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWW  636
            +     SP  F   FFFF+LYLVA+ Q GHKPCVQAFGADQFD ++ QE   +SSFFNWW
Sbjct  123  TTEVTSSPSSFVNAFFFFSLYLVAIGQSGHKPCVQAFGADQFDEKNLQEYSDRSSFFNWW  182

Query  637  YFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +  +C G+ + + ++ Y+Q+ +SW LGF
Sbjct  183  FLTICAGISLAILVVVYIQEYVSWALGF  210



>dbj|BAD82717.1| putative amino acid/peptide transporter [Oryza sativa Japonica 
Group]
 dbj|BAG90750.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   203 bits (516),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 162/207 (78%), Gaps = 5/207 (2%)
 Frame = +1

Query  115  SVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanv  294
            +VD  GRPA+R  +GRW +A FIIGVE++ERF++ GIS NLI+YLTGPLGQSTA+AAA +
Sbjct  15   AVDHLGRPASRRTSGRWLAALFIIGVEISERFAFGGISGNLITYLTGPLGQSTASAAAAI  74

Query  295  nawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL-PFESSDS----  459
            NAW+G A LLPLLGA +ADS+LGRYR I+ +SLLY L LG LT+S VL P + ++S    
Sbjct  75   NAWNGAALLLPLLGAAVADSWLGRYRIIICASLLYILGLGMLTLSPVLVPHQQAESGDNA  134

Query  460  QNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWY  639
             N A S     V FF+ +LY+VA AQGGHKPCVQAFGADQFD  DP+EC ++SSFFNWWY
Sbjct  135  DNNASSSMDIHVAFFYLSLYIVAFAQGGHKPCVQAFGADQFDENDPEECASRSSFFNWWY  194

Query  640  FGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FG+  G ++T+ ILNY+QDN+ W LGF
Sbjct  195  FGIYGGNVITVSILNYIQDNIGWQLGF  221



>ref|XP_011464752.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Fragaria vesca 
subsp. vesca]
Length=561

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 137/220 (62%), Positives = 163/220 (74%), Gaps = 7/220 (3%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            D +TP L  DV    +D+K  P     +G WRSA FIIGV   ERF++YG+SSNL+++L+
Sbjct  10   DLKTPLLQNDVEAAVLDYKHPPTG---SGGWRSAIFIIGVGCTERFAFYGVSSNLVTFLS  66

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
            GPLG+STA AA NVN WSG ASLLPLLGA +ADSFLGRYRTIV SSLLY L LG L+ ST
Sbjct  67   GPLGESTATAAENVNTWSGTASLLPLLGAVVADSFLGRYRTIVFSSLLYILGLGLLSFST  126

Query  433  VLP-FESSDSQNGA---GSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQ  600
             LP    SD +N +       Q QVIFF+F+LYLVA+ QGG+KPC+QAFGADQFD QDP 
Sbjct  127  KLPSLTGSDCENSSQLTSCYSQLQVIFFYFSLYLVAVGQGGNKPCIQAFGADQFDGQDPV  186

Query  601  ECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            E KAKSSFFNWWYFG+C G + T  + +Y+QDN SW LGF
Sbjct  187  ESKAKSSFFNWWYFGICSGSLCTRLVSSYIQDNFSWVLGF  226



>ref|XP_008781659.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 5.10-like 
[Phoenix dactylifera]
Length=1040

 Score =   213 bits (541),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 163/209 (78%), Gaps = 5/209 (2%)
 Frame = +1

Query  109  DGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaa  288
             G VD++GRP +RS TG W +A F+IG+EVAER +  GI+SNLI+YLTGPLG+STAAAAA
Sbjct  483  KGVVDYRGRPISRSATGGWTAALFVIGMEVAERCANAGIASNLITYLTGPLGESTAAAAA  542

Query  289  nvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPF----ESSD  456
             VN WSG+ S+LPLLGAF+ADS+LGRY T+VISSLLY L L  L +S ++P     + S 
Sbjct  543  AVNTWSGMGSMLPLLGAFVADSYLGRYWTVVISSLLYLLGLAMLMLSAMMPTLYPPKCSG  602

Query  457  SQNGAGSPP-QFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNW  633
            S +    PP QFQV  F+F+LYLVA+ QGG KPCV+AFGADQFD  DP+ECKAKSSFFNW
Sbjct  603  SADTKACPPTQFQVAIFYFSLYLVAIGQGGFKPCVEAFGADQFDESDPEECKAKSSFFNW  662

Query  634  WYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            W+FGMC G   T +++NYVQDN+SW L F
Sbjct  663  WFFGMCSGATATTFVVNYVQDNVSWALSF  691


 Score =   133 bits (334),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 103/136 (76%), Gaps = 2/136 (1%)
 Frame = +1

Query  319  LLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLP-FESSDSQNGAGSP-PQFQ  492
            +LPL+GAF+ADS+LGRYRTIV++SLLY L LG LT S++LP    SD  +    P  QFQ
Sbjct  17   MLPLVGAFVADSYLGRYRTIVLASLLYLLGLGMLTFSSMLPTLNPSDCTDLTACPQSQFQ  76

Query  493  VIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTL  672
               F+F+LY++A AQGGH+PCVQAFGADQFD  + +ECK+KSSFFNWW FG+    +VT 
Sbjct  77   ARVFYFSLYVIAFAQGGHRPCVQAFGADQFDENNLEECKSKSSFFNWWNFGVHASSLVTS  136

Query  673  WILNYVQDNLSWGLGF  720
              LNYVQDN+ W LGF
Sbjct  137  LALNYVQDNIGWTLGF  152



>emb|CDX82183.1| BnaC02g21070D [Brassica napus]
Length=554

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 124/218 (57%), Positives = 157/218 (72%), Gaps = 1/218 (0%)
 Frame = +1

Query  70   SDAET-PFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            +D+ET   L   VV GSVDF+G+P+ R  +G WRS+ FIIG EV+E+F+Y+G++SNLI+Y
Sbjct  6    ADSETGTTLSYGVVGGSVDFRGKPSLRFSSGGWRSSGFIIGAEVSEKFAYFGVASNLITY  65

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
             T  LG+STAAAA+NVN W G A+ LPL+   +ADSFLGR+RTI  +S LY L LG LT 
Sbjct  66   FTAQLGESTAAAASNVNLWLGTAAFLPLIWGSIADSFLGRFRTIHFTSSLYILGLGLLTF  125

Query  427  STVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQEC  606
            S  +P    D +       QF+V  FF ALYL+AL +GG K C++AFGADQFD QDP E 
Sbjct  126  SATIPSACKDQETLVSCVSQFKVTIFFCALYLIALGEGGFKACLRAFGADQFDEQDPIES  185

Query  607  KAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KAKSSFFNW YF + FG++ T  + NYVQ+NLSW LGF
Sbjct  186  KAKSSFFNWLYFAISFGILATRLVSNYVQENLSWALGF  223



>ref|XP_010415943.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 5.13-like 
[Camelina sativa]
Length=554

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 127/211 (60%), Positives = 161/211 (76%), Gaps = 6/211 (3%)
 Frame = +1

Query  94   HQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQ--  267
             + V+D +VD +G  A RS TGRWR+A FIIGVEVAERF++YGI SNLISYLTGPLGQ  
Sbjct  6    EERVID-AVDHRGFDARRSNTGRWRAAWFIIGVEVAERFAHYGIGSNLISYLTGPLGQTQ  64

Query  268  STaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFE  447
            STA AAANVNAWSG++++LP+LGAF+AD+FLGRYRTI+I+SL+Y L L FLT S    F 
Sbjct  65   STAVAAANVNAWSGISTILPVLGAFVADAFLGRYRTIIIASLIYVLGLAFLTSSA---FM  121

Query  448  SSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFF  627
              ++     SP  F    FFF+LYLVA+ Q  HKPCVQAFGADQFD ++PQE + +SSFF
Sbjct  122  IPNTTEVTSSPSSFVNALFFFSLYLVAIGQSVHKPCVQAFGADQFDEKNPQEYRDRSSFF  181

Query  628  NWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            NWWY  +C G+ + + ++ Y+Q+ +SW LGF
Sbjct  182  NWWYLSICAGISLAVLVVVYIQEYVSWALGF  212



>ref|XP_006376229.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
 gb|ERP54026.1| proton-dependent oligopeptide transport family protein [Populus 
trichocarpa]
Length=572

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 134/230 (58%), Positives = 159/230 (69%), Gaps = 20/230 (9%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            ETP L    VD SVD+KG     S +G W+ A  IIGVEVAER +Y+GIS NLI+YLTGP
Sbjct  4    ETPLLLPYAVDSSVDYKGF----SNSGGWKCAFLIIGVEVAERSAYFGISGNLITYLTGP  59

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTL-----------  405
            LGQST  AA N+N WSG A LLPLLGAF+ADSFLGRYRTI++++ +Y L           
Sbjct  60   LGQSTVTAAENLNLWSGTAWLLPLLGAFVADSFLGRYRTIIVAASIYILLVKCMEFNLNS  119

Query  406  -ALGFLTISTVLP-FESSDSQNGAG---SPPQFQVIffffalylvalaQGGHKPCVQAFG  570
              L  LT+S VLP   + D Q+        P   +I FFFALYLVA  QGG +PCVQAFG
Sbjct  120  QGLSLLTLSAVLPSVRAHDCQSADTIQLCSPDPSLILFFFALYLVAFGQGGFRPCVQAFG  179

Query  571  ADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            ADQFD QDP+E K++SSFFNWW FGM  G++V L  LNY+QDNL+WG GF
Sbjct  180  ADQFDGQDPEERKSRSSFFNWWNFGMNAGLIVILPFLNYIQDNLNWGFGF  229



>dbj|BAB86541.1| OSJNBb0008G24.11 [Oryza sativa Japonica Group]
Length=617

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 134/283 (47%), Positives = 179/283 (63%), Gaps = 50/283 (18%)
 Frame = +1

Query  4    LWAQRRRG----GRLLSMAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRS  171
            L  QRR        + S A T   +L  +E        V G+VDF+GRPA+R+ TGRW +
Sbjct  26   LIHQRRNATHHDATMASHAVTDALLLPRSE------GAVAGAVDFRGRPASRASTGRWSA  79

Query  172  ASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLAD  351
            A F++GVE+AERF+Y+G+S+NLISYLTGPLG+STA AAA +N WSGVA++LPLL A +AD
Sbjct  80   AMFVLGVEIAERFAYHGVSANLISYLTGPLGESTAGAAAAINLWSGVATMLPLLVACVAD  139

Query  352  SFLGRYRTIVISSLLYTL---------------------------------ALGFLTIST  432
            ++LGRYRTIV++SLL+ +                                 ++G LT+S+
Sbjct  140  AWLGRYRTIVLASLLFVVKKAHAFLQMNFSKSPTYIQFGGESAATRFGKKKSMGMLTLSS  199

Query  433  VLPFESSD-------SQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQ  591
             LP    D       S++ + +P   QV  F+ +LYLVALA+ GHKPC QAFGADQFD  
Sbjct  200  ALPAFHGDGGGCSYTSKSLSCAPSTAQVAIFYVSLYLVALAEAGHKPCAQAFGADQFDQN  259

Query  592  DPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            D +E  ++SSFFNWWYFGMC G  +T  + +Y+QDN+ WGLGF
Sbjct  260  DAKESVSRSSFFNWWYFGMCSGTAMTTMVSSYIQDNIGWGLGF  302



>ref|XP_002441153.1| hypothetical protein SORBIDRAFT_09g021320 [Sorghum bicolor]
 gb|EES19583.1| hypothetical protein SORBIDRAFT_09g021320 [Sorghum bicolor]
Length=545

 Score =   206 bits (525),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 127/193 (66%), Positives = 151/193 (78%), Gaps = 4/193 (2%)
 Frame = +1

Query  154  TGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLL  333
            TG W+SA FII VEVAERF+YYGISSNLISYLTGPLGQ+TAAAAA VNAWSG AS+LPLL
Sbjct  22   TGGWKSALFIIWVEVAERFAYYGISSNLISYLTGPLGQTTAAAAAAVNAWSGAASMLPLL  81

Query  334  GAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL--PFESSDSQNGAG--SPPQFQVIf  501
            GA +ADS+LGRYRTIV SS+LY   LG LT+S++   P +  DS +G G   P   Q  F
Sbjct  82   GAAVADSWLGRYRTIVASSVLYITGLGMLTLSSMFSSPQQCRDSADGQGVCPPSSLQTAF  141

Query  502  fffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWIL  681
            F+ +LYLVA+AQ GHKPCVQAFGADQFD  DP E  +++SFFNWWY G+C    VT+ ++
Sbjct  142  FYISLYLVAIAQSGHKPCVQAFGADQFDATDPDESVSRASFFNWWYMGLCTSATVTIALM  201

Query  682  NYVQDNLSWGLGF  720
            +YVQDN+ W LGF
Sbjct  202  SYVQDNIGWALGF  214



>emb|CBI39331.3| unnamed protein product [Vitis vinifera]
Length=1046

 Score =   211 bits (538),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 143/232 (62%), Positives = 179/232 (77%), Gaps = 8/232 (3%)
 Frame = +1

Query  40   SMAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYY  219
            +MA  G  +L   ++P L +D V G++D KGRPA RS +GRWR+A FI+G  VAERF+Y+
Sbjct  473  NMAMNG--LLEGPQSPLL-EDTVVGAIDNKGRPARRSTSGRWRAACFIVGAAVAERFAYF  529

Query  220  GISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLY  399
            GI +NLI+YLTG LGQSTAAAA NVN W GV++LLPL+GAF+AD ++GRYRTIV +SLLY
Sbjct  530  GIEANLINYLTGQLGQSTAAAAKNVNTWFGVSALLPLVGAFVADCYVGRYRTIVAASLLY  589

Query  400  TLALGFLTISTVLPFES-SDSQNG----AGSPPQFQVIffffalylvalaQGGHKPCVQA  564
             L LG LT+S V   +S SD QN     + SP + QV+FFFF+LYLVA+A GGHK C QA
Sbjct  590  VLGLGLLTLSAVYSSQSLSDCQNTEKIMSCSPSRPQVLFFFFSLYLVAVAGGGHKTCNQA  649

Query  565  FGADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FGADQFD QDP+ECKAKSSFFNW  F +C G+ V++  L+Y+QDNL+W LGF
Sbjct  650  FGADQFDGQDPEECKAKSSFFNWCSFCLCIGLSVSMLTLSYIQDNLNWVLGF  701


 Score =   203 bits (516),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 151/186 (81%), Gaps = 6/186 (3%)
 Frame = +1

Query  118  VDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanvn  297
            VD KG PA RS +G WRSA FIIG EVAER +YYGI SNLI+YLTGPLGQSTA AAANVN
Sbjct  2    VDHKGCPATRSSSGAWRSAYFIIGAEVAERIAYYGIGSNLINYLTGPLGQSTAMAAANVN  61

Query  298  awsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPF-ESSDSQNG--  468
             WSG A+LLPLLGAF+AD++LGRYRTIVI+SLLY L LG LT+S VLP+   SD QN   
Sbjct  62   TWSGTATLLPLLGAFVADTYLGRYRTIVIASLLYILGLGLLTLSAVLPYLRPSDCQNSDK  121

Query  469  --AGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYF  642
              + SPPQ  VI FFF+LYLVA+ +GGHKPC+QAFGADQFD  +P+ECKAKSSFFNWWYF
Sbjct  122  ITSCSPPQIPVI-FFFSLYLVAVGEGGHKPCIQAFGADQFDGNNPEECKAKSSFFNWWYF  180

Query  643  GMCFGV  660
              C G+
Sbjct  181  SQCAGI  186



>ref|XP_010521166.1| PREDICTED: protein NRT1/ PTR FAMILY 5.14-like [Tarenaya hassleriana]
 ref|XP_010521167.1| PREDICTED: protein NRT1/ PTR FAMILY 5.14-like [Tarenaya hassleriana]
Length=566

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 126/225 (56%), Positives = 165/225 (73%), Gaps = 7/225 (3%)
 Frame = +1

Query  67   LSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            + + +   L +     +V+ +G PA +S TG WRSA FIIGVEVAERF+Y+GI SNLI+Y
Sbjct  1    MENTDEKTLGEGYASSAVNHRGIPAEKSSTGGWRSAWFIIGVEVAERFAYFGIGSNLINY  60

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTG +G STAAA+ANVNAW G  ++LP+LGAF+AD++LGR+RTIV+SSL+Y + +  LT+
Sbjct  61   LTGHIGLSTAAASANVNAWVGTGAILPVLGAFVADAYLGRFRTIVVSSLIYVVGMASLTL  120

Query  427  STVL-PFESSDSQNG----AGSPPQ--FQVIffffalylvalaQGGHKPCVQAFGADQFD  585
            S  + P   S  +N     AG+ P     VIFFFF+LYLVA+ Q GHKPCVQAFGADQFD
Sbjct  121  SAFMNPIIKSKYRNHNKTEAGTSPSSLINVIFFFFSLYLVAVGQSGHKPCVQAFGADQFD  180

Query  586  TQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             +D +E KA+SSFFNWWY  +  G+ + + I+ YVQDN+SW LGF
Sbjct  181  VEDEKEKKARSSFFNWWYLSLSAGINLAILIVVYVQDNVSWALGF  225



>gb|AFW78188.1| hypothetical protein ZEAMMB73_298414 [Zea mays]
Length=538

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 126/194 (65%), Positives = 149/194 (77%), Gaps = 5/194 (3%)
 Frame = +1

Query  154  TGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLL  333
            TG W+SA FII VEVAERF+YYGISSNLISYLTGPLGQ+TAAAAA VNAWSG AS+LPLL
Sbjct  22   TGGWKSALFIIWVEVAERFAYYGISSNLISYLTGPLGQTTAAAAAAVNAWSGAASMLPLL  81

Query  334  GAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPF-----ESSDSQNGAGSPPQFQVI  498
            GA +ADS+LGRYRTIV SS+LY   LG LT+S+V        +S+D   G   P   Q  
Sbjct  82   GAAVADSWLGRYRTIVASSVLYITGLGMLTLSSVFSSPQQCRDSADDGEGICPPSSLQTA  141

Query  499  ffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWI  678
            FF+ +LYLVA+AQ GHKPCVQAFGADQFD  DP E  +++SFFNWWY G+C    VT+ +
Sbjct  142  FFYASLYLVAIAQSGHKPCVQAFGADQFDATDPDESVSRASFFNWWYMGLCTSATVTIAL  201

Query  679  LNYVQDNLSWGLGF  720
            ++YVQDN+ W LGF
Sbjct  202  MSYVQDNVGWALGF  215



>gb|EEC71883.1| hypothetical protein OsI_04614 [Oryza sativa Indica Group]
Length=548

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 163/207 (79%), Gaps = 5/207 (2%)
 Frame = +1

Query  115  SVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanv  294
            +VD  GRPA+R  +GRW +A FIIGVE++ERF++ GIS NLI+YLTGPLGQSTA+AAA +
Sbjct  15   AVDHLGRPASRRTSGRWLAALFIIGVEISERFAFGGISGNLITYLTGPLGQSTASAAAAI  74

Query  295  nawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL-PFESSDS----  459
            NAW+G A LLPLLGA +ADS+LGRYRTI+ +SLLY L LG LT+S VL P + ++S    
Sbjct  75   NAWNGAALLLPLLGAAVADSWLGRYRTIICASLLYILGLGMLTLSPVLVPHQQAESGDNA  134

Query  460  QNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWY  639
             N A S     V FF+ +LY+VA AQGGHKPCVQAFGADQFD  DP+EC ++SSFFNWWY
Sbjct  135  DNNASSSMDIHVAFFYLSLYIVAFAQGGHKPCVQAFGADQFDENDPEECASRSSFFNWWY  194

Query  640  FGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FG+  G ++T+ ILNY+QDN+ W LGF
Sbjct  195  FGIYGGNVITVSILNYIQDNIGWQLGF  221



>ref|XP_011039203.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X1 [Populus 
euphratica]
 ref|XP_011039204.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like isoform X2 [Populus 
euphratica]
Length=564

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 138/218 (63%), Positives = 162/218 (74%), Gaps = 4/218 (2%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            ETP L  + V+ SVD+KGRP  R  +G W+S  FII VEVAER +Y GI+ NLI+YLTGP
Sbjct  4    ETPLLVDNPVEDSVDYKGRPVYRFNSGGWKSTLFIIVVEVAERSAYLGIAGNLITYLTGP  63

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            LGQST  AA N+N WSG + LLPLLGAF+ADSF+GRYRTIV+S+L+Y L LG L +S VL
Sbjct  64   LGQSTVTAAENMNVWSGTSWLLPLLGAFVADSFIGRYRTIVVSTLIYILGLGLLALSAVL  123

Query  439  P---FESSDSQNGAGS-PPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQEC  606
            P        S + AGS  P   +I FFFA YLVAL QGG +PCVQAFGADQFD QDP+E 
Sbjct  124  PPLSSSGCQSSDSAGSCSPDPVLILFFFAFYLVALGQGGFRPCVQAFGADQFDGQDPEER  183

Query  607  KAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            KAKSSFFNWW F M  GV+V L  LNY+QDN++W LGF
Sbjct  184  KAKSSFFNWWNFFMNAGVIVILLALNYIQDNINWVLGF  221



>ref|XP_006416185.1| hypothetical protein EUTSA_v10007251mg [Eutrema salsugineum]
 gb|ESQ34538.1| hypothetical protein EUTSA_v10007251mg [Eutrema salsugineum]
Length=562

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 126/212 (59%), Positives = 162/212 (76%), Gaps = 2/212 (1%)
 Frame = +1

Query  91   LHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQS  270
            L +D V  SVD +G PA +S TG WRSA +IIGVEV ERF+Y+GI+SNLI+YLTGPLGQS
Sbjct  10   LLEDSVSDSVDHRGIPAGKSSTGGWRSAWYIIGVEVGERFAYFGIASNLITYLTGPLGQS  69

Query  271  TaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFES  450
            TA AA NVN WSG AS+LP+LGAF+AD++LGRY TIV++SL+Y   LG LT+S  L    
Sbjct  70   TATAAVNVNTWSGTASMLPVLGAFVADAYLGRYLTIVVASLIYIFGLGLLTLSASLILTG  129

Query  451  -SDSQNGAGSPPQFQV-IffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSF  624
             S+ +N A + P F V I FF +LYLVA+ QGGHKPCVQAFGADQFD+ D +E  ++ SF
Sbjct  130  LSELRNDASARPSFWVNILFFCSLYLVAIGQGGHKPCVQAFGADQFDSADSKERISRGSF  189

Query  625  FNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FNWW+  +  G+ +++ ++ YVQDN++W LGF
Sbjct  190  FNWWFLSLSAGITLSIVVVVYVQDNVNWALGF  221



>ref|NP_001168010.1| uncharacterized protein LOC100381733 [Zea mays]
 gb|ACN26827.1| unknown [Zea mays]
 gb|AFW81843.1| hypothetical protein ZEAMMB73_422562 [Zea mays]
Length=564

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 157/207 (76%), Gaps = 4/207 (2%)
 Frame = +1

Query  112  GSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaan  291
             ++D++  PA R  TG WRSA FII VE++ERF++YG+SSNLI+YLTGPLG+ TAAAAA 
Sbjct  20   AALDYRDHPADRGATGGWRSALFIIAVEISERFTFYGVSSNLINYLTGPLGEGTAAAAAA  79

Query  292  vnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSDSQNGA  471
            +N W+GVA LLPLLG  LAD +LGRYRTIV++SLLY +  G L  ST+L   S      A
Sbjct  80   INTWNGVAQLLPLLGGALADKWLGRYRTIVVASLLYVIGAGMLAFSTLLSSGSGHQCTTA  139

Query  472  G----SPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWY  639
            G    +P   +V FF+ +LY+VA+AQGGHKPCVQAFGADQFD  DP+E  ++SSFFNWWY
Sbjct  140  GGQTCAPSTIKVTFFYVSLYIVAVAQGGHKPCVQAFGADQFDQSDPKETVSRSSFFNWWY  199

Query  640  FGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FGMC G  VTL  LNYVQDN+ WGLGF
Sbjct  200  FGMCAGTAVTLLFLNYVQDNIGWGLGF  226



>ref|XP_009110133.1| PREDICTED: protein NRT1/ PTR FAMILY 5.15 [Brassica rapa]
Length=564

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 163/216 (75%), Gaps = 2/216 (1%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E   L +D V  SVD +G PAA+S TG WRSA FIIGVEVAERF+Y+GI+ NLI+YLTGP
Sbjct  6    EEASLLEDYVSDSVDHRGSPAAKSSTGGWRSAWFIIGVEVAERFAYFGIACNLINYLTGP  65

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST--  432
            LGQSTAAAA NVN WSG AS+LP+LGAF+AD++LGRYRTI+ +SL+Y L LG LT+S   
Sbjct  66   LGQSTAAAAVNVNTWSGTASMLPILGAFVADAYLGRYRTILAASLIYILGLGLLTLSASL  125

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
            +L  ES    N +  P     I FF +LYLVA+ QGGHKPCVQAFGADQFD+ DP+E  +
Sbjct  126  ILTGESEQRVNVSAKPSVSVNILFFCSLYLVAIGQGGHKPCVQAFGADQFDSGDPKEVIS  185

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            + SFFNWW+  +  G+ +++ ++ YVQDN+SW  GF
Sbjct  186  RGSFFNWWFLSLSAGISLSIIVVAYVQDNVSWAYGF  221



>gb|EAZ14316.1| hypothetical protein OsJ_04243 [Oryza sativa Japonica Group]
Length=478

 Score =   203 bits (517),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 153/207 (74%), Gaps = 11/207 (5%)
 Frame = +1

Query  100  DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaa  279
            D V G+VD++GRPA+R+ TG W+S+ F++ +E+AERF+Y G+++NLI+YLTGPLGQ  A 
Sbjct  19   DTVAGAVDYRGRPASRAATGGWKSSVFVMAMEIAERFAYKGVAANLITYLTGPLGQPMAR  78

Query  280  aaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSDS  459
            AAA+++AW GV+ +LPL  A +AD++LGRYR IV++S+++ L++G L++S+  P      
Sbjct  79   AAASIDAWKGVSQMLPLPLACVADAWLGRYRAIVLASVIFVLSMGTLSMSSAFPVSR---  135

Query  460  QNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWY  639
               AG    F V     ALY+VAL +G HKPC QAF ADQFD +D  EC A+SSFFNWWY
Sbjct  136  ---AGHVAVFYV-----ALYMVALGEGAHKPCAQAFAADQFDEKDGGECAARSSFFNWWY  187

Query  640  FGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FGMC G  VT  + +YVQDN+ WGLGF
Sbjct  188  FGMCAGTAVTTMVSSYVQDNVGWGLGF  214



>emb|CDY41477.1| BnaA08g20790D [Brassica napus]
Length=564

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 130/216 (60%), Positives = 163/216 (75%), Gaps = 2/216 (1%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E   L +D V  SVD +G PAA+S TG WRSA FIIGVEVAERF+Y+GI+ NLI+YLTGP
Sbjct  6    EEASLLEDYVSDSVDHRGSPAAKSSTGGWRSAWFIIGVEVAERFAYFGIACNLINYLTGP  65

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST--  432
            LGQSTAAAA NVN WSG AS+LP+LGAF+AD++LGRYRTI+ +SL+Y L LG LT+S   
Sbjct  66   LGQSTAAAAVNVNTWSGTASMLPILGAFVADAYLGRYRTILAASLIYILGLGLLTLSASL  125

Query  433  VLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
            +L  ES    N +  P     I FF +LYLVA+ QGGHKPCVQAFGADQFD+ DP+E  +
Sbjct  126  ILTGESEQRLNVSAKPSVSVNILFFCSLYLVAIGQGGHKPCVQAFGADQFDSGDPKEVIS  185

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            + SFFNWW+  +  G+ +++ ++ YVQDN+SW  GF
Sbjct  186  RGSFFNWWFLSLSAGISLSIIVVAYVQDNVSWAYGF  221



>dbj|BAB86548.1| OSJNBb0008G24.20 [Oryza sativa Japonica Group]
Length=548

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 162/207 (78%), Gaps = 5/207 (2%)
 Frame = +1

Query  115  SVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanv  294
            +VD  GRPA+R  +GRW +A FIIGVE++ERF++ GIS NLI+YLTGPLGQSTA+AAA +
Sbjct  15   AVDHLGRPASRRTSGRWLAALFIIGVEISERFAFGGISGNLITYLTGPLGQSTASAAAAI  74

Query  295  nawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL-PFESSDS----  459
            NAW+G A LLPLLGA +ADS+LGRYR I+ +SLLY L LG LT+S VL P + ++S    
Sbjct  75   NAWNGAALLLPLLGAAVADSWLGRYRIIICASLLYILGLGMLTLSPVLVPHQQAESGDNA  134

Query  460  QNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWY  639
             N A S     V FF+ +LY+VA AQGGHKPCVQAFGADQFD  DP+EC ++SSFFNWWY
Sbjct  135  DNNASSSMDIHVAFFYLSLYIVAFAQGGHKPCVQAFGADQFDENDPEECASRSSFFNWWY  194

Query  640  FGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FG+  G ++T+ ILNY+QDN+ W LGF
Sbjct  195  FGIYGGNVITVSILNYIQDNIGWQLGF  221



>emb|CDY58918.1| BnaCnng33930D [Brassica napus]
Length=552

 Score =   204 bits (518),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 151/210 (72%), Gaps = 0/210 (0%)
 Frame = +1

Query  91   LHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQS  270
            L   +VDGSVD +G+P+ RS +G WRS+ FIIG EVAE+F+Y GI+SNLI+Y TGPL  S
Sbjct  14   LLNGIVDGSVDLRGKPSVRSTSGGWRSSGFIIGAEVAEKFAYLGIASNLITYFTGPLEMS  73

Query  271  TaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFES  450
            TA+AA+NVN W G A+ LPL+   +ADSFLGRYRTI+++S LY L LG LT S  +P   
Sbjct  74   TASAASNVNLWLGTAAFLPLIWGSIADSFLGRYRTILLTSSLYILGLGLLTFSATIPSLC  133

Query  451  SDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFN  630
             D +       + ++  FF ALYL+A+ +GG K C++AFGADQFD QDP+E KAKS +FN
Sbjct  134  KDQETLVSCVSKLKITIFFSALYLIAIGEGGFKVCIRAFGADQFDEQDPKESKAKSVYFN  193

Query  631  WWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            W YF    G++ T  I N+VQ+NLSW LGF
Sbjct  194  WSYFARSAGILTTRLISNHVQENLSWALGF  223



>gb|ERM97850.1| hypothetical protein AMTR_s00118p00129200 [Amborella trichopoda]
Length=338

 Score =   198 bits (504),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 137/230 (60%), Positives = 165/230 (72%), Gaps = 14/230 (6%)
 Frame = +1

Query  64   ILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLIS  243
            + + A +  L  D V G  D  GRPA RS TG WRS+ FIIGVEVAER +YYG SSNLI+
Sbjct  1    MAASASSRLLFGDRVPGITDVHGRPAVRSGTGGWRSSLFIIGVEVAERLAYYGASSNLIT  60

Query  244  YLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLT  423
            YLT  L Q+TA AA NVN WSGVASLLPLLGAF+ADS+LGRYRTI+ISSL+Y L L  LT
Sbjct  61   YLTDYLNQNTATAAKNVNIWSGVASLLPLLGAFVADSYLGRYRTIIISSLIYLLGLILLT  120

Query  424  ISTVLPFESSDSQNGA-GSPPQ----------FQVIffffalylvalaQGGHKPCVQAFG  570
            +S  +P   S   NG   + P+          FQV FFFF+LYL+AL QGGHKPCVQ+FG
Sbjct  121  LSAAVP---SLQPNGCYKTEPRALAKCHGSSTFQVAFFFFSLYLIALGQGGHKPCVQSFG  177

Query  571  ADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            ADQF+  DP E + K+SFFNWWY G+C G ++ + ++ YVQDN+ WGLGF
Sbjct  178  ADQFNEDDPTERRGKASFFNWWYMGICGGSLLAVSVVMYVQDNMGWGLGF  227



>ref|XP_010930856.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105051911 
[Elaeis guineensis]
Length=1124

 Score =   209 bits (531),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 124/202 (61%), Positives = 149/202 (74%), Gaps = 5/202 (2%)
 Frame = +1

Query  130  GRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanvnawsg  309
            GRP  R  TGRW +A F+IG+E+AER +  GI+SNLI+YLTGPLGQSTA AA  VN WSG
Sbjct  9    GRPKTRPATGRWNAAFFVIGLEIAERSANAGIASNLITYLTGPLGQSTAVAATAVNTWSG  68

Query  310  vasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSDSQNGAGS----  477
            VAS+LPLLGAF+ADS+LGRYRTI++SS LY L L  LT+S++LP     + +GA      
Sbjct  69   VASMLPLLGAFIADSYLGRYRTIILSSTLYLLGLSMLTLSSMLPNLFPPNCDGAKDSTAC  128

Query  478  -PPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYFGMCF  654
             P +F V  F+F+LY+VALAQGG  P   AFGADQFD  DP+ECK KSSFFNWWYF  C 
Sbjct  129  PPTRFHVFAFYFSLYVVALAQGGQTPSAVAFGADQFDEDDPEECKDKSSFFNWWYFATCG  188

Query  655  GVMVTLWILNYVQDNLSWGLGF  720
            G    ++ILNYVQDN+ W L F
Sbjct  189  GSNFAMFILNYVQDNIGWALAF  210


 Score =   195 bits (496),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 128/206 (62%), Positives = 160/206 (78%), Gaps = 6/206 (3%)
 Frame = +1

Query  121  DFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanvna  300
            D  GRP +RS TG W +A FI+GVE+AER + +G+SSNLISYLTGPLG+S AAAA  VN 
Sbjct  582  DDPGRPISRSTTGGWTAALFILGVEIAERSARFGVSSNLISYLTGPLGESMAAAATAVNV  641

Query  301  wsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPF----ESSDSQNG  468
            WSGV+ +LPL+GAF+ADS+LGRYRTIV+SSLLY L LG LT+S++LP     E +DS + 
Sbjct  642  WSGVSFMLPLVGAFIADSYLGRYRTIVLSSLLYLLGLGMLTLSSMLPTLNPSECNDSTDL  701

Query  469  AGSPP--QFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYF  642
               P   +FQ I F+F+LYL A AQGGH+PCVQAFGA+QFD  +P+ECKA+SSFFNWW F
Sbjct  702  TACPQLLRFQAIVFYFSLYLFAFAQGGHRPCVQAFGAEQFDENNPEECKARSSFFNWWNF  761

Query  643  GMCFGVMVTLWILNYVQDNLSWGLGF  720
            G+   ++VT   LNY+QDN+ W LGF
Sbjct  762  GVFATILVTNLALNYIQDNIGWTLGF  787



>gb|EAY76648.1| hypothetical protein OsI_04604 [Oryza sativa Indica Group]
Length=532

 Score =   203 bits (516),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 153/207 (74%), Gaps = 11/207 (5%)
 Frame = +1

Query  100  DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaa  279
            D V G+VD++GRPA+R+ TG W+S+ F++ +E+AERF+Y G+++NLI+YLTGPLGQ  A 
Sbjct  3    DTVAGAVDYRGRPASRAATGGWKSSVFVMAMEIAERFAYKGVAANLITYLTGPLGQPMAR  62

Query  280  aaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSDS  459
            AAA+++AW GV+ +LPL  A +AD++LGRYR IV++S+++ L++G L++S+  P      
Sbjct  63   AAASIDAWKGVSQMLPLPLACVADAWLGRYRAIVLASVIFVLSMGTLSMSSAFPVSR---  119

Query  460  QNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWY  639
               AG    F V     ALY+VAL +G HKPC QAF ADQFD +D  EC A+SSFFNWWY
Sbjct  120  ---AGHVAVFYV-----ALYMVALGEGAHKPCAQAFAADQFDEKDGGECAARSSFFNWWY  171

Query  640  FGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FGMC G  VT  + +YVQDN+ WGLGF
Sbjct  172  FGMCAGTAVTTMVSSYVQDNVGWGLGF  198



>ref|NP_001044939.2| Os01g0871600 [Oryza sativa Japonica Group]
 dbj|BAD81723.1| putative oligopeptide transporter [Oryza sativa Japonica Group]
 dbj|BAD82710.1| putative oligopeptide transporter [Oryza sativa Japonica Group]
 dbj|BAF06853.2| Os01g0871600 [Oryza sativa Japonica Group]
Length=532

 Score =   203 bits (516),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 153/207 (74%), Gaps = 11/207 (5%)
 Frame = +1

Query  100  DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaa  279
            D V G+VD++GRPA+R+ TG W+S+ F++ +E+AERF+Y G+++NLI+YLTGPLGQ  A 
Sbjct  3    DTVAGAVDYRGRPASRAATGGWKSSVFVMAMEIAERFAYKGVAANLITYLTGPLGQPMAR  62

Query  280  aaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSDS  459
            AAA+++AW GV+ +LPL  A +AD++LGRYR IV++S+++ L++G L++S+  P      
Sbjct  63   AAASIDAWKGVSQMLPLPLACVADAWLGRYRAIVLASVIFVLSMGTLSMSSAFPVSR---  119

Query  460  QNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWY  639
               AG    F V     ALY+VAL +G HKPC QAF ADQFD +D  EC A+SSFFNWWY
Sbjct  120  ---AGHVAVFYV-----ALYMVALGEGAHKPCAQAFAADQFDEKDGGECAARSSFFNWWY  171

Query  640  FGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FGMC G  VT  + +YVQDN+ WGLGF
Sbjct  172  FGMCAGTAVTTMVSSYVQDNVGWGLGF  198



>ref|XP_010414832.1| PREDICTED: protein NRT1/ PTR FAMILY 5.13-like isoform X2 [Camelina 
sativa]
Length=550

 Score =   203 bits (517),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 127/209 (61%), Positives = 161/209 (77%), Gaps = 6/209 (3%)
 Frame = +1

Query  94   HQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQST  273
             + V+D +VD +G  A RS TGR R+A FIIGVEVAERF++YGI SNLISYLTGPLGQST
Sbjct  6    EERVID-AVDHRGFDARRSNTGRRRAAWFIIGVEVAERFAHYGIGSNLISYLTGPLGQST  64

Query  274  aaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESS  453
            A AAANVNAWSG++++LP+LGAF+AD+FLGRYRTI+I+SL+Y LA  FLT S    F   
Sbjct  65   AVAAANVNAWSGISTILPVLGAFVADAFLGRYRTIIIASLIYGLA--FLTSSA---FMIP  119

Query  454  DSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNW  633
            ++     SP  F    FFF+LYLVA+ Q GHKPCVQAFGADQFD ++ QE + +SSFFNW
Sbjct  120  NTTEVTSSPSSFVNALFFFSLYLVAIGQSGHKPCVQAFGADQFDEKNLQEYRDRSSFFNW  179

Query  634  WYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            WYF +C G+ + + ++ Y+Q+ +SW LGF
Sbjct  180  WYFSICAGISLVILVVVYIQEYVSWALGF  208



>dbj|BAB86542.1| OSJNBb0008G24.12 [Oryza sativa Japonica Group]
Length=548

 Score =   203 bits (516),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 153/207 (74%), Gaps = 11/207 (5%)
 Frame = +1

Query  100  DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaa  279
            D V G+VD++GRPA+R+ TG W+S+ F++ +E+AERF+Y G+++NLI+YLTGPLGQ  A 
Sbjct  19   DTVAGAVDYRGRPASRAATGGWKSSVFVMAMEIAERFAYKGVAANLITYLTGPLGQPMAR  78

Query  280  aaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSDS  459
            AAA+++AW GV+ +LPL  A +AD++LGRYR IV++S+++ L++G L++S+  P      
Sbjct  79   AAASIDAWKGVSQMLPLPLACVADAWLGRYRAIVLASVIFVLSMGTLSMSSAFPVSR---  135

Query  460  QNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWY  639
               AG    F V     ALY+VAL +G HKPC QAF ADQFD +D  EC A+SSFFNWWY
Sbjct  136  ---AGHVAVFYV-----ALYMVALGEGAHKPCAQAFAADQFDEKDGGECAARSSFFNWWY  187

Query  640  FGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FGMC G  VT  + +YVQDN+ WGLGF
Sbjct  188  FGMCAGTAVTTMVSSYVQDNVGWGLGF  214



>ref|XP_006306225.1| hypothetical protein CARUB_v10011935mg [Capsella rubella]
 gb|EOA39123.1| hypothetical protein CARUB_v10011935mg [Capsella rubella]
Length=560

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 163/216 (75%), Gaps = 2/216 (1%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E   L +D V  SVD +G PA +S TG WRSA +IIGVEV ERF+Y+GI SNLI+YLTGP
Sbjct  6    EEAALIEDSVSDSVDHRGLPAGKSSTGGWRSAWYIIGVEVGERFAYFGIGSNLITYLTGP  65

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            LGQSTA AA NVN WSG AS+LP+LGAF+AD++LGRYRTIV++SL+Y L LG LT+S VL
Sbjct  66   LGQSTAIAAVNVNTWSGTASMLPVLGAFIADAYLGRYRTIVVASLIYILGLGLLTLSAVL  125

Query  439  PFES-SDSQNGAGSPPQFQV-IffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
                 S+  N   + P F V I FF +LYLVA+ QGGHKPCVQAFGADQFD +D +E  +
Sbjct  126  IMMGLSEQLNDVSAKPSFWVNILFFCSLYLVAIGQGGHKPCVQAFGADQFDVRDRKERIS  185

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            + SFFNWW+  +  G+ +++ ++ YVQDN++W LGF
Sbjct  186  RGSFFNWWFLSLSAGITLSIIVVVYVQDNINWALGF  221



>ref|NP_173672.1| putative peptide/nitrate transporter [Arabidopsis thaliana]
 sp|Q9SK99.1|PTR11_ARATH RecName: Full=Protein NRT1/ PTR FAMILY 5.15; Short=AtNPF5.15 
[Arabidopsis thaliana]
 gb|AAF18521.1|AC006551_7 Similar to LeOPT1 [Lycopersicon esculentum] [Arabidopsis thaliana]
 gb|AEE30256.1| putative peptide/nitrate transporter [Arabidopsis thaliana]
Length=565

 Score =   203 bits (517),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 162/216 (75%), Gaps = 2/216 (1%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E   L +D V  SVD +G PA +S TG WRSA FIIGVEVAERF+Y+GI+ NLI+YLTGP
Sbjct  6    EEVALLEDYVSDSVDHRGFPAGKSSTGGWRSAWFIIGVEVAERFAYFGIACNLITYLTGP  65

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            LGQSTA AA NVN WSG AS+LP+LGAF+AD++LGRYRTIV++SL+Y L LG LT+S  L
Sbjct  66   LGQSTAKAAVNVNTWSGTASILPILGAFVADAYLGRYRTIVVASLIYILGLGLLTLSASL  125

Query  439  PFES-SDSQNGAGSPPQFQV-IffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
                 S  +N A + P   V   FF +LYLVA+ QGGHKPCVQAFGADQFD +DP+E  A
Sbjct  126  IIMGLSKQRNDASAKPSIWVNTLFFCSLYLVAIGQGGHKPCVQAFGADQFDAEDPKEVIA  185

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            + SFFNWW+  +  G+ +++ ++ YVQ+N++W  GF
Sbjct  186  RGSFFNWWFLSLSAGISISIIVVAYVQENVNWAFGF  221



>emb|CDX91683.1| BnaC08g06020D [Brassica napus]
Length=565

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 129/212 (61%), Positives = 161/212 (76%), Gaps = 2/212 (1%)
 Frame = +1

Query  91   LHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQS  270
            L +D V  SVD +G PAA+S TG WRSA FIIGVEVAERF+Y+GI+ NLI+YLTGPLGQS
Sbjct  10   LLEDYVSDSVDHRGSPAAKSSTGGWRSAWFIIGVEVAERFAYFGIACNLINYLTGPLGQS  69

Query  271  TaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPF--  444
            TAAAA NVN WSG AS+LP+LGAF+AD++LGRYRTI+ +SL+Y L LG LT+S  L    
Sbjct  70   TAAAAVNVNTWSGTASMLPILGAFVADAYLGRYRTILAASLIYILGLGLLTLSASLFLTG  129

Query  445  ESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSF  624
            ES    N +  P     I FF +LYLVA+ QGGHKPCVQAFGADQFD+ DP+E  ++ SF
Sbjct  130  ESEQRVNVSAKPSVSVNILFFCSLYLVAIGQGGHKPCVQAFGADQFDSGDPKEVISRGSF  189

Query  625  FNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FNWW+  +  G+ +++ ++ YVQDN+SW  GF
Sbjct  190  FNWWFLSLSAGISLSIIVVAYVQDNVSWAYGF  221



>gb|EMT03148.1| Peptide transporter PTR2 [Aegilops tauschii]
Length=545

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 123/208 (59%), Positives = 152/208 (73%), Gaps = 3/208 (1%)
 Frame = +1

Query  106  VDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaa  285
            V  +VD +GRP +R  +GRW +A F++GVEVAERF++ GISSNLI+YLTGPLGQSTA+AA
Sbjct  8    VVTAVDHRGRPVSRHSSGRWPAALFVVGVEVAERFAFAGISSNLITYLTGPLGQSTASAA  67

Query  286  anvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESS---D  456
            A VN W+GVA LLPLLGA +ADS+LGRYRTIV +S LY L L  LT+S+  P   +   D
Sbjct  68   AAVNVWAGVAMLLPLLGAAVADSWLGRYRTIVYASGLYILGLAMLTVSSAPPAACAGTPD  127

Query  457  SQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWW  636
            S   + SP   QV FF+ +LYLVA A GG KPCVQAF ADQFD  DP+E  ++ SFFNWW
Sbjct  128  SAECSASPSTVQVAFFYVSLYLVAFAYGGQKPCVQAFSADQFDESDPEELASRGSFFNWW  187

Query  637  YFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             F    G  +T+  LNYVQ+++SW  GF
Sbjct  188  CFATSGGNTITISALNYVQESVSWQFGF  215



>ref|XP_010498727.1| PREDICTED: protein NRT1/ PTR FAMILY 5.16 [Camelina sativa]
Length=564

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 128/216 (59%), Positives = 164/216 (76%), Gaps = 2/216 (1%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E   L +D V  SVD +G PA +S TG WR A +IIGVEV ERF+Y+GISSNLI+YLTGP
Sbjct  6    EKVSLLEDFVSDSVDHRGLPAGKSTTGGWRFAWYIIGVEVGERFAYFGISSNLITYLTGP  65

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            LGQSTA AA NVN WSG AS+LP+LGAF+AD++LGRYRTIV++SL+Y L LG LT+S VL
Sbjct  66   LGQSTATAAVNVNTWSGTASMLPVLGAFIADAYLGRYRTIVVASLIYILGLGLLTLSAVL  125

Query  439  PFES-SDSQNGAGSPPQFQV-IffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
                 S+ ++   + P F V I FF +LYLVA+ QGGHKPCVQAFGADQFD +D +E  +
Sbjct  126  ILMGLSEKRSDVSTKPSFWVNILFFCSLYLVAMGQGGHKPCVQAFGADQFDVEDRKERIS  185

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            + SFFNWW+  +  G+ +++ ++ YVQDN++W LGF
Sbjct  186  RGSFFNWWFLSLSAGITLSIIVVVYVQDNVNWALGF  221



>ref|XP_002893237.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH69496.1| proton-dependent oligopeptide transport family protein [Arabidopsis 
lyrata subsp. lyrata]
Length=561

 Score =   202 bits (514),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 129/216 (60%), Positives = 167/216 (77%), Gaps = 2/216 (1%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E   L +D V  SVD +G PA +S TG WRSA +IIGVEV ERF+Y+GI SNLI+YLTGP
Sbjct  6    EEAALIEDSVSDSVDHRGLPAGKSSTGGWRSAWYIIGVEVGERFAYFGIGSNLITYLTGP  65

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTV-  435
            LGQSTA AA NVN WSG AS+LP+LGAF+AD++LGRYRTIVI+SL+Y L LG LT+S++ 
Sbjct  66   LGQSTATAAVNVNTWSGTASMLPVLGAFIADAYLGRYRTIVIASLIYILGLGLLTLSSIF  125

Query  436  LPFESSDSQNGAGSPPQFQV-IffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
            +    S+ +N A + P F V + FF +LYLVA+ QGGHKPCVQAFGADQFD +DP+E  +
Sbjct  126  ILMRLSEQRNDASARPLFWVNLLFFCSLYLVAIGQGGHKPCVQAFGADQFDVEDPKERIS  185

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            + SFFNWW+  +  G+ +++ ++ YVQDN++W LGF
Sbjct  186  RGSFFNWWFLSLSAGITLSIIVVVYVQDNVNWALGF  221



>emb|CDX68281.1| BnaA07g23210D [Brassica napus]
Length=551

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 149/210 (71%), Gaps = 0/210 (0%)
 Frame = +1

Query  91   LHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQS  270
            L   +VD SVDF+G+P+ R  +G WRS+ +IIG EVAE+F+Y GI+SNLI+Y TGPL  S
Sbjct  14   LLNGIVDSSVDFRGKPSVRFTSGGWRSSGYIIGAEVAEKFAYLGIASNLITYFTGPLEMS  73

Query  271  TaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFES  450
            TA+AA+NVN W G A+ LPL+   +ADSFLGRYRTI+++S LY L LG LT S  +P   
Sbjct  74   TASAASNVNLWLGTAAFLPLIWGSIADSFLGRYRTILLTSSLYILGLGLLTFSATIPSLR  133

Query  451  SDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFN  630
             D +         +V  FF ALYL+A+ +GG K C++AFGADQFD QDP+E KAKS +FN
Sbjct  134  KDQETLVSCVSNLKVTIFFSALYLIAIGEGGFKVCIRAFGADQFDEQDPKESKAKSVYFN  193

Query  631  WWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            W YF    G++ T  I NYVQ+NLSW LGF
Sbjct  194  WSYFARSAGILTTRLISNYVQENLSWALGF  223



>ref|XP_002893239.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69498.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=569

 Score =   202 bits (514),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 125/216 (58%), Positives = 159/216 (74%), Gaps = 2/216 (1%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E   L +D V  SVD +G PA +S TG WRSA FIIGVEVAERF+Y+GI+ NLI+YLTGP
Sbjct  6    EEVTLLEDYVSDSVDHRGLPAGKSSTGGWRSAWFIIGVEVAERFAYFGIACNLITYLTGP  65

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            LGQSTA AA NVN WSG AS+LP+LGAF+AD++LGRYRTI+++SL+Y L LG LT+S  L
Sbjct  66   LGQSTATAAVNVNTWSGTASMLPILGAFVADAYLGRYRTIIVASLIYILGLGLLTLSASL  125

Query  439  PFE--SSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKA  612
                 S    NG+  P  +    FF +LYLVA+ QGGHKPCVQ FGADQFD  DP+E  A
Sbjct  126  IIMRLSEQRNNGSAKPSIWVNTLFFCSLYLVAIGQGGHKPCVQVFGADQFDAYDPKEVIA  185

Query  613  KSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            + SFFNWW+  +  G+ +++ ++ YVQ+N++W  GF
Sbjct  186  RGSFFNWWFLSLSAGISLSIIVVAYVQENVNWAFGF  221



>ref|XP_009104873.1| PREDICTED: protein NRT1/ PTR FAMILY 5.12-like [Brassica rapa]
Length=552

 Score =   201 bits (512),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 117/210 (56%), Positives = 149/210 (71%), Gaps = 0/210 (0%)
 Frame = +1

Query  91   LHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQS  270
            L   +VD SVDF+G+P+ R  +G WRS+ +IIG EVAE+F+Y GI+SNLI+Y TGPL  S
Sbjct  14   LLNGIVDSSVDFRGKPSVRFTSGGWRSSGYIIGAEVAEKFAYLGIASNLITYFTGPLEMS  73

Query  271  TaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFES  450
            TA+AA+NVN W G A+ LPL+   +ADSFLGRYRTI+++S LY L LG LT S  +P   
Sbjct  74   TASAASNVNLWLGTAAFLPLIWGSIADSFLGRYRTILLTSSLYILGLGLLTFSATIPSLR  133

Query  451  SDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFN  630
             D +         +V  FF ALYL+A+ +GG K C++AFGADQFD QDP+E KAKS +FN
Sbjct  134  KDQETLVSCVSNLKVTIFFSALYLIAIGEGGFKVCIRAFGADQFDEQDPKESKAKSVYFN  193

Query  631  WWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            W YF    G++ T  I NYVQ+NLSW LGF
Sbjct  194  WSYFARSAGILTTRLISNYVQENLSWALGF  223



>gb|KFK41628.1| hypothetical protein AALP_AA2G152500 [Arabis alpina]
Length=563

 Score =   201 bits (512),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 125/214 (58%), Positives = 158/214 (74%), Gaps = 1/214 (0%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E P L   V+D +VD  G  A RS TGRW++A FIIGVEVAERF+YYGI++NLISYLTGP
Sbjct  6    EIPLLEDYVID-AVDHAGLAAGRSSTGRWKAAWFIIGVEVAERFAYYGIAANLISYLTGP  64

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            LGQS A AAANVNAWSG++SLLP+LGAF+AD+FLGRYRTI+I+SL+  L L  LT+S  L
Sbjct  65   LGQSIAVAAANVNAWSGISSLLPVLGAFVADAFLGRYRTIIIASLIDLLGLVLLTLSAFL  124

Query  439  PFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKS  618
               +S+      S      + FF +++ VA+ QGGHKPCVQAFGADQFD +DP+E   +S
Sbjct  125  VPVTSEKTEVTSSSSFLPNVLFFLSMFFVAIGQGGHKPCVQAFGADQFDEKDPKEKSERS  184

Query  619  SFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            SFFNWWY  M  G+ + + ++ Y+Q+  SW LGF
Sbjct  185  SFFNWWYLTMAAGISLAIVVVVYIQEAFSWALGF  218



>ref|XP_006416184.1| hypothetical protein EUTSA_v10007239mg [Eutrema salsugineum]
 gb|ESQ34537.1| hypothetical protein EUTSA_v10007239mg [Eutrema salsugineum]
Length=565

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 127/219 (58%), Positives = 165/219 (75%), Gaps = 2/219 (1%)
 Frame = +1

Query  70   SDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYL  249
             D E   L ++ V  SVD +G PA +S TG WRSA FIIGVEV ERF+Y+GI+ NLI+YL
Sbjct  3    KDEEGFSLVENYVCDSVDHRGSPAGKSSTGGWRSAWFIIGVEVGERFAYFGIACNLITYL  62

Query  250  TGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIS  429
            TGPLGQSTA AA NVN WSG AS+LP+LGAF+AD++LGRYRTI+ +SL+Y L LG LT+S
Sbjct  63   TGPLGQSTATAAVNVNTWSGTASILPILGAFVADAYLGRYRTILAASLIYILGLGLLTLS  122

Query  430  TVLPFES-SDSQNGAGSPPQFQV-IffffalylvalaQGGHKPCVQAFGADQFDTQDPQE  603
              L     S+ +N A + P F V I FF +LYLVA+ QGGHKPCVQAFGADQFD++DP+E
Sbjct  123  ASLILTGLSEQRNDASAKPSFWVNILFFCSLYLVAIGQGGHKPCVQAFGADQFDSEDPKE  182

Query  604  CKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
              ++ SFFNWW+  +  G+ +++ ++ YVQ+N++W  GF
Sbjct  183  VISRGSFFNWWFLSLSAGISLSIIVVAYVQENVNWAFGF  221



>ref|XP_010665402.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Vitis vinifera]
Length=574

 Score =   201 bits (512),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 135/231 (58%), Positives = 170/231 (74%), Gaps = 8/231 (3%)
 Frame = +1

Query  43   MAATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYG  222
            MAA G  ++   E+P L +D V G+VD  G PA RS +G W S+ FIIG EVAER +Y+G
Sbjct  1    MAANG--MVDGPESPLL-EDTVAGAVDHTGLPAKRSTSGGWSSSYFIIGTEVAERSAYFG  57

Query  223  ISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYT  402
            I +NL++YLTGPL QSTA AA NVN W G+ +LLPL+GAF+ADS++GRYRTIVI+SLLY 
Sbjct  58   IEANLVNYLTGPLRQSTAMAAKNVNTWFGITTLLPLVGAFVADSYMGRYRTIVIASLLYI  117

Query  403  LALGFLTISTVLPFES-SDSQNG----AGSPPQFQVIffffalylvalaQGGHKPCVQAF  567
            L LG LT+S VL   + S+ QN     +  PPQ QVIF F +LYLVA+A+GGHKPC QAF
Sbjct  118  LGLGLLTMSAVLSSHNPSECQNTRKIMSCPPPQCQVIFLFLSLYLVAVAEGGHKPCTQAF  177

Query  568  GADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            GADQFD +D +E KAKSS+FNW  F +   + V++  L+Y+QD LSW LGF
Sbjct  178  GADQFDGRDSEEGKAKSSYFNWLNFCVGISLSVSMLTLSYIQDKLSWVLGF  228



>gb|EEE55748.1| hypothetical protein OsJ_04251 [Oryza sativa Japonica Group]
Length=1010

 Score =   204 bits (518),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 162/207 (78%), Gaps = 5/207 (2%)
 Frame = +1

Query  115  SVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanv  294
            +VD  GRPA+R  +GRW +A FIIGVE++ERF++ GIS NLI+YLTGPLGQSTA+AAA +
Sbjct  15   AVDHLGRPASRRTSGRWLAALFIIGVEISERFAFGGISGNLITYLTGPLGQSTASAAAAI  74

Query  295  nawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL-PFESSDS----  459
            NAW+G A LLPLLGA +ADS+LGRYR I+ +SLLY L LG LT+S VL P + ++S    
Sbjct  75   NAWNGAALLLPLLGAAVADSWLGRYRIIICASLLYILGLGMLTLSPVLVPHQQAESGDNA  134

Query  460  QNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWY  639
             N A S     V FF+ +LY+VA AQGGHKPCVQAFGADQFD  DP+EC ++SSFFNWWY
Sbjct  135  DNNASSSMDIHVAFFYLSLYIVAFAQGGHKPCVQAFGADQFDENDPEECASRSSFFNWWY  194

Query  640  FGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FG+  G ++T+ ILNY+QDN+ W LGF
Sbjct  195  FGIYGGNVITVSILNYIQDNIGWQLGF  221


 Score =   174 bits (440),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 113/180 (63%), Positives = 134/180 (74%), Gaps = 6/180 (3%)
 Frame = +1

Query  184  IGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLG  363
            IG EV ERF+Y GI  NL+ YLTGPL Q TAAAAA VN W G + LLPLLG+ +ADS+LG
Sbjct  342  IGAEVGERFAYSGIMGNLVIYLTGPLRQPTAAAAAAVNVWMGTSMLLPLLGSAVADSWLG  401

Query  364  RYRTIVISSLLYTLALGFLTISTVL-PFESSDSQNGAGSPPQFQVIffffalylvalaQG  540
            RYRTIV +SLLY L LG +T+S+VL P ESS+S N A       V FF+F+LY+VA AQG
Sbjct  402  RYRTIVCASLLYILGLGMITVSSVLAPEESSESSNLAA-----HVAFFYFSLYVVAFAQG  456

Query  541  GHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            GHKPC QA GADQFD  DP E  ++SSFFNWW+F    G  VT+ ILNYVQ+++SW LGF
Sbjct  457  GHKPCAQALGADQFDENDPGELASRSSFFNWWFFASYGGNTVTVPILNYVQESVSWQLGF  516



>ref|XP_003564730.2| PREDICTED: uncharacterized protein LOC100833779 [Brachypodium 
distachyon]
Length=1117

 Score =   204 bits (520),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 132/228 (58%), Positives = 160/228 (70%), Gaps = 10/228 (4%)
 Frame = +1

Query  46   AATGTTILSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGI  225
            A T   +L   E P         +VD  GRPA+   +G W +A FIIGVEVAERF++ GI
Sbjct  608  AETAEALLPRPEPPM-------SAVDHLGRPASHGGSGGWPAAFFIIGVEVAERFAFCGI  660

Query  226  SSNLISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTL  405
              NL+ YLTGPLGQSTA+AAA+VNAW G A LLPLLG+ +ADS+LGRYRT++ +SLLY L
Sbjct  661  MGNLMIYLTGPLGQSTASAAASVNAWLGAAMLLPLLGSAVADSWLGRYRTVICASLLYIL  720

Query  406  ALGFLTISTVL-PFESSDSQNGAG--SPPQFQVIffffalylvalaQGGHKPCVQAFGAD  576
             LG LT+STVL P   +   + AG  +    QV   F +LY+VA+AQGGHKPCVQAFGAD
Sbjct  721  GLGMLTLSTVLAPGGCAGELDSAGCSTSRSAQVALLFVSLYVVAIAQGGHKPCVQAFGAD  780

Query  577  QFDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            QFD  DP E  ++SSFFNWWYF    G  VTL ILNYVQ+++SW LGF
Sbjct  781  QFDENDPGELASRSSFFNWWYFAAYGGNTVTLPILNYVQESVSWQLGF  828


 Score =   201 bits (511),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 135/223 (61%), Positives = 165/223 (74%), Gaps = 7/223 (3%)
 Frame = +1

Query  67   LSDAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISY  246
            +  A  P L Q     +VD  GRP +R  +GRW +A FIIGVE++ERF+Y GIS NLI+Y
Sbjct  1    MDAAAEPLLPQSAT--AVDHLGRPVSRRASGRWPAALFIIGVEISERFAYSGISGNLITY  58

Query  247  LTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTI  426
            LTG LGQSTA+AAA +NAWSG A LLPLLGA +ADS+LGRYRTIV +SLLY L LG LT+
Sbjct  59   LTGQLGQSTASAAAAINAWSGAALLLPLLGAAIADSWLGRYRTIVCTSLLYILGLGMLTV  118

Query  427  STVL----PFESSDSQNGA-GSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQ  591
            S+VL    P +  D ++ A  S     + FF+ +LYLVA AQGGHKPC+QAFGADQFD  
Sbjct  119  SSVLTPQQPAQFGDHKDSALSSTSAIHLAFFYLSLYLVAFAQGGHKPCLQAFGADQFDEN  178

Query  592  DPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            DP+EC ++SSFFNWWYFG   G +VT+ ILNY+QDN+SW  GF
Sbjct  179  DPEECASRSSFFNWWYFGTYGGSIVTVSILNYIQDNISWQFGF  221



>ref|XP_011656123.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Cucumis sativus]
Length=600

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 126/221 (57%), Positives = 156/221 (71%), Gaps = 8/221 (4%)
 Frame = +1

Query  73   DAETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLT  252
            D++ P++   ++        R   RS++G WR+A  IIGVE+AERF+++GIS+NL+SYLT
Sbjct  34   DSQFPYMDDSLILNDAAPDNR---RSQSGGWRAAGVIIGVEIAERFAFFGISTNLVSYLT  90

Query  253  GPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTIST  432
              +GQS A AA NVN W G ASLLPLL A  ADSFLGRY TI+++S LY L LG LT+S 
Sbjct  91   VEMGQSMADAAQNVNLWVGTASLLPLLAASFADSFLGRYLTIILASALYILGLGLLTLSA  150

Query  433  VLPFESS-----DSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDP  597
            +L   SS      + +GA S P   V+FFF +LYLVA AQGGHKPC+QAFG DQFD +DP
Sbjct  151  ILASPSSFQGSGSAASGASSRPVLHVLFFFTSLYLVAFAQGGHKPCLQAFGCDQFDGEDP  210

Query  598  QECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            QEC AK SFFNWWYF    G  + L IL+Y+QDNL WGLGF
Sbjct  211  QECIAKCSFFNWWYFSTTLGSFIALIILSYIQDNLGWGLGF  251



>ref|XP_010543249.1| PREDICTED: LOW QUALITY PROTEIN: protein NRT1/ PTR FAMILY 5.16-like 
[Tarenaya hassleriana]
Length=563

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 132/227 (58%), Positives = 165/227 (73%), Gaps = 13/227 (6%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E   L +D V  SVD +G PA +S TG +RSA FIIGVEVAERF+Y+GISSNLI+YLTGP
Sbjct  5    EEVALLEDYVSSSVDHRGLPAGKSSTGGYRSAWFIIGVEVAERFAYFGISSNLINYLTGP  64

Query  259  LGQSTa---------aaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLAL  411
            LG+STA         AAAAN+N WSG ASLLP+LGAF+AD++LGRY TIVISSL+Y L L
Sbjct  65   LGESTAGRRPLHLGWAAAANINVWSGTASLLPILGAFVADAYLGRYLTIVISSLIYVLGL  124

Query  412  GFLTISTVLPFESSDSQN----GAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQ  579
            G LT+S VL      + +     A SP     I FF +LYL+A+AQGGHKPCVQAFGADQ
Sbjct  125  GLLTLSAVLILNDMSAADKTSPAAESPFSLVNILFFSSLYLIAIAQGGHKPCVQAFGADQ  184

Query  580  FDTQDPQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FD  DP+E  A++SFFNWW+  +  G+ +++ ++ YVQD ++W LGF
Sbjct  185  FDADDPREKMARASFFNWWFLSLSAGITLSIVVVVYVQDYVNWALGF  231



>emb|CDM85180.1| unnamed protein product [Triticum aestivum]
Length=533

 Score =   199 bits (505),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/207 (54%), Positives = 153/207 (74%), Gaps = 10/207 (5%)
 Frame = +1

Query  100  DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaa  279
            D V G+VD++GRPA+R+ TG W+S+ F++ +E+AERF+Y G+++NLI+YLTGPLGQ  A 
Sbjct  3    DAVAGAVDYRGRPASRAATGGWKSSVFVMAMEIAERFAYKGVAANLITYLTGPLGQPMAR  62

Query  280  aaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSDS  459
            AAA+++AW GV+ +LPL  A +AD++LGRYR IV++S+L+ +++G L++S+      S  
Sbjct  63   AAASIDAWKGVSQMLPLPVACVADAWLGRYRAIVLASILFVVSMGTLSLSSAFHIFRSGG  122

Query  460  QNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWY  639
                       V  F+ ALYLVAL +G HKPC QAF ADQFD +DP+E  A+SSFFNWWY
Sbjct  123  H----------VAVFYVALYLVALGEGAHKPCAQAFAADQFDEKDPKENVARSSFFNWWY  172

Query  640  FGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FGMC G  VT  + +YVQDN+ WGLGF
Sbjct  173  FGMCAGTAVTTMVSSYVQDNVGWGLGF  199



>emb|CBI39332.3| unnamed protein product [Vitis vinifera]
Length=604

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 164/219 (75%), Gaps = 6/219 (3%)
 Frame = +1

Query  79   ETPFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGP  258
            E+P L +D V G+VD  G PA RS +G W S+ FIIG EVAER +Y+GI +NL++YLTGP
Sbjct  6    ESPLL-EDTVAGAVDHTGLPAKRSTSGGWSSSYFIIGTEVAERSAYFGIEANLVNYLTGP  64

Query  259  LGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVL  438
            L QSTA AA NVN W G+ +LLPL+GAF+ADS++GRYRTIVI+SLLY L LG LT+S VL
Sbjct  65   LRQSTAMAAKNVNTWFGITTLLPLVGAFVADSYMGRYRTIVIASLLYILGLGLLTMSAVL  124

Query  439  PFES-SDSQNG----AGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQE  603
               + S+ QN     +  PPQ QVIF F +LYLVA+A+GGHKPC QAFGADQFD +D +E
Sbjct  125  SSHNPSECQNTRKIMSCPPPQCQVIFLFLSLYLVAVAEGGHKPCTQAFGADQFDGRDSEE  184

Query  604  CKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
             KAKSS+FNW  F +   + V++  L+Y+QD LSW LGF
Sbjct  185  GKAKSSYFNWLNFCVGISLSVSMLTLSYIQDKLSWVLGF  223


 Score =   107 bits (267),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  115  SVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanv  294
            +VD +G PA RS +G WRS  FIIG EVA+R +Y+GI +NL++YLT PLGQSTA AA NV
Sbjct  500  AVDHRGLPAKRSTSGGWRSTYFIIGTEVAKRSAYFGIEANLVNYLTRPLGQSTAMAAKNV  559

Query  295  nawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLT  423
            N W G+A+LLPL+GAF+ADS++GR RT VI SLLY L    L+
Sbjct  560  NTWFGIATLLPLVGAFVADSYIGRSRTTVILSLLYILVCDLLS  602



>gb|EMT00830.1| Peptide transporter PTR2 [Aegilops tauschii]
Length=529

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 112/207 (54%), Positives = 153/207 (74%), Gaps = 10/207 (5%)
 Frame = +1

Query  100  DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaa  279
            D V G+VD++GRPA+R+ TG W+S+ F++ +E+AERF+Y G+++NLI+YLTGPLGQ  A 
Sbjct  3    DAVAGAVDYRGRPASRAATGGWKSSVFVMAMEIAERFAYKGVAANLITYLTGPLGQPMAR  62

Query  280  aaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFESSDS  459
            AAA+++AW GV+ +LPL  A +AD++LGRYR IV++S+L+ +++G L++S+      S  
Sbjct  63   AAASIDAWKGVSQMLPLPVACVADAWLGRYRAIVLASILFVVSMGTLSLSSAFHIFRS--  120

Query  460  QNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWY  639
                G    F V     ALYLVAL +G HKPC QAF ADQFD +DP+E  A+SSFFNWWY
Sbjct  121  ---GGHVAVFYV-----ALYLVALGEGAHKPCAQAFAADQFDEKDPKENVARSSFFNWWY  172

Query  640  FGMCFGVMVTLWILNYVQDNLSWGLGF  720
            FGMC G  VT  + +YVQDN+ WGLGF
Sbjct  173  FGMCAGTAVTTMVSSYVQDNVGWGLGF  199



>ref|XP_003568390.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Brachypodium distachyon]
Length=529

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 124/199 (62%), Positives = 152/199 (76%), Gaps = 7/199 (4%)
 Frame = +1

Query  145  RSRTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaanvnawsgvasLL  324
            R  +G W+SA FII VEVAERF+YYGIS NLISYLTGPLG+STAAAAA VNAWSG +S+L
Sbjct  17   RPVSGGWKSAMFIIWVEVAERFAYYGISGNLISYLTGPLGESTAAAAAGVNAWSGASSML  76

Query  325  PLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFE-------SSDSQNGAGSPP  483
            PLLGA +ADS+LGRYRTIV SS+LY + LG L +S++           S+  Q    S  
Sbjct  77   PLLGAAVADSWLGRYRTIVASSVLYIVGLGMLALSSMFSAPQTQQCTLSAGGQRACSSSS  136

Query  484  QFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFFNWWYFGMCFGVM  663
              Q  FF+ +LYLVA+AQ GHKPCVQAFGADQFDT DP+E  ++SSFFNWWYFG+C    
Sbjct  137  SLQTAFFYVSLYLVAVAQSGHKPCVQAFGADQFDTMDPRESSSRSSFFNWWYFGICASAT  196

Query  664  VTLWILNYVQDNLSWGLGF  720
            VT+ +++Y+QDN+SWG+GF
Sbjct  197  VTIALMSYIQDNVSWGVGF  215



>ref|XP_010930854.1| PREDICTED: protein NRT1/ PTR FAMILY 5.10-like [Elaeis guineensis]
Length=458

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 138/211 (65%), Positives = 157/211 (74%), Gaps = 8/211 (4%)
 Frame = +1

Query  112  GSVDFKGRPAARS-RTGRWRSASFIIGVEVAERFSYYGISSNLISYLTGPLGQSTaaaaa  288
            G VD+KGRP +RS  TG W SA FIIGVE AERFSY GISSNLISYLTGPL QSTAA AA
Sbjct  3    GMVDYKGRPISRSATTGGWTSALFIIGVETAERFSYSGISSNLISYLTGPLRQSTAAGAA  62

Query  289  nvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGFLTISTVLPFE-SSDSQN  465
            N NAWSG A++LP+LGA +ADS+LGRYRTI++SSLLY L L  LT+S  L    SSD   
Sbjct  63   NANAWSGTANMLPILGAVVADSWLGRYRTILLSSLLYVLGLALLTLSAALLSLGSSDCDL  122

Query  466  GAGS------PPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDPQECKAKSSFF  627
              G       P  F VI FFF+LYLVAL QGGHKPCVQAFGADQFD +DP E KA+SSFF
Sbjct  123  SKGEISSCPPPSPFHVIIFFFSLYLVALGQGGHKPCVQAFGADQFDDRDPSESKARSSFF  182

Query  628  NWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            NWWY G+C G +    +LNY+QD +SW + F
Sbjct  183  NWWYVGICLGCVAAYMVLNYIQDYVSWTVAF  213



>ref|XP_010415947.1| PREDICTED: protein NRT1/ PTR FAMILY 5.12-like [Camelina sativa]
Length=555

 Score =   199 bits (505),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 115/222 (52%), Positives = 156/222 (70%), Gaps = 1/222 (0%)
 Frame = +1

Query  58   TTILSDAET-PFLHQDVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSN  234
            +T  +D ET   +  D+V+ SVDF+G P+ RS +G WRS+ F IG E+AE+F+Y+G++SN
Sbjct  2    STFTADNETGTIVSNDIVECSVDFQGNPSVRSASGGWRSSGFFIGAEMAEKFAYFGVASN  61

Query  235  LISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALG  414
            L++Y TGPL +STA AA+NVN W G A+ LPL+   +ADSFLGR+RTI+++S  Y + LG
Sbjct  62   LMTYFTGPLQESTAVAASNVNLWLGTAAFLPLIWGSIADSFLGRFRTILVTSSFYIMGLG  121

Query  415  FLTISTVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQD  594
             LT S  +P    D +       Q +V  FF ALYL+AL +GG K C++ FGADQFD QD
Sbjct  122  LLTYSATIPDICGDQEAHVSCVSQVKVGVFFCALYLIALGEGGFKVCLRTFGADQFDEQD  181

Query  595  PQECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            P E KAKSS+FNW YF +  G+  T  ++NYVQ+NLSW LG+
Sbjct  182  PVESKAKSSYFNWLYFAISTGIFTTRLVINYVQENLSWALGY  223



>gb|AGT17393.1| hypothetical protein SHCRBa_189_K21_R_20 [Saccharum hybrid cultivar 
R570]
Length=541

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 159/221 (72%), Gaps = 15/221 (7%)
 Frame = +1

Query  70   SDAETPFLHQ----DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNL  237
            S+  +  L+Q    D V G+ D++G+PA+R+ TG W+ + F++ +E+AERF+Y G+++NL
Sbjct  5    SEVHSLLLYQPAMVDTVAGATDYRGQPASRTATGGWKPSVFVMAMEIAERFAYKGVAANL  64

Query  238  ISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGF  417
            I+YLTGPLGQ    AAA+++AW GV+ +LPL  A +AD++LGRYR IV++SL++ +++G 
Sbjct  65   ITYLTGPLGQPMVRAAASIDAWKGVSQMLPLPLACVADAWLGRYRAIVLASLIFVVSMGA  124

Query  418  LTISTVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDP  597
            L++S+ LP     +  G        V  F+ ALYLVAL +G HKPC QAF ADQFD +DP
Sbjct  125  LSLSSALP-----ALRGG------HVAIFYVALYLVALGEGAHKPCAQAFAADQFDEKDP  173

Query  598  QECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +E  A+SSFFNWWYFGMC G  VT  + +YVQDN+ WGLGF
Sbjct  174  EESVARSSFFNWWYFGMCAGTAVTTMVSSYVQDNVGWGLGF  214



>gb|AGT17133.1| peptide/nitrate transporter [Saccharum hybrid cultivar R570]
Length=534

 Score =   198 bits (503),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 112/221 (51%), Positives = 159/221 (72%), Gaps = 15/221 (7%)
 Frame = +1

Query  70   SDAETPFLHQ----DVVDGSVDFKGRPAARSRTGRWRSASFIIGVEVAERFSYYGISSNL  237
            S+  +  L+Q    D V G+ D++G+PA+R+ TG W+ + F++ +E+AERF+Y G+++NL
Sbjct  5    SEVHSLLLYQPAMVDTVAGATDYRGQPASRTATGGWKPSVFVMAMEIAERFAYKGVAANL  64

Query  238  ISYLTGPLGQSTaaaaanvnawsgvasLLPLLGAFLADSFLGRYRTIVISSLLYTLALGF  417
            I+YLTGPLGQ    AAA+++AW GV+ +LPL  A +AD++LGRYR IV++SL++ +++G 
Sbjct  65   ITYLTGPLGQPMVRAAASIDAWKGVSQMLPLPLACVADAWLGRYRAIVLASLIFVVSMGA  124

Query  418  LTISTVLPFESSDSQNGAGSPPQFQVIffffalylvalaQGGHKPCVQAFGADQFDTQDP  597
            L++S+ LP     +  G        V  F+ ALYLVAL +G HKPC QAF ADQFD +DP
Sbjct  125  LSLSSALP-----ALRGG------HVAIFYVALYLVALGEGAHKPCAQAFAADQFDEKDP  173

Query  598  QECKAKSSFFNWWYFGMCFGVMVTLWILNYVQDNLSWGLGF  720
            +E  A+SSFFNWWYFGMC G  VT  + +YVQDN+ WGLGF
Sbjct  174  EESVARSSFFNWWYFGMCAGTAVTTMVSSYVQDNVGWGLGF  214



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1323106870870