BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2432

Length=748
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009593960.1|  PREDICTED: ATP-dependent zinc metalloproteas...    171   1e-44   Nicotiana tomentosiformis
ref|XP_009774520.1|  PREDICTED: ATP-dependent zinc metalloproteas...    171   1e-44   Nicotiana sylvestris
ref|XP_006347120.1|  PREDICTED: ATP-dependent zinc metalloproteas...    166   7e-43   Solanum tuberosum [potatoes]
ref|XP_004232810.1|  PREDICTED: ATP-dependent zinc metalloproteas...    165   2e-42   Solanum lycopersicum
ref|XP_011095724.1|  PREDICTED: ATP-dependent zinc metalloproteas...    160   9e-41   Sesamum indicum [beniseed]
ref|XP_007213697.1|  hypothetical protein PRUPE_ppa000789mg             155   5e-39   Prunus persica
ref|XP_008226136.1|  PREDICTED: ATP-dependent zinc metalloproteas...    154   2e-38   Prunus mume [ume]
ref|XP_008372001.1|  PREDICTED: ATP-dependent zinc metalloproteas...    153   4e-38   
ref|XP_011013846.1|  PREDICTED: ATP-dependent zinc metalloproteas...    152   4e-38   Populus euphratica
ref|XP_012087358.1|  PREDICTED: ATP-dependent zinc metalloproteas...    151   1e-37   Jatropha curcas
ref|XP_006422287.1|  hypothetical protein CICLE_v10004242mg             150   4e-37   Citrus clementina [clementine]
gb|KDP25069.1|  hypothetical protein JCGZ_22604                         149   8e-37   Jatropha curcas
ref|XP_010417622.1|  PREDICTED: ATP-dependent zinc metalloproteas...    149   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010472815.1|  PREDICTED: ATP-dependent zinc metalloproteas...    148   2e-36   Camelina sativa [gold-of-pleasure]
emb|CDX67988.1|  BnaA07g20280D                                          147   2e-36   
gb|EYU27570.1|  hypothetical protein MIMGU_mgv1a000728mg                146   6e-36   Erythranthe guttata [common monkey flower]
emb|CDX79327.1|  BnaC06g19760D                                          144   5e-35   
ref|XP_010537801.1|  PREDICTED: ATP-dependent zinc metalloproteas...    144   5e-35   Tarenaya hassleriana [spider flower]
ref|XP_009104519.1|  PREDICTED: ATP-dependent zinc metalloproteas...    144   5e-35   Brassica rapa
ref|XP_002263178.1|  PREDICTED: ATP-dependent zinc metalloproteas...    143   7e-35   Vitis vinifera
emb|CBI24177.3|  unnamed protein product                                143   8e-35   Vitis vinifera
ref|XP_010429850.1|  PREDICTED: ATP-dependent zinc metalloproteas...    143   8e-35   Camelina sativa [gold-of-pleasure]
ref|XP_007022615.1|  FTSH protease 12 isoform 1                         139   1e-33   
ref|XP_006389876.1|  hypothetical protein EUTSA_v100180710mg            139   2e-33   
gb|KDO36852.1|  hypothetical protein CISIN_1g0356082mg                  128   1e-32   Citrus sinensis [apfelsine]
gb|KFK42356.1|  hypothetical protein AALP_AA2G245500                    136   2e-32   Arabis alpina [alpine rockcress]
gb|AAD30220.1|AC007202_2  Is a member of PF|00004 ATPases associa...    135   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008456301.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    135   4e-32   
ref|NP_565212.1|  cell division protease ftsH-12                        135   4e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010260593.1|  PREDICTED: ATP-dependent zinc metalloproteas...    134   9e-32   Nelumbo nucifera [Indian lotus]
ref|XP_004306570.1|  PREDICTED: ATP-dependent zinc metalloproteas...    133   3e-31   Fragaria vesca subsp. vesca
ref|XP_002887790.1|  EMB1047/FTSH12                                     132   8e-31   
ref|XP_002513356.1|  Cell division protein ftsH, putative               131   8e-31   Ricinus communis
ref|XP_010064082.1|  PREDICTED: ATP-dependent zinc metalloproteas...    131   1e-30   Eucalyptus grandis [rose gum]
ref|XP_006303096.1|  hypothetical protein CARUB_v100197241mg            130   2e-30   
ref|XP_004139903.1|  PREDICTED: ATP-dependent zinc metalloproteas...    130   4e-30   Cucumis sativus [cucumbers]
gb|KJB81419.1|  hypothetical protein B456_013G144900                    128   9e-30   Gossypium raimondii
gb|KJB81418.1|  hypothetical protein B456_013G144900                    128   1e-29   Gossypium raimondii
ref|XP_010936492.1|  PREDICTED: ATP-dependent zinc metalloproteas...    126   6e-29   Elaeis guineensis
ref|XP_010936478.1|  PREDICTED: ATP-dependent zinc metalloproteas...    126   7e-29   Elaeis guineensis
ref|XP_008805979.1|  PREDICTED: ATP-dependent zinc metalloproteas...    124   3e-28   Phoenix dactylifera
ref|XP_004516247.1|  PREDICTED: ATP-dependent zinc metalloproteas...    118   4e-26   Cicer arietinum [garbanzo]
ref|XP_004516246.1|  PREDICTED: ATP-dependent zinc metalloproteas...    118   4e-26   Cicer arietinum [garbanzo]
gb|ABF70169.1|  hypothetical protein MA4_112I10.64                      110   1e-24   Musa acuminata [banana]
gb|ERN19706.1|  hypothetical protein AMTR_s00062p00195710               108   6e-23   Amborella trichopoda
ref|XP_011628477.1|  PREDICTED: ATP-dependent zinc metalloproteas...    108   7e-23   Amborella trichopoda
ref|XP_009397211.1|  PREDICTED: ATP-dependent zinc metalloproteas...    107   1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003530406.1|  PREDICTED: ATP-dependent zinc metalloproteas...    107   2e-22   Glycine max [soybeans]
gb|EPS74203.1|  hypothetical protein M569_00544                         105   8e-22   Genlisea aurea
ref|XP_003628399.1|  Cell division protease ftsH-like protein           105   1e-21   Medicago truncatula
ref|XP_007133424.1|  hypothetical protein PHAVU_011G177500g             103   3e-21   Phaseolus vulgaris [French bean]
ref|XP_010693321.1|  PREDICTED: ATP-dependent zinc metalloproteas...    102   9e-21   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006378601.1|  hypothetical protein POPTR_0010s17840g           93.6    5e-19   
emb|CDP16392.1|  unnamed protein product                              86.3    4e-16   Coffea canephora [robusta coffee]
emb|CDP22028.1|  unnamed protein product                              83.6    1e-15   Coffea canephora [robusta coffee]
gb|ABR16425.1|  unknown                                               63.2    5e-08   Picea sitchensis
ref|XP_001760368.1|  predicted protein                                61.6    1e-07   



>ref|XP_009593960.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Nicotiana tomentosiformis]
Length=1002

 Score =   171 bits (434),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            WL LSQSIRRGSERF+K+LG+SVKKETGFD +DAK   +EF+  A D+A  GQ QL RF+
Sbjct  63   WLRLSQSIRRGSERFIKQLGDSVKKETGFDFDDAKNTVAEFSGRAVDTAKTGQIQLQRFK  122

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             ELFP+F+ WN++E WKDIK W+ KRV V ++YV+ TVFSCQ+IYMAIRAP+INRERKEL
Sbjct  123  SELFPDFLNWNKFESWKDIKKWDSKRVGVFIVYVIFTVFSCQKIYMAIRAPMINRERKEL  182

Query  734  TEAYM  748
            TEAYM
Sbjct  183  TEAYM  187



>ref|XP_009774520.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Nicotiana sylvestris]
Length=1008

 Score =   171 bits (433),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/125 (70%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            WL LSQSIRRGSERF+K+LG+SVKKETGFD +DAK   +EF+  A DSA +GQ QL RF+
Sbjct  69   WLRLSQSIRRGSERFVKQLGDSVKKETGFDFDDAKNTVAEFSGRAVDSAKKGQIQLQRFK  128

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             ELFPEF+ WN++E WKDIK W+ KRV V ++YV+ TVFSCQ+I+MAIRAP+INRERKEL
Sbjct  129  SELFPEFLNWNKFESWKDIKKWDSKRVGVFIIYVIFTVFSCQKIHMAIRAPMINRERKEL  188

Query  734  TEAYM  748
            TEAYM
Sbjct  189  TEAYM  193



>ref|XP_006347120.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like 
[Solanum tuberosum]
Length=997

 Score =   166 bits (420),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +2

Query  320  PIFLAssssssdgsqgfsWLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFA  499
            P  +ASSS++++  +GFSWL LSQSIRRGSERFL +L +SVKKETGFD +D KV+  EF+
Sbjct  40   PTIVASSSNTNNSPEGFSWLQLSQSIRRGSERFLNQLEDSVKKETGFDFQDVKVKVGEFS  99

Query  500  NNANDSATEGQAQLDRFRFELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQ  679
              A DSA  GQ  L RF+ ELFPEF+ WN++E WKD+K W+ KRV V +LY++VTV SCQ
Sbjct  100  GRAVDSAKNGQILLQRFQSELFPEFLNWNKFESWKDVKKWDSKRVGVFILYIIVTVCSCQ  159

Query  680  RIYMAIRAPIINRERKELTEAYM  748
            +IYMAIRAPIINRERKELTEAYM
Sbjct  160  KIYMAIRAPIINRERKELTEAYM  182



>ref|XP_004232810.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Solanum lycopersicum]
Length=997

 Score =   165 bits (417),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +2

Query  320  PIFLAssssssdgsqgfsWLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFA  499
            P  +ASSS++++  +GFSWL LSQSIRRGSERFL +L +SVK+ETGFD +D KV+  EF+
Sbjct  40   PTIVASSSNTNNSPEGFSWLQLSQSIRRGSERFLNQLEDSVKQETGFDFKDVKVKVGEFS  99

Query  500  NNANDSATEGQAQLDRFRFELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQ  679
              A DSA  GQ  L RF+ ELFPEF+ WN++E WKD+K W+ KRV V +LY++VTV SCQ
Sbjct  100  GRAVDSAKNGQVLLQRFQSELFPEFLNWNKFESWKDVKKWDSKRVGVFILYIIVTVCSCQ  159

Query  680  RIYMAIRAPIINRERKELTEAYM  748
            +IYMAIRAPIINRERKELTEAYM
Sbjct  160  KIYMAIRAPIINRERKELTEAYM  182



>ref|XP_011095724.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Sesamum indicum]
Length=1005

 Score =   160 bits (405),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 97/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            WL L+QSIRRGS+RF + LGES+KKETGFD+EDA VR  E +  A DSA   Q  ++R  
Sbjct  64   WLRLAQSIRRGSQRFFENLGESLKKETGFDLEDAMVRVDEISGRARDSARNAQDAVERVN  123

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             EL P+F+ WN+WE WKDIKNWEPKR+ VL+LY+ V +FSCQ IY A+RAPII RER+EL
Sbjct  124  SELLPQFVSWNKWERWKDIKNWEPKRLGVLVLYIFVAIFSCQSIYKAVRAPIIERERREL  183

Query  734  TEAYM  748
             EAYM
Sbjct  184  AEAYM  188



>ref|XP_007213697.1| hypothetical protein PRUPE_ppa000789mg [Prunus persica]
 gb|EMJ14896.1| hypothetical protein PRUPE_ppa000789mg [Prunus persica]
Length=1003

 Score =   155 bits (392),  Expect = 5e-39, Method: Composition-based stats.
 Identities = 75/125 (60%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W+ L+QSIRRGSERF    GESVKKETGFD++DA V+  E+         +G+ +L+RF+
Sbjct  62   WVSLTQSIRRGSERFWSNFGESVKKETGFDLKDANVKVGEYVGRVEGGLKKGRTELERFK  121

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             EL PEF+ WNRWE WKDIK WE KR+A L+ Y+ + V SCQRIY+AIRAP+ +R+RKEL
Sbjct  122  TELVPEFVSWNRWERWKDIKTWESKRIAALIFYIFLAVVSCQRIYIAIRAPLQDRQRKEL  181

Query  734  TEAYM  748
            TEAYM
Sbjct  182  TEAYM  186



>ref|XP_008226136.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Prunus mume]
Length=1003

 Score =   154 bits (388),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 95/125 (76%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W+ L+QSIRRGSERF    GESVKKETGFD++DA V+  E+         +G+ +L+RF+
Sbjct  62   WVSLTQSIRRGSERFWSNFGESVKKETGFDLKDANVKVGEYVGRVEGGLKKGRTELERFK  121

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             EL PEF+ WNRWE WKDIK WE KR+A L+ Y+ + V SCQRIY+AIRAP+ +R+RKEL
Sbjct  122  TELVPEFVSWNRWERWKDIKTWESKRIAALIFYIFLAVVSCQRIYIAIRAPLQDRQRKEL  181

Query  734  TEAYM  748
            TEAYM
Sbjct  182  TEAYM  186



>ref|XP_008372001.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Malus domestica]
Length=1003

 Score =   153 bits (386),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 77/125 (62%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W  L++SIRRGS RF    GESVKKETGFD+++A V   EF     D   +G  +L+RFR
Sbjct  62   WQXLTRSIRRGSXRFWSDFGESVKKETGFDLKEANVTVGEFVGRXGDGLKKGGTELERFR  121

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             EL PEF+ WNRWE WKD+K WE KRVA L+ YV +T+ SCQRIY+AIRAP+ NR+RKEL
Sbjct  122  TELLPEFVSWNRWERWKDLKTWESKRVAALIFYVFITLVSCQRIYIAIRAPLQNRQRKEL  181

Query  734  TEAYM  748
            TEAYM
Sbjct  182  TEAYM  186



>ref|XP_011013846.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Populus euphratica]
Length=1003

 Score =   152 bits (385),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 87/143 (61%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +2

Query  320  PIFLAssssssdgsqgfsWLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFA  499
            PIF   SS++++GS GFSW  L++S+R G+ERFL KLGESVKKETGFDVE   V+  EF 
Sbjct  45   PIFRIYSSANANGSDGFSWPILTRSVRLGTERFLLKLGESVKKETGFDVEVGNVKVGEFL  104

Query  500  NNANDSATEGQAQLDRFRFELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQ  679
                    +G A L RFR EL  +F++WNRWE WKD KNWEPKRV  LLLY+   +FSCQ
Sbjct  105  ERIKGDIKKGDAALTRFRTELLTDFVDWNRWERWKDFKNWEPKRVGALLLYIFAVMFSCQ  164

Query  680  RIYMAIRAPIINRERKELTEAYM  748
            RIY AIRAP +++ER+ELTEAYM
Sbjct  165  RIYGAIRAPFLDQERRELTEAYM  187



>ref|XP_012087358.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Jatropha curcas]
Length=999

 Score =   151 bits (381),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 86/143 (60%), Positives = 103/143 (72%), Gaps = 3/143 (2%)
 Frame = +2

Query  320  PIFLAssssssdgsqgfsWLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFA  499
            P+F   SS + + S GFSW  LS++++ GS+RFL KLGESVK+ET FDVE      SE  
Sbjct  44   PVFRIRSSVNPNESDGFSWPKLSRAVQLGSQRFLLKLGESVKRETAFDVEGV---ISESV  100

Query  500  NNANDSATEGQAQLDRFRFELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQ  679
             +  D    GQA+  RFR EL PEF++WNRWE WKD KNWEPKRV VL LY  V  FSCQ
Sbjct  101  ESVKDQVKNGQAEFTRFRTELLPEFLDWNRWERWKDFKNWEPKRVGVLFLYAFVMAFSCQ  160

Query  680  RIYMAIRAPIINRERKELTEAYM  748
            RIY+AIRAP ++RER+ELTEAYM
Sbjct  161  RIYVAIRAPYLDRERRELTEAYM  183



>ref|XP_006422287.1| hypothetical protein CICLE_v10004242mg [Citrus clementina]
 ref|XP_006493752.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like 
[Citrus sinensis]
 gb|ESR35527.1| hypothetical protein CICLE_v10004242mg [Citrus clementina]
Length=1000

 Score =   150 bits (378),  Expect = 4e-37, Method: Composition-based stats.
 Identities = 82/143 (57%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +2

Query  320  PIFLAssssssdgsqgfsWLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFA  499
            P+F   SS++S+   GFSW  L++S+  GSERF  KLGESVKKETGFD+ +A ++  E  
Sbjct  40   PVFRVYSSANSNVPGGFSWQRLARSVLVGSERFSSKLGESVKKETGFDLNEAIMKVDELV  99

Query  500  NNANDSATEGQAQLDRFRFELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQ  679
            +   D   +G  +L RFR EL P+F+EWNRWE W+D +NWEPKRV  L+LYV V + SCQ
Sbjct  100  DRVKDGVKKGDDELTRFRTELLPQFVEWNRWERWQDFENWEPKRVGALVLYVFVVIVSCQ  159

Query  680  RIYMAIRAPIINRERKELTEAYM  748
            R+Y+AIRAP INR++KELTEAYM
Sbjct  160  RMYVAIRAPYINRQKKELTEAYM  182



>gb|KDP25069.1| hypothetical protein JCGZ_22604 [Jatropha curcas]
Length=959

 Score =   149 bits (375),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 92/125 (74%), Gaps = 3/125 (2%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W  LS++++ GS+RFL KLGESVK+ET FDVE      SE   +  D    GQA+  RFR
Sbjct  62   WPKLSRAVQLGSQRFLLKLGESVKRETAFDVEGV---ISESVESVKDQVKNGQAEFTRFR  118

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             EL PEF++WNRWE WKD KNWEPKRV VL LY  V  FSCQRIY+AIRAP ++RER+EL
Sbjct  119  TELLPEFLDWNRWERWKDFKNWEPKRVGVLFLYAFVMAFSCQRIYVAIRAPYLDRERREL  178

Query  734  TEAYM  748
            TEAYM
Sbjct  179  TEAYM  183



>ref|XP_010417622.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Camelina sativa]
Length=1009

 Score =   149 bits (375),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W+ L QS+R G+ER  +K+GESVKKETGFD E+A  R  EF     DS  +GQ QL RF+
Sbjct  68   WVRLMQSLRVGAERIGEKIGESVKKETGFDSEEASARVDEFVGRVKDSVQKGQHQLTRFK  127

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             E  P FI+WN+WE WKDI+NW+ KR+A L++Y    +FSCQR+Y+AI+AP I RERKEL
Sbjct  128  TETVPSFIDWNKWEHWKDIRNWDGKRLAALVIYAFALLFSCQRVYVAIQAPRIERERKEL  187

Query  734  TEAYM  748
            TE++M
Sbjct  188  TESFM  192



>ref|XP_010472815.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like 
[Camelina sativa]
Length=1008

 Score =   148 bits (373),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W+ L Q++R G+ER  +K+GESVKKETGFD E+A  R  EF     DS  +GQ QL RF+
Sbjct  67   WVRLMQTLRVGAERIGEKIGESVKKETGFDSEEASARVDEFVGRVKDSVQKGQHQLTRFK  126

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             E  P FI+WN+WE WKDI+NW+ KR+A L++Y    +FSCQR+Y+AI+AP I RERKEL
Sbjct  127  TETVPSFIDWNKWEHWKDIRNWDGKRLAALVIYAFALLFSCQRVYVAIQAPRIERERKEL  186

Query  734  TEAYM  748
            TE++M
Sbjct  187  TESFM  191



>emb|CDX67988.1| BnaA07g20280D [Brassica napus]
Length=950

 Score =   147 bits (372),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 70/125 (56%), Positives = 94/125 (75%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W+ L+QS+R G ER  +K+GESVKKETGFD E+A  R  E+     DS  +GQ +L RFR
Sbjct  67   WVRLTQSLRIGVERIGEKIGESVKKETGFDPEEAGARVDEYVGRVKDSVKKGQGELTRFR  126

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             E+ P FI+WN+WE WKDIKNW+ +RVA L++Y    +FSCQR+Y+A++AP I RER+EL
Sbjct  127  TEIVPSFIDWNKWEHWKDIKNWDGRRVAALMIYAFALLFSCQRVYVAVQAPRIERERREL  186

Query  734  TEAYM  748
            TE++M
Sbjct  187  TESFM  191



>gb|EYU27570.1| hypothetical protein MIMGU_mgv1a000728mg [Erythranthe guttata]
Length=1001

 Score =   146 bits (369),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            WL LSQSIRRGS RF + LG+SVKKETGF+V+D  VR    +  A +SA   Q  L R  
Sbjct  63   WLRLSQSIRRGSLRFFQNLGDSVKKETGFNVDDVLVRFDGLSGRAGNSARNAQDSLQRVN  122

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             EL P+F+ WN+WE WKDIKNWEP+R+ VL+LY+ VT+FS   IY AIRAPII RER+EL
Sbjct  123  SELLPQFVTWNKWEKWKDIKNWEPRRLGVLVLYIFVTIFSGLSIYKAIRAPIIERERREL  182

Query  734  TEAYM  748
            TEAYM
Sbjct  183  TEAYM  187



>emb|CDX79327.1| BnaC06g19760D [Brassica napus]
Length=950

 Score =   144 bits (362),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 68/125 (54%), Positives = 93/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W+ L+QS+R G ER  +K+G+SVKKETGFD E+A  R  E+     D   +GQ +L RFR
Sbjct  67   WVRLTQSLRVGVERIGEKIGKSVKKETGFDPEEAGARVDEYVGRVKDIVKKGQGELTRFR  126

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             E+ P FI+WN+WE WKDIKNW+ +RVA L++Y    +FSCQR+Y+A++AP I RER+EL
Sbjct  127  TEIVPSFIDWNKWEHWKDIKNWDGRRVAALMIYAFALLFSCQRVYVAVQAPRIERERREL  186

Query  734  TEAYM  748
            TE++M
Sbjct  187  TESFM  191



>ref|XP_010537801.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Tarenaya hassleriana]
Length=1007

 Score =   144 bits (362),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 98/125 (78%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W+ L++S+R G+ERF +KLG+SVKKE GF  E+A  +A++F++   D A +GQ +L+RFR
Sbjct  66   WVKLTRSLRVGAERFRQKLGDSVKKEIGFGSEEASTKANQFSDRVKDGAKKGQDELNRFR  125

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             E+ P F++WN+WE WKDI+NW+ KRVA L +Y    VFSCQR+Y+AI+AP + +ER+EL
Sbjct  126  TEVVPGFVDWNKWECWKDIRNWDVKRVAALFIYAFALVFSCQRVYIAIQAPRLEQERREL  185

Query  734  TEAYM  748
            TEA+M
Sbjct  186  TEAFM  190



>ref|XP_009104519.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Brassica rapa]
Length=1008

 Score =   144 bits (362),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 69/125 (55%), Positives = 92/125 (74%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            WL L+ S+R G ER  +K+GESVKKETGFD E+A  R  E+      S  +GQ +L RFR
Sbjct  67   WLRLTLSLRLGVERIGEKIGESVKKETGFDPEEAGARVDEYVGRVKASVKKGQGELTRFR  126

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             E+ P FI+WN+WE WKDIKNW+ +RVA L++Y    +FSCQR+Y+A++AP I RER+EL
Sbjct  127  TEIVPSFIDWNKWEHWKDIKNWDGRRVAALMIYAFAVLFSCQRVYVAVQAPRIERERREL  186

Query  734  TEAYM  748
            TE++M
Sbjct  187  TESFM  191



>ref|XP_002263178.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Vitis vinifera]
Length=1010

 Score =   143 bits (361),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 125/197 (63%), Gaps = 4/197 (2%)
 Frame = +2

Query  164  MDVSTTIRHCT-SPLHSSQIKLNIGKQAYSNLV-FHSRHLFNQrrnlklsrrrrPIFLAs  337
            MD+S  I H T  P H    K  +  Q  SNLV F    L +  R       +RP+F+A+
Sbjct  1    MDLS--IPHTTLYPFHLCSSKPLLFNQNSSNLVLFKPLSLPSSNRRRSRQYHKRPVFVAA  58

Query  338  sssssdgsqgfsWLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDS  517
            SS++  G  GFSWL L+ SI+RGSERF  + G  VK+ETGFD+EDA  + +EF      +
Sbjct  59   SSANPSGPNGFSWLGLAYSIQRGSERFWVQFGGLVKRETGFDLEDANSKVNEFVGPVRGA  118

Query  518  ATEGQAQLDRFRFELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAI  697
               G+  LDRFR EL PEF+ WNRWE WKD+KNWE KR+  L+LY  V + S + IY+A 
Sbjct  119  MKRGEDGLDRFRTELLPEFVNWNRWERWKDLKNWEAKRIGALILYTFVVIISFRGIYLAF  178

Query  698  RAPIINRERKELTEAYM  748
            +AP ++R+RKE+TEAYM
Sbjct  179  QAPRLDRQRKEVTEAYM  195



>emb|CBI24177.3| unnamed protein product [Vitis vinifera]
Length=1014

 Score =   143 bits (361),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 95/197 (48%), Positives = 125/197 (63%), Gaps = 4/197 (2%)
 Frame = +2

Query  164  MDVSTTIRHCT-SPLHSSQIKLNIGKQAYSNLV-FHSRHLFNQrrnlklsrrrrPIFLAs  337
            MD+S  I H T  P H    K  +  Q  SNLV F    L +  R       +RP+F+A+
Sbjct  1    MDLS--IPHTTLYPFHLCSSKPLLFNQNSSNLVLFKPLSLPSSNRRRSRQYHKRPVFVAA  58

Query  338  sssssdgsqgfsWLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDS  517
            SS++  G  GFSWL L+ SI+RGSERF  + G  VK+ETGFD+EDA  + +EF      +
Sbjct  59   SSANPSGPNGFSWLGLAYSIQRGSERFWVQFGGLVKRETGFDLEDANSKVNEFVGPVRGA  118

Query  518  ATEGQAQLDRFRFELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAI  697
               G+  LDRFR EL PEF+ WNRWE WKD+KNWE KR+  L+LY  V + S + IY+A 
Sbjct  119  MKRGEDGLDRFRTELLPEFVNWNRWERWKDLKNWEAKRIGALILYTFVVIISFRGIYLAF  178

Query  698  RAPIINRERKELTEAYM  748
            +AP ++R+RKE+TEAYM
Sbjct  179  QAPRLDRQRKEVTEAYM  195



>ref|XP_010429850.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like 
[Camelina sativa]
Length=1009

 Score =   143 bits (361),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W+ L QS+R G+ER  + +GESVKKETGFD E+   R  ++     DS  +GQ QL RF+
Sbjct  68   WVRLMQSLRVGAERIGENIGESVKKETGFDSEETTARVDDYVGQVKDSVQKGQHQLTRFK  127

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             E  P FI+WN+WE WKDI+NW+ KR+A L++Y    +FSCQR+Y+AI+AP I RERKEL
Sbjct  128  TETVPSFIDWNKWEHWKDIRNWDGKRLAALVIYAFALLFSCQRVYVAIQAPRIERERKEL  187

Query  734  TEAYM  748
            TE++M
Sbjct  188  TESFM  192



>ref|XP_007022615.1| FTSH protease 12 isoform 1 [Theobroma cacao]
 gb|EOY14140.1| FTSH protease 12 isoform 1 [Theobroma cacao]
Length=998

 Score =   139 bits (351),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 88/125 (70%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W  L++S R GSERF  K GESVKKETGF++++A VR  E      +   +G+ +  R  
Sbjct  57   WFSLARSFRLGSERFWSKFGESVKKETGFNLDEANVRVDELVGRVKEGFRKGEGEFTRLW  116

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             EL PEF+ WNRWE WKD KNWEPKRV  L+LY+ V + SCQ++Y A+RAP + RERKEL
Sbjct  117  TELVPEFVSWNRWERWKDFKNWEPKRVTALILYIFVAIISCQKLYAAVRAPQLGRERKEL  176

Query  734  TEAYM  748
            TEAYM
Sbjct  177  TEAYM  181



>ref|XP_006389876.1| hypothetical protein EUTSA_v100180710mg, partial [Eutrema salsugineum]
 gb|ESQ27162.1| hypothetical protein EUTSA_v100180710mg, partial [Eutrema salsugineum]
Length=824

 Score =   139 bits (349),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 91/125 (73%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            WL L++S+R G ER  +K+GESVKKE GFD E+A  R  E+     +S  +GQ QLDR +
Sbjct  67   WLRLARSLRIGVERIGEKIGESVKKEIGFDSEEAGARVDEYVGRVKNSVQKGQHQLDRLK  126

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             E  P FI+WN+WE WKDI+NW+  RVA L++Y    +FSCQR+Y+A++AP I RER+EL
Sbjct  127  NETVPSFIDWNKWEHWKDIRNWDGTRVAALVIYAFALLFSCQRVYVAVQAPRIERERREL  186

Query  734  TEAYM  748
            TE++M
Sbjct  187  TESFM  191



>gb|KDO36852.1| hypothetical protein CISIN_1g0356082mg, partial [Citrus sinensis]
Length=168

 Score =   128 bits (321),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 93/129 (72%), Gaps = 0/129 (0%)
 Frame = +2

Query  320  PIFLAssssssdgsqgfsWLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFA  499
            P+F   SS++S+   GFSW  L++S+  GSERF  KLGESVKKETGFD+ +A ++  E  
Sbjct  40   PVFRVYSSANSNVPGGFSWQRLARSVLVGSERFSSKLGESVKKETGFDLNEAIMKVDELV  99

Query  500  NNANDSATEGQAQLDRFRFELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQ  679
            +   D   +G  +L RFR EL P+F+EWNRWE WKD +NWEPKRV  L+LYV V + SCQ
Sbjct  100  DRVKDGVKKGDDELTRFRTELLPQFVEWNRWERWKDFENWEPKRVGALVLYVFVVIVSCQ  159

Query  680  RIYMAIRAP  706
            R+Y+AIRAP
Sbjct  160  RMYVAIRAP  168



>gb|KFK42356.1| hypothetical protein AALP_AA2G245500 [Arabis alpina]
Length=1000

 Score =   136 bits (343),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 89/125 (71%), Gaps = 4/125 (3%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W+ L QS+R G ER    +GE+VKKETGFD E+A  R  EF     DS  +GQ +L RFR
Sbjct  63   WVRLGQSLRIGVER----IGETVKKETGFDSEEANARVDEFKGRVKDSVKKGQDELTRFR  118

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             E  P FI+WN+WE WKDI+NW+ +RVA L++Y     FSCQR+Y+AI+AP I RER+EL
Sbjct  119  NETVPLFIDWNKWEHWKDIRNWDGRRVAALVVYAFAVFFSCQRVYVAIQAPRIERERREL  178

Query  734  TEAYM  748
            TE++M
Sbjct  179  TESFM  183



>gb|AAD30220.1|AC007202_2 Is a member of PF|00004 ATPases associated with various cellular 
activities (AAA) family. ESTs gb|T43031, gb|R64750, gb|AA394742 
and gb|AI100347 come from this gene [Arabidopsis thaliana]
Length=998

 Score =   135 bits (341),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W+ L+QSIR G+ER  +K+GESVK E GFD E+A  R +E+     DS  +G  +L RF+
Sbjct  67   WVRLAQSIRLGAERIGEKIGESVKTEIGFDSEEASGRVNEYVARVKDSVHKGHHELTRFK  126

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             E  P FI+WN+WE WKDI+NW+ KRVA L +Y    + SCQR+Y+AI+AP + RER+EL
Sbjct  127  NETVPSFIDWNKWEHWKDIRNWDGKRVAALFIYAFALLLSCQRVYVAIQAPRVERERREL  186

Query  734  TEAYM  748
            TE++M
Sbjct  187  TESFM  191



>ref|XP_008456301.1| PREDICTED: LOW QUALITY PROTEIN: ATP-dependent zinc metalloprotease 
FTSH 12, chloroplastic [Cucumis melo]
Length=1001

 Score =   135 bits (341),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 87/125 (70%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W   S+S+RRGSERF    G+S++KETGFD+++   R  EF   AN+       +L R +
Sbjct  62   WESFSRSVRRGSERFWLNFGKSIRKETGFDLKNTDGRLVEFFAGANERLENMGTELQRLK  121

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             E FPEFI WNRW+ WK  KNWEPKRV  L LY +V + SCQRIYMA+RAP +NRER +L
Sbjct  122  NETFPEFINWNRWDRWKAFKNWEPKRVGALFLYALVMIVSCQRIYMAVRAPFVNRERLKL  181

Query  734  TEAYM  748
            TEAYM
Sbjct  182  TEAYM  186



>ref|NP_565212.1| cell division protease ftsH-12 [Arabidopsis thaliana]
 sp|Q9SAJ3.2|FTSHC_ARATH RecName: Full=ATP-dependent zinc metalloprotease FTSH 12, chloroplastic; 
Short=AtFTSH12; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAH20273.1| AT1G79560 [Arabidopsis thaliana]
 gb|AEE36264.1| cell division protease ftsH-12 [Arabidopsis thaliana]
Length=1008

 Score =   135 bits (341),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 90/125 (72%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W+ L+QSIR G+ER  +K+GESVK E GFD E+A  R +E+     DS  +G  +L RF+
Sbjct  67   WVRLAQSIRLGAERIGEKIGESVKTEIGFDSEEASGRVNEYVARVKDSVHKGHHELTRFK  126

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             E  P FI+WN+WE WKDI+NW+ KRVA L +Y    + SCQR+Y+AI+AP + RER+EL
Sbjct  127  NETVPSFIDWNKWEHWKDIRNWDGKRVAALFIYAFALLLSCQRVYVAIQAPRVERERREL  186

Query  734  TEAYM  748
            TE++M
Sbjct  187  TESFM  191



>ref|XP_010260593.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Nelumbo nucifera]
Length=1007

 Score =   134 bits (338),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 89/126 (71%), Gaps = 1/126 (1%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W  +  SIRRGSER L   GE VKKETGFD+EDA  +         D+A +G+   DRF+
Sbjct  65   WSRVRHSIRRGSERVLSNFGELVKKETGFDLEDANEKVVGLLGQVRDTAKKGEIVFDRFK  124

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERK-E  730
            FE  P+FI+WN+WE WKD+KNWEPKR+  L+ Y+ V + SCQR+Y+A++ P ++R+ K E
Sbjct  125  FEWVPKFIDWNKWERWKDVKNWEPKRIGALIFYIFVVIISCQRVYVALKTPRLDRQSKEE  184

Query  731  LTEAYM  748
            LTEA+M
Sbjct  185  LTEAFM  190



>ref|XP_004306570.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=993

 Score =   133 bits (334),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 92/125 (74%), Gaps = 7/125 (6%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W+ L++SIRRGSE+F    G+SVKKETGFD+++  V+  E    A        A+L+RFR
Sbjct  59   WVSLTRSIRRGSEQFWSSFGDSVKKETGFDLKEVNVKVGECLGQAG-------AELERFR  111

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             EL P+F+ WNR E WKD+K WEPKR A L++YV+V V SCQR+Y+A+RAPI +R R+EL
Sbjct  112  TELVPQFVSWNRLEHWKDVKTWEPKRFAALVVYVLVAVVSCQRMYVAVRAPIQDRRRREL  171

Query  734  TEAYM  748
            TEAYM
Sbjct  172  TEAYM  176



>ref|XP_002887790.1| EMB1047/FTSH12 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64049.1| EMB1047/FTSH12 [Arabidopsis lyrata subsp. lyrata]
Length=994

 Score =   132 bits (331),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 89/125 (71%), Gaps = 4/125 (3%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W+ L+QSIR G+ER  +K+GESVKK  GFD E+A  R  E+     DS  E    L+RF+
Sbjct  67   WVRLAQSIRVGAERIGEKIGESVKKGIGFDSEEASARVDEYVGRVKDSVHE----LNRFK  122

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             E  P FI+WN+WE WKDI+NW+ KRVA L +Y    +FSCQR+Y+AI+AP + +ER+EL
Sbjct  123  TETVPSFIDWNKWEHWKDIRNWDGKRVAALFIYAFALLFSCQRVYVAIQAPRVEQERREL  182

Query  734  TEAYM  748
            TE++M
Sbjct  183  TESFM  187



>ref|XP_002513356.1| Cell division protein ftsH, putative [Ricinus communis]
 gb|EEF48759.1| Cell division protein ftsH, putative [Ricinus communis]
Length=993

 Score =   131 bits (330),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 92/125 (74%), Gaps = 4/125 (3%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W  L+++ R GSERFL KL +SVKKETGFD+E A V+  EF       A  G+A+L R +
Sbjct  56   WPSLTRAFRLGSERFLLKLRQSVKKETGFDLEGANVKLGEFVERIKGQAKMGEAELTRLK  115

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
                 +FI+WNR + WKD KNW+PKRV VL+LYV V +FSCQR+Y+AIRAP ++RER++L
Sbjct  116  ----TDFIDWNRLDRWKDFKNWQPKRVGVLVLYVFVMMFSCQRMYVAIRAPFLDRERRQL  171

Query  734  TEAYM  748
            TEAYM
Sbjct  172  TEAYM  176



>ref|XP_010064082.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Eucalyptus grandis]
 gb|KCW71389.1| hypothetical protein EUGRSUZ_F04462 [Eucalyptus grandis]
Length=995

 Score =   131 bits (330),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 67/126 (53%), Positives = 90/126 (71%), Gaps = 1/126 (1%)
 Frame = +2

Query  374  WLH-LSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRF  550
            W H LS+SIRRGS+RF    G +VKKETGFD E A  +  E A    D A   +A + R 
Sbjct  53   WHHRLSRSIRRGSDRFFLNFGAAVKKETGFDPEAANAKLRELAALVKDRAQLSEAAVARL  112

Query  551  RFELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKE  730
            R EL P F++WNRW+ WKD+++W+PKR+A L+LY +V V SCQR+Y+ IRAP+++  R++
Sbjct  113  RSELLPAFLDWNRWDRWKDLESWDPKRIAALVLYTLVVVVSCQRVYVTIRAPVLDHRRRQ  172

Query  731  LTEAYM  748
            LTEAYM
Sbjct  173  LTEAYM  178



>ref|XP_006303096.1| hypothetical protein CARUB_v100197241mg [Capsella rubella]
 gb|EOA35994.1| hypothetical protein CARUB_v100197241mg [Capsella rubella]
Length=978

 Score =   130 bits (328),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 66/125 (53%), Positives = 89/125 (71%), Gaps = 7/125 (6%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W+ L +SIR G+ER  +K+GESVKKE GFD       + E+     D+  +GQ +L RF+
Sbjct  67   WVRLMRSIRLGAERIGEKVGESVKKEIGFD-------SDEYVGRVKDTVHKGQHELTRFK  119

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             E  P FI+WN+WE WKDI+NW+ KRVA L++Y    +FSCQR+Y+AI+AP I RERKEL
Sbjct  120  TETVPLFIDWNKWEHWKDIRNWDGKRVATLVIYAFALLFSCQRVYVAIQAPRIERERKEL  179

Query  734  TEAYM  748
            TE++M
Sbjct  180  TESFM  184



>ref|XP_004139903.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Cucumis sativus]
 gb|KGN46798.1| hypothetical protein Csa_6G136520 [Cucumis sativus]
Length=1003

 Score =   130 bits (326),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 84/121 (69%), Gaps = 0/121 (0%)
 Frame = +2

Query  386  SQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFRFELF  565
            S+S+RRGSERF    GES++KETGF +++   R  EF   AN+       +L R + E  
Sbjct  66   SRSVRRGSERFWLNFGESIRKETGFGLKNTDGRLVEFFARANERLENMGPELQRLKNETL  125

Query  566  PEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKELTEAY  745
            PEFI WNRW+ WKD KNWEPKRV  L LY +V + SCQRIYM++R P +NRER +LTEAY
Sbjct  126  PEFITWNRWDRWKDFKNWEPKRVGALFLYALVMIVSCQRIYMSVRVPFVNRERLKLTEAY  185

Query  746  M  748
            M
Sbjct  186  M  186



>gb|KJB81419.1| hypothetical protein B456_013G144900 [Gossypium raimondii]
Length=925

 Score =   128 bits (322),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +2

Query  395  IRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFRFELFPEF  574
            +R GS++F  K GESVKKETGFD+++A VR  E     N    +G+ + +R R EL PEF
Sbjct  56   LRLGSQKFWFKFGESVKKETGFDLDEANVRVGELVGRVNQGLRKGEGEFNRLRTELLPEF  115

Query  575  IEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKELTEAYM  748
            + WNRW+ WKD+KNWE KR+A L+LY+ V + SCQ++Y  +RAP  ++ERK+LTEAYM
Sbjct  116  VSWNRWDRWKDLKNWELKRIAALILYIFVAIISCQKLYAVVRAPQQDQERKQLTEAYM  173



>gb|KJB81418.1| hypothetical protein B456_013G144900 [Gossypium raimondii]
Length=990

 Score =   128 bits (322),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/118 (53%), Positives = 86/118 (73%), Gaps = 0/118 (0%)
 Frame = +2

Query  395  IRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFRFELFPEF  574
            +R GS++F  K GESVKKETGFD+++A VR  E     N    +G+ + +R R EL PEF
Sbjct  56   LRLGSQKFWFKFGESVKKETGFDLDEANVRVGELVGRVNQGLRKGEGEFNRLRTELLPEF  115

Query  575  IEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKELTEAYM  748
            + WNRW+ WKD+KNWE KR+A L+LY+ V + SCQ++Y  +RAP  ++ERK+LTEAYM
Sbjct  116  VSWNRWDRWKDLKNWELKRIAALILYIFVAIISCQKLYAVVRAPQQDQERKQLTEAYM  173



>ref|XP_010936492.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=865

 Score =   126 bits (316),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 63/125 (50%), Positives = 87/125 (70%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W  +S+S+RRGSERFL    E +KKETG D+E A ++A E  + A  +A +G+A +DRFR
Sbjct  66   WHRVSESMRRGSERFLASFVEYLKKETGLDLEQANLKAGELLDGARGAAEKGRAVVDRFR  125

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             +L PEFIEWN+WE WKD + WEP+RV  L+LY++V    CQ+ Y A  +    R ++EL
Sbjct  126  LDLVPEFIEWNKWENWKDKEKWEPRRVGALILYIIVVTIICQKTYGAFTSYFDRRSKREL  185

Query  734  TEAYM  748
            TEA+M
Sbjct  186  TEAFM  190



>ref|XP_010936478.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=1013

 Score =   126 bits (316),  Expect = 7e-29, Method: Composition-based stats.
 Identities = 63/125 (50%), Positives = 87/125 (70%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W  +S+S+RRGSERFL    E +KKETG D+E A ++A E  + A  +A +G+A +DRFR
Sbjct  66   WHRVSESMRRGSERFLASFVEYLKKETGLDLEQANLKAGELLDGARGAAEKGRAVVDRFR  125

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             +L PEFIEWN+WE WKD + WEP+RV  L+LY++V    CQ+ Y A  +    R ++EL
Sbjct  126  LDLVPEFIEWNKWENWKDKEKWEPRRVGALILYIIVVTIICQKTYGAFTSYFDRRSKREL  185

Query  734  TEAYM  748
            TEA+M
Sbjct  186  TEAFM  190



>ref|XP_008805979.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Phoenix dactylifera]
Length=1014

 Score =   124 bits (311),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 61/125 (49%), Positives = 86/125 (69%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W  +S+S+RRGS RFL   GE ++KETG D+E A ++A E  + A  +A +G+  +DRFR
Sbjct  67   WRRVSESMRRGSVRFLASFGEYLRKETGLDLEQANLKARELLDGARGAAEKGRGVVDRFR  126

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             EL PEFI WN+WE WKD + WEP+RV  L+LY++V    CQ+ Y+A  +    R ++EL
Sbjct  127  LELVPEFIGWNKWENWKDKEKWEPRRVGALILYIIVVTIICQKTYVAFTSYFDRRSKREL  186

Query  734  TEAYM  748
            TEA+M
Sbjct  187  TEAFM  191



>ref|XP_004516247.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like 
isoform X2 [Cicer arietinum]
Length=989

 Score =   118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 83/121 (69%), Gaps = 7/121 (6%)
 Frame = +2

Query  386  SQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFRFELF  565
            SQS+ R S RFL K G++VKKETG D+ D  V+ASEF +   +  +E       F     
Sbjct  60   SQSLERASRRFLLKFGDTVKKETGVDLGDGVVKASEFVDGVKNVGSE-------FGTRSL  112

Query  566  PEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKELTEAY  745
             EF++WNR E WK+IKNWEP+R+  L+LY+ V  F+C+  Y+AI+AP +NR+RKELTEAY
Sbjct  113  SEFVDWNRVEHWKNIKNWEPRRIGALVLYIFVVAFACRGSYVAIKAPFVNRQRKELTEAY  172

Query  746  M  748
            M
Sbjct  173  M  173



>ref|XP_004516246.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like 
isoform X1 [Cicer arietinum]
Length=990

 Score =   118 bits (295),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 83/121 (69%), Gaps = 7/121 (6%)
 Frame = +2

Query  386  SQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFRFELF  565
            SQS+ R S RFL K G++VKKETG D+ D  V+ASEF +   +  +E       F     
Sbjct  60   SQSLERASRRFLLKFGDTVKKETGVDLGDGVVKASEFVDGVKNVGSE-------FGTRSL  112

Query  566  PEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKELTEAY  745
             EF++WNR E WK+IKNWEP+R+  L+LY+ V  F+C+  Y+AI+AP +NR+RKELTEAY
Sbjct  113  SEFVDWNRVEHWKNIKNWEPRRIGALVLYIFVVAFACRGSYVAIKAPFVNRQRKELTEAY  172

Query  746  M  748
            M
Sbjct  173  M  173



>gb|ABF70169.1| hypothetical protein MA4_112I10.64 [Musa acuminata]
Length=380

 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 84/125 (67%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W +  +S+RRGS RF    GE +KKETGFD+E A   A+       D+  +G++ +D+FR
Sbjct  67   WENFYESLRRGSARFTSSFGEHLKKETGFDLESANATAAVLVERTRDATKKGRSAVDQFR  126

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             E   EF+EWN+WE WKD++ WEP+R+  L+LY++V   S ++ Y+A+ + I  + ++EL
Sbjct  127  SEWLSEFLEWNKWENWKDLRKWEPRRIGALILYIIVVSISSRKFYVALTSQINRQSKREL  186

Query  734  TEAYM  748
            TEAYM
Sbjct  187  TEAYM  191



>gb|ERN19706.1| hypothetical protein AMTR_s00062p00195710 [Amborella trichopoda]
Length=1013

 Score =   108 bits (271),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 79/126 (63%), Gaps = 1/126 (1%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W  +SQ + RGS+R     G+ +K+ETGFDVE A  R + F    + +   G   L+R R
Sbjct  70   WEKISQGVSRGSKRLFSNFGKQLKEETGFDVEAANSRVNGFMERFSKAKERGNVVLERLR  129

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKE-  730
             E FP+FIEWN+W+ WKD+KNWEP R+  LLLY  +   +   I+MA+  P ++R  K+ 
Sbjct  130  VEWFPQFIEWNKWDNWKDLKNWEPARIGALLLYTFLLAVTSHGIFMAVTVPRLDRGAKQK  189

Query  731  LTEAYM  748
            LT+AYM
Sbjct  190  LTDAYM  195



>ref|XP_011628477.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Amborella trichopoda]
Length=1012

 Score =   108 bits (270),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 79/126 (63%), Gaps = 1/126 (1%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W  +SQ + RGS+R     G+ +K+ETGFDVE A  R + F    + +   G   L+R R
Sbjct  70   WEKISQGVSRGSKRLFSNFGKQLKEETGFDVEAANSRVNGFMERFSKAKERGNVVLERLR  129

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKE-  730
             E FP+FIEWN+W+ WKD+KNWEP R+  LLLY  +   +   I+MA+  P ++R  K+ 
Sbjct  130  VEWFPQFIEWNKWDNWKDLKNWEPARIGALLLYTFLLAVTSHGIFMAVTVPRLDRGAKQK  189

Query  731  LTEAYM  748
            LT+AYM
Sbjct  190  LTDAYM  195



>ref|XP_009397211.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=1018

 Score =   107 bits (268),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/125 (44%), Positives = 81/125 (65%), Gaps = 0/125 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W +  +S+RRGS RF    GE +KKETG D+E A   A+       D   +G A +D+FR
Sbjct  69   WENFYESLRRGSARFTSSFGEHLKKETGIDLESANATAAVLVERTRDVTKKGLAAVDQFR  128

Query  554  FELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKEL  733
             E   EF+EWN+WE WKD++ WEP+R+  L+LY++V   S ++ Y+A+ + I  + ++EL
Sbjct  129  SEWLSEFLEWNKWENWKDLRKWEPRRIGALILYIIVVSISSRKFYVALTSQINRQSKREL  188

Query  734  TEAYM  748
            TEAYM
Sbjct  189  TEAYM  193



>ref|XP_003530406.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic-like 
[Glycine max]
Length=982

 Score =   107 bits (267),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 59/122 (48%), Positives = 80/122 (66%), Gaps = 10/122 (8%)
 Frame = +2

Query  386  SQSIRRGSERFLKKLGESVKKETGFDVEDAKVR-ASEFANNANDSATEGQAQLDRFRFEL  562
            SQS+ RGS RF  K GE VKKETG D E+  V+   EF N           +L R   + 
Sbjct  54   SQSLLRGSRRFWGKFGEMVKKETGLDFENRSVKKVGEFVNGD---------ELRRLGTDW  104

Query  563  FPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKELTEA  742
               F++WNRWE WK+IK+WEPKR+  L+LY+ V  F+C+ +Y+ I+AP ++R++KELTEA
Sbjct  105  VFRFVDWNRWERWKNIKDWEPKRIGALVLYIFVVTFACRGVYVTIQAPFLSRQKKELTEA  164

Query  743  YM  748
            YM
Sbjct  165  YM  166



>gb|EPS74203.1| hypothetical protein M569_00544, partial [Genlisea aurea]
Length=926

 Score =   105 bits (262),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 76/120 (63%), Gaps = 10/120 (8%)
 Frame = +2

Query  389  QSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFRFELFP  568
            +SI RGS RF    G+SVKKETGFD  D    A E               L     EL P
Sbjct  1    RSILRGSRRFFHNFGDSVKKETGFDSVDG---AKELLGGVRRG-------LHWLYSELLP  50

Query  569  EFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKELTEAYM  748
            EF  WN+WE WKD+KNWEPKR+ V +LYV+VT FS + IY+++RAP INRER+EL EA+M
Sbjct  51   EFFSWNQWERWKDLKNWEPKRLGVFVLYVLVTAFSFRTIYLSVRAPFINRERRELAEAFM  110



>ref|XP_003628399.1| Cell division protease ftsH-like protein [Medicago truncatula]
 gb|AET02875.1| ATP-dependent zinc metalloprotease FTSH protein [Medicago truncatula]
Length=988

 Score =   105 bits (261),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 78/121 (64%), Gaps = 7/121 (6%)
 Frame = +2

Query  386  SQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFRFELF  565
            S+S+ R S RFL K G+ VKKETG D+ D   +  EF +      +E        R    
Sbjct  59   SESLDRASRRFLVKFGDMVKKETGVDLGDGVGKVGEFVDGVRKVGSE-------LRIPSL  111

Query  566  PEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKELTEAY  745
             EF++WNR+E WK++KNWEP+R+  L+LY+ V  F+C+ +++AI+AP +N +RKE TEAY
Sbjct  112  DEFVDWNRFENWKNVKNWEPRRIGALVLYIFVVAFACRGVFVAIQAPFLNHQRKESTEAY  171

Query  746  M  748
            M
Sbjct  172  M  172



>ref|XP_007133424.1| hypothetical protein PHAVU_011G177500g [Phaseolus vulgaris]
 gb|ESW05418.1| hypothetical protein PHAVU_011G177500g [Phaseolus vulgaris]
Length=975

 Score =   103 bits (258),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/121 (45%), Positives = 79/121 (65%), Gaps = 8/121 (7%)
 Frame = +2

Query  386  SQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFRFELF  565
            S S+RRGS RF  K GE VKKETG D E++ V+      + +        +L RF  +  
Sbjct  50   SHSLRRGSRRFWLKFGEMVKKETGLDFENSSVKKVGEVMSGD--------ELRRFGAQWV  101

Query  566  PEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKELTEAY  745
             +F++WNRWE WK+IK+WEP R+   +LY+ V   +C+ +Y+A++ P +NR++KELTEAY
Sbjct  102  SQFVDWNRWERWKNIKDWEPMRIGTFVLYMFVVTVACRGVYVAVQTPFLNRQKKELTEAY  161

Query  746  M  748
            M
Sbjct  162  M  162



>ref|XP_010693321.1| PREDICTED: ATP-dependent zinc metalloprotease FTSH 12, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=985

 Score =   102 bits (254),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 92/143 (64%), Gaps = 11/143 (8%)
 Frame = +2

Query  320  PIFLAssssssdgsqgfsWLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFA  499
            PIFLAS+S + +G     W  LS SIR GS+RFL K GE + KETG +  D + R     
Sbjct  37   PIFLASASGNPNGLS---WDRLSGSIRHGSDRFLSKFGE-LMKETGMNFGDTQKRIYT--  90

Query  500  NNANDSATEGQAQLDRFRFELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQ  679
                   ++ +A   RFRFEL P+FI WN+W+ WKD+K W+P R+ VL+LY++  V S +
Sbjct  91   -----QVSKFEAGFSRFRFELVPQFINWNKWDNWKDVKVWKPYRIGVLVLYLIAIVVSSR  145

Query  680  RIYMAIRAPIINRERKELTEAYM  748
            +IY  ++AP I +E+KEL EAYM
Sbjct  146  KIYTVLQAPRIAQEKKELMEAYM  168



>ref|XP_006378601.1| hypothetical protein POPTR_0010s17840g, partial [Populus trichocarpa]
 gb|ERP56398.1| hypothetical protein POPTR_0010s17840g, partial [Populus trichocarpa]
Length=257

 Score = 93.6 bits (231),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/77 (56%), Positives = 52/77 (68%), Gaps = 0/77 (0%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFR  553
            W  L++S+R G+ERFL KLGESVKKETGFDVE   V+  EF         +G A L RFR
Sbjct  15   WPILTRSVRLGTERFLLKLGESVKKETGFDVEGGNVKVGEFVERIKGDIKKGDAALTRFR  74

Query  554  FELFPEFIEWNRWELWK  604
             EL  +F++WNRWE WK
Sbjct  75   TELLTDFVDWNRWERWK  91



>emb|CDP16392.1| unnamed protein product [Coffea canephora]
Length=372

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 74/126 (59%), Gaps = 12/126 (10%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVEDAKVRA-SEFANNANDSATEGQAQLDRF  550
            WLHLS+       RF        K++TG D +   + A +        S     + L+RF
Sbjct  110  WLHLSR-------RFFTNF----KQQTGIDFQHDTIAALARLTAPLRRSVQLPHSALERF  158

Query  551  RFELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKE  730
            R  L  +F+ WN+ + WKD+KNWE KR+ VL+LY +V V S Q IY AI+AP+I+RER+E
Sbjct  159  RSHLLADFVNWNKLDCWKDVKNWEAKRIGVLILYALVMVVSSQGIYKAIQAPVIDRERRE  218

Query  731  LTEAYM  748
            L EAYM
Sbjct  219  LAEAYM  224



>emb|CDP22028.1| unnamed protein product [Coffea canephora]
Length=265

 Score = 83.6 bits (205),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 76/126 (60%), Gaps = 12/126 (10%)
 Frame = +2

Query  374  WLHLSQSIRRGSERFLKKLGESVKKETGFDVE-DAKVRASEFANNANDSATEGQAQLDRF  550
            WLHLS+       RF        K++TG D + DA    ++ A     S       L+RF
Sbjct  111  WLHLSR-------RFFTNF----KQQTGIDFQHDAIAILAQLAAPLRRSVQLPHFALERF  159

Query  551  RFELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAIRAPIINRERKE  730
            R  L P+F+ WN+ + WKD+KNWE KR+ VL+LY +V V S + IY AI+AP+I+RER+E
Sbjct  160  RSHLLPDFVNWNKLDRWKDVKNWEAKRIGVLILYALVMVVSSRGIYKAIQAPVIDRERRE  219

Query  731  LTEAYM  748
            L EAYM
Sbjct  220  LAEAYM  225



>gb|ABR16425.1| unknown [Picea sitchensis]
Length=1036

 Score = 63.2 bits (152),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 68/121 (56%), Gaps = 1/121 (1%)
 Frame = +2

Query  389  QSIRRGSERFLKKLGESVKKETGFDVEDAKVRASEFANNANDSATEGQAQLDRFRFELFP  568
            Q+     +R  +K    +K+ETG D+E  + R  + +    +   +G   +++ RF+L+P
Sbjct  100  QAFGGAVDRIRRKFQRQLKEETGIDIEQIEARIVDSSRKVEEYRQQGMQNVEKLRFQLWP  159

Query  569  EFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIYMAI-RAPIINRERKELTEAY  745
             F+ WN+ E WKD K+WE +R+  L+LYV+V   S Q +++A  R+ +  +    L E Y
Sbjct  160  RFVAWNQLERWKDFKHWESRRIVALVLYVLVVAVSFQGLFLAFKRSRVYLQPNSRLAEGY  219

Query  746  M  748
            +
Sbjct  220  L  220



>ref|XP_001760368.1| predicted protein [Physcomitrella patens]
 gb|EDQ74759.1| predicted protein, partial [Physcomitrella patens]
Length=432

 Score = 61.6 bits (148),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 65/139 (47%), Gaps = 18/139 (13%)
 Frame = +2

Query  383  LSQSIRRGSERFLKKLGESVKKETGFDVEDA------------------KVRASEFANNA  508
            L  +  RGS RF + + +  K+E G D+  A                  K RA E     
Sbjct  131  LQGAFARGSARFYENIVDDAKRELGVDIGSAVDSSNALVDAFEGMVKTSKQRAKELQKEL  190

Query  509  NDSATEGQAQLDRFRFELFPEFIEWNRWELWKDIKNWEPKRvavlllyvvvtvFSCQRIY  688
             ++  E Q        + +P+F+EWNRWELWKD+++W  +R+   +LY ++   S +  Y
Sbjct  191  QEARAEAQDSFALVEGKYWPQFVEWNRWELWKDVRSWNARRIGAFILYGLLVGASVRGAY  250

Query  689  MAIRAPIINRERKELTEAY  745
              +R+      ++ + EAY
Sbjct  251  STVRSVGSRGAKETIAEAY  269



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1427800438025