BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2382

Length=641
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009609142.1|  PREDICTED: 60S ribosomal protein L18a              354   2e-121   Nicotiana tomentosiformis
ref|XP_009799848.1|  PREDICTED: 60S ribosomal protein L18a              353   5e-121   Nicotiana sylvestris
gb|ADE42972.1|  putative 60S ribosomal protein L18a                     353   6e-121   Gardenia jasminoides
ref|XP_006387417.1|  60S ribosomal protein L18a-1                       352   1e-120   
ref|NP_001275252.1|  uncharacterized protein LOC102577837               352   1e-120   Solanum tuberosum [potatoes]
ref|XP_009782492.1|  PREDICTED: 60S ribosomal protein L18a-like         352   1e-120   Nicotiana sylvestris
ref|XP_011071121.1|  PREDICTED: 60S ribosomal protein L18a              352   1e-120   Sesamum indicum [beniseed]
emb|CDP06299.1|  unnamed protein product                                352   2e-120   Coffea canephora [robusta coffee]
ref|XP_009598886.1|  PREDICTED: 60S ribosomal protein L18a-like         351   4e-120   Nicotiana tomentosiformis
gb|KCW75929.1|  hypothetical protein EUGRSUZ_D00304                     353   5e-120   Eucalyptus grandis [rose gum]
gb|KCW89756.1|  hypothetical protein EUGRSUZ_A02018                     352   6e-120   Eucalyptus grandis [rose gum]
ref|XP_004241806.1|  PREDICTED: 60S ribosomal protein L18a              350   8e-120   Solanum lycopersicum
ref|XP_011096544.1|  PREDICTED: 60S ribosomal protein L18a-like         350   8e-120   Sesamum indicum [beniseed]
ref|XP_010053843.1|  PREDICTED: 60S ribosomal protein L18a              350   9e-120   
ref|XP_011009655.1|  PREDICTED: 60S ribosomal protein L18a-2            349   1e-119   Populus euphratica
gb|ABK92715.1|  unknown                                                 349   1e-119   Populus trichocarpa [western balsam poplar]
ref|XP_006477944.1|  PREDICTED: 60S ribosomal protein L18a-like i...    350   1e-119   Citrus sinensis [apfelsine]
ref|XP_010052071.1|  PREDICTED: 60S ribosomal protein L18a-like i...    349   2e-119   Eucalyptus grandis [rose gum]
ref|XP_002317384.1|  60S ribosomal protein L18a-1                       349   2e-119   Populus trichocarpa [western balsam poplar]
ref|NP_001275107.1|  60S ribosomal protein L18a-like                    348   2e-119   Solanum tuberosum [potatoes]
ref|XP_007159262.1|  hypothetical protein PHAVU_002G223200g             348   3e-119   Phaseolus vulgaris [French bean]
ref|XP_006449674.1|  hypothetical protein CICLE_v10016900mg             348   4e-119   Citrus clementina [clementine]
ref|XP_007147889.1|  hypothetical protein PHAVU_006G163400g             348   5e-119   Phaseolus vulgaris [French bean]
gb|KHN38335.1|  60S ribosomal protein L18a                              348   5e-119   Glycine soja [wild soybean]
ref|XP_006363066.1|  PREDICTED: 60S ribosomal protein L18a-like         348   5e-119   Solanum tuberosum [potatoes]
ref|XP_010324737.1|  PREDICTED: 60S ribosomal protein L18a-like         348   5e-119   Solanum lycopersicum
gb|KDO51884.1|  hypothetical protein CISIN_1g030276mg                   348   6e-119   Citrus sinensis [apfelsine]
ref|XP_011074018.1|  PREDICTED: 60S ribosomal protein L18a-2-like       348   6e-119   Sesamum indicum [beniseed]
gb|KHG02356.1|  60S ribosomal L18a                                      347   1e-118   Gossypium arboreum [tree cotton]
ref|XP_011002051.1|  PREDICTED: 60S ribosomal protein L18a-like         347   1e-118   Populus euphratica
ref|XP_002528496.1|  60S ribosomal protein L18a, putative               347   1e-118   Ricinus communis
ref|XP_002300869.1|  60S ribosomal protein L18a-1                       347   1e-118   Populus trichocarpa [western balsam poplar]
ref|NP_001275234.1|  60S ribosomal protein L18a-like                    347   2e-118   Solanum tuberosum [potatoes]
gb|KHG16522.1|  60S ribosomal L18a                                      346   2e-118   Gossypium arboreum [tree cotton]
ref|XP_004134633.1|  PREDICTED: 60S ribosomal protein L18a              346   2e-118   Cucumis sativus [cucumbers]
ref|XP_010542333.1|  PREDICTED: 60S ribosomal protein L18a isofor...    346   3e-118   Tarenaya hassleriana [spider flower]
ref|XP_006437137.1|  hypothetical protein CICLE_v10032878mg             346   3e-118   
ref|XP_011659876.1|  PREDICTED: 60S ribosomal protein L18a              345   4e-118   Cucumis sativus [cucumbers]
ref|XP_009389413.1|  PREDICTED: 60S ribosomal protein L18a-like         346   4e-118   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU36633.1|  hypothetical protein MIMGU_mgv1a014793mg                345   5e-118   Erythranthe guttata [common monkey flower]
gb|KHG16962.1|  60S ribosomal L18a                                      345   5e-118   Gossypium arboreum [tree cotton]
ref|XP_007025105.1|  Ribosomal protein L18ae/LX family protein          345   5e-118   
ref|XP_006442292.1|  hypothetical protein CICLE_v10022114mg             347   6e-118   Citrus clementina [clementine]
ref|XP_008439644.1|  PREDICTED: 60S ribosomal protein L18a              345   6e-118   Cucumis melo [Oriental melon]
ref|XP_009406265.1|  PREDICTED: 60S ribosomal protein L18a              345   7e-118   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABB29925.1|  unknown                                                 345   7e-118   Solanum tuberosum [potatoes]
gb|EYU33348.1|  hypothetical protein MIMGU_mgv1a014797mg                345   8e-118   Erythranthe guttata [common monkey flower]
ref|XP_010538246.1|  PREDICTED: 60S ribosomal protein L18a-like         345   9e-118   Tarenaya hassleriana [spider flower]
ref|XP_012072093.1|  PREDICTED: 60S ribosomal protein L18a isofor...    345   1e-117   Jatropha curcas
ref|XP_008444078.1|  PREDICTED: 60S ribosomal protein L18a              344   1e-117   Cucumis melo [Oriental melon]
ref|XP_010655647.1|  PREDICTED: 60S ribosomal protein L18a isofor...    344   1e-117   Vitis vinifera
gb|ABK94361.1|  unknown                                                 344   2e-117   Populus trichocarpa [western balsam poplar]
gb|KHG29727.1|  60S ribosomal L18a                                      344   2e-117   Gossypium arboreum [tree cotton]
ref|XP_008789456.1|  PREDICTED: 60S ribosomal protein L18a-2            344   2e-117   Phoenix dactylifera
ref|XP_009399317.1|  PREDICTED: 60S ribosomal protein L18a-like         343   3e-117   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB42782.1|  hypothetical protein B456_007G174800                    343   3e-117   Gossypium raimondii
ref|XP_008811096.1|  PREDICTED: 60S ribosomal protein L18a              343   3e-117   Phoenix dactylifera
ref|NP_001237207.1|  uncharacterized protein LOC100527007               343   4e-117   
ref|XP_002276260.1|  PREDICTED: 60S ribosomal protein L18a              343   4e-117   Vitis vinifera
ref|XP_010924380.1|  PREDICTED: 60S ribosomal protein L18a              343   4e-117   Elaeis guineensis
ref|XP_007048983.1|  Ribosomal protein L18ae/LX family protein          343   4e-117   Theobroma cacao [chocolate]
ref|XP_009394206.1|  PREDICTED: 60S ribosomal protein L18a-like         343   5e-117   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008798296.1|  PREDICTED: 60S ribosomal protein L18a              343   5e-117   Phoenix dactylifera
ref|XP_007215058.1|  hypothetical protein PRUPE_ppa012231mg             342   7e-117   
ref|XP_010918885.1|  PREDICTED: 60S ribosomal protein L18a-like         342   1e-116   
ref|XP_008796386.1|  PREDICTED: 60S ribosomal protein L18a-like         342   1e-116   Phoenix dactylifera
gb|KHG26670.1|  60S ribosomal L18a                                      342   1e-116   Gossypium arboreum [tree cotton]
ref|XP_002268750.1|  PREDICTED: 60S ribosomal protein L18a              342   1e-116   Vitis vinifera
gb|KJB10614.1|  hypothetical protein B456_001G211400                    341   2e-116   Gossypium raimondii
ref|NP_001237679.1|  uncharacterized protein LOC100306365               341   2e-116   Glycine max [soybeans]
ref|XP_010552158.1|  PREDICTED: 60S ribosomal protein L18a              341   2e-116   Tarenaya hassleriana [spider flower]
gb|KJB57268.1|  hypothetical protein B456_009G155900                    341   3e-116   Gossypium raimondii
ref|XP_010540563.1|  PREDICTED: 60S ribosomal protein L18a              341   3e-116   Tarenaya hassleriana [spider flower]
gb|EYU43268.1|  hypothetical protein MIMGU_mgv1a013972mg                342   3e-116   Erythranthe guttata [common monkey flower]
ref|NP_001238728.1|  uncharacterized protein LOC100306174               341   3e-116   Glycine max [soybeans]
ref|XP_007136179.1|  hypothetical protein PHAVU_009G024800g             340   5e-116   Phaseolus vulgaris [French bean]
ref|XP_006410594.1|  hypothetical protein EUTSA_v10017304mg             340   5e-116   Eutrema salsugineum [saltwater cress]
gb|KJB69800.1|  hypothetical protein B456_011G042900                    340   6e-116   Gossypium raimondii
emb|CDX97587.1|  BnaA05g24920D                                          340   7e-116   
ref|NP_001236918.1|  uncharacterized protein LOC100500108               340   8e-116   Glycine max [soybeans]
ref|XP_004486036.1|  PREDICTED: 60S ribosomal protein L18a-like         340   8e-116   Cicer arietinum [garbanzo]
ref|XP_007212144.1|  hypothetical protein PRUPE_ppa012251mg             340   1e-115   Prunus persica
gb|KHG27228.1|  60S ribosomal L18a                                      339   1e-115   Gossypium arboreum [tree cotton]
gb|AFK44558.1|  unknown                                                 339   1e-115   Lotus japonicus
gb|AFK33651.1|  unknown                                                 338   2e-115   Lotus japonicus
sp|Q9ATF5.1|RL18A_CASSA  RecName: Full=60S ribosomal protein L18a       338   2e-115   Castanea sativa
ref|XP_009407842.1|  PREDICTED: 60S ribosomal protein L18a-like         338   3e-115   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFK40398.1|  unknown                                                 338   3e-115   Medicago truncatula
ref|XP_010263115.1|  PREDICTED: 60S ribosomal protein L18a-2            338   4e-115   Nelumbo nucifera [Indian lotus]
ref|XP_008371596.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    337   6e-115   Malus domestica [apple tree]
gb|AFK46978.1|  unknown                                                 337   2e-114   Lotus japonicus
emb|CDX79564.1|  BnaC03g19000D                                          336   2e-114   
ref|XP_008380196.1|  PREDICTED: 60S ribosomal protein L18a-2-like       336   2e-114   Malus domestica [apple tree]
ref|XP_009146339.1|  PREDICTED: 60S ribosomal protein L18a-2            336   2e-114   Brassica rapa
ref|XP_006407062.1|  hypothetical protein EUTSA_v10021546mg             336   3e-114   Eutrema salsugineum [saltwater cress]
emb|CDX75778.1|  BnaC03g38610D                                          338   6e-114   
ref|XP_009132991.1|  PREDICTED: 60S ribosomal protein L18a-2-like       335   6e-114   Brassica rapa
ref|XP_004488610.1|  PREDICTED: 60S ribosomal protein L18a-like i...    335   8e-114   Cicer arietinum [garbanzo]
ref|XP_006298665.1|  hypothetical protein CARUB_v10014756mg             334   1e-113   Capsella rubella
ref|XP_010052072.1|  PREDICTED: 60S ribosomal protein L18a-2-like...    339   1e-113   Eucalyptus grandis [rose gum]
ref|XP_011085620.1|  PREDICTED: 60S ribosomal protein L18a-like         333   2e-113   
gb|KFK36339.1|  hypothetical protein AALP_AA4G109800                    333   2e-113   Arabis alpina [alpine rockcress]
ref|XP_006841639.1|  PREDICTED: 60S ribosomal protein L18a              333   2e-113   Amborella trichopoda
ref|XP_010465351.1|  PREDICTED: 60S ribosomal protein L18a-3            333   2e-113   Camelina sativa [gold-of-pleasure]
ref|XP_009135390.1|  PREDICTED: 60S ribosomal protein L18a-2-like       333   3e-113   Brassica rapa
ref|XP_006595492.1|  PREDICTED: uncharacterized protein LOC100305...    352   3e-113   
ref|XP_004303886.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    333   4e-113   Fragaria vesca subsp. vesca
ref|XP_006467486.1|  PREDICTED: 60S ribosomal protein L18a-2-like...    338   4e-113   Citrus sinensis [apfelsine]
gb|KEH33554.1|  60S ribosomal protein L18a-3                            333   5e-113   Medicago truncatula
ref|XP_006601742.1|  PREDICTED: uncharacterized protein LOC100306...    333   5e-113   
ref|XP_010542335.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    337   6e-113   Tarenaya hassleriana [spider flower]
ref|XP_009141387.1|  PREDICTED: 60S ribosomal protein L18a-2            332   7e-113   Brassica rapa
ref|XP_006574359.1|  PREDICTED: uncharacterized protein LOC100527...    352   9e-113   
ref|XP_006295085.1|  hypothetical protein CARUB_v10024156mg             332   9e-113   Capsella rubella
ref|XP_003597433.1|  60S ribosomal protein L18a                         332   1e-112   
ref|XP_011628903.1|  PREDICTED: 60S ribosomal protein L18a              331   2e-112   Amborella trichopoda
ref|XP_004488609.1|  PREDICTED: 60S ribosomal protein L18a-like i...    331   2e-112   
ref|XP_008465452.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    350   3e-112   Cucumis melo [Oriental melon]
ref|XP_002519698.1|  60S ribosomal protein L18a, putative               335   4e-112   Ricinus communis
ref|NP_180995.1|  60S ribosomal protein L18a-2                          330   4e-112   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010504908.1|  PREDICTED: 60S ribosomal protein L18a-2            330   6e-112   Camelina sativa [gold-of-pleasure]
ref|XP_012072094.1|  PREDICTED: 60S ribosomal protein L18a isofor...    335   6e-112   Jatropha curcas
ref|XP_002276545.1|  PREDICTED: 60S ribosomal protein L18a isofor...    334   7e-112   Vitis vinifera
ref|XP_006407063.1|  hypothetical protein EUTSA_v10021546mg             330   1e-111   
ref|XP_008225468.1|  PREDICTED: 60S ribosomal protein L18a isofor...    334   1e-111   
ref|XP_009360876.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    334   1e-111   Pyrus x bretschneideri [bai li]
ref|XP_008371597.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    334   1e-111   Malus domestica [apple tree]
ref|XP_004303885.2|  PREDICTED: 60S ribosomal protein L18a-2 isof...    329   2e-111   Fragaria vesca subsp. vesca
gb|ABK26330.1|  unknown                                                 328   2e-111   Picea sitchensis
ref|XP_006484924.1|  PREDICTED: uncharacterized protein LOC102625748    349   2e-111   
ref|XP_010501986.1|  PREDICTED: 60S ribosomal protein L18a-3-like       328   3e-111   Camelina sativa [gold-of-pleasure]
ref|XP_010499515.1|  PREDICTED: 60S ribosomal protein L18a-1            328   4e-111   Camelina sativa [gold-of-pleasure]
ref|NP_188078.1|  60S ribosomal protein L18a-3                          328   4e-111   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44821.1|  hypothetical protein AALP_AA1G307200                    328   5e-111   Arabis alpina [alpine rockcress]
ref|XP_002440257.1|  hypothetical protein SORBIDRAFT_09g028590          327   7e-111   Sorghum bicolor [broomcorn]
ref|XP_008229704.1|  PREDICTED: uncharacterized protein LOC103329046    346   1e-110   Prunus mume [ume]
ref|XP_009109630.1|  PREDICTED: 60S ribosomal protein L18a-2            327   1e-110   Brassica rapa
ref|XP_002882886.1|  60S ribosomal protein L18A                         327   1e-110   
ref|NP_001056335.1|  Os05g0565000                                       327   1e-110   
gb|EMS54441.1|  60S ribosomal protein L18a                              326   2e-110   Triticum urartu
ref|XP_002449311.1|  hypothetical protein SORBIDRAFT_05g007540          326   2e-110   Sorghum bicolor [broomcorn]
gb|AAM65890.1|  putative 60S ribosomal protein L18A                     326   2e-110   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ85943.1|  predicted protein                                      326   3e-110   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT24993.1|  60S ribosomal protein L18a                              325   3e-110   
ref|XP_006654794.1|  PREDICTED: 60S ribosomal protein L18a-like         325   4e-110   Oryza brachyantha
ref|NP_001149475.1|  LOC100283101                                       325   5e-110   Zea mays [maize]
gb|ACG30921.1|  60S ribosomal protein L18a                              325   6e-110   Zea mays [maize]
ref|XP_010460775.1|  PREDICTED: 60S ribosomal protein L18a-1-like       325   6e-110   Camelina sativa [gold-of-pleasure]
ref|XP_010679799.1|  PREDICTED: 60S ribosomal protein L18a-2            324   8e-110   Beta vulgaris subsp. vulgaris [field beet]
gb|EMT07340.1|  60S ribosomal protein L18a                              324   8e-110   
ref|NP_001148024.1|  60S ribosomal protein L18a                         324   9e-110   Zea mays [maize]
ref|XP_006644488.1|  PREDICTED: 60S ribosomal protein L18a-like         324   1e-109   Oryza brachyantha
ref|XP_004969468.1|  PREDICTED: 60S ribosomal protein L18a-like         324   1e-109   Setaria italica
ref|XP_003567891.1|  PREDICTED: 60S ribosomal protein L18a-like         324   2e-109   Brachypodium distachyon [annual false brome]
ref|NP_001043805.2|  Os01g0666900                                       323   2e-109   
ref|XP_006415527.1|  hypothetical protein EUTSA_v10009933mg             328   2e-109   
gb|ACF78859.1|  unknown                                                 323   2e-109   Zea mays [maize]
gb|ACN28455.1|  unknown                                                 323   2e-109   Zea mays [maize]
ref|XP_004979031.1|  PREDICTED: 60S ribosomal protein L18a-like         323   4e-109   Setaria italica
ref|NP_001044264.1|  Os01g0752300                                       323   4e-109   
ref|NP_001152227.1|  60S ribosomal protein L18a                         322   5e-109   Zea mays [maize]
ref|XP_004491319.1|  PREDICTED: LOW QUALITY PROTEIN: probable asp...    340   1e-108   
ref|XP_003569521.1|  PREDICTED: 60S ribosomal protein L18a-like         322   1e-108   Brachypodium distachyon [annual false brome]
ref|XP_010940708.1|  PREDICTED: 60S ribosomal protein L18a-2-like       321   2e-108   Elaeis guineensis
emb|CDY35269.1|  BnaC03g59540D                                          321   3e-108   Brassica napus [oilseed rape]
ref|XP_010936051.1|  PREDICTED: 60S ribosomal protein L18a-2            320   4e-108   Elaeis guineensis
ref|XP_003617399.1|  60S ribosomal protein L18a                         338   5e-108   
ref|NP_849729.1|  ribosomal protein L18ae/LX family protein             320   6e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306031.1|  hypothetical protein CARUB_v10011327mg             323   3e-107   
ref|XP_010666370.1|  PREDICTED: 60S ribosomal protein L18a-like         318   4e-107   Beta vulgaris subsp. vulgaris [field beet]
gb|ACG47612.1|  60S ribosomal protein L18a                              316   2e-106   Zea mays [maize]
ref|XP_003569823.1|  PREDICTED: 60S ribosomal protein L18a              313   2e-105   Brachypodium distachyon [annual false brome]
ref|XP_004961208.1|  PREDICTED: 60S ribosomal protein L18a-like         319   3e-105   
ref|XP_010549484.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    318   3e-105   Tarenaya hassleriana [spider flower]
ref|NP_001152434.1|  LOC100286074                                       313   4e-105   
ref|XP_002893593.1|  60S ribosomal protein L18A-1                       316   1e-104   
ref|NP_001077626.1|  60S ribosomal protein L18a-1                       315   3e-104   Arabidopsis thaliana [mouse-ear cress]
gb|EEE55145.1|  hypothetical protein OsJ_02939                          309   1e-103   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB90499.1|  ribosomal protein L18a-like                            308   3e-103   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001762693.1|  predicted protein                                  308   3e-103   
ref|XP_009419339.1|  PREDICTED: 60S ribosomal protein L18a-like         306   7e-103   
ref|XP_001765218.1|  predicted protein                                  306   1e-102   
ref|XP_001752605.1|  predicted protein                                  305   4e-102   
pdb|3IZS|S  Chain S, Localization Of The Large Subunit Ribosomal ...    303   1e-101   Saccharomyces cerevisiae [brewer's yeast]
ref|XP_001760636.1|  predicted protein                                  303   3e-101   
gb|AAG52055.1|AC022455_9  60S ribosomal protein L18A, putative; 2...    307   8e-101   Arabidopsis thaliana [mouse-ear cress]
gb|ADU56180.1|  hypothetical protein                                    297   3e-99    Jatropha curcas
gb|AAT08714.1|  ribosomal protein L18A                                  296   1e-98    Hyacinthus orientalis [common hyacinth]
ref|XP_002961150.1|  hypothetical protein SELMODRAFT_227198             296   1e-98    Selaginella moellendorffii
ref|XP_011460183.1|  PREDICTED: 60S ribosomal protein L18a              296   1e-98    Fragaria vesca subsp. vesca
ref|XP_006387416.1|  hypothetical protein POPTR_1064s00200g             295   2e-98    
ref|XP_007146225.1|  hypothetical protein PHAVU_006G022700g             293   1e-97    Phaseolus vulgaris [French bean]
gb|KJB34967.1|  hypothetical protein B456_006G092900                    290   7e-97    Gossypium raimondii
emb|CDX98480.1|  BnaC05g38950D                                          290   1e-96    
ref|NP_001237792.1|  uncharacterized protein LOC100305604               290   1e-96    
gb|EYU33347.1|  hypothetical protein MIMGU_mgv1a014797mg                289   3e-96    Erythranthe guttata [common monkey flower]
gb|KJB10615.1|  hypothetical protein B456_001G211400                    288   1e-95    Gossypium raimondii
emb|CDX84313.1|  BnaC04g10750D                                          287   2e-95    
emb|CDX84643.1|  BnaA03g15870D                                          286   2e-95    
emb|CDX82474.1|  BnaA03g33470D                                          286   4e-95    
emb|CDY43672.1|  BnaA04g20190D                                          285   7e-95    Brassica napus [oilseed rape]
dbj|BAH20340.1|  AT3G14600                                              276   5e-91    Arabidopsis thaliana [mouse-ear cress]
ref|XP_005652280.1|  60S ribosomal protein L18a-2                       276   1e-90    Coccomyxa subellipsoidea C-169
ref|XP_005848088.1|  hypothetical protein CHLNCDRAFT_30965              273   2e-89    Chlorella variabilis
gb|KCW89757.1|  hypothetical protein EUGRSUZ_A02018                     269   6e-88    Eucalyptus grandis [rose gum]
gb|KIZ01204.1|  60S ribosomal protein L18a-2                            259   7e-84    Monoraphidium neglectum
gb|KJB69797.1|  hypothetical protein B456_011G042800                    257   8e-84    Gossypium raimondii
gb|KDD75676.1|  ribosomal protein L18ae/LX                              254   5e-82    Helicosporidium sp. ATCC 50920
ref|XP_011401286.1|  60S ribosomal protein L18a-2                       251   5e-81    Auxenochlorella protothecoides
gb|ERM96192.1|  hypothetical protein AMTR_s00001p00102800               249   5e-81    Amborella trichopoda
ref|XP_001689743.1|  ribosomal protein L18a, component of cytosol...    250   1e-80    Chlamydomonas reinhardtii
ref|XP_002948508.1|  ribosomal protein L18A component of cytosoli...    249   4e-80    Volvox carteri f. nagariensis
ref|XP_003617398.1|  60S ribosomal protein L18a                         246   2e-79    
ref|XP_006387717.1|  hypothetical protein POPTR_0647s00210g             245   5e-79    
ref|XP_007508296.1|  unknown                                            233   2e-73    Bathycoccus prasinos
ref|XP_001418811.1|  Ribosomal protein L18a, component of cytosol...    230   1e-72    Ostreococcus lucimarinus CCE9901
emb|CEF98555.1|  Ribosomal protein L18ae                                224   2e-70    Ostreococcus tauri
ref|XP_006384076.1|  60S ribosomal protein L18a-1                       222   2e-70    
gb|KDO49364.1|  hypothetical protein CISIN_1g028910mg                   222   2e-70    Citrus sinensis [apfelsine]
ref|XP_011648501.1|  PREDICTED: 60S ribosomal protein L18a-2-like       218   7e-69    Cucumis sativus [cucumbers]
ref|XP_003062312.1|  predicted protein                                  220   8e-69    Micromonas pusilla CCMP1545
ref|XP_008880083.1|  hypothetical protein H310_14105                    219   3e-68    Aphanomyces invadans
gb|ABQ42114.1|  60S ribosomal protein L18a                              214   2e-67    Sonneratia caseolaris
gb|ABQ42113.1|  60S ribosomal protein L18a                              213   4e-67    Sonneratia alba
emb|CBI30857.3|  unnamed protein product                                213   6e-67    Vitis vinifera
ref|XP_009831602.1|  hypothetical protein H257_07690                    213   3e-66    Aphanomyces astaci
ref|XP_008604133.1|  50S ribosomal protein L18Ae                        213   5e-66    Saprolegnia diclina VS20
ref|XP_002501229.1|  predicted protein                                  213   5e-66    Micromonas commoda
gb|AFW81143.1|  hypothetical protein ZEAMMB73_376835                    210   8e-66    
ref|XP_009144150.1|  PREDICTED: 60S ribosomal protein L18a-2-like       209   2e-65    
gb|ADV03035.1|  ribosomal protein L18A                                  211   3e-65    Karlodinium veneficum
gb|EMS66554.1|  60S ribosomal protein L18a                              210   3e-65    Triticum urartu
gb|ACS68696.1|  60S RPL18aB                                             201   3e-62    Sonneratia alba
gb|ACN30573.1|  unknown                                                 201   3e-62    Zea mays [maize]
gb|KFH68950.1|  60S ribosomal protein L20                               202   1e-61    Mortierella verticillata NRRL 6337
emb|CBN79653.1|  ribosomal protein L18                                  203   2e-61    Ectocarpus siliculosus
ref|XP_005702735.1|  60S ribosomal protein L18Ae                        199   1e-60    Galdieria sulphuraria
gb|EPZ32213.1|  60S ribosomal protein L20-B                             199   2e-60    Rozella allomycis CSF55
gb|KFH68928.1|  large subunit ribosomal protein L18Ae                   200   3e-60    Mortierella verticillata NRRL 6337
gb|KHN49096.1|  60S ribosomal protein L18a-2                            196   4e-60    Glycine soja [wild soybean]
gb|AGE89254.1|  60S ribosomal protein L18a                              197   6e-60    Cryptocaryon irritans
ref|XP_637982.2|  S60 ribosomal protein L18a                            195   3e-59    Dictyostelium discoideum AX4
ref|XP_009521845.1|  hypothetical protein PHYSODRAFT_354168             195   4e-59    Phytophthora sojae
ref|XP_005830017.1|  large subunit ribosomal protein L18Ae, cytop...    195   5e-59    Guillardia theta CCMP2712
gb|ADV03042.1|  ribosomal protein L18A                                  194   1e-58    Amphidinium carterae
dbj|GAM28311.1|  hypothetical protein SAMD00019534_114870               193   3e-58    Acytostelium subglobosum LB1
ref|XP_008897642.1|  hypothetical protein PPTG_05682                    193   4e-58    Phytophthora parasitica INRA-310
ref|XP_011653978.1|  PREDICTED: 60S ribosomal protein L18a-like         190   4e-58    Cucumis sativus [cucumbers]
ref|XP_002897608.1|  60S ribosomal protein L18a                         192   7e-58    Phytophthora infestans T30-4
ref|XP_003292885.1|  ribosomal protein L18a                             191   1e-57    Dictyostelium purpureum
gb|KFM72761.1|  60S ribosomal protein L18a                              191   2e-57    Stegodyphus mimosarum
ref|XP_002108947.1|  expressed hypothetical protein                     191   3e-57    Trichoplax adhaerens
gb|ACO51977.1|  60S ribosomal protein L18a                              191   3e-57    Rana catesbeiana [bullfrog]
ref|NP_001090206.1|  ribosomal protein L18a                             190   5e-57    Xenopus laevis [clawed frog]
ref|XP_001362363.1|  PREDICTED: 60S ribosomal protein L18a              190   5e-57    Monodelphis domestica
emb|CDY71447.1|  BnaAnng37490D                                          187   6e-57    Brassica napus [oilseed rape]
gb|AAH42256.1|  RPL18A protein                                          190   6e-57    Xenopus laevis [clawed frog]
ref|XP_004616713.1|  PREDICTED: 60S ribosomal protein L18a              189   8e-57    Sorex araneus [Eurasian shrew]
ref|XP_006633700.1|  PREDICTED: 60S ribosomal protein L18a-like         189   1e-56    Lepisosteus oculatus
gb|EHH59357.1|  hypothetical protein EGM_09444                          189   1e-56    Macaca fascicularis [crab eating macaque]
gb|ELK19170.1|  60S ribosomal protein L18a                              190   1e-56    Pteropus alecto
ref|XP_002783609.1|  60S ribosomal protein L18A-2, putative             189   2e-56    Perkinsus marinus ATCC 50983
ref|XP_006680278.1|  hypothetical protein BATDEDRAFT_17251              188   2e-56    Batrachochytrium dendrobatidis JAM81
gb|ACO51820.1|  60S ribosomal protein L18a                              188   2e-56    Rana catesbeiana [bullfrog]
ref|XP_005715079.1|  unnamed protein product                            189   2e-56    Chondrus crispus [carageen]
ref|NP_001016690.1|  ribosomal protein L18a                             187   6e-56    Xenopus tropicalis [western clawed frog]
ref|XP_005988719.1|  PREDICTED: 60S ribosomal protein L18a-like i...    187   6e-56    Latimeria chalumnae
ref|XP_005682245.1|  PREDICTED: 60S ribosomal protein L18a              187   7e-56    
emb|CDI83837.1|  60S ribosomal protein L18a, putative                   187   7e-56    Eimeria acervulina
ref|XP_007433473.1|  PREDICTED: 60S ribosomal protein L18a-like         187   8e-56    Python bivittatus
ref|XP_003413070.1|  PREDICTED: 60S ribosomal protein L18a              187   8e-56    Loxodonta africana [African bush elephant]
ref|XP_320252.4|  AGAP012284-PA                                         187   9e-56    Anopheles gambiae str. PEST
ref|XP_004761042.1|  PREDICTED: 60S ribosomal protein L18a isofor...    188   1e-55    
gb|KFB49813.1|  AGAP012284-PA-like protein                              186   1e-55    Anopheles sinensis
gb|EDL28885.1|  mCG14783, isoform CRA_a                                 187   1e-55    Mus musculus [mouse]
ref|XP_006035334.1|  PREDICTED: 60S ribosomal protein L18a-like         186   1e-55    Alligator sinensis
dbj|BAG34717.1|  unnamed protein product                                186   1e-55    Homo sapiens [man]
gb|AGH70166.1|  60S ribosomal protein L18a                              186   1e-55    Placozoa sp. H4
ref|XP_002808227.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    186   1e-55    
dbj|BAD96367.1|  ribosomal protein L18a variant                         186   1e-55    
ref|XP_006876351.1|  PREDICTED: 60S ribosomal protein L18a              186   1e-55    
ref|XP_003465225.2|  PREDICTED: 60S ribosomal protein L18a              186   2e-55    
ref|XP_001652207.1|  AAEL006785-PB                                      186   2e-55    
ref|XP_005604175.1|  PREDICTED: 60S ribosomal protein L18a              188   2e-55    
ref|NP_000971.1|  60S ribosomal protein L18a                            186   2e-55    
emb|CBK25105.2|  unnamed protein product                                186   2e-55    
ref|XP_533877.1|  PREDICTED: 60S ribosomal protein L18a isoform 1       186   2e-55    
ref|XP_005409607.1|  PREDICTED: 60S ribosomal protein L18a              186   2e-55    
gb|KFV71518.1|  60S ribosomal protein L18a                              186   2e-55    
gb|ELR54862.1|  60S ribosomal protein L18a                              186   2e-55    
ref|XP_005303239.1|  PREDICTED: 60S ribosomal protein L18a              186   2e-55    
gb|ELK32292.1|  60S ribosomal protein L18a                              186   2e-55    
ref|XP_005588457.1|  PREDICTED: 60S ribosomal protein L18a isofor...    186   2e-55    
ref|XP_006898371.1|  PREDICTED: 60S ribosomal protein L18a-like         186   2e-55    
ref|NP_997675.1|  60S ribosomal protein L18a                            186   2e-55    
ref|XP_416064.3|  PREDICTED: 60S ribosomal protein L18a                 186   2e-55    
gb|EDL28886.1|  mCG14783, isoform CRA_b                                 186   2e-55    
gb|KIK92807.1|  hypothetical protein PAXRUDRAFT_13013                   185   2e-55    
ref|XP_005654963.1|  PREDICTED: 60S ribosomal protein L18a isofor...    186   3e-55    
sp|Q8WQI7.1|RL18A_SPOFR  RecName: Full=60S ribosomal protein L18a       186   3e-55    
ref|XP_008822798.1|  PREDICTED: 60S ribosomal protein L18a isofor...    186   3e-55    
ref|NP_957354.1|  60S ribosomal protein L18a                            185   3e-55    
ref|NP_001291810.1|  ribosomal protein L18a                             185   3e-55    
ref|XP_005499868.1|  PREDICTED: 60S ribosomal protein L18a-like         185   3e-55    
gb|EFB19107.1|  hypothetical protein PANDA_000535                       185   3e-55    
gb|KIY70561.1|  60S ribosomal protein L18A                              185   3e-55    
ref|XP_011949759.1|  PREDICTED: 60S ribosomal protein L18a isofor...    185   3e-55    
gb|KFP08674.1|  60S ribosomal protein L18a                              185   3e-55    
gb|EMC81423.1|  60S ribosomal protein L18a                              185   3e-55    
gb|EJY71843.1|  60S ribosomal protein L18a-1                            185   4e-55    
ref|XP_004423023.1|  PREDICTED: 60S ribosomal protein L18a              185   4e-55    
gb|KFV06361.1|  60S ribosomal protein L18a                              185   4e-55    
ref|XP_006890332.1|  PREDICTED: 60S ribosomal protein L18a-like         185   4e-55    
gb|AAV90708.1|  60S ribosomal protein L18a                              185   4e-55    
ref|XP_007116964.1|  PREDICTED: 60S ribosomal protein L18a              185   5e-55    
ref|XP_001614192.1|  60S ribosomal protein L18a                         185   5e-55    
ref|XP_006894400.1|  PREDICTED: 60S ribosomal protein L18a-like         185   5e-55    
ref|XP_005370652.1|  PREDICTED: 60S ribosomal protein L18a              184   6e-55    
emb|CEG71682.1|  Putative 60S ribosomal protein L20                     184   6e-55    
ref|NP_001037219.1|  ribosomal protein L18A                             184   6e-55    
gb|EHH29801.1|  hypothetical protein EGK_10314                          184   6e-55    
ref|XP_006887480.1|  PREDICTED: 60S ribosomal protein L18a-like         184   6e-55    
gb|EFA83144.1|  S60 ribosomal protein L18a                              184   6e-55    
ref|XP_005972333.1|  PREDICTED: 60S ribosomal protein L18a              184   6e-55    
gb|KKA25011.1|  60S ribosomal protein L20                               184   6e-55    
emb|CDH57447.1|  60s ribosomal protein l20                              184   7e-55    
ref|XP_005444139.1|  PREDICTED: 60S ribosomal protein L18a-like         186   7e-55    
ref|XP_009038926.1|  hypothetical protein AURANDRAFT_60205              184   7e-55    
ref|XP_007313367.1|  hypothetical protein SERLADRAFT_456475             184   7e-55    
gb|KFV79623.1|  60S ribosomal protein L18a                              184   7e-55    
gb|KFP71409.1|  60S ribosomal protein L18a                              184   7e-55    
gb|KFM08760.1|  60S ribosomal protein L18a                              184   7e-55    
ref|XP_004991000.1|  ribosomal protein L18a                             184   8e-55    
gb|KFO58423.1|  60S ribosomal protein L18a                              184   8e-55    
ref|XP_001245490.1|  60S ribosomal protein L20                          184   8e-55    
gb|AAI61335.1|  LOC549444 protein                                       184   8e-55    
ref|XP_002187596.1|  PREDICTED: 60S ribosomal protein L18a-like i...    184   8e-55    
ref|XP_008950341.1|  PREDICTED: 60S ribosomal protein L18a-like         184   9e-55    
ref|XP_005148123.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    184   9e-55    
ref|XP_004277609.1|  PREDICTED: 60S ribosomal protein L18a              184   9e-55    
gb|AEL28892.1|  ribosomal protein L18A                                  184   1e-54    
gb|KDQ60389.1|  hypothetical protein JAAARDRAFT_126134                  184   1e-54    
ref|XP_628224.1|  60S ribosomal protein L18A                            184   1e-54    
ref|XP_011845447.1|  PREDICTED: 60S ribosomal protein L18a isofor...    186   1e-54    
ref|XP_007611098.1|  PREDICTED: 60S ribosomal protein L18a isofor...    184   1e-54    
gb|KIJ91891.1|  hypothetical protein K443DRAFT_114419                   184   1e-54    
ref|XP_007636083.1|  PREDICTED: 60S ribosomal protein L18a isofor...    184   1e-54    
emb|CDO75758.1|  hypothetical protein BN946_scf184921.g34               184   1e-54    
ref|XP_005480619.1|  PREDICTED: 60S ribosomal protein L18a-like         184   1e-54    
ref|XP_003123559.3|  PREDICTED: 60S ribosomal protein L18a isoformX1    185   1e-54    
emb|CDS14547.1|  Putative 60S ribosomal protein L20                     184   1e-54    
ref|XP_007415007.1|  hypothetical protein MELLADRAFT_72927              184   1e-54    
emb|CDS03349.1|  Putative 60S ribosomal protein L20                     184   1e-54    
gb|EIF45355.1|  60s ribosomal protein l20                               184   1e-54    
ref|XP_004200777.1|  Piso0_003381                                       184   1e-54    
ref|XP_004873387.1|  PREDICTED: 60S ribosomal protein L18a              184   1e-54    
ref|XP_003898411.1|  PREDICTED: 60S ribosomal protein L18a-like         184   1e-54    
gb|ADT80712.1|  ribosomal protein L18A                                  184   2e-54    
gb|KIL64760.1|  hypothetical protein M378DRAFT_77817                    183   2e-54    
ref|XP_002779521.1|  60S ribosomal protein L18A-2, putative             183   2e-54    
gb|KJA26912.1|  hypothetical protein HYPSUDRAFT_132230                  183   2e-54    
gb|KFR06619.1|  60S ribosomal protein L18a                              183   2e-54    
ref|XP_004277364.1|  PREDICTED: 60S ribosomal protein L18a-like         183   2e-54    
gb|ADX97197.1|  60S ribosomal protein l18a                              183   2e-54    
ref|XP_006886772.1|  PREDICTED: 60S ribosomal protein L18a-like         183   2e-54    
ref|XP_006886145.1|  PREDICTED: 60S ribosomal protein L18a-like         183   2e-54    
ref|XP_008109288.1|  PREDICTED: 60S ribosomal protein L18a              183   2e-54    
ref|XP_008508109.1|  PREDICTED: 60S ribosomal protein L18a isofor...    183   2e-54    
gb|EDL39919.1|  mCG14017                                                183   2e-54    
ref|XP_011203338.1|  PREDICTED: 60S ribosomal protein L18a              183   2e-54    
ref|XP_001882521.1|  60S ribosomal protein L20                          182   3e-54    
gb|EAW97746.1|  hCG2015272                                              183   3e-54    
gb|KDR72699.1|  hypothetical protein GALMADRAFT_142989                  182   3e-54    
gb|ERS97659.1|  60S ribosomal protein L20                               183   3e-54    
gb|KJP86891.1|  hypothetical protein AK88_03505                         183   3e-54    
ref|XP_006889246.1|  PREDICTED: 60S ribosomal protein L18a-like         182   3e-54    
ref|XP_007867854.1|  60S ribosomal protein L18A                         182   3e-54    
emb|CDR47151.1|  CYFA0S29e00936g1_1                                     182   3e-54    
gb|AAR09828.1|  similar to Drosophila melanogaster RpL18A               182   4e-54    
ref|XP_003383990.1|  PREDICTED: 60S ribosomal protein L18a-like         182   4e-54    
ref|XP_007874905.1|  hypothetical protein PNEG_02868                    182   4e-54    
gb|EYE94501.1|  ribosomal protein L18ae                                 182   4e-54    
gb|KIK23334.1|  hypothetical protein PISMIDRAFT_679451                  182   4e-54    
ref|XP_011177993.1|  PREDICTED: 60S ribosomal protein L18a              182   4e-54    
ref|NP_523774.1|  ribosomal protein L18A                                182   4e-54    
gb|ERE89015.1|  60S ribosomal protein L18a-like protein                 183   4e-54    
emb|CAQ37750.1|  60S ribosomal protein L18a                             182   5e-54    
ref|XP_001960744.1|  GF13512                                            182   5e-54    
ref|XP_002469001.1|  60S ribosomal protein L18A                         182   5e-54    
ref|XP_001839657.1|  60S ribosomal protein L20                          182   5e-54    
gb|EUC60950.1|  60S ribosomal protein L20                               182   5e-54    
gb|KIJ04866.1|  hypothetical protein PAXINDRAFT_159230                  182   5e-54    
gb|KIO01130.1|  hypothetical protein M404DRAFT_1003406                  182   5e-54    
gb|KDQ32854.1|  hypothetical protein PLEOSDRAFT_1051744                 182   6e-54    
ref|XP_004520736.1|  PREDICTED: 60S ribosomal protein L18a-like         182   6e-54    
ref|XP_007394375.1|  hypothetical protein PHACADRAFT_253712             182   7e-54    
dbj|BAE40206.1|  unnamed protein product                                182   7e-54    
ref|XP_006882833.1|  PREDICTED: 60S ribosomal protein L18a-like         182   7e-54    
ref|XP_002006863.1|  GI21298                                            182   8e-54    
ref|XP_002063423.1|  GK21403                                            182   9e-54    
gb|ACY95363.1|  ribosomal protein L18A                                  182   9e-54    
ref|XP_004417384.1|  PREDICTED: 60S ribosomal protein L18a-like         181   9e-54    
ref|XP_008815720.1|  50S ribosomal protein L18Ae                        182   9e-54    
ref|XP_007303851.1|  60S ribosomal protein L20                          181   9e-54    
dbj|BAC56406.1|  similar to ribosomal protein L18a                      181   1e-53    
ref|XP_003976423.1|  PREDICTED: 60S ribosomal protein L18a              181   1e-53    
ref|XP_006464014.1|  hypothetical protein AGABI2DRAFT_194625            181   1e-53    
emb|CAF89492.1|  unnamed protein product                                181   1e-53    
ref|XP_003672513.1|  ribosomal protein L20                              181   1e-53    
ref|XP_002365367.1|  60S ribosomal protein L18a, putative               181   1e-53    
dbj|BAJ93879.1|  predicted protein                                      181   1e-53    
ref|XP_002599714.1|  hypothetical protein BRAFLDRAFT_116402             181   1e-53    
ref|XP_003029116.1|  60S ribosomal protein L20                          181   1e-53    
dbj|BAN20250.1|  hypothetical protein                                   181   1e-53    
emb|CCA22335.1|  60S ribosomal protein L18a putative                    194   1e-53    
ref|XP_011274808.1|  60S ribosomal protein L18a                         181   1e-53    
ref|XP_004087014.1|  PREDICTED: 60S ribosomal protein L18a              181   1e-53    
emb|CCI45297.1|  unnamed protein product                                195   1e-53    
ref|XP_004365311.1|  ribosomal protein L18ae                            181   2e-53    
gb|EPS96483.1|  hypothetical protein FOMPIDRAFT_1025390                 181   2e-53    
gb|EIE90718.1|  60S ribosomal protein L18ae                             181   2e-53    
gb|AFK10877.1|  60S ribosomal protein L18a-like protein                 181   2e-53    
gb|ESW95865.1|  60S ribosomal protein L20-A                             181   2e-53    
gb|AFM89633.1|  60S ribosomal protein L18a-like protein                 181   2e-53    
gb|ABR27953.1|  60S ribosomal protein L18a                              181   2e-53    
gb|EIE86590.1|  60S ribosomal protein L18ae                             181   2e-53    
gb|EGU11460.1|  60S ribosomal protein L20A                              181   2e-53    
ref|XP_003233919.1|  60S ribosomal protein L20                          181   2e-53    
emb|CAA88652.1|  unknown                                                181   2e-53    
gb|EZF34867.1|  60S ribosomal protein L20                               181   2e-53    
gb|EGE06819.1|  Ribosomal L18ae family protein                          181   2e-53    
gb|KIH90052.1|  60S ribosomal protein l20                               184   2e-53    
gb|EHN05474.1|  Rpl20bp                                                 181   2e-53    
gb|KIK70034.1|  hypothetical protein GYMLUDRAFT_34471                   180   2e-53    
ref|XP_004223603.1|  60S ribosomal protein L18a                         181   2e-53    
ref|XP_008313517.1|  PREDICTED: 60S ribosomal protein L18a              180   3e-53    
ref|XP_004384453.1|  PREDICTED: 60S ribosomal protein L18a              180   3e-53    
gb|EHN00058.1|  Rpl20bp                                                 181   3e-53    
gb|KIW08808.1|  60S ribosomal protein L20-B                             181   3e-53    
gb|AAN52374.1|  ribosomal protein L18a                                  180   3e-53    
ref|XP_002142084.1|  60S ribosomal protein L18a                         181   3e-53    
gb|AJS98744.1|  Rpl20ap                                                 180   3e-53    
gb|EGD98622.1|  60S ribosomal protein L18A                              181   3e-53    
ref|NP_013969.3|  ribosomal 60S subunit protein L20A                    180   3e-53    
ref|XP_010896328.1|  PREDICTED: 60S ribosomal protein L18a              180   3e-53    
ref|XP_005174872.1|  PREDICTED: 60S ribosomal protein L18a              180   3e-53    
gb|AAP20183.1|  ribosomal protein L18a                                  180   3e-53    
emb|CAA62167.1|  orf 06116                                              180   3e-53    
dbj|BAF98666.1|  ribosomal protein L18a                                 180   4e-53    
ref|NP_001284617.1|  60S ribosomal protein L18a                         180   4e-53    
ref|XP_007772738.1|  60S ribosomal protein L18A                         180   4e-53    
gb|AFK43985.1|  unknown                                                 180   4e-53    
ref|XP_005097851.1|  PREDICTED: 60S ribosomal protein L18a-like         180   4e-53    
ref|XP_008882849.1|  ribosomal protein RPL18A                           180   4e-53    
gb|KIM74091.1|  hypothetical protein PILCRDRAFT_99202                   179   4e-53    
ref|NP_001187046.1|  60S ribosomal protein L18a                         180   4e-53    
ref|NP_001279187.1|  ribosomal protein L18a                             180   4e-53    
dbj|BAH28893.1|  ribosomal protein L18a                                 180   4e-53    
ref|XP_007540776.1|  PREDICTED: 60S ribosomal protein L18a              180   4e-53    
ref|XP_007791911.1|  putative 60s ribosomal protein l20 protein         179   5e-53    
ref|XP_003448789.1|  PREDICTED: 60S ribosomal protein L18a-like         179   5e-53    
ref|XP_003022051.1|  hypothetical protein TRV_03792                     180   5e-53    
gb|AAX62413.1|  ribosomal protein L18a                                  179   5e-53    
gb|AFM90776.1|  60S ribosomal protein L18a-like protein                 179   6e-53    
dbj|BAM17719.1|  ribosomal protein L18A                                 179   6e-53    
ref|XP_005809747.1|  PREDICTED: 60S ribosomal protein L18a-like         179   6e-53    
dbj|GAM38126.1|  ribosomal L18ae protein family protein                 180   6e-53    
ref|XP_005242188.1|  PREDICTED: uncharacterized protein LOC101921474    186   6e-53    
ref|XP_003656447.1|  60S ribosomal protein L20                          179   6e-53    
gb|EJT44404.1|  RPL20A-like protein                                     181   6e-53    
gb|KIM56681.1|  hypothetical protein SCLCIDRAFT_1220115                 179   6e-53    
gb|KIJ63802.1|  hypothetical protein HYDPIDRAFT_91738                   179   7e-53    
gb|EHN00736.1|  Rpl20bp                                                 181   7e-53    
gb|EDN64179.1|  ribosomal protein L20A                                  179   7e-53    
emb|CDR97128.1|  60S ribosomal protein L18ae, putative                  179   7e-53    
emb|CEG68118.1|  Putative 60S ribosomal protein L20                     179   7e-53    
ref|XP_001360626.1|  GA19650                                            179   7e-53    
emb|CCM00446.1|  predicted protein                                      180   7e-53    
ref|XP_011349291.1|  PREDICTED: 60S ribosomal protein L18a-like         179   8e-53    
gb|EZA47602.1|  60S ribosomal protein L18a                              179   8e-53    
ref|XP_448543.1|  60S ribosomal protein L20                             179   8e-53    
ref|XP_007235111.1|  PREDICTED: 60S ribosomal protein L18a-like         179   8e-53    
ref|XP_003670112.1|  ribosomal protein L20                              179   9e-53    
gb|KIP09725.1|  hypothetical protein PHLGIDRAFT_28839                   179   9e-53    
ref|XP_003707868.1|  PREDICTED: 60S ribosomal protein L18a              179   1e-52    
ref|XP_001935145.1|  60S ribosomal protein L20                          179   1e-52    
gb|KDN45848.1|  hypothetical protein RSAG8_04681                        180   1e-52    
ref|XP_003297118.1|  60S ribosomal protein L20                          179   1e-52    
gb|AFM87509.1|  60S ribosomal protein L18a-like protein                 179   1e-52    
ref|XP_001265211.1|  60S ribosomal protein L20                          179   1e-52    
gb|AFM87268.1|  60S ribosomal protein L18a-like protein                 179   1e-52    
ref|XP_003923253.1|  PREDICTED: 60S ribosomal protein L18a              179   1e-52    
emb|CCG80842.1|  Ribosomal L18ae protein family                         179   1e-52    
ref|XP_393322.1|  PREDICTED: 60S ribosomal protein L18a                 179   1e-52    
ref|XP_003393070.1|  PREDICTED: 60S ribosomal protein L18a-like         179   1e-52    
ref|XP_008213453.1|  PREDICTED: 60S ribosomal protein L18a-like i...    179   1e-52    
ref|XP_011065620.1|  PREDICTED: 60S ribosomal protein L18a              178   1e-52    
gb|EHJ65723.1|  ribosomal protein L18A                                  178   1e-52    
ref|XP_007848531.1|  60s ribosomal protein l20                          178   1e-52    
gb|AAI67657.1|  Unknown (protein for IMAGE:7718161)                     178   1e-52    



>ref|XP_009609142.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana tomentosiformis]
 ref|XP_009627827.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana tomentosiformis]
 ref|XP_009592293.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana tomentosiformis]
 ref|XP_009757479.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana sylvestris]
 ref|XP_009757480.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana sylvestris]
Length=178

 Score =   354 bits (908),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVTY+FHQYQVVGRALPTE DEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKK+NGQ+
Sbjct  1    MVTYKFHQYQVVGRALPTENDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF +SKIKFPLVFKKVRPPSRKLKTTYKA+RPNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKATRPNLFM  178



>ref|XP_009799848.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana sylvestris]
Length=178

 Score =   353 bits (905),  Expect = 5e-121, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV Y+FHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKK+NGQ+
Sbjct  1    MVNYKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF +SKIKFPLVFKKVRPPSRKLKTTYKA+RPNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKATRPNLFM  178



>gb|ADE42972.1| putative 60S ribosomal protein L18a [Gardenia jasminoides]
Length=178

 Score =   353 bits (905),  Expect = 6e-121, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV YRFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVNYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR+
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRY  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTAT+PAKLCKRESTKQF NSKI+FPLVFKKVRPPSRKLKTTYKASRPNLF+
Sbjct  121  HCIQIIKTATVPAKLCKRESTKQFHNSKIRFPLVFKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_006387417.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 ref|XP_011009656.1| PREDICTED: 60S ribosomal protein L18a [Populus euphratica]
 gb|ABK93213.1| unknown [Populus trichocarpa]
 gb|ABK94632.1| unknown [Populus trichocarpa]
 gb|ERP46331.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=178

 Score =   352 bits (903),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 168/178 (94%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPTE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  178



>ref|NP_001275252.1| uncharacterized protein LOC102577837 [Solanum tuberosum]
 ref|XP_004233112.1| PREDICTED: 60S ribosomal protein L18a-2 [Solanum lycopersicum]
 ref|XP_010316931.1| PREDICTED: 60S ribosomal protein L18a-2 [Solanum lycopersicum]
 gb|ABA46783.1| unknown [Solanum tuberosum]
Length=178

 Score =   352 bits (903),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVTY+FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVTYKFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRH  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF +SKIKFPLVFKKVRPPSRKLKTTYKA++PNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKATKPNLFM  178



>ref|XP_009782492.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana sylvestris]
Length=178

 Score =   352 bits (903),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVTY+FHQYQVVGRALPTE DEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKK+NGQ+
Sbjct  1    MVTYKFHQYQVVGRALPTENDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRH  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF +SKIKFPLVFKKVRPPSRKLKTTYKA+RPNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKATRPNLFM  178



>ref|XP_011071121.1| PREDICTED: 60S ribosomal protein L18a [Sesamum indicum]
Length=178

 Score =   352 bits (903),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVTY+FHQYQVVGR LPTETDEHP+IYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVTYKFHQYQVVGRGLPTETDEHPRIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF +SKIKFPLVF+KVRPP+RKLKTTYKASRPNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFRKVRPPTRKLKTTYKASRPNLFM  178



>emb|CDP06299.1| unnamed protein product [Coffea canephora]
Length=178

 Score =   352 bits (902),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV YRFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVNYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR+
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRY  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTAT+PAKLCKRESTKQF NSKI+FPLVFKKVRPPSRKLKTTYKAS+PNLF+
Sbjct  121  HCIQIIKTATVPAKLCKRESTKQFHNSKIRFPLVFKKVRPPSRKLKTTYKASKPNLFM  178



>ref|XP_009598886.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana tomentosiformis]
Length=178

 Score =   351 bits (900),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV Y+FHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKK+NGQ+
Sbjct  1    MVNYKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIK ATIPAKLCKRESTKQF +SKIKFPLVFKKVRPPSRKLKTTYKA+RPNLF+
Sbjct  121  HCIQIIKIATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKATRPNLFM  178



>gb|KCW75929.1| hypothetical protein EUGRSUZ_D00304 [Eucalyptus grandis]
Length=255

 Score =   353 bits (906),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 167/184 (91%), Positives = 176/184 (96%), Gaps = 0/184 (0%)
 Frame = +1

Query  58   VQLVEKMVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVK  237
            + L  +MVT+RFHQYQVVGRALPT  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVK
Sbjct  72   LPLASEMVTFRFHQYQVVGRALPTGADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVK  131

Query  238  KANGQVLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMAS  417
            K+NGQVLAINEIFEKNPTKINNYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMAS
Sbjct  132  KSNGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMAS  191

Query  418  RHRVRHHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRP  597
            RHRVR  CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLVFKKVRPP+RKLKTTYKASRP
Sbjct  192  RHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRP  251

Query  598  NLFV  609
            NLF+
Sbjct  252  NLFM  255



>gb|KCW89756.1| hypothetical protein EUGRSUZ_A02018 [Eucalyptus grandis]
Length=213

 Score =   352 bits (902),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPT +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  36   MVTFRFHQYQVVGRALPTGSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  95

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKINNYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  96   LAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  155

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLVFKKVRPP+RKLKTTYKASRPNLF+
Sbjct  156  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  213



>ref|XP_004241806.1| PREDICTED: 60S ribosomal protein L18a [Solanum lycopersicum]
Length=178

 Score =   350 bits (898),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT++FHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVTFKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEK PTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF +SKIKFPLVFKKVRPPSRKLKTTYKA++PNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKATKPNLFM  178



>ref|XP_011096544.1| PREDICTED: 60S ribosomal protein L18a-like [Sesamum indicum]
Length=178

 Score =   350 bits (897),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVTY+FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVTYKFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNG+VEQMYTEMASRHRVR+
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGSVEQMYTEMASRHRVRY  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF +SKIKFPLVF+KVRPP+RKLKTTYKA+RPNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFRKVRPPTRKLKTTYKATRPNLFM  178



>ref|XP_010053843.1| PREDICTED: 60S ribosomal protein L18a [Eucalyptus grandis]
Length=178

 Score =   350 bits (897),  Expect = 9e-120, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPT +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRFHQYQVVGRALPTGSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKINNYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLVFKKVRPP+RKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_011009655.1| PREDICTED: 60S ribosomal protein L18a-2 [Populus euphratica]
 ref|XP_011009657.1| PREDICTED: 60S ribosomal protein L18a-2 [Populus euphratica]
Length=178

 Score =   349 bits (896),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M T+RFHQYQVVGRALPTE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MGTFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  178



>gb|ABK92715.1| unknown [Populus trichocarpa]
Length=178

 Score =   349 bits (896),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/178 (94%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPT +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRFHQYQVVGRALPTGSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_006477944.1| PREDICTED: 60S ribosomal protein L18a-like isoform X1 [Citrus 
sinensis]
 gb|KDO49363.1| hypothetical protein CISIN_1g028910mg [Citrus sinensis]
Length=202

 Score =   350 bits (898),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 167/182 (92%), Positives = 175/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  64   LVEKMVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKA  243
            L  KMVT+RFHQYQVVGRALPTE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+
Sbjct  21   LGGKMVTFRFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  80

Query  244  NGQVLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH  423
            NGQ+LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRH
Sbjct  81   NGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRH  140

Query  424  RVRHHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNL  603
            RVR  CIQII+TATIPAKLCKRESTKQF NSKIKFPLVFKKVRPP+RKLKTTYKASRPNL
Sbjct  141  RVRSPCIQIIRTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNL  200

Query  604  FV  609
            F+
Sbjct  201  FM  202



>ref|XP_010052071.1| PREDICTED: 60S ribosomal protein L18a-like isoform X1 [Eucalyptus 
grandis]
Length=178

 Score =   349 bits (895),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPT  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRFHQYQVVGRALPTGADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKINNYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLVFKKVRPP+RKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_002317384.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 gb|ABK93710.1| unknown [Populus trichocarpa]
 gb|EEE97996.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=178

 Score =   349 bits (895),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPT++DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRFHQYQVVGRALPTQSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  178



>ref|NP_001275107.1| 60S ribosomal protein L18a-like [Solanum tuberosum]
 gb|AFX66998.1| 60S ribosomal protein L18a [Solanum tuberosum]
Length=178

 Score =   348 bits (894),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 175/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT++FHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVTFKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEK PTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF +SKIKFPLVFKKVRPP+RKLKTTYKA++PNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYKATKPNLFM  178



>ref|XP_007159262.1| hypothetical protein PHAVU_002G223200g [Phaseolus vulgaris]
 gb|ESW31256.1| hypothetical protein PHAVU_002G223200g [Phaseolus vulgaris]
Length=178

 Score =   348 bits (894),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPTE D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKINNYG+WLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKK+RPPSRKLKTTYKA +PNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKIRPPSRKLKTTYKAKKPNLFM  178



>ref|XP_006449674.1| hypothetical protein CICLE_v10016900mg [Citrus clementina]
 ref|XP_006467485.1| PREDICTED: 60S ribosomal protein L18a-2-like isoform X1 [Citrus 
sinensis]
 gb|ESR62914.1| hypothetical protein CICLE_v10016900mg [Citrus clementina]
 gb|KDO78150.1| hypothetical protein CISIN_1g035537mg [Citrus sinensis]
Length=178

 Score =   348 bits (893),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPTE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVF+KVRPPSRKL+TTYKA+RPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLRTTYKATRPNLFM  178



>ref|XP_007147889.1| hypothetical protein PHAVU_006G163400g [Phaseolus vulgaris]
 gb|ESW19883.1| hypothetical protein PHAVU_006G163400g [Phaseolus vulgaris]
Length=178

 Score =   348 bits (892),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPTE D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKINNYG+WLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKK+RPPSRKLKTTYKA +PNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKIRPPSRKLKTTYKAKKPNLFM  178



>gb|KHN38335.1| 60S ribosomal protein L18a [Glycine soja]
Length=178

 Score =   348 bits (892),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV  RFHQYQVVGRALPTE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVAMRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+NPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVRH
Sbjct  61   LAINEIFERNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASRHRVRH  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKKVRPP+RKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_006363066.1| PREDICTED: 60S ribosomal protein L18a-like [Solanum tuberosum]
Length=178

 Score =   348 bits (892),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV Y+FHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVNYKFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEK PTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF +SKIKFPLVFKK+RPPSRKLKTTYKA++PNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKIRPPSRKLKTTYKATKPNLFM  178



>ref|XP_010324737.1| PREDICTED: 60S ribosomal protein L18a-like [Solanum lycopersicum]
Length=178

 Score =   348 bits (892),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVTY+FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVTYKFHQYQVVGRALPSENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEK PTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRH  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF +SKIKFPLVFKKVRPPSRKLKTTYKA++PNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKATKPNLFM  178



>gb|KDO51884.1| hypothetical protein CISIN_1g030276mg [Citrus sinensis]
Length=180

 Score =   348 bits (892),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 164/179 (92%), Positives = 174/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  73   KMVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQ  252
            +MVT+RFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKK+NGQ
Sbjct  2    RMVTFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQ  61

Query  253  VLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  432
            VLAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR
Sbjct  62   VLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVR  121

Query  433  HHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
              CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVF+KVRPP+RKL+TTYKASRPNLF+
Sbjct  122  SPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLRTTYKASRPNLFM  180



>ref|XP_011074018.1| PREDICTED: 60S ribosomal protein L18a-2-like [Sesamum indicum]
Length=178

 Score =   348 bits (892),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  YRF QYQVVGRALPTET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MAIYRFRQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF +SKIKFPLVF+KVRPP+RKLKTTYKASRPNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFRKVRPPTRKLKTTYKASRPNLFM  178



>gb|KHG02356.1| 60S ribosomal L18a [Gossypium arboreum]
 gb|KJB34966.1| hypothetical protein B456_006G092900 [Gossypium raimondii]
Length=178

 Score =   347 bits (890),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPTE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRFHQYQVVGRALPTENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKR+STKQF NSKIKFPLVFKKVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_011002051.1| PREDICTED: 60S ribosomal protein L18a-like [Populus euphratica]
Length=178

 Score =   347 bits (890),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPT++DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRFHQYQVVGRALPTQSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKKVRPPSRKLKTTY ASRPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYNASRPNLFM  178



>ref|XP_002528496.1| 60S ribosomal protein L18a, putative [Ricinus communis]
 gb|EEF33913.1| 60S ribosomal protein L18a, putative [Ricinus communis]
Length=178

 Score =   347 bits (890),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPTE D+HPKIYRMKLW+TNEVRAKSKFWYFLRKLKKVK++NGQV
Sbjct  1    MVTFRFHQYQVVGRALPTENDDHPKIYRMKLWSTNEVRAKSKFWYFLRKLKKVKRSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEK+PTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF+
Sbjct  121  SCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_002300869.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 ref|XP_011026230.1| PREDICTED: 60S ribosomal protein L18a-like [Populus euphratica]
 gb|ABK92614.1| unknown [Populus trichocarpa]
 gb|EEE80142.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=178

 Score =   347 bits (889),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV++RFHQYQVVGRALPTE+DEHPKIYRMKLWATNEVR+KSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVSFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRSKSKFWYFLRKLKKVKKSNGQI  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKKVRPP+RKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>ref|NP_001275234.1| 60S ribosomal protein L18a-like [Solanum tuberosum]
 gb|ABB29928.1| unknown [Solanum tuberosum]
Length=178

 Score =   347 bits (889),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVTY+FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVTYKFHQYQVVGRALPSENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEK PTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRH  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF +SKIKFPLVFKKVRPP+RKLKTTYKA++PNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYKATKPNLFM  178



>gb|KHG16522.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   346 bits (888),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 165/178 (93%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRA PTE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRFHQYQVVGRAHPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKKVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_004134633.1| PREDICTED: 60S ribosomal protein L18a [Cucumis sativus]
 gb|KGN49388.1| hypothetical protein Csa_6G522810 [Cucumis sativus]
Length=178

 Score =   346 bits (888),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRFHQYQVVGRALPSEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEAMYTEMASRHRVRH  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF +SKIKFPLVFK VRPP+RKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHDSKIKFPLVFKTVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_010542333.1| PREDICTED: 60S ribosomal protein L18a isoform X1 [Tarenaya hassleriana]
Length=178

 Score =   346 bits (887),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_006437137.1| hypothetical protein CICLE_v10032878mg [Citrus clementina]
 gb|ESR50377.1| hypothetical protein CICLE_v10032878mg [Citrus clementina]
Length=180

 Score =   346 bits (887),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  73   KMVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQ  252
            +MVT+RFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKK+NGQ
Sbjct  2    RMVTFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQ  61

Query  253  VLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  432
            VLAINEIFEKNP KI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR
Sbjct  62   VLAINEIFEKNPAKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVR  121

Query  433  HHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
              CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVF+KVRPP+RKL+TTYKASRPNLF+
Sbjct  122  SPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLRTTYKASRPNLFM  180



>ref|XP_011659876.1| PREDICTED: 60S ribosomal protein L18a [Cucumis sativus]
Length=178

 Score =   345 bits (886),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV++RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVSFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTK+ NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKVKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF +SKIKFPLVFKKVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_009389413.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=188

 Score =   346 bits (887),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  11   MVAFRFHQYQVVGRALPTAADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  70

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+ PTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVRH
Sbjct  71   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRH  130

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIP+KLCKRESTKQF +SKIKFPLVFKKVRPP+RKLKTTYKASRPNLF+
Sbjct  131  HCIQIIKTATIPSKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  188



>gb|EYU36633.1| hypothetical protein MIMGU_mgv1a014793mg [Erythranthe guttata]
Length=178

 Score =   345 bits (885),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVTYRFHQYQVVGRALPTET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTYRFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF NSKIKFPLV +KVRPP+RKLKTTYKA++PNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVTRKVRPPTRKLKTTYKATKPNLFM  178



>gb|KHG16962.1| 60S ribosomal L18a [Gossypium arboreum]
 gb|KJB69799.1| hypothetical protein B456_011G042800 [Gossypium raimondii]
Length=178

 Score =   345 bits (885),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRA PTE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRFHQYQVVGRAHPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKR+STKQF NSKIKFPLVFKKVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_007025105.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
 gb|EOY27727.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
Length=178

 Score =   345 bits (885),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+R+HQYQVVGRALPTE+DEHPKIYRM+LWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRYHQYQVVGRALPTESDEHPKIYRMRLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKR+STKQF NSKIKFPLVFKKVRPP+RKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_006442292.1| hypothetical protein CICLE_v10022114mg [Citrus clementina]
 gb|ESR55532.1| hypothetical protein CICLE_v10022114mg [Citrus clementina]
Length=224

 Score =   347 bits (890),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 165/182 (91%), Positives = 174/182 (96%), Gaps = 0/182 (0%)
 Frame = +1

Query  64   LVEKMVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKA  243
            L  KMVT+RFHQYQVVGRALPTE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+
Sbjct  43   LGGKMVTFRFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  102

Query  244  NGQVLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH  423
            NGQ+LAI+EIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RD TLNGAVEQMYTEMASRH
Sbjct  103  NGQMLAIDEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDITLNGAVEQMYTEMASRH  162

Query  424  RVRHHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNL  603
            RVR  CIQII+TATIPAKLCKRESTKQF NSKIKFPLVFKKVRPP+RKLKTTYKASRPNL
Sbjct  163  RVRSPCIQIIRTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNL  222

Query  604  FV  609
            F+
Sbjct  223  FM  224



>ref|XP_008439644.1| PREDICTED: 60S ribosomal protein L18a [Cucumis melo]
Length=178

 Score =   345 bits (885),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRFHQYQVVGRALPSEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEAMYTEMASRHRVRH  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF +SKIKFPLVFK VRPP+RKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHDSKIKFPLVFKTVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_009406265.1| PREDICTED: 60S ribosomal protein L18a [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   345 bits (885),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVVFRFHQYQVVGRALPSATDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+ PTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR+
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRY  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIP+KLCKRESTKQF +SKIKFPLVFKKVRPPSRKLKTTYKASRPNLF+
Sbjct  121  HCIQIIKTATIPSKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  178



>gb|ABB29925.1| unknown [Solanum tuberosum]
Length=178

 Score =   345 bits (884),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT++FHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVTFKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEK PTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVRH
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRH  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF +SKIKFPLVFKKVRPP+RKLKTTY A++PNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYWATKPNLFM  178



>gb|EYU33348.1| hypothetical protein MIMGU_mgv1a014797mg [Erythranthe guttata]
Length=178

 Score =   345 bits (884),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVTYR HQYQVVGRALPTET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVTYRIHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVR+
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASRHRVRY  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF NSKIKFPLVF KVRPP+RKLKTTYKA++PNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFHKVRPPTRKLKTTYKATKPNLFM  178



>ref|XP_010538246.1| PREDICTED: 60S ribosomal protein L18a-like [Tarenaya hassleriana]
Length=178

 Score =   345 bits (884),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPTE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RD TLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDITLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_012072093.1| PREDICTED: 60S ribosomal protein L18a isoform X1 [Jatropha curcas]
 gb|ACS96446.1| 60S ribosomal protein L18a [Jatropha curcas]
 gb|KDP37961.1| hypothetical protein JCGZ_04604 [Jatropha curcas]
Length=178

 Score =   345 bits (884),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVTY+FHQYQVVGR LPTE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTYKFHQYQVVGRGLPTENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKT TIPAKLCKRES+KQF NSKIKFPLVFKKVRPP+RKL+TTYKASRPNLF+
Sbjct  121  PCIQIIKTGTIPAKLCKRESSKQFHNSKIKFPLVFKKVRPPTRKLRTTYKASRPNLFM  178



>ref|XP_008444078.1| PREDICTED: 60S ribosomal protein L18a [Cucumis melo]
Length=178

 Score =   344 bits (883),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 174/178 (98%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV++RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVSFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTK+ NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKVKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF +SKIKFPLVFKKVRPP+RKL+TTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLRTTYKASKPNLFM  178



>ref|XP_010655647.1| PREDICTED: 60S ribosomal protein L18a isoform X1 [Vitis vinifera]
 emb|CAN82658.1| hypothetical protein VITISV_011977 [Vitis vinifera]
Length=178

 Score =   344 bits (883),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYAEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRES+KQF NSKIKFPL F+KVRPP+RKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESSKQFHNSKIKFPLTFRKVRPPTRKLKTTYKASRPNLFM  178



>gb|ABK94361.1| unknown [Populus trichocarpa]
Length=178

 Score =   344 bits (882),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV++RFHQYQVVGRALPTE+DEHPKIYRMKLWATNEVR+KSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVSFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRSKSKFWYFLRKLKKVKKSNGQI  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKR STKQF NSKIKFPLVFKKVRPP+RKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRGSTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>gb|KHG29727.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   344 bits (882),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPTE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKR++TKQF NSKIKFPL+ KKVRPP+RKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRDNTKQFHNSKIKFPLMVKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_008789456.1| PREDICTED: 60S ribosomal protein L18a-2 [Phoenix dactylifera]
Length=178

 Score =   344 bits (882),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPT +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MGNFRFHQYQVVGRALPTPSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+ PTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVRH
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRH  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF +SKIKFPLVFKKVRPP+RKLKTTYKASRPNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_009399317.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   343 bits (881),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 163/177 (92%), Positives = 170/177 (96%), Gaps = 0/177 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPTET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MGNFRFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+ PTKI NYGVWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERKPTKIKNYGVWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRQ  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF  606
            HCIQIIKTATIP+KLCKRESTKQF +SKIKFPLVFKKVRPPSRKLKTTYKASRPNLF
Sbjct  121  HCIQIIKTATIPSKLCKRESTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF  177



>gb|KJB42782.1| hypothetical protein B456_007G174800 [Gossypium raimondii]
Length=178

 Score =   343 bits (880),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGR LPTE D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVAFRFHQYQVVGRGLPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKR+STKQF NSKIKFPLVFKKVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_008811096.1| PREDICTED: 60S ribosomal protein L18a [Phoenix dactylifera]
Length=178

 Score =   343 bits (880),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVVFRFHQYQVVGRALPSPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+ PTKI NYG+WLRYQSRTGYHNMYKEFRDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYNEMASRHRVRC  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF +SKIKFPLVFK VRPPSRKLKTTYKASRPNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKMVRPPSRKLKTTYKASRPNLFM  178



>ref|NP_001237207.1| uncharacterized protein LOC100527007 [Glycine max]
 gb|ACU16044.1| unknown [Glycine max]
Length=178

 Score =   343 bits (880),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 163/178 (92%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV  RFHQYQVVGRALPTE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVAMRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+NPTKI N G+WLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVRH
Sbjct  61   LAINEIFERNPTKIKNCGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASRHRVRH  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKI+FPLVFKKVRPP+RKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIEFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_002276260.1| PREDICTED: 60S ribosomal protein L18a [Vitis vinifera]
 emb|CAN71860.1| hypothetical protein VITISV_019859 [Vitis vinifera]
 emb|CBI30856.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   343 bits (880),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYAEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRES+KQF NSKIKFPL F+KVRPP+RKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESSKQFHNSKIKFPLTFRKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_010924380.1| PREDICTED: 60S ribosomal protein L18a [Elaeis guineensis]
Length=178

 Score =   343 bits (879),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVAFRFHQYQVVGRALPSPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+ PTKI NYG+WLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASRHRVR+
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASRHRVRY  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRE+TKQF +SKIKFPLVFKKVRPPSRKLKTTYKASRPNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRENTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_007048983.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
 gb|EOX93140.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
Length=178

 Score =   343 bits (879),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV++R+HQYQVVGR LPTE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVSFRYHQYQVVGRGLPTEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKR+STKQF NSKIKFPLVFKKVRPP+RKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_009394206.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   343 bits (879),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVAFRFHQYQVVGRALPSSTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+ PTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRC  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIP+KLCKRESTKQF +SKIKFPLVFKKVRPP+RKLKTTYKASRPNLF+
Sbjct  121  HCIQIIKTATIPSKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_008798296.1| PREDICTED: 60S ribosomal protein L18a [Phoenix dactylifera]
Length=178

 Score =   343 bits (879),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALP+ T+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVAFRFHQYQVVGRALPSPTNEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+ PTKI NYG+WLRYQSRTGYHNMYKEFRDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYNEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRE+TKQF +SKIKFPLVFKKVRPPSRKLKTTYKASRPNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRENTKQFHDSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_007215058.1| hypothetical protein PRUPE_ppa012231mg [Prunus persica]
 gb|EMJ16257.1| hypothetical protein PRUPE_ppa012231mg [Prunus persica]
Length=178

 Score =   342 bits (878),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRFHQYQVVGRALPSEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEK+PT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVR 
Sbjct  61   LAINEIFEKSPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEDMYTEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKKVRPP+RKLKTTYKA+RPN+FV
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKATRPNIFV  178



>ref|XP_010918885.1| PREDICTED: 60S ribosomal protein L18a-like [Elaeis guineensis]
Length=178

 Score =   342 bits (877),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALP+ TDEHP+IYRMKLW TNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVAFRFHQYQVVGRALPSPTDEHPRIYRMKLWTTNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+ PTKI NYG+WLRYQSRTGYHNMYKEFRDT LNGAVE MY EMASRHRVR+
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTALNGAVEHMYNEMASRHRVRY  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_008796386.1| PREDICTED: 60S ribosomal protein L18a-like [Phoenix dactylifera]
Length=178

 Score =   342 bits (877),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPT +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MGNFRFHQYQVVGRALPTPSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+ PTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVRH
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRH  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF +SKIKFPLV KKVRPP+RKLKTTYKASRPNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVLKKVRPPTRKLKTTYKASRPNLFM  178



>gb|KHG26670.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   342 bits (876),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGR LPTE D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVAFRFHQYQVVGRGLPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYAEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKR+STKQF NSKIKFPLVFKKVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_002268750.1| PREDICTED: 60S ribosomal protein L18a [Vitis vinifera]
 emb|CBI22128.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   342 bits (876),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT++FHQYQVVGRALP+E+DEHP+IYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFKFHQYQVVGRALPSESDEHPRIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNG+VEQMYTEMASRHRVR+
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGSVEQMYTEMASRHRVRY  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQ  NSKIKFPLV +KVRPP+RKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQMHNSKIKFPLVVRKVRPPTRKLKTTYKASRPNLFM  178



>gb|KJB10614.1| hypothetical protein B456_001G211400 [Gossypium raimondii]
Length=178

 Score =   341 bits (875),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGR LPTE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVAFRFHQYQVVGRGLPTEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEK+PTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKR+STKQF NSKIKFPLVFKKVRPP+RKLKTTYKA++PNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKATKPNLFM  178



>ref|NP_001237679.1| uncharacterized protein LOC100306365 [Glycine max]
 gb|ACU14501.1| unknown [Glycine max]
 gb|KHN35898.1| 60S ribosomal protein L18a-2 [Glycine soja]
Length=178

 Score =   341 bits (875),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPTETD HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTETDVHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKKVRPP+RKLKTTYKA++PNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKATKPNLFM  178



>ref|XP_010552158.1| PREDICTED: 60S ribosomal protein L18a [Tarenaya hassleriana]
Length=178

 Score =   341 bits (875),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNG+VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIRNYGIWLRYQSRTGYHNMYKEYRDTTLNGSVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             C+QIIKTAT+PAKLCKRESTKQF NSKIKFPLV++KVRPP+RKLKTT+KAS+PNLF+
Sbjct  121  PCVQIIKTATVPAKLCKRESTKQFHNSKIKFPLVYRKVRPPTRKLKTTFKASKPNLFM  178



>gb|KJB57268.1| hypothetical protein B456_009G155900 [Gossypium raimondii]
Length=178

 Score =   341 bits (874),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPT++DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRFHQYQVVGRALPTDSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIP KLCKR++TKQF NSKIKFPL+ KKVRPP+RKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATIPTKLCKRDNTKQFHNSKIKFPLMVKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_010540563.1| PREDICTED: 60S ribosomal protein L18a [Tarenaya hassleriana]
Length=178

 Score =   341 bits (874),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVV RALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVTFRFHQYQVVERALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKEFRD TLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDITLNGAVEQMYNEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRES+KQF NSKIKFPLVF+KVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESSKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  178



>gb|EYU43268.1| hypothetical protein MIMGU_mgv1a013972mg [Erythranthe guttata]
Length=204

 Score =   342 bits (876),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  73   KMVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQ  252
            KMVTY+FHQYQVVGRALPTE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ
Sbjct  26   KMVTYKFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  85

Query  253  VLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  432
            +LAINEIFEKNPT I N+GVWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVR
Sbjct  86   MLAINEIFEKNPTTIKNFGVWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVR  145

Query  433  HHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             HCIQIIKTATIPAKLCKRESTKQF NSKIKFPLV++KVRP SRKLKTTYKA++PNLF+
Sbjct  146  PHCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVYRKVRPHSRKLKTTYKATKPNLFM  204



>ref|NP_001238728.1| uncharacterized protein LOC100306174 [Glycine max]
 gb|ACU14228.1| unknown [Glycine max]
 gb|KHN33136.1| 60S ribosomal protein L18a [Glycine soja]
Length=178

 Score =   341 bits (874),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPTE D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEAMYNEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLV+KKVRPP+RKLKTTYKA +PNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVYKKVRPPTRKLKTTYKAKKPNLFM  178



>ref|XP_007136179.1| hypothetical protein PHAVU_009G024800g [Phaseolus vulgaris]
 gb|ESW08173.1| hypothetical protein PHAVU_009G024800g [Phaseolus vulgaris]
Length=178

 Score =   340 bits (872),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV++RFHQYQVVGRALPTE D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVSFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIQNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF +SKIKFPLVFKK+RPPSRKLKTTYKA +PNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKIRPPSRKLKTTYKAKKPNLFM  178



>ref|XP_006410594.1| hypothetical protein EUTSA_v10017304mg [Eutrema salsugineum]
 gb|ESQ52047.1| hypothetical protein EUTSA_v10017304mg [Eutrema salsugineum]
Length=178

 Score =   340 bits (872),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT++FHQYQVVGRALPTE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVTFKFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I N+G+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PA LCKRESTKQF NSKIKFPLVF+KVRPPSRKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPAALCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASKPNLFM  178



>gb|KJB69800.1| hypothetical protein B456_011G042900 [Gossypium raimondii]
Length=178

 Score =   340 bits (872),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRA P E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+ GQV
Sbjct  1    MVTFRFHQYQVVGRAHPAESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSIGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKR+STKQF NSKIKFPLVFKKVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASKPNLFM  178



>emb|CDX97587.1| BnaA05g24920D [Brassica napus]
Length=178

 Score =   340 bits (872),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPTE D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  178



>ref|NP_001236918.1| uncharacterized protein LOC100500108 [Glycine max]
 gb|ACU14971.1| unknown [Glycine max]
 gb|KHN47310.1| 60S ribosomal protein L18a [Glycine soja]
Length=178

 Score =   340 bits (871),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPTE D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNG+VE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGSVEAMYNEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTTYKA +PNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFQKVRPPTRKLKTTYKAKKPNLFM  178



>ref|XP_004486036.1| PREDICTED: 60S ribosomal protein L18a-like [Cicer arietinum]
Length=178

 Score =   340 bits (871),  Expect = 8e-116, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 171/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV++++HQYQVVGRALPTE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVSFKYHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKEFRDTTLNGAV+ MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVDLMYNEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKK+RPPSRKLKTTYKA +PNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKIRPPSRKLKTTYKAKKPNLFM  178



>ref|XP_007212144.1| hypothetical protein PRUPE_ppa012251mg [Prunus persica]
 ref|XP_008225467.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Prunus mume]
 gb|EMJ13343.1| hypothetical protein PRUPE_ppa012251mg [Prunus persica]
Length=178

 Score =   340 bits (871),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 162/178 (91%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M T++FHQYQVVGR LPT +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MGTFKFHQYQVVGRKLPTASDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVF+KVRPPSRKLKTTYKASRPNLFV
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASRPNLFV  178



>gb|KHG27228.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   339 bits (870),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGR LPT+ DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVAFRFHQYQVVGRGLPTDADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKR+STKQF NSKIKFPLV KKVRPP+RKLKTTYKA++PNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVSKKVRPPTRKLKTTYKATKPNLFM  178



>gb|AFK44558.1| unknown [Lotus japonicus]
Length=178

 Score =   339 bits (870),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 172/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPT++D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRFHQYQVVGRALPTDSDQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI N+G+WLRYQSRTGYHNMYKE+RDTTLNGAV+ MYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVDAMYTEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLV++KVRPPSRKLKTTYKA +PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVYRKVRPPSRKLKTTYKAKKPNLFM  178



>gb|AFK33651.1| unknown [Lotus japonicus]
Length=178

 Score =   338 bits (868),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV ++FHQYQVVGRALPTE+D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVAFKFHQYQVVGRALPTESDDHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLV+KK+RPP+RKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVYKKIRPPTRKLKTTYKASRPNLFM  178



>sp|Q9ATF5.1|RL18A_CASSA RecName: Full=60S ribosomal protein L18a [Castanea sativa]
 gb|AAK25759.1|AF334839_1 ribosomal protein L18a [Castanea sativa]
Length=178

 Score =   338 bits (868),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGR LP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVTFRFHQYQVVGRGLPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRES+KQF NSKIKFPLV +K+RPPSRKLKT YKASRPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESSKQFHNSKIKFPLVTRKIRPPSRKLKTHYKASRPNLFM  178



>ref|XP_009407842.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   338 bits (868),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 160/177 (90%), Positives = 169/177 (95%), Gaps = 0/177 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPT TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MGNFRFHQYQVVGRALPTATDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+ PTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNG+VEQMY EMASRHRVR 
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGSVEQMYNEMASRHRVRC  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF  606
            HCIQIIKTATIP+KLCKRESTKQF +SKIKFPLVFKKVRPP+RKLKTTYKASRPNLF
Sbjct  121  HCIQIIKTATIPSKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYKASRPNLF  177



>gb|AFK40398.1| unknown [Medicago truncatula]
 gb|KEH33553.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
Length=178

 Score =   338 bits (867),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M T+++HQYQVVGRALPTE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MATFKYHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVRH
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEYMYNEMASRHRVRH  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPA LCKRESTKQF NSKIKFPLVFKK+RPP+RKLKTTYKA++PN+F+
Sbjct  121  PCIQIIKTATIPANLCKRESTKQFHNSKIKFPLVFKKIRPPTRKLKTTYKATKPNMFM  178



>ref|XP_010263115.1| PREDICTED: 60S ribosomal protein L18a-2 [Nelumbo nucifera]
Length=178

 Score =   338 bits (866),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALP+E D HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MGIFRFHQYQVVGRALPSEADPHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR+
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRY  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPA LCKRESTKQF N+KIKFPLVFKKVRPP+RKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATIPASLCKRESTKQFHNAKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_008371596.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Malus domestica]
 ref|XP_008383489.1| PREDICTED: 60S ribosomal protein L18a-2 [Malus domestica]
 ref|XP_009360875.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Pyrus x bretschneideri]
Length=178

 Score =   337 bits (865),  Expect = 6e-115, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  ++FHQYQVVGR LPTETDE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MGVFKFHQYQVVGRKLPTETDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVF+KVRPPSRKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASRPNLFM  178



>gb|AFK46978.1| unknown [Lotus japonicus]
Length=178

 Score =   337 bits (863),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV ++FHQYQVVGRALPTETD HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVAFKFHQYQVVGRALPTETDVHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+ AKLCKRESTKQF NSKIKFPLV+KK+RPP+RKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATVEAKLCKRESTKQFHNSKIKFPLVYKKIRPPTRKLKTTYKASRPNLFM  178



>emb|CDX79564.1| BnaC03g19000D [Brassica napus]
Length=178

 Score =   336 bits (862),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPTE D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I N+G+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTNIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLVF+KVRPPSRKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASKPNLFM  178



>ref|XP_008380196.1| PREDICTED: 60S ribosomal protein L18a-2-like [Malus domestica]
 ref|XP_008342343.1| PREDICTED: 60S ribosomal protein L18a-2-like [Malus domestica]
 ref|XP_009377204.1| PREDICTED: 60S ribosomal protein L18a-2-like [Pyrus x bretschneideri]
 ref|XP_009356606.1| PREDICTED: 60S ribosomal protein L18a-2-like [Pyrus x bretschneideri]
Length=178

 Score =   336 bits (862),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 161/178 (90%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPTE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MGVFRFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEK PT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MYTE+ASRHRVR 
Sbjct  61   LAINEIFEKYPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEAMYTELASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVF+KVRPPSRKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_009146339.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
Length=178

 Score =   336 bits (861),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV + FHQYQVVGRALPTE D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAFGFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKEFRDTTLNG+VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGSVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_006407062.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
 gb|ESQ48515.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
Length=178

 Score =   336 bits (861),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPTE D  PKIYRMKLWATNEVRA SKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAMSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  178



>emb|CDX75778.1| BnaC03g38610D [Brassica napus]
Length=258

 Score =   338 bits (867),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 160/184 (87%), Positives = 172/184 (93%), Gaps = 0/184 (0%)
 Frame = +1

Query  58   VQLVEKMVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVK  237
            + L  +MV +RFHQYQVVGRALPTE D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVK
Sbjct  75   LDLSLEMVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVK  134

Query  238  KANGQVLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMAS  417
            K+NGQ+LAINEIFEK+PTKI NYG+WLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMAS
Sbjct  135  KSNGQMLAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMAS  194

Query  418  RHRVRHHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRP  597
            RHRVR  CIQIIKTAT+PA LCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTTYKAS+P
Sbjct  195  RHRVRFPCIQIIKTATVPAGLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKP  254

Query  598  NLFV  609
            NLF+
Sbjct  255  NLFM  258



>ref|XP_009132991.1| PREDICTED: 60S ribosomal protein L18a-2-like [Brassica rapa]
Length=178

 Score =   335 bits (859),  Expect = 6e-114, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPTE D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I N+G+WLRYQSRTGYHNMYKE RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKESRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLVF+KVRPPSRKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASKPNLFM  178



>ref|XP_004488610.1| PREDICTED: 60S ribosomal protein L18a-like isoform X2 [Cicer 
arietinum]
Length=178

 Score =   335 bits (858),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV  +FHQYQVVGRALPTET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVNMKFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVETMYNEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPA LCKRESTKQF NSKIKFPLV+KK+RPP+RKLKTTYKA++PNLF+
Sbjct  121  PCIQIIKTATIPANLCKRESTKQFHNSKIKFPLVYKKIRPPTRKLKTTYKATKPNLFM  178



>ref|XP_006298665.1| hypothetical protein CARUB_v10014756mg [Capsella rubella]
 gb|EOA31563.1| hypothetical protein CARUB_v10014756mg [Capsella rubella]
Length=178

 Score =   334 bits (857),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPTE DEHPKIYRMKLW TNEV AKSKFWYF+RKLKKVKK+NGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDEHPKIYRMKLWGTNEVCAKSKFWYFMRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLVF+KVRPPSRKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASKPNLFM  178



>ref|XP_010052072.1| PREDICTED: 60S ribosomal protein L18a-2-like isoform X2 [Eucalyptus 
grandis]
Length=317

 Score =   339 bits (870),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 162/173 (94%), Positives = 168/173 (97%), Gaps = 0/173 (0%)
 Frame = +1

Query  91   FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINE  270
            FHQYQVVGRALPT  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQVLAINE
Sbjct  145  FHQYQVVGRALPTGADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  204

Query  271  IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  450
            IFEKNPTKINNYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  205  IFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  264

Query  451  IKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKTAT+PAKLCKRESTKQF NSKIKFPLVFKKVRPP+RKLKTTYKASRPNLF+
Sbjct  265  IKTATVPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  317



>ref|XP_011085620.1| PREDICTED: 60S ribosomal protein L18a-like [Sesamum indicum]
Length=175

 Score =   333 bits (855),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 160/178 (90%), Positives = 170/178 (96%), Gaps = 3/178 (2%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVTYR   YQVVGR+LPTET+EHPKIYRMKLWA NEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVTYR---YQVVGRSLPTETEEHPKIYRMKLWAPNEVRAKSKFWYFLRKLKKVKKSNGQI  57

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  58   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRP  117

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF +SKIKFPLVF+KVRPP+RKLKTTYKASRPNLF+
Sbjct  118  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFRKVRPPTRKLKTTYKASRPNLFM  175



>gb|KFK36339.1| hypothetical protein AALP_AA4G109800 [Arabis alpina]
Length=178

 Score =   333 bits (855),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M T+RFHQYQVVGRALPTE D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MGTFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I N+G+WLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLVF+KVRPPSRKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASKPNLFM  178



>ref|XP_006841639.1| PREDICTED: 60S ribosomal protein L18a [Amborella trichopoda]
 gb|ERN03314.1| hypothetical protein AMTR_s00003p00234980 [Amborella trichopoda]
Length=178

 Score =   333 bits (855),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT T+EHPK+YRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVAFRFHQYQVVGRALPTPTEEHPKLYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEK PTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR+
Sbjct  61   LAINEIFEKKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRY  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRE+TKQF +SKIKFPLVF+K RPP+RKLKTT+KASRPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRENTKQFHDSKIKFPLVFRKFRPPTRKLKTTFKASRPNLFM  178



>ref|XP_010465351.1| PREDICTED: 60S ribosomal protein L18a-3 [Camelina sativa]
Length=178

 Score =   333 bits (855),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 158/178 (89%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPTE DEHPKIYRMKLW  NEV AKSKFWYF+RKLKKVKK+NGQ+
Sbjct  1    MGVFRFHQYQVVGRALPTEKDEHPKIYRMKLWGKNEVCAKSKFWYFMRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLVF+KVRPPSRKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASRPNLFM  178



>ref|XP_009135390.1| PREDICTED: 60S ribosomal protein L18a-2-like [Brassica rapa]
Length=178

 Score =   333 bits (854),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPTE D  PKIYRMKLWA+NEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDVQPKIYRMKLWASNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEK+PTKI NYG+WLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PA LCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPASLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_006595492.1| PREDICTED: uncharacterized protein LOC100305604 isoform X1 [Glycine 
max]
Length=753

 Score =   352 bits (903),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 165/179 (92%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  73   KMVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQ  252
            +MV  RFHQYQVVGRALPTE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ
Sbjct  575  EMVAMRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  634

Query  253  VLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  432
            VLAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVR
Sbjct  635  VLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASRHRVR  694

Query  433  HHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            H CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKK+RPP+RKLKTTYKASRPNLF+
Sbjct  695  HPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKIRPPTRKLKTTYKASRPNLFM  753



>ref|XP_004303886.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=178

 Score =   333 bits (853),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +R+HQYQVVGRALPTE DEHPKI+RMKLW TNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MAPFRYHQYQVVGRALPTEKDEHPKIFRMKLWHTNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT INNYG+WLRYQSRTGYHNMYKE+R+TTLNGAVE MYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTINNYGIWLRYQSRTGYHNMYKEYRNTTLNGAVEDMYTEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLV +K+RPPSRKLKTTYKASRPN+F+
Sbjct  121  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVLRKIRPPSRKLKTTYKASRPNIFM  178



>ref|XP_006467486.1| PREDICTED: 60S ribosomal protein L18a-2-like isoform X2 [Citrus 
sinensis]
Length=307

 Score =   338 bits (866),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 169/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  91   FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINE  270
            FHQYQVVGRALPTE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+LAINE
Sbjct  135  FHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINE  194

Query  271  IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  450
            IFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  195  IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRSPCIQI  254

Query  451  IKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKTATIPAKLCKRESTKQF NSKIKFPLVF+KVRPPSRKL+TTYKA+RPNLF+
Sbjct  255  IKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLRTTYKATRPNLFM  307



>gb|KEH33554.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
Length=176

 Score =   333 bits (853),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 156/174 (90%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +1

Query  88   RFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAIN  267
            ++HQYQVVGRALPTE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQVLAIN
Sbjct  3    QYHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  62

Query  268  EIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  447
            EIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVRH CIQ
Sbjct  63   EIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEYMYNEMASRHRVRHPCIQ  122

Query  448  IIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IIKTATIPA LCKRESTKQF NSKIKFPLVFKK+RPP+RKLKTTYKA++PN+F+
Sbjct  123  IIKTATIPANLCKRESTKQFHNSKIKFPLVFKKIRPPTRKLKTTYKATKPNMFM  176



>ref|XP_006601742.1| PREDICTED: uncharacterized protein LOC100306365 isoform X1 [Glycine 
max]
Length=184

 Score =   333 bits (853),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 158/174 (91%), Positives = 167/174 (96%), Gaps = 0/174 (0%)
 Frame = +1

Query  88   RFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAIN  267
            +FHQYQVVGRALPTETD HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+LAIN
Sbjct  11   QFHQYQVVGRALPTETDVHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAIN  70

Query  268  EIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  447
            EIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR  CIQ
Sbjct  71   EIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASRHRVRSPCIQ  130

Query  448  IIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IIKTATIPAKLCKRESTKQF NSKIKFPLVFKKVRPP+RKLKTTYKA++PNLF+
Sbjct  131  IIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKATKPNLFM  184



>ref|XP_010542335.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X3 [Tarenaya 
hassleriana]
Length=316

 Score =   337 bits (865),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 169/173 (98%), Gaps = 0/173 (0%)
 Frame = +1

Query  91   FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINE  270
            FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+LAINE
Sbjct  144  FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINE  203

Query  271  IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  450
            IFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  204  IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  263

Query  451  IKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKTAT+PAKLCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTTYKAS+PNLF+
Sbjct  264  IKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  316



>ref|XP_009141387.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
 ref|XP_009143771.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
Length=178

 Score =   332 bits (852),  Expect = 7e-113, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPTE D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I N+G+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_006574359.1| PREDICTED: uncharacterized protein LOC100527007 isoform X1 [Glycine 
max]
Length=784

 Score =   352 bits (903),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 166/179 (93%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +1

Query  73   KMVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQ  252
            KMV  RFHQYQVVGRALPTE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ
Sbjct  606  KMVAMRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  665

Query  253  VLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  432
            VLAINEIFE+NPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVR
Sbjct  666  VLAINEIFERNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASRHRVR  725

Query  433  HHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            H CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKKVRPP+RKLKTTYKASRPNLF+
Sbjct  726  HPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  784



>ref|XP_006295085.1| hypothetical protein CARUB_v10024156mg [Capsella rubella]
 gb|EOA27983.1| hypothetical protein CARUB_v10024156mg [Capsella rubella]
Length=178

 Score =   332 bits (851),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M T+RFHQYQVVGRALPTE D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MGTFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEI+EKNPT I N+G+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIYEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLVF+KVRPPSRKLKTTYKA++PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKANKPNLFM  178



>ref|XP_003597433.1| 60S ribosomal protein L18a [Medicago truncatula]
 ref|XP_003617397.1| 60S ribosomal protein L18a [Medicago truncatula]
 gb|ACJ84852.1| unknown [Medicago truncatula]
 gb|AES67684.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
 gb|AET00356.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
 gb|AFK39885.1| unknown [Medicago truncatula]
 gb|AFK41441.1| unknown [Medicago truncatula]
 gb|AFK43765.1| unknown [Medicago truncatula]
 gb|AFK46613.1| unknown [Medicago truncatula]
 gb|KEH28400.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
Length=178

 Score =   332 bits (850),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/178 (88%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV  +FHQYQVVGRALPTE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVNAKFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR 
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVETMYNEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPA LCKRESTKQF NSKIKFPLV+KK+RPP+R LKTTYKA +PNLF+
Sbjct  121  PCIQIIKTATIPANLCKRESTKQFHNSKIKFPLVYKKIRPPTRSLKTTYKAKKPNLFM  178



>ref|XP_011628903.1| PREDICTED: 60S ribosomal protein L18a [Amborella trichopoda]
Length=178

 Score =   331 bits (849),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT  +EHPK+YRMKLWATN+VRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVAFRFHQYQVVGRALPTACEEHPKLYRMKLWATNDVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEK PTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFEKKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRE+TKQF +S+IKFPLVF+KVRPP+RKLKTT+KASRPNLF+
Sbjct  121  PCIQIIKTATIPAKLCKRENTKQFHDSRIKFPLVFRKVRPPTRKLKTTFKASRPNLFM  178



>ref|XP_004488609.1| PREDICTED: 60S ribosomal protein L18a-like isoform X1 [Cicer 
arietinum]
Length=182

 Score =   331 bits (849),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  73   KMVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQ  252
            +++  +FHQYQVVGRALPTET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ
Sbjct  4    RLLLKQFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  63

Query  253  VLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  432
            VLAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR
Sbjct  64   VLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVETMYNEMASRHRVR  123

Query  433  HHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
              CIQIIKTATIPA LCKRESTKQF NSKIKFPLV+KK+RPP+RKLKTTYKA++PNLF+
Sbjct  124  FPCIQIIKTATIPANLCKRESTKQFHNSKIKFPLVYKKIRPPTRKLKTTYKATKPNLFM  182



>ref|XP_008465452.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Cucumis 
melo]
Length=751

 Score =   350 bits (897),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 163/179 (91%), Positives = 175/179 (98%), Gaps = 0/179 (0%)
 Frame = +1

Query  73   KMVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQ  252
            KMVT+RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ
Sbjct  573  KMVTFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  632

Query  253  VLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  432
            +LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR
Sbjct  633  ILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVR  692

Query  433  HHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
              CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLV+KKVRPP+RKLKTTYKAS+PNLF+
Sbjct  693  CPCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVYKKVRPPTRKLKTTYKASKPNLFM  751



>ref|XP_002519698.1| 60S ribosomal protein L18a, putative [Ricinus communis]
 gb|EEF42671.1| 60S ribosomal protein L18a, putative [Ricinus communis]
Length=303

 Score =   335 bits (859),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 160/173 (92%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = +1

Query  91   FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINE  270
            FHQYQVVGR LPTE D+HPKIYRMKLWATNE RAKSKFWYFLRKLKKVKK+NGQVLAINE
Sbjct  131  FHQYQVVGRGLPTEADDHPKIYRMKLWATNEFRAKSKFWYFLRKLKKVKKSNGQVLAINE  190

Query  271  IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  450
            IFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  191  IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  250

Query  451  IKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKTATIPAKLCKRESTKQF NSKIKFPLVFKKVRPP+RKLKTTYKASRPNLF+
Sbjct  251  IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  303



>ref|NP_180995.1| 60S ribosomal protein L18a-2 [Arabidopsis thaliana]
 ref|XP_002881337.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
 sp|P51418.2|R18A2_ARATH RecName: Full=60S ribosomal protein L18a-2 [Arabidopsis thaliana]
 gb|AAC26708.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAK68743.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM14956.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAM53336.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAN15395.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAP21367.1| At2g34480 [Arabidopsis thaliana]
 gb|EFH57596.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
 gb|AEC08980.1| 60S ribosomal protein L18a-2 [Arabidopsis thaliana]
Length=178

 Score =   330 bits (846),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPTE D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEI+EKNPT I N+G+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIYEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLVF+KVRPPSRKLKTTYKA++PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKANKPNLFM  178



>ref|XP_010504908.1| PREDICTED: 60S ribosomal protein L18a-2 [Camelina sativa]
 ref|XP_010509745.1| PREDICTED: 60S ribosomal protein L18a-2 [Camelina sativa]
 ref|XP_010516589.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Camelina 
sativa]
 ref|XP_010516590.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Camelina 
sativa]
Length=178

 Score =   330 bits (846),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 156/178 (88%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPTE D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MGLFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEI+EKNPT I N+G+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIYEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLVF+KVRPPSRKLKTTYKA++PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKANKPNLFM  178



>ref|XP_012072094.1| PREDICTED: 60S ribosomal protein L18a isoform X2 [Jatropha curcas]
Length=311

 Score =   335 bits (858),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = +1

Query  91   FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINE  270
            FHQYQVVGR LPTE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQVLAINE
Sbjct  139  FHQYQVVGRGLPTENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  198

Query  271  IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  450
            IFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  199  IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  258

Query  451  IKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKT TIPAKLCKRES+KQF NSKIKFPLVFKKVRPP+RKL+TTYKASRPNLF+
Sbjct  259  IKTGTIPAKLCKRESSKQFHNSKIKFPLVFKKVRPPTRKLRTTYKASRPNLFM  311



>ref|XP_002276545.1| PREDICTED: 60S ribosomal protein L18a isoform X2 [Vitis vinifera]
Length=299

 Score =   334 bits (857),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 159/177 (90%), Positives = 167/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  79   VTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVL  258
             T  FHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQVL
Sbjct  123  CTIAFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  182

Query  259  AINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  438
            AINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  
Sbjct  183  AINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYAEMASRHRVRSP  242

Query  439  CIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            CIQIIKTATIPAKLCKRES+KQF NSKIKFPL F+KVRPP+RKLKTTYKASRPNLF+
Sbjct  243  CIQIIKTATIPAKLCKRESSKQFHNSKIKFPLTFRKVRPPTRKLKTTYKASRPNLFM  299



>ref|XP_006407063.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
 gb|ESQ48516.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
Length=203

 Score =   330 bits (846),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = +1

Query  91   FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINE  270
            FHQYQVVGRALPTE D  PKIYRMKLWATNEVRA SKFWYFLRKLKKVKK+NGQ+LAINE
Sbjct  31   FHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAMSKFWYFLRKLKKVKKSNGQMLAINE  90

Query  271  IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  450
            IFEKNPT I NYG+WLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  91   IFEKNPTTIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRFPCIQI  150

Query  451  IKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKTAT+PAKLCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTTYKAS+PNLF+
Sbjct  151  IKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  203



>ref|XP_008225468.1| PREDICTED: 60S ribosomal protein L18a isoform X2 [Prunus mume]
Length=320

 Score =   334 bits (857),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  79   VTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVL  258
             T  FHQYQVVGR LPT +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQVL
Sbjct  144  CTIAFHQYQVVGRKLPTASDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  203

Query  259  AINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  438
            AINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  
Sbjct  204  AINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASRHRVRFP  263

Query  439  CIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVF+KVRPPSRKLKTTYKASRPNLFV
Sbjct  264  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASRPNLFV  320



>ref|XP_009360876.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Pyrus x bretschneideri]
Length=321

 Score =   334 bits (857),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  79   VTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVL  258
             T  FHQYQVVGR LPTETDE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQVL
Sbjct  145  CTIAFHQYQVVGRKLPTETDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  204

Query  259  AINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  438
            AINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  
Sbjct  205  AINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASRHRVRFP  264

Query  439  CIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVF+KVRPPSRKLKTTYKASRPNLF+
Sbjct  265  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASRPNLFM  321



>ref|XP_008371597.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Malus domestica]
Length=315

 Score =   334 bits (856),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 161/177 (91%), Positives = 166/177 (94%), Gaps = 0/177 (0%)
 Frame = +1

Query  79   VTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVL  258
             T  FHQYQVVGR LPTETDE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQVL
Sbjct  139  CTIAFHQYQVVGRKLPTETDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  198

Query  259  AINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  438
            AINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  
Sbjct  199  AINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASRHRVRFP  258

Query  439  CIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVF+KVRPPSRKLKTTYKASRPNLF+
Sbjct  259  CIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASRPNLFM  315



>ref|XP_004303885.2| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=181

 Score =   329 bits (843),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 154/174 (89%), Positives = 166/174 (95%), Gaps = 0/174 (0%)
 Frame = +1

Query  88   RFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAIN  267
            ++HQYQVVGRALPTE DEHPKI+RMKLW TNEVRAKSKFWYFLRKLKKVKK+NGQ+LAIN
Sbjct  8    QYHQYQVVGRALPTEKDEHPKIFRMKLWHTNEVRAKSKFWYFLRKLKKVKKSNGQILAIN  67

Query  268  EIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  447
            EIFEKNPT INNYG+WLRYQSRTGYHNMYKE+R+TTLNGAVE MYTEMASRHRVR  CIQ
Sbjct  68   EIFEKNPTTINNYGIWLRYQSRTGYHNMYKEYRNTTLNGAVEDMYTEMASRHRVRSPCIQ  127

Query  448  IIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IIKTATIPAKLCKRESTKQF NSKIKFPLV +K+RPPSRKLKTTYKASRPN+F+
Sbjct  128  IIKTATIPAKLCKRESTKQFHNSKIKFPLVLRKIRPPSRKLKTTYKASRPNIFM  181



>gb|ABK26330.1| unknown [Picea sitchensis]
 gb|ABR16921.1| unknown [Picea sitchensis]
 gb|ABR17139.1| unknown [Picea sitchensis]
Length=178

 Score =   328 bits (842),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 170/178 (96%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGR+LPT TDEHPKI+RMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVNFRFHQYQVVGRSLPTPTDEHPKIFRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I N+G+WLRYQSRTGYHNMYKE+RDTTLNGAV+QMY EMASRHRVR+
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVQQMYDEMASRHRVRY  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIP +LCKRE+TKQF +SKIKFPLV++KVRPP+RKLKTT+KASRPNLF+
Sbjct  121  PCIQIIKTATIPNELCKRENTKQFQDSKIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  178



>ref|XP_006484924.1| PREDICTED: uncharacterized protein LOC102625748 [Citrus sinensis]
Length=820

 Score =   349 bits (896),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/178 (92%), Positives = 173/178 (97%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKK+NGQV
Sbjct  643  MVTFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQV  702

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  703  LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  762

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVF+KVRPP+RKL+TTYKASRPNLF+
Sbjct  763  PCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLRTTYKASRPNLFM  820



>ref|XP_010501986.1| PREDICTED: 60S ribosomal protein L18a-3-like [Camelina sativa]
Length=178

 Score =   328 bits (841),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPTE DEHPKIYRMKLW  NEV A SKFWYF+RKLKKVKK+NGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDEHPKIYRMKLWGKNEVCAMSKFWYFMRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NS+IKFPLVF+KVRPPSR LKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSEIKFPLVFRKVRPPSRMLKTTYKASRPNLFM  178



>ref|XP_010499515.1| PREDICTED: 60S ribosomal protein L18a-1 [Camelina sativa]
 ref|XP_010478371.1| PREDICTED: 60S ribosomal protein L18a-1 [Camelina sativa]
Length=178

 Score =   328 bits (840),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +R HQYQVVGRALPTE DE PKIYRMKLWATNEV AKSKFWYFLR+ KKVKK+NGQ+
Sbjct  1    MGVFRLHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYFLRRQKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I N+G+WLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PA LCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATVPANLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASRPNLFM  178



>ref|NP_188078.1| 60S ribosomal protein L18a-3 [Arabidopsis thaliana]
 sp|Q9LUD4.1|R18A3_ARATH RecName: Full=60S ribosomal protein L18a-3 [Arabidopsis thaliana]
 dbj|BAB02392.1| 60S ribosomal protein L18A-like [Arabidopsis thaliana]
 gb|AAL60048.1| AT3g14600/MIE1_10 [Arabidopsis thaliana]
 gb|AAM19893.1| AT3g14600/MIE1_10 [Arabidopsis thaliana]
 gb|AEE75546.1| 60S ribosomal protein L18a-3 [Arabidopsis thaliana]
Length=178

 Score =   328 bits (840),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 155/178 (87%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPTE DEHPKIYRMKLW  NEV AKSKFWYF+RKLKKVKK+NGQ+
Sbjct  1    MGGFRFHQYQVVGRALPTENDEHPKIYRMKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRE TKQF NSKIKFPLVF+KVRPPSRKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKREITKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASKPNLFM  178



>gb|KFK44821.1| hypothetical protein AALP_AA1G307200 [Arabis alpina]
Length=178

 Score =   328 bits (840),  Expect = 5e-111, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALP+E +  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MGAFRFHQYQVVGRALPSEKELQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I N+G+WLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_002440257.1| hypothetical protein SORBIDRAFT_09g028590 [Sorghum bicolor]
 gb|EES18687.1| hypothetical protein SORBIDRAFT_09g028590 [Sorghum bicolor]
Length=178

 Score =   327 bits (839),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+NPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF NSKIKFPLV++KVRPP+RKLKTT+KASRPNLF+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSKIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  178



>ref|XP_008229704.1| PREDICTED: uncharacterized protein LOC103329046 [Prunus mume]
Length=776

 Score =   346 bits (888),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 162/179 (91%), Positives = 172/179 (96%), Gaps = 0/179 (0%)
 Frame = +1

Query  73   KMVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQ  252
            +MVT+RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ
Sbjct  598  QMVTFRFHQYQVVGRALPSEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  657

Query  253  VLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  432
            VLAINEIFEK+PT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASRHRVR
Sbjct  658  VLAINEIFEKSPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEDMYTEMASRHRVR  717

Query  433  HHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
              CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKKVRPP+RKLKTTYKA+RPN+FV
Sbjct  718  SPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKATRPNIFV  776



>ref|XP_009109630.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
Length=194

 Score =   327 bits (839),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/182 (85%), Positives = 167/182 (92%), Gaps = 0/182 (0%)
 Frame = +1

Query  64   LVEKMVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKA  243
            L  KM  +RFHQYQVVGRALPTE +  PKIYRMKLWATNEVRA SKFWYFLRK  K+KK+
Sbjct  13   LTTKMGVFRFHQYQVVGRALPTENEVQPKIYRMKLWATNEVRAMSKFWYFLRKQVKIKKS  72

Query  244  NGQVLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH  423
            NGQ+LAINEIFEKNPT INN+G+WLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH
Sbjct  73   NGQMLAINEIFEKNPTTINNFGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH  132

Query  424  RVRHHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNL  603
            RVR  CIQIIKTAT+PA LCKRESTKQF NSKIKFPLV++KVRPP+RKLKTTYKAS+PNL
Sbjct  133  RVRFPCIQIIKTATVPAALCKRESTKQFHNSKIKFPLVYRKVRPPTRKLKTTYKASKPNL  192

Query  604  FV  609
            F+
Sbjct  193  FM  194



>ref|XP_002882886.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59145.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
Length=178

 Score =   327 bits (837),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPTE DEHPKIYRMKLW  NEV AKSKFWYF+RKLKKVKK+NGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDEHPKIYRMKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRE TKQF NSKIKFPLVF+KVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKREITKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  178



>ref|NP_001056335.1| Os05g0565000 [Oryza sativa Japonica Group]
 gb|AAT77404.1| putative 60S ribosomal protein L18a [Oryza sativa Japonica Group]
 dbj|BAF18249.1| Os05g0565000 [Oryza sativa Japonica Group]
 gb|EAY99039.1| hypothetical protein OsI_20997 [Oryza sativa Indica Group]
 dbj|BAG95664.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64706.1| hypothetical protein OsJ_19561 [Oryza sativa Japonica Group]
Length=178

 Score =   327 bits (837),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV YRFHQYQVVGRALPT  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAYRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+NPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF NS IKFPLV++KVRPP+RKLKTT+KASRPNLF+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSNIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  178



>gb|EMS54441.1| 60S ribosomal protein L18a [Triticum urartu]
Length=178

 Score =   326 bits (836),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF NSKIKFPLV++KVRPP+RKLKTTYKA+RPNLF+
Sbjct  121  PCIQIIKTATVNFKLCKRDNTKQFHNSKIKFPLVYQKVRPPTRKLKTTYKATRPNLFM  178



>ref|XP_002449311.1| hypothetical protein SORBIDRAFT_05g007540 [Sorghum bicolor]
 gb|EES08299.1| hypothetical protein SORBIDRAFT_05g007540 [Sorghum bicolor]
Length=178

 Score =   326 bits (836),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT  DEHPKIYRMKLWATNEVR+KSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVAHRFHQYQVVGRALPTPADEHPKIYRMKLWATNEVRSKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+NPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF NSKIKFPLV++KVRPP+RKLKTT+KASRPNLF+
Sbjct  121  PCIQIIKTATVDFKLCKRDNTKQFHNSKIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  178



>gb|AAM65890.1| putative 60S ribosomal protein L18A [Arabidopsis thaliana]
Length=178

 Score =   326 bits (835),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPTE DEHPKIYRMKLW  NEV AKSKFWYF+RKLKKVKK+NGQ+
Sbjct  1    MGGFRFHQYQVVGRALPTENDEHPKIYRMKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNG VEQMYTE+ASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEIASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PAKLCKRE TKQF NSKIKFPLVF+KVRPPSRKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPAKLCKREITKQFHNSKIKFPLVFRKVRPPSRKLKTTYKASKPNLFM  178



>dbj|BAJ85943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=178

 Score =   326 bits (835),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF NSKIKFPLV++KVRPP+RKLKTTYKA+RPNLF+
Sbjct  121  PCIQIIKTATVDFKLCKRDNTKQFHNSKIKFPLVYQKVRPPTRKLKTTYKATRPNLFM  178



>gb|EMT24993.1| 60S ribosomal protein L18a [Aegilops tauschii]
Length=178

 Score =   325 bits (834),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASRHRVRA  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF NSKIKFPLV++KVRPP+RKLKTTYKA+RPNLF+
Sbjct  121  PCIQIIKTATVDFKLCKRDNTKQFHNSKIKFPLVYQKVRPPTRKLKTTYKATRPNLFM  178



>ref|XP_006654794.1| PREDICTED: 60S ribosomal protein L18a-like [Oryza brachyantha]
Length=178

 Score =   325 bits (833),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV YRFHQYQVVGRALPT  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAYRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+NPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF N  IKFPLV++KVRPP+RKLKTT+KASRPNLF+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNGSIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  178



>ref|NP_001149475.1| LOC100283101 [Zea mays]
 ref|XP_002458279.1| hypothetical protein SORBIDRAFT_03g030600 [Sorghum bicolor]
 gb|ACF85683.1| unknown [Zea mays]
 gb|ACF85980.1| unknown [Zea mays]
 gb|ACG29474.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG35503.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG35547.1| 60S ribosomal protein L18a [Zea mays]
 gb|EES03399.1| hypothetical protein SORBIDRAFT_03g030600 [Sorghum bicolor]
 tpg|DAA58211.1| TPA: hypothetical protein ZEAMMB73_000159 [Zea mays]
Length=178

 Score =   325 bits (833),  Expect = 5e-110, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+NPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF NS+IKFPLV++KVRPP+RKLKTT+KASRPNLF+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  178



>gb|ACG30921.1| 60S ribosomal protein L18a [Zea mays]
 gb|AFW81142.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   325 bits (833),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 168/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+NPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF NS+IKFPLV++KVRPP+RKL+TT+KASRPNLF+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKLRTTFKASRPNLFM  178



>ref|XP_010460775.1| PREDICTED: 60S ribosomal protein L18a-1-like [Camelina sativa]
Length=178

 Score =   325 bits (832),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +R HQYQVVGRALPTE DE PKIYRMKLWATNEV AKSKFWYFLR+ KKVKK+NGQ+
Sbjct  1    MGVFRLHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYFLRRQKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I N+G+WLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+ A LCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTTYKASRPNLF+
Sbjct  121  PCIQIIKTATVQANLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_010679799.1| PREDICTED: 60S ribosomal protein L18a-2 [Beta vulgaris subsp. 
vulgaris]
Length=178

 Score =   324 bits (831),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 154/178 (87%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPTE+D HPKIYRMKLWATN+VRAKSKFWYFLRKLKKVKK+ GQV
Sbjct  1    MGQFRFHQYQVVGRALPTESDAHPKIYRMKLWATNDVRAKSKFWYFLRKLKKVKKSVGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEI+EKNPT I NYG+WLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIYEKNPTLIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRA  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+P +LCKRE+TKQF    IKFPLVFKKVRPPSRKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPDELCKRENTKQFHAKDIKFPLVFKKVRPPSRKLKTTYKASKPNLFM  178



>gb|EMT07340.1| 60S ribosomal protein L18a [Aegilops tauschii]
Length=178

 Score =   324 bits (831),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF NSKIKFPLV++KVRPP+RKLKTTYK +RPNLF+
Sbjct  121  PCIQIIKTATVNFKLCKRDNTKQFHNSKIKFPLVYQKVRPPTRKLKTTYKVTRPNLFM  178



>ref|NP_001148024.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG29459.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   324 bits (831),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+NPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF NS IKFPLV++KVRPP+RKL+TT+KASRPNLF+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSAIKFPLVYRKVRPPTRKLRTTFKASRPNLFM  178



>ref|XP_006644488.1| PREDICTED: 60S ribosomal protein L18a-like [Oryza brachyantha]
Length=178

 Score =   324 bits (831),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+NPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF N+ IKFPLV++KVRPP+RKLKTT+KASRPNLF+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNASIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  178



>ref|XP_004969468.1| PREDICTED: 60S ribosomal protein L18a-like [Setaria italica]
Length=178

 Score =   324 bits (830),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+NPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRA  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF NSKIKFPLV +K+RPP+RKLKTT+KASRPNLF+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSKIKFPLVSRKIRPPTRKLKTTFKASRPNLFM  178



>ref|XP_003567891.1| PREDICTED: 60S ribosomal protein L18a-like [Brachypodium distachyon]
Length=178

 Score =   324 bits (830),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 153/178 (86%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+   LCKR++TKQF NSKIKFPLV++KVRPP+RKLKTTYKA+RPNLF+
Sbjct  121  PCIQIIKTATVHFSLCKRDNTKQFHNSKIKFPLVYQKVRPPTRKLKTTYKATRPNLFM  178



>ref|NP_001043805.2| Os01g0666900 [Oryza sativa Japonica Group]
 gb|EEC71234.1| hypothetical protein OsI_03189 [Oryza sativa Indica Group]
 dbj|BAF05719.2| Os01g0666900 [Oryza sativa Japonica Group]
Length=178

 Score =   323 bits (829),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+NPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF N  IKFPLV++KVRPP+RKLKTT+KASRPNLF+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNGSIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  178



>ref|XP_006415527.1| hypothetical protein EUTSA_v10009933mg [Eutrema salsugineum]
 gb|ESQ33880.1| hypothetical protein EUTSA_v10009933mg [Eutrema salsugineum]
Length=317

 Score =   328 bits (842),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/173 (90%), Positives = 166/173 (96%), Gaps = 0/173 (0%)
 Frame = +1

Query  91   FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINE  270
            FHQYQVVGRALPTE + HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+LAINE
Sbjct  145  FHQYQVVGRALPTEKELHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINE  204

Query  271  IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  450
            IFEKNPTKI N+G+WLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  205  IFEKNPTKIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRFPCIQI  264

Query  451  IKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKTAT+PA LCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTTYKAS+PNLF+
Sbjct  265  IKTATVPAALCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  317



>gb|ACF78859.1| unknown [Zea mays]
Length=178

 Score =   323 bits (829),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT  DEHPKIYRMKLWATNEVRAKSKFWYFLR LKKVKK+NGQV
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRNLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+NPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF NS+IKFPLV++KVRPP+RKLKTT+KASRPNLF+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  178



>gb|ACN28455.1| unknown [Zea mays]
 gb|AFW79177.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   323 bits (828),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 167/178 (94%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+NPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF NS IKFPLV++KVRPP+RKL+TT+K+SRPNLF+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSAIKFPLVYRKVRPPTRKLRTTFKSSRPNLFM  178



>ref|XP_004979031.1| PREDICTED: 60S ribosomal protein L18a-like [Setaria italica]
Length=178

 Score =   323 bits (827),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVAHRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+NPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRA  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF N+KIKFPLV +K+RPP+RKLKTT+KASRPNLF+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNAKIKFPLVSRKIRPPTRKLKTTFKASRPNLFM  178



>ref|NP_001044264.1| Os01g0752300 [Oryza sativa Japonica Group]
 ref|XP_006644713.1| PREDICTED: 60S ribosomal protein L18a-like [Oryza brachyantha]
 sp|Q943F3.1|RL18A_ORYSJ RecName: Full=60S ribosomal protein L18a [Oryza sativa Japonica 
Group]
 pdb|3J61|S Chain S, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAB67920.1| putative ribosomal protein L18a [Oryza sativa Japonica Group]
 dbj|BAB89536.1| putative ribosomal protein L18a [Oryza sativa Japonica Group]
 dbj|BAF06178.1| Os01g0752300 [Oryza sativa Japonica Group]
 gb|EAY75840.1| hypothetical protein OsI_03756 [Oryza sativa Indica Group]
 gb|EAZ13560.1| hypothetical protein OsJ_03475 [Oryza sativa Japonica Group]
Length=178

 Score =   323 bits (827),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 165/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGR LPT TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MGAFRFHQYQVVGRGLPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF  S IKFPLV++KVRPP+RKLKTT+KASRPNLF+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHKSDIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  178



>ref|NP_001152227.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG46491.1| 60S ribosomal protein L18a [Zea mays]
 gb|AFW83498.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   322 bits (826),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 152/178 (85%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+NPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF NS+IKFPLV +KVRPP+RKL+TT+KASRPNLF+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVHRKVRPPTRKLRTTFKASRPNLFM  178



>ref|XP_004491319.1| PREDICTED: LOW QUALITY PROTEIN: probable aspartic protease At2g35615-like 
[Cicer arietinum]
Length=748

 Score =   340 bits (873),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 160/179 (89%), Positives = 170/179 (95%), Gaps = 0/179 (0%)
 Frame = +1

Query  73   KMVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQ  252
            KMV  +FHQYQVVGRALPTET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ
Sbjct  570  KMVNMKFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  629

Query  253  VLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  432
            VLAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR
Sbjct  630  VLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVETMYNEMASRHRVR  689

Query  433  HHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
              CIQIIKTATIPA LCKRESTKQF NSKIKFPLV+KK+RPPSRKLKTTYKA++PNLF+
Sbjct  690  FPCIQIIKTATIPASLCKRESTKQFHNSKIKFPLVYKKIRPPSRKLKTTYKANKPNLFM  748



>ref|XP_003569521.1| PREDICTED: 60S ribosomal protein L18a-like [Brachypodium distachyon]
Length=178

 Score =   322 bits (824),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 166/178 (93%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I N+G+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+   LCKR++TKQF NSKIKFPLV++KVRPP+RKLKTT+KA+RPNLF+
Sbjct  121  PCIQIIKTATVHFSLCKRDNTKQFHNSKIKFPLVYQKVRPPTRKLKTTFKATRPNLFM  178



>ref|XP_010940708.1| PREDICTED: 60S ribosomal protein L18a-2-like [Elaeis guineensis]
Length=178

 Score =   321 bits (822),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPT +DEHPKIYRMKLWATNEVRAKSKFWYFL KLKKVKK+NGQV
Sbjct  1    MGNFRFHQYQVVGRALPTPSDEHPKIYRMKLWATNEVRAKSKFWYFLSKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+ PTKI NYG+WLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASRHRVR+
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASRHRVRY  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF +SKIKFPLVFKK+RPP+RKLKTTYKASRPNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKIRPPTRKLKTTYKASRPNLFM  178



>emb|CDY35269.1| BnaC03g59540D [Brassica napus]
Length=178

 Score =   321 bits (822),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 151/178 (85%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPTE +  PKIYRMKLWATNEVRA SKFWYFLRK  K+KK+NGQ+
Sbjct  1    MGVFRFHQYQVVGRALPTEKEVQPKIYRMKLWATNEVRAMSKFWYFLRKQVKIKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I N+G+WLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PA LCKRESTKQF NSKIKFPLV++KVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  PCIQIIKTATVPAALCKRESTKQFHNSKIKFPLVYRKVRPPTRKLKTTYKASKPNLFM  178



>ref|XP_010936051.1| PREDICTED: 60S ribosomal protein L18a-2 [Elaeis guineensis]
Length=178

 Score =   320 bits (821),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 159/178 (89%), Positives = 169/178 (95%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPT +DEHPKIYRMKLWATNEVRAKSKFWYFL KLKKVKK+NGQV
Sbjct  1    MGNFRFHQYQVVGRALPTPSDEHPKIYRMKLWATNEVRAKSKFWYFLSKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+ PTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRHRVR+
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASRHRVRY  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            HCIQIIKTATIPAKLCKRESTKQF +SKIKFPLVFKKVRPP+RKLKTTYKASRPNLF+
Sbjct  121  HCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  178



>ref|XP_003617399.1| 60S ribosomal protein L18a [Medicago truncatula]
Length=749

 Score =   338 bits (868),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 159/182 (87%), Positives = 168/182 (92%), Gaps = 0/182 (0%)
 Frame = +1

Query  64   LVEKMVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKA  243
             V KMV  +FHQYQVVGRALPTE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+
Sbjct  568  FVAKMVNAKFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  627

Query  244  NGQVLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH  423
            NGQVLAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASRH
Sbjct  628  NGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVETMYNEMASRH  687

Query  424  RVRHHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNL  603
            RVR  CIQIIKTATIPA LCKRESTKQF NSKIKFPLV+KK+RPP+R LKTTYKA +PNL
Sbjct  688  RVRFPCIQIIKTATIPANLCKRESTKQFHNSKIKFPLVYKKIRPPTRSLKTTYKAKKPNL  747

Query  604  FV  609
            F+
Sbjct  748  FM  749



>ref|NP_849729.1| ribosomal protein L18ae/LX family protein [Arabidopsis thaliana]
 sp|Q8L7K0.1|R18A1_ARATH RecName: Full=60S ribosomal protein L18a-1 [Arabidopsis thaliana]
 gb|AAM91614.1| 60S ribosomal protein L18A, putative [Arabidopsis thaliana]
 gb|AAN15378.1| 60S ribosomal protein L18A, putative [Arabidopsis thaliana]
 gb|AEE31159.1| ribosomal protein L18ae/LX family protein [Arabidopsis thaliana]
Length=178

 Score =   320 bits (819),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 150/178 (84%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M   R HQYQVVGRALPTE DE PKIYRMKLWATNEV AKSKFWY+LR+ KKVKK+NGQ+
Sbjct  1    MSVIRLHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYYLRRQKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I N+G+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+PA LCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTT+KA++PNLF+
Sbjct  121  PCIQIIKTATVPASLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTFKANKPNLFM  178



>ref|XP_006306031.1| hypothetical protein CARUB_v10011327mg [Capsella rubella]
 gb|EOA38929.1| hypothetical protein CARUB_v10011327mg [Capsella rubella]
Length=319

 Score =   323 bits (828),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/173 (88%), Positives = 164/173 (95%), Gaps = 0/173 (0%)
 Frame = +1

Query  91   FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINE  270
             HQYQVVGRALPTE DEHPKIYRMKLWATNEV AKSKFWYFLR+ KKVKK+NGQ+LAINE
Sbjct  147  LHQYQVVGRALPTEKDEHPKIYRMKLWATNEVLAKSKFWYFLRRQKKVKKSNGQMLAINE  206

Query  271  IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  450
            IFEK+PTKI NYG+WLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  207  IFEKSPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRFPCIQI  266

Query  451  IKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKTAT+PA LCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTTYKA++PNLF+
Sbjct  267  IKTATVPANLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKANKPNLFM  319



>ref|XP_010666370.1| PREDICTED: 60S ribosomal protein L18a-like [Beta vulgaris subsp. 
vulgaris]
Length=177

 Score =   318 bits (814),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 149/177 (84%), Positives = 165/177 (93%), Gaps = 0/177 (0%)
 Frame = +1

Query  79   VTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVL  258
            + +RFHQYQVVGRALPTE+ EHPKIYRMKLWATN+VRAKSKFWYFLRKLKKVKK+ GQVL
Sbjct  1    MGFRFHQYQVVGRALPTESVEHPKIYRMKLWATNDVRAKSKFWYFLRKLKKVKKSVGQVL  60

Query  259  AINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  438
            AINEI+EKNPT I NYG+WLRYQSRTGYHNMYKEFRDTTLNGAVEQMY EMASRHRVR  
Sbjct  61   AINEIYEKNPTIIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYCEMASRHRVRAP  120

Query  439  CIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            CIQIIKTAT+P +LCKRE+TKQF +  IKFP+VF+KVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  CIQIIKTATVPDELCKRENTKQFHSKDIKFPMVFRKVRPPTRKLKTTYKASKPNLFM  177



>gb|ACG47612.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   316 bits (809),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+NPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNG V QMY EM SRHRVR 
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGXVXQMYNEMXSRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF NS+IKFPLV++KV PP+RKL+TT+KASRPNLF+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVXPPTRKLRTTFKASRPNLFM  178



>ref|XP_003569823.1| PREDICTED: 60S ribosomal protein L18a [Brachypodium distachyon]
Length=178

 Score =   313 bits (803),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 146/178 (82%), Positives = 163/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGR LPT T+E PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAFRFHQYQVVGRGLPTPTEEKPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LA NEIFEKNPT I N+G+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAFNEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+   +CKR++TKQF  S IKFPLV++KVRPP+RKLKTT+KA+RPNLF+
Sbjct  121  PCIQIIKTATVHFSICKRDNTKQFHKSDIKFPLVYQKVRPPTRKLKTTFKATRPNLFM  178



>ref|XP_004961208.1| PREDICTED: 60S ribosomal protein L18a-like [Setaria italica]
Length=339

 Score =   319 bits (817),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/177 (85%), Positives = 164/177 (93%), Gaps = 0/177 (0%)
 Frame = +1

Query  79   VTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVL  258
             T  FHQYQVVGRALPT  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+L
Sbjct  163  CTIAFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQML  222

Query  259  AINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  438
            AINEIFE+NPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  
Sbjct  223  AINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRAP  282

Query  439  CIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            CIQIIKTAT+  KLCKR++TKQF NSKIKFPLV++KVRPP+RKLKTT+KASRPNLF+
Sbjct  283  CIQIIKTATVHFKLCKRDNTKQFHNSKIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  339



>ref|XP_010549484.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Tarenaya 
hassleriana]
Length=312

 Score =   318 bits (814),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/170 (89%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = +1

Query  100  YQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEIFE  279
            Y     ALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+LAINEIFE
Sbjct  143  YHCFVPALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFE  202

Query  280  KNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKT  459
            KNPTKI NYG+WLRYQSRTGYHNMYKE+RD TLNGAVEQMYTEMASRHRVR  CIQIIKT
Sbjct  203  KNPTKIKNYGIWLRYQSRTGYHNMYKEYRDITLNGAVEQMYTEMASRHRVRFPCIQIIKT  262

Query  460  ATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            AT+PAKLCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTTYKAS+PNLF+
Sbjct  263  ATVPAKLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTYKASKPNLFM  312



>ref|NP_001152434.1| LOC100286074 [Zea mays]
 gb|ACG47606.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   313 bits (801),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 148/178 (83%), Positives = 164/178 (92%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRAL T TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+ GQ+
Sbjct  1    MVAHRFHQYQVVGRALXTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSXGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFE+ PT I NYG+WLRYQSRTGYHNMYKE+R TTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINEIFERXPTTIKNYGIWLRYQSRTGYHNMYKEYRXTTLNGAVEQMYNEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTAT+  KLCKR++TKQF NS+IKFPLV++KVRPP+RKL+TT+KASRPNLF+
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKLRTTFKASRPNLFM  178



>ref|XP_002893593.1| 60S ribosomal protein L18A-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69852.1| 60S ribosomal protein L18A-1 [Arabidopsis lyrata subsp. lyrata]
Length=314

 Score =   316 bits (810),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/173 (86%), Positives = 161/173 (93%), Gaps = 0/173 (0%)
 Frame = +1

Query  91   FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINE  270
             HQYQVVGRALP E DE PKIYRMKLWATNEV AKSKFWYFLR+ KKVKK+NGQ+LAINE
Sbjct  142  LHQYQVVGRALPMEKDEQPKIYRMKLWATNEVLAKSKFWYFLRRQKKVKKSNGQMLAINE  201

Query  271  IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  450
            IFEKNPT I N+G+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  202  IFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  261

Query  451  IKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKTAT+PA LCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTT+KAS+PNLF+
Sbjct  262  IKTATVPANLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTFKASKPNLFM  314



>ref|NP_001077626.1| 60S ribosomal protein L18a-1 [Arabidopsis thaliana]
 gb|AEE31161.1| 60S ribosomal protein L18a-1 [Arabidopsis thaliana]
Length=312

 Score =   315 bits (807),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 148/173 (86%), Positives = 162/173 (94%), Gaps = 0/173 (0%)
 Frame = +1

Query  91   FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINE  270
             HQYQVVGRALPTE DE PKIYRMKLWATNEV AKSKFWY+LR+ KKVKK+NGQ+LAINE
Sbjct  140  LHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYYLRRQKKVKKSNGQMLAINE  199

Query  271  IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  450
            IFEKNPT I N+G+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  200  IFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  259

Query  451  IKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKTAT+PA LCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTT+KA++PNLF+
Sbjct  260  IKTATVPASLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTFKANKPNLFM  312



>gb|EEE55145.1| hypothetical protein OsJ_02939 [Oryza sativa Japonica Group]
Length=198

 Score =   309 bits (792),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/198 (76%), Positives = 165/198 (83%), Gaps = 20/198 (10%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGRALPT  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  256  LAINE--------------------IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTT  375
            LAIN                     IFE+NPT I NYG+WLRYQSRTGYHNMYKE+RDTT
Sbjct  61   LAINGGGPSAFANEFFIFLHHGFVGIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTT  120

Query  376  LNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRP  555
            LNGAVEQMYTEMASRHRVR  CIQIIKTAT+  KLCKR++TKQF N  IKFPLV++KVRP
Sbjct  121  LNGAVEQMYTEMASRHRVRFPCIQIIKTATVHFKLCKRDNTKQFHNGSIKFPLVYRKVRP  180

Query  556  PSRKLKTTYKASRPNLFV  609
            P+RKLKTT+KASRPNLF+
Sbjct  181  PTRKLKTTFKASRPNLFM  198



>dbj|BAB90499.1| ribosomal protein L18a-like [Oryza sativa Japonica Group]
Length=195

 Score =   308 bits (790),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 166/195 (85%), Gaps = 17/195 (9%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKF----------W------  207
            MV +RFHQYQVVGRALPT  DEHPKIYRMKLWATNEVRAKSKF          W      
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFCSSYLVRFADWGACPVC  60

Query  208  -YFLRKLKKVKKANGQVLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNG  384
             YFLRKLKKVKK+NGQ+LAINEIFE+NPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNG
Sbjct  61   RYFLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNG  120

Query  385  AVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSR  564
            AVEQMYTEMASRHRVR  CIQIIKTAT+  KLCKR++TKQF N  IKFPLV++KVRPP+R
Sbjct  121  AVEQMYTEMASRHRVRFPCIQIIKTATVHFKLCKRDNTKQFHNGSIKFPLVYRKVRPPTR  180

Query  565  KLKTTYKASRPNLFV  609
            KLKTT+KASRPNLF+
Sbjct  181  KLKTTFKASRPNLFM  195



>ref|XP_001762693.1| predicted protein [Physcomitrella patens]
 ref|XP_001768277.1| predicted protein [Physcomitrella patens]
 gb|EDQ66891.1| predicted protein [Physcomitrella patens]
 gb|EDQ72492.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   308 bits (788),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/177 (82%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = +1

Query  79   VTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVL  258
            +++RFHQYQVVGRALPT T+E PK YRMKLWATNEVRAKSKFWYFLRKL+KVKKA+GQ+L
Sbjct  1    MSFRFHQYQVVGRALPTATNETPKAYRMKLWATNEVRAKSKFWYFLRKLQKVKKAHGQLL  60

Query  259  AINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  438
            AINEIFEK PT I NYG+W+RYQSRTGYHNMYKE+RD TLNGAVEQMY EMASRHRVR  
Sbjct  61   AINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYKEYRDLTLNGAVEQMYDEMASRHRVRFP  120

Query  439  CIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            CIQIIKTATIP  LCKR +TKQF NSKIKFPL  +K+RPPSR LKTTYKASRPN FV
Sbjct  121  CIQIIKTATIPVSLCKRVNTKQFHNSKIKFPLTTRKIRPPSRSLKTTYKASRPNTFV  177



>ref|XP_009419339.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=173

 Score =   306 bits (785),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 147/177 (83%), Positives = 159/177 (90%), Gaps = 5/177 (3%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPT   EHPKIYRMKLWATNE RAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MTIFRFHQYQVVGRALPTAAVEHPKIYRMKLWATNEARAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAIN IFE+ PTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINVIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRC  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF  606
             CIQII+TATIP+KLC     KQF +SKIKFP+VFKKVRPP+RKLKTT+KASRP+LF
Sbjct  121  LCIQIIRTATIPSKLC-----KQFHDSKIKFPVVFKKVRPPTRKLKTTFKASRPSLF  172



>ref|XP_001765218.1| predicted protein [Physcomitrella patens]
 ref|XP_001774990.1| predicted protein [Physcomitrella patens]
 gb|EDQ60256.1| predicted protein [Physcomitrella patens]
 gb|EDQ69946.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   306 bits (784),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 145/177 (82%), Positives = 159/177 (90%), Gaps = 0/177 (0%)
 Frame = +1

Query  79   VTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVL  258
            +++RFHQYQVVGRALPT T+E PK YRMKLWATNEVRAKSKFWYFLRKL+KVKKA+GQ+L
Sbjct  1    MSFRFHQYQVVGRALPTATNETPKAYRMKLWATNEVRAKSKFWYFLRKLQKVKKAHGQLL  60

Query  259  AINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  438
            AINEIFEK PT I NYG+W+RYQSRTGYHNMYKE+RD TLNGAVEQMY EMASRHRVR  
Sbjct  61   AINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYKEYRDLTLNGAVEQMYDEMASRHRVRFP  120

Query  439  CIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            CIQIIKTATIP  LCKR +TKQF NSKIKFPL  +K+RPP+R LKTTYKASRPN FV
Sbjct  121  CIQIIKTATIPVSLCKRVNTKQFHNSKIKFPLTTRKIRPPTRSLKTTYKASRPNTFV  177



>ref|XP_001752605.1| predicted protein [Physcomitrella patens]
 gb|EDQ82476.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   305 bits (781),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 158/177 (89%), Gaps = 0/177 (0%)
 Frame = +1

Query  79   VTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVL  258
            +++RFHQYQVVGRALPT T+E PK YRMKLWATNEVRAKSKFWYFLRKL+KVKKA+GQ+L
Sbjct  1    MSFRFHQYQVVGRALPTATNEAPKAYRMKLWATNEVRAKSKFWYFLRKLQKVKKAHGQLL  60

Query  259  AINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  438
            AINEIFEK PT I NYG+W+RYQSRTGYHNMYKE+RD TLNGAVEQMY EMASRHRVR  
Sbjct  61   AINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYKEYRDLTLNGAVEQMYDEMASRHRVRFP  120

Query  439  CIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            CIQIIKT TIP  LCKR +TKQF NSKIKFPL  +K+RPP+R LKTTYKASRPN FV
Sbjct  121  CIQIIKTGTIPVSLCKRVNTKQFHNSKIKFPLTTRKIRPPTRSLKTTYKASRPNTFV  177



>pdb|3IZS|S Chain S, Localization Of The Large Subunit Ribosomal Proteins 
Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 
80s Ribosome
Length=167

 Score =   303 bits (776),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 143/167 (86%), Positives = 154/167 (92%), Gaps = 0/167 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGR LPT TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MGAFRFHQYQVVGRGLPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKT  576
             CIQIIKTAT+  KLCKR++TKQF  S IKFPLV++KVRPP+RKLKT
Sbjct  121  PCIQIIKTATVHFKLCKRDNTKQFHKSDIKFPLVYRKVRPPTRKLKT  167



>ref|XP_001760636.1| predicted protein [Physcomitrella patens]
 gb|EDQ74375.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   303 bits (775),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/177 (81%), Positives = 157/177 (89%), Gaps = 0/177 (0%)
 Frame = +1

Query  79   VTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVL  258
            + +RFHQYQVVGRALPT  +E PK YRMKLWAT+EVRAKSKFWYFLRKL+KVKKA+GQ+L
Sbjct  1    MIFRFHQYQVVGRALPTPGNETPKAYRMKLWATDEVRAKSKFWYFLRKLQKVKKAHGQLL  60

Query  259  AINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHH  438
            AINEIFEK PT I NYG+W+RYQSRTGYHNMYKE+RD TLNGAVEQMY EMASRHRVR  
Sbjct  61   AINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYKEYRDLTLNGAVEQMYDEMASRHRVRSP  120

Query  439  CIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            CIQIIKTATIP  LCKR +TKQF NSKIKFPL  +K+RPPSR LKTTYKASRPN FV
Sbjct  121  CIQIIKTATIPVALCKRVNTKQFHNSKIKFPLTSRKIRPPSRSLKTTYKASRPNTFV  177



>gb|AAG52055.1|AC022455_9 60S ribosomal protein L18A, putative; 23187-20334 [Arabidopsis 
thaliana]
Length=321

 Score =   307 bits (786),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 162/185 (88%), Gaps = 12/185 (6%)
 Frame = +1

Query  91   FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINE  270
             HQYQVVGRALPTE DE PKIYRMKLWATNEV AKSKFWY+LR+ KKVKK+NGQ+LAINE
Sbjct  137  LHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYYLRRQKKVKKSNGQMLAINE  196

Query  271  ------------IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMA  414
                        IFEKNPT I N+G+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMA
Sbjct  197  VLAVGSEFDLFSIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMA  256

Query  415  SRHRVRHHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASR  594
            SRHRVR  CIQIIKTAT+PA LCKRESTKQF NSKIKFPLVF+KVRPP+RKLKTT+KA++
Sbjct  257  SRHRVRFPCIQIIKTATVPASLCKRESTKQFHNSKIKFPLVFRKVRPPTRKLKTTFKANK  316

Query  595  PNLFV  609
            PNLF+
Sbjct  317  PNLFM  321



>gb|ADU56180.1| hypothetical protein [Jatropha curcas]
Length=154

 Score =   297 bits (760),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/154 (92%), Positives = 149/154 (97%), Gaps = 0/154 (0%)
 Frame = +1

Query  148  KIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEIFEKNPTKINNYGVWLRYQ  327
            KIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQVLAINEIFEKNPTKI NYG+WLRYQ
Sbjct  1    KIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQ  60

Query  328  SRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQF  507
            SRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKT TIPAKLCKRES+KQF
Sbjct  61   SRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTGTIPAKLCKRESSKQF  120

Query  508  LNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             NSKIKFPLVFKKVRPP+RKL+TTYKASRPNLF+
Sbjct  121  HNSKIKFPLVFKKVRPPTRKLRTTYKASRPNLFM  154



>gb|AAT08714.1| ribosomal protein L18A [Hyacinthus orientalis]
Length=178

 Score =   296 bits (758),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 148/182 (81%), Positives = 160/182 (88%), Gaps = 8/182 (4%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  +RFHQYQVVGRALPT +DEHPKI+RMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MGGFRFHQYQVVGRALPTPSDEHPKIFRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHN----MYKEFRDTTLNGAVEQMYTEMASRH  423
            LAINEIFEKNPTKI    + LR+ +     N    MYKE+RDTTLNG VEQMYTEMASRH
Sbjct  61   LAINEIFEKNPTKI----IELRHMAEVPEQNRLSYMYKEYRDTTLNGGVEQMYTEMASRH  116

Query  424  RVRHHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNL  603
            RVR  CIQIIKTATIPAKLCKRESTKQF +SKIKFPLVFKKVRPP+RKLKTT+KASRPNL
Sbjct  117  RVRFPCIQIIKTATIPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTFKASRPNL  176

Query  604  FV  609
            F+
Sbjct  177  FM  178



>ref|XP_002961150.1| hypothetical protein SELMODRAFT_227198 [Selaginella moellendorffii]
 ref|XP_002966859.1| hypothetical protein SELMODRAFT_270606 [Selaginella moellendorffii]
 gb|EFJ31458.1| hypothetical protein SELMODRAFT_270606 [Selaginella moellendorffii]
 gb|EFJ38689.1| hypothetical protein SELMODRAFT_227198 [Selaginella moellendorffii]
Length=177

 Score =   296 bits (758),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 156/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  85   YRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAI  264
            +RFHQYQVVGRA PT  +EHPK+YRMKLWA +EVRAKSKFWYFLRKLKKVKK++GQ+LAI
Sbjct  3    FRFHQYQVVGRATPTPDNEHPKMYRMKLWAGDEVRAKSKFWYFLRKLKKVKKSHGQILAI  62

Query  265  NEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  444
            NEIFEKNPT I NYG+W+RYQSRTGYHNMYKE+RD TLNGAVEQMY EMASRHRVR  CI
Sbjct  63   NEIFEKNPTTIKNYGIWVRYQSRTGYHNMYKEYRDITLNGAVEQMYDEMASRHRVRFPCI  122

Query  445  QIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            QIIKTA++P   CKRE+TKQF +S+IKFPL+ +K+R PSRKLKTT+KA RPN F 
Sbjct  123  QIIKTASVPDSACKRENTKQFHSSEIKFPLMNRKIRAPSRKLKTTFKAKRPNTFA  177



>ref|XP_011460183.1| PREDICTED: 60S ribosomal protein L18a [Fragaria vesca subsp. 
vesca]
Length=178

 Score =   296 bits (758),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 147/178 (83%), Positives = 162/178 (91%), Gaps = 0/178 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV  ++HQYQVVGRALP + ++ PKIYRMKLW TNEVRAKSKFWYFL+KLKKVKK+NGQ+
Sbjct  1    MVALKYHQYQVVGRALPKDAEDTPKIYRMKLWHTNEVRAKSKFWYFLKKLKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEK PT + NYG+WLRYQSRTGYHNMYKE+RDTTLNGAV+QMY EMASRHRVR 
Sbjct  61   LAINEIFEKKPTVVENYGIWLRYQSRTGYHNMYKEYRDTTLNGAVDQMYNEMASRHRVRF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIK ATIPAKLCKRE TKQF NSKIKFPL+ +KVRPP+RKLKTTYKASRPNLFV
Sbjct  121  PCIQIIKIATIPAKLCKRECTKQFHNSKIKFPLITRKVRPPTRKLKTTYKASRPNLFV  178



>ref|XP_006387416.1| hypothetical protein POPTR_1064s00200g [Populus trichocarpa]
 gb|ERP46330.1| hypothetical protein POPTR_1064s00200g [Populus trichocarpa]
Length=150

 Score =   295 bits (754),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 142/150 (95%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  160  MKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEIFEKNPTKINNYGVWLRYQSRTG  339
            MKLWATNEVRAKSKFWYFLRKLKKVKK+NGQVLAINEIFEKNPTKI NYG+WLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTG  60

Query  340  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFLNSK  519
            YHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKTATIPAKLCKRESTKQF NSK
Sbjct  61   YHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSK  120

Query  520  IKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKFPLVFKKVRPPSRKLKTTYKASRPNLF+
Sbjct  121  IKFPLVFKKVRPPSRKLKTTYKASRPNLFM  150



>ref|XP_007146225.1| hypothetical protein PHAVU_006G022700g [Phaseolus vulgaris]
 gb|ESW18219.1| hypothetical protein PHAVU_006G022700g [Phaseolus vulgaris]
Length=159

 Score =   293 bits (750),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 144/178 (81%), Positives = 154/178 (87%), Gaps = 19/178 (11%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPTETD HPKIYRMKLWATNEVRAKSKFWYFLRK+KKVKK+NGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTETDVHPKIYRMKLWATNEVRAKSKFWYFLRKVKKVKKSNGQM  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINE                   SRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR 
Sbjct  61   LAINE-------------------SRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRC  101

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
             CIQIIKTATIPAKLCKRE TKQFL+SKIKFPLVFKK+RPP+RKLKTTYKAS+PNLF+
Sbjct  102  PCIQIIKTATIPAKLCKRECTKQFLDSKIKFPLVFKKIRPPTRKLKTTYKASKPNLFM  159



>gb|KJB34967.1| hypothetical protein B456_006G092900 [Gossypium raimondii]
 gb|KJB42783.1| hypothetical protein B456_007G174800 [Gossypium raimondii]
 gb|KJB69798.1| hypothetical protein B456_011G042800 [Gossypium raimondii]
Length=150

 Score =   290 bits (743),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 139/150 (93%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  160  MKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEIFEKNPTKINNYGVWLRYQSRTG  339
            MKLWATNEVRAKSKFWYFLRKLKKVKK+NGQVLAINEIFEKNPTKI NYG+WLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTG  60

Query  340  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFLNSK  519
            YHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKTATIPAKLCKR+STKQF NSK
Sbjct  61   YHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSK  120

Query  520  IKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKFPLVFKKVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  IKFPLVFKKVRPPTRKLKTTYKASKPNLFM  150



>emb|CDX98480.1| BnaC05g38950D [Brassica napus]
Length=150

 Score =   290 bits (742),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  160  MKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEIFEKNPTKINNYGVWLRYQSRTG  339
            MKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+LAINEIFEKNPTKI NYG+WLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTG  60

Query  340  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFLNSK  519
            YHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQF NSK
Sbjct  61   YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSK  120

Query  520  IKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKFPLVF+KVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  IKFPLVFRKVRPPTRKLKTTYKASKPNLFM  150



>ref|NP_001237792.1| uncharacterized protein LOC100305604 [Glycine max]
 gb|ACU13370.1| unknown [Glycine max]
Length=150

 Score =   290 bits (742),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 138/150 (92%), Positives = 144/150 (96%), Gaps = 0/150 (0%)
 Frame = +1

Query  160  MKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEIFEKNPTKINNYGVWLRYQSRTG  339
            MKLWATNEVRAKSKFWYFLRKLKKVKK+NGQVLAINEIFEKNPTKI NYG+WLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTG  60

Query  340  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFLNSK  519
            YHNMYKE+RDTTLNGAVE MYTEMASRHRVRH CIQIIKTAT PAKLCKRESTKQF NSK
Sbjct  61   YHNMYKEYRDTTLNGAVEHMYTEMASRHRVRHPCIQIIKTATTPAKLCKRESTKQFHNSK  120

Query  520  IKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKFPLVFKK+RPP+RKLKTTYK SRPNLF+
Sbjct  121  IKFPLVFKKIRPPTRKLKTTYKTSRPNLFM  150



>gb|EYU33347.1| hypothetical protein MIMGU_mgv1a014797mg [Erythranthe guttata]
Length=150

 Score =   289 bits (739),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  160  MKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEIFEKNPTKINNYGVWLRYQSRTG  339
            MKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+LAINEIFEKNPT I NYG+WLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTG  60

Query  340  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFLNSK  519
            YHNMYKE+RDTTLNGAVE MYTEMASRHRVR+HCIQIIKTATIPAKLCKRESTKQF NSK
Sbjct  61   YHNMYKEYRDTTLNGAVEHMYTEMASRHRVRYHCIQIIKTATIPAKLCKRESTKQFHNSK  120

Query  520  IKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKFPLVF KVRPP+RKLKTTYKA++PNLF+
Sbjct  121  IKFPLVFHKVRPPTRKLKTTYKATKPNLFM  150



>gb|KJB10615.1| hypothetical protein B456_001G211400 [Gossypium raimondii]
Length=150

 Score =   288 bits (736),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 137/150 (91%), Positives = 146/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  160  MKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEIFEKNPTKINNYGVWLRYQSRTG  339
            MKLWATNEVRAKSKFWYFLRKLKKVKK+NGQVLAINEIFEK+PTKI NYG+WLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKSPTKIKNYGIWLRYQSRTG  60

Query  340  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFLNSK  519
            YHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKTATIPAKLCKR+STKQF NSK
Sbjct  61   YHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSK  120

Query  520  IKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKFPLVFKKVRPP+RKLKTTYKA++PNLF+
Sbjct  121  IKFPLVFKKVRPPTRKLKTTYKATKPNLFM  150



>emb|CDX84313.1| BnaC04g10750D [Brassica napus]
Length=150

 Score =   287 bits (734),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  160  MKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEIFEKNPTKINNYGVWLRYQSRTG  339
            MKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+LAINEIFEKNPT I N+G+WLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTG  60

Query  340  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFLNSK  519
            YHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQF NSK
Sbjct  61   YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSK  120

Query  520  IKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKFPLVF+KVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  IKFPLVFRKVRPPTRKLKTTYKASKPNLFM  150



>emb|CDX84643.1| BnaA03g15870D [Brassica napus]
Length=150

 Score =   286 bits (733),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 136/150 (91%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  160  MKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEIFEKNPTKINNYGVWLRYQSRTG  339
            MKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+LAINEIFEKNPT I N+G+WLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTG  60

Query  340  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFLNSK  519
            YHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQF NSK
Sbjct  61   YHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSK  120

Query  520  IKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKFPLVF+KVRPPSRKLKTTYKAS+PNLF+
Sbjct  121  IKFPLVFRKVRPPSRKLKTTYKASKPNLFM  150



>emb|CDX82474.1| BnaA03g33470D [Brassica napus]
Length=150

 Score =   286 bits (732),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  160  MKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEIFEKNPTKINNYGVWLRYQSRTG  339
            MKLWA+NEVRAKSKFWYFLRKLKKVKK+NGQ+LAINEIFEK+PTKI NYG+WLRYQSRTG
Sbjct  1    MKLWASNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKSPTKIKNYGIWLRYQSRTG  60

Query  340  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFLNSK  519
            YHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  CIQIIKTAT+PA LCKRESTKQF NSK
Sbjct  61   YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPASLCKRESTKQFHNSK  120

Query  520  IKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKFPLVF+KVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  IKFPLVFRKVRPPTRKLKTTYKASKPNLFM  150



>emb|CDY43672.1| BnaA04g20190D [Brassica napus]
 emb|CDY17253.1| BnaA05g09350D [Brassica napus]
Length=150

 Score =   285 bits (730),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 135/150 (90%), Positives = 145/150 (97%), Gaps = 0/150 (0%)
 Frame = +1

Query  160  MKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEIFEKNPTKINNYGVWLRYQSRTG  339
            MKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+LAINEIFEKNPT I N+G+WLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTG  60

Query  340  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFLNSK  519
            YHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRESTKQF NSK
Sbjct  61   YHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKRESTKQFHNSK  120

Query  520  IKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKFPLVF+KVRPP+RKLKTTYKAS+PNLF+
Sbjct  121  IKFPLVFRKVRPPTRKLKTTYKASKPNLFM  150



>dbj|BAH20340.1| AT3G14600 [Arabidopsis thaliana]
Length=150

 Score =   276 bits (705),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 131/150 (87%), Positives = 140/150 (93%), Gaps = 0/150 (0%)
 Frame = +1

Query  160  MKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEIFEKNPTKINNYGVWLRYQSRTG  339
            MKLW  NEV AKSKFWYF+RKLKKVKK+NGQ+LAINEIFEKNPT I NYG+WLRYQSRTG
Sbjct  1    MKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTG  60

Query  340  YHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFLNSK  519
            YHNMYKE+RDTTLNG VEQMYTEMASRHRVR  CIQIIKTAT+PAKLCKRE TKQF NSK
Sbjct  61   YHNMYKEYRDTTLNGGVEQMYTEMASRHRVRFPCIQIIKTATVPAKLCKREITKQFHNSK  120

Query  520  IKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKFPLVF+KVRPPSRKLKTTYKAS+PNLF+
Sbjct  121  IKFPLVFRKVRPPSRKLKTTYKASKPNLFM  150



>ref|XP_005652280.1| 60S ribosomal protein L18a-2 [Coccomyxa subellipsoidea C-169]
 gb|EIE27736.1| 60S ribosomal protein L18a-2 [Coccomyxa subellipsoidea C-169]
Length=179

 Score =   276 bits (706),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  Y++HQYQVVGR LPTE +  P IYRMKLWAT+ VRAKSKFWYFLRKL+KVKKANGQ+
Sbjct  1    MGGYKYHQYQVVGRHLPTEKEPEPTIYRMKLWATDPVRAKSKFWYFLRKLRKVKKANGQI  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LA NEIFEK PT + N+GVW+RYQSRTGYHNMYKE+RDTTLNGAVEQ+Y EMASRHRVR 
Sbjct  61   LAANEIFEKKPTTVKNFGVWVRYQSRTGYHNMYKEYRDTTLNGAVEQLYQEMASRHRVRA  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNL  603
             C+QIIKTAT+PA L KR + KQF +SKIKFPL  +  RP SR  KTT+KA RPN+
Sbjct  121  PCMQIIKTATVPAALTKRVNIKQFHDSKIKFPLTRRMARPSSRTFKTTFKAVRPNV  176



>ref|XP_005848088.1| hypothetical protein CHLNCDRAFT_30965 [Chlorella variabilis]
 gb|EFN55986.1| hypothetical protein CHLNCDRAFT_30965 [Chlorella variabilis]
Length=181

 Score =   273 bits (697),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 126/173 (73%), Positives = 145/173 (84%), Gaps = 0/173 (0%)
 Frame = +1

Query  85   YRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAI  264
            Y++HQYQVVGR LP+E D  P IYRMKLWA + VRAKSKFWYFLRKL+KVKKANGQ+LA 
Sbjct  6    YKYHQYQVVGRHLPSEKDAEPTIYRMKLWAQDPVRAKSKFWYFLRKLRKVKKANGQILAC  65

Query  265  NEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  444
            NEIFE+NPT + NYG+W+RYQSRTG+HN YKE+RDTTLNGAVEQMY EM SRHRVR  CI
Sbjct  66   NEIFERNPTTVKNYGIWVRYQSRTGFHNAYKEYRDTTLNGAVEQMYQEMGSRHRVRSPCI  125

Query  445  QIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNL  603
            QIIKTATI A  CKR +T+Q  +SKI FPL  K +RP SRK +TT+KA RPN+
Sbjct  126  QIIKTATITAAQCKRAATQQLHDSKISFPLTRKVLRPSSRKYRTTFKAVRPNV  178



>gb|KCW89757.1| hypothetical protein EUGRSUZ_A02018 [Eucalyptus grandis]
Length=178

 Score =   269 bits (687),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 124/133 (93%), Positives = 130/133 (98%), Gaps = 0/133 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALPT +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  36   MVTFRFHQYQVVGRALPTGSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  95

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            LAINEIFEKNPTKINNYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR 
Sbjct  96   LAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRF  155

Query  436  HCIQIIKTATIPA  474
             CIQIIKTAT+PA
Sbjct  156  PCIQIIKTATVPA  168



>gb|KIZ01204.1| 60S ribosomal protein L18a-2 [Monoraphidium neglectum]
Length=182

 Score =   259 bits (661),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 143/173 (83%), Gaps = 0/173 (0%)
 Frame = +1

Query  85   YRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAI  264
            +++HQYQVVGR  PT  + +P +YRMK+WA + V AKSKFWYFLRKL++VKKANGQVLA+
Sbjct  7    FKYHQYQVVGRHNPTTAEPNPTVYRMKVWAPDAVCAKSKFWYFLRKLRRVKKANGQVLAV  66

Query  265  NEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  444
            NEIFE+  T + N+GVW+RYQSRTGYHNMYKE+RDTTLNGA+ QMY EMASRHRVR+ CI
Sbjct  67   NEIFERKTTTVKNFGVWVRYQSRTGYHNMYKEYRDTTLNGAIGQMYGEMASRHRVRYPCI  126

Query  445  QIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNL  603
            Q+IKTAT+PA  CKR +T QF +SKIKFPL    +RP S+  KT YKA RPN+
Sbjct  127  QVIKTATVPASACKRANTLQFHDSKIKFPLTHNALRPSSKVFKTLYKAKRPNV  179



>gb|KJB69797.1| hypothetical protein B456_011G042800 [Gossypium raimondii]
Length=145

 Score =   257 bits (657),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 130/134 (97%), Gaps = 0/134 (0%)
 Frame = +1

Query  208  YFLRKLKKVKKANGQVLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGA  387
            YFLRKLKKVKK+NGQVLAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGA
Sbjct  12   YFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGA  71

Query  388  VEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRK  567
            VEQMYTEMASRHRVR  CIQIIKTATIPAKLCKR+STKQF NSKIKFPLVFKKVRPP+RK
Sbjct  72   VEQMYTEMASRHRVRFPCIQIIKTATIPAKLCKRDSTKQFHNSKIKFPLVFKKVRPPTRK  131

Query  568  LKTTYKASRPNLFV  609
            LKTTYKAS+PNLF+
Sbjct  132  LKTTYKASKPNLFM  145



>gb|KDD75676.1| ribosomal protein L18ae/LX [Helicosporidium sp. ATCC 50920]
Length=182

 Score =   254 bits (648),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 141/176 (80%), Gaps = 0/176 (0%)
 Frame = +1

Query  73   KMVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQ  252
            K   +++ QYQVVGR LPTE D  P ++RMKLWA + VRAKSKFWYF+RKL+KVKKANGQ
Sbjct  3    KQGIFKYKQYQVVGRHLPTEKDAEPALFRMKLWAEDSVRAKSKFWYFMRKLRKVKKANGQ  62

Query  253  VLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  432
            V+A+NEI EK PT + NYG+W+RY SRTG HNMYKEFRDTTLNGAV QMY+EMA RHRVR
Sbjct  63   VVAVNEIVEKRPTVVKNYGIWVRYTSRTGVHNMYKEFRDTTLNGAVSQMYSEMAGRHRVR  122

Query  433  HHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPN  600
            H  +QIIKTA IPA+L KR   KQFL++KI+FP+  + VRP SR  K+ ++  RPN
Sbjct  123  HSALQIIKTAEIPAELVKRPGVKQFLSAKIRFPITRRLVRPSSRVHKSLFQDRRPN  178



>ref|XP_011401286.1| 60S ribosomal protein L18a-2 [Auxenochlorella protothecoides]
 gb|KFM28272.1| 60S ribosomal protein L18a-2 [Auxenochlorella protothecoides]
Length=182

 Score =   251 bits (642),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 116/175 (66%), Positives = 139/175 (79%), Gaps = 0/175 (0%)
 Frame = +1

Query  85   YRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAI  264
            Y++HQYQVVGR LPTE D  P I+RMKLWA + VRAKSKFWYFL KL+KVKKANGQ++A+
Sbjct  7    YKYHQYQVVGRHLPTEKDAEPPIFRMKLWAQDTVRAKSKFWYFLAKLRKVKKANGQIVAV  66

Query  265  NEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  444
            NEIFE+ PT I N+G+W+RY SRTG HNM+KE+RD TLNGAVEQMY EM SRHRVR   +
Sbjct  67   NEIFERRPTTIKNFGIWVRYTSRTGVHNMFKEYRDVTLNGAVEQMYQEMGSRHRVRSSAL  126

Query  445  QIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            QIIKTATI A   KR + KQF +SKI FPL  +  RP   + KTT+KA+RPN+ +
Sbjct  127  QIIKTATIKAADTKRANIKQFHDSKISFPLTRRMARPSDPRFKTTFKANRPNVAI  181



>gb|ERM96192.1| hypothetical protein AMTR_s00001p00102800 [Amborella trichopoda]
Length=138

 Score =   249 bits (637),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +1

Query  208  YFLRKLKKVKKANGQVLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGA  387
            YFLRKLKKVKK+NGQVLAINEIFEK PTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGA
Sbjct  5    YFLRKLKKVKKSNGQVLAINEIFEKKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGA  64

Query  388  VEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRK  567
            VEQMY EMASRHRVR  CIQIIKTATIPAKLCKRE+TKQF +S+IKFPLVF+KVRPP+RK
Sbjct  65   VEQMYNEMASRHRVRSPCIQIIKTATIPAKLCKRENTKQFHDSRIKFPLVFRKVRPPTRK  124

Query  568  LKTTYKASRPNLFV  609
            LKTT+KASRPNLF+
Sbjct  125  LKTTFKASRPNLFM  138



>ref|XP_001689743.1| ribosomal protein L18a, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP09481.1| ribosomal protein L18a [Chlamydomonas reinhardtii]
Length=182

 Score =   250 bits (639),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 114/173 (66%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = +1

Query  85   YRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAI  264
            ++FHQYQVVGR LPT  D +P +YRMK+WA ++V+AKSKFWYFLRKL++VKKANGQ++A 
Sbjct  7    FKFHQYQVVGRHLPTAADANPTVYRMKVWAEDDVKAKSKFWYFLRKLRRVKKANGQIIAC  66

Query  265  NEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  444
            NEIFE+ PT   NYG+W+RYQSRTG HNMYKE+RD TLNG+V QMY EMASRHRVR   I
Sbjct  67   NEIFERKPTLAKNYGIWVRYQSRTGVHNMYKEYRDVTLNGSVSQMYQEMASRHRVRPSSI  126

Query  445  QIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNL  603
            QIIKTAT+    CKR +TKQF N KI FP+  K  RP S   +T +KA+RPN+
Sbjct  127  QIIKTATVDYHSCKRANTKQFHNEKISFPVTQKLARPSSATFRTLFKANRPNV  179



>ref|XP_002948508.1| ribosomal protein L18A component of cytosolic 80S ribosome and 
60S large subunit [Volvox carteri f. nagariensis]
 gb|EFJ50383.1| ribosomal protein L18A component of cytosolic 80S ribosome and 
60S large subunit [Volvox carteri f. nagariensis]
Length=182

 Score =   249 bits (636),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 138/173 (80%), Gaps = 0/173 (0%)
 Frame = +1

Query  85   YRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAI  264
            ++FHQYQVVGR LPT  D  P +YRMK+WA ++V+AKSKFWYFLRKL++VKKANGQ++A 
Sbjct  7    FKFHQYQVVGRHLPTAADATPTVYRMKVWAEDDVKAKSKFWYFLRKLRRVKKANGQIIAC  66

Query  265  NEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCI  444
            NEIFE+ PT   NYGVW+RYQSRTG HNMYKE+RD TLNG+V QMY EMASRHRVR   I
Sbjct  67   NEIFERKPTLAKNYGVWVRYQSRTGVHNMYKEYRDVTLNGSVAQMYQEMASRHRVRPSSI  126

Query  445  QIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNL  603
            QIIKTAT+    CKR +TKQF N  IKFP+  K  RP + + +T +KASRPN+
Sbjct  127  QIIKTATVDYHSCKRANTKQFHNENIKFPVTHKLSRPSNPEFRTLFKASRPNV  179



>ref|XP_003617398.1| 60S ribosomal protein L18a [Medicago truncatula]
Length=147

 Score =   246 bits (628),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +1

Query  208  YFLRKLKKVKKANGQVLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGA  387
            YFLRKLKKVKK+NGQVLAINEIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGA
Sbjct  14   YFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGA  73

Query  388  VEQMYTEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRK  567
            VE MY EMASRHRVR  CIQIIKTATIPA LCKRESTKQF NSKIKFPLV+KK+RPP+R 
Sbjct  74   VETMYNEMASRHRVRFPCIQIIKTATIPANLCKRESTKQFHNSKIKFPLVYKKIRPPTRS  133

Query  568  LKTTYKASRPNLFV  609
            LKTTYKA +PNLF+
Sbjct  134  LKTTYKAKKPNLFM  147



>ref|XP_006387717.1| hypothetical protein POPTR_0647s00210g [Populus trichocarpa]
 gb|ERP46631.1| hypothetical protein POPTR_0647s00210g [Populus trichocarpa]
Length=152

 Score =   245 bits (626),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +1

Query  223  LKKVKKANGQVLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMY  402
            LKKVKK+NGQ+LAINEIFEKNPT I N+G+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY
Sbjct  24   LKKVKKSNGQILAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMY  83

Query  403  TEMASRHRVRHHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTY  582
            TEMASRHRVR  CIQIIKTATIPAKLCKRESTKQF NSKIKFPLVFKKVRPP+RKLKTTY
Sbjct  84   TEMASRHRVRFPCIQIIKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTY  143

Query  583  KASRPNLFV  609
            KASRPNLF+
Sbjct  144  KASRPNLFM  152



>ref|XP_007508296.1| unknown [Bathycoccus prasinos]
 emb|CCO20400.1| unknown [Bathycoccus prasinos]
Length=211

 Score =   233 bits (595),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 102/173 (59%), Positives = 135/173 (78%), Gaps = 0/173 (0%)
 Frame = +1

Query  91   FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINE  270
            +HQYQ+VGR +PTE +  P++YRMKLWA +  RA+SKFWYFL +L+KVKKANGQ++A NE
Sbjct  38   YHQYQIVGRRVPTEQEPTPQVYRMKLWALDATRARSKFWYFLSRLRKVKKANGQIIACNE  97

Query  271  IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  450
            IFEK+ T + NYGVW+RYQSR G+HN YKE+R+TT+N AV+ +YTEMASRHRVR H +QI
Sbjct  98   IFEKDDTTVKNYGVWIRYQSRVGFHNAYKEYRETTMNAAVDALYTEMASRHRVRSHALQI  157

Query  451  IKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IK A +  +  +RE+T+QFL   + FP+V K +R  S+  KTT+K  RPN  +
Sbjct  158  IKIAEVANEDVRRENTRQFLADDVSFPVVRKTLRHDSKSQKTTFKYQRPNFAI  210



>ref|XP_001418811.1| Ribosomal protein L18a, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO97104.1| Ribosomal protein L18a, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=179

 Score =   230 bits (586),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 134/175 (77%), Gaps = 0/175 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M   R+HQYQVVGR +PT+    P+++RMKLWA ++V+A+SKFWYF+ +LKKVKKANGQ+
Sbjct  1    MAKIRYHQYQVVGRHVPTDAHPEPEVFRMKLWALDDVKARSKFWYFMSRLKKVKKANGQI  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            +A NEIFE + T + N+G+W+RYQSRTGYHN YKE+R+TT+N AV+ +Y EMASRHRVR 
Sbjct  61   IACNEIFEADTTTVKNFGIWIRYQSRTGYHNSYKEYRETTMNAAVDALYEEMASRHRVRA  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPN  600
             C+QIIK A +  K  +RE+T+QF+   + FP+V K  R PS+  KT  K  RPN
Sbjct  121  SCLQIIKIAEVADKDVRRENTRQFIQDDLSFPVVTKVTRHPSKASKTIIKYKRPN  175



>emb|CEF98555.1| Ribosomal protein L18ae [Ostreococcus tauri]
Length=179

 Score =   224 bits (572),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 136/175 (78%), Gaps = 0/175 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M  YR+ Q+QVVGR LPTE    P+++RMKLWA ++V+A+SKFWYF+ +LKKVKKANGQ+
Sbjct  1    MAPYRYRQFQVVGRHLPTEATPEPEVFRMKLWALDDVKARSKFWYFMSRLKKVKKANGQI  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            +A NEIFE++ T + N+G+W+RYQSRTG+HN YKE+R+TT+N AV+ +Y EMASRHRVR 
Sbjct  61   IACNEIFEEDTTTVKNFGIWIRYQSRTGFHNSYKEYRETTMNKAVDALYEEMASRHRVRS  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPN  600
              +QIIK A +  +  +RE+T+QFL   + FP+V K +R PS+  KT +K  RPN
Sbjct  121  SQLQIIKIAEVSDENVRRENTRQFLAEDLSFPVVNKVMRHPSKATKTIFKYKRPN  175



>ref|XP_006384076.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 gb|ERP61873.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=121

 Score =   222 bits (566),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/113 (94%), Positives = 109/113 (96%), Gaps = 0/113 (0%)
 Frame = +1

Query  271  IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  450
            IFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  9    IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  68

Query  451  IKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKTATIPAKLCKRESTKQF NSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF+
Sbjct  69   IKTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFM  121



>gb|KDO49364.1| hypothetical protein CISIN_1g028910mg [Citrus sinensis]
Length=124

 Score =   222 bits (566),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 105/114 (92%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +1

Query  268  EIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  447
            EIFEKNPTKI NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQ
Sbjct  11   EIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRSPCIQ  70

Query  448  IIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            II+TATIPAKLCKRESTKQF NSKIKFPLVFKKVRPP+RKLKTTYKASRPNLF+
Sbjct  71   IIRTATIPAKLCKRESTKQFHNSKIKFPLVFKKVRPPTRKLKTTYKASRPNLFM  124



>ref|XP_011648501.1| PREDICTED: 60S ribosomal protein L18a-2-like, partial [Cucumis 
sativus]
Length=121

 Score =   218 bits (556),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 110/114 (96%), Gaps = 0/114 (0%)
 Frame = +1

Query  268  EIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  447
            +IFEKNPTK+ NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQ
Sbjct  8    QIFEKNPTKVKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRSPCIQ  67

Query  448  IIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IIKTAT+PAKLCKRESTKQF +SKIKFPLVFKKVRPP+RKLKTTYKAS+PNLF+
Sbjct  68   IIKTATVPAKLCKRESTKQFHDSKIKFPLVFKKVRPPTRKLKTTYKASKPNLFM  121



>ref|XP_003062312.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53131.1| predicted protein [Micromonas pusilla CCMP1545]
Length=185

 Score =   220 bits (561),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 100/182 (55%), Positives = 138/182 (76%), Gaps = 2/182 (1%)
 Frame = +1

Query  64   LVEKMVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKA  243
            +V+ +  +R+HQY +VGR +PT+ D +P++YRMKLW+ ++ RAKSKFWYFL +LKKVKKA
Sbjct  1    MVKGLKPHRYHQYHIVGRHVPTDADPNPQVYRMKLWSLDDTRAKSKFWYFLSRLKKVKKA  60

Query  244  NGQVLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH  423
            NGQ++A NEIFE++ T I N+G+W+RYQSRTG+HN YKE+R+ ++N AV+ +Y EMASRH
Sbjct  61   NGQIIACNEIFEEDVTTIKNFGIWIRYQSRTGFHNAYKEYREISMNKAVDALYEEMASRH  120

Query  424  RVRHHCIQIIKTATIPAKLCKRESTKQFLNSK--IKFPLVFKKVRPPSRKLKTTYKASRP  597
            RVR  C+QIIK   +     KR++T QFL  K  + FP+V K +R  S+  KTT+K  RP
Sbjct  121  RVRAPCLQIIKICQVADADVKRDNTIQFLGVKEPVSFPVVNKVLRHDSKSQKTTFKYKRP  180

Query  598  NL  603
            N 
Sbjct  181  NF  182



>ref|XP_008880083.1| hypothetical protein H310_14105 [Aphanomyces invadans]
 gb|ETV91246.1| hypothetical protein H310_14105 [Aphanomyces invadans]
Length=177

 Score =   219 bits (557),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 131/172 (76%), Gaps = 0/172 (0%)
 Frame = +1

Query  91   FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINE  270
             H YQVVGR  PTETD +P  +RMKL+A NEV AKS+FWYFL ++KK+KK  G++L+INE
Sbjct  4    IHHYQVVGRKAPTETDPNPPAFRMKLFAPNEVLAKSRFWYFLHQMKKMKKTTGEILSINE  63

Query  271  IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  450
            + EKN   + NYGVW+RY SR+G HNMYKE+RD TLNGA+EQ+Y E+A RHR R   IQI
Sbjct  64   LREKNKRIVKNYGVWIRYNSRSGTHNMYKEYRDVTLNGAIEQLYAELAGRHRARPRSIQI  123

Query  451  IKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF  606
            ++TA + AK CK+ +T Q+ +SKIKFPL  +  RP  +K +T YKA+RP+ F
Sbjct  124  MRTAILAAKDCKKPNTLQYHDSKIKFPLSHRVPRPSLKKFRTVYKANRPSTF  175



>gb|ABQ42114.1| 60S ribosomal protein L18a [Sonneratia caseolaris]
Length=107

 Score =   214 bits (546),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/107 (93%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +1

Query  136  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEIFEKNPTKINNYGVW  315
            DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQVLAINEIFEKNPTKI+NYG+W
Sbjct  1    DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIDNYGIW  60

Query  316  LRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIK  456
            LRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  CIQIIK
Sbjct  61   LRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRFPCIQIIK  107



>gb|ABQ42113.1| 60S ribosomal protein L18a [Sonneratia alba]
 gb|ABQ42115.1| 60S ribosomal protein L18a [Sonneratia ovata]
 gb|ABQ42116.1| 60S ribosomal protein L18a [Sonneratia apetala]
Length=107

 Score =   213 bits (543),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 99/107 (93%), Positives = 104/107 (97%), Gaps = 0/107 (0%)
 Frame = +1

Query  136  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEIFEKNPTKINNYGVW  315
            DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQVLAINEIFEKNPT+I+NYG+W
Sbjct  1    DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTRIDNYGIW  60

Query  316  LRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIK  456
            LRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  CIQIIK
Sbjct  61   LRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRFPCIQIIK  107



>emb|CBI30857.3| unnamed protein product [Vitis vinifera]
Length=124

 Score =   213 bits (543),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 97/106 (92%), Positives = 103/106 (97%), Gaps = 0/106 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQV
Sbjct  1    MVTFRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVE  393
            LAINEIFEKNPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGA+ 
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGALS  106



>ref|XP_009831602.1| hypothetical protein H257_07690 [Aphanomyces astaci]
 gb|ETV78883.1| hypothetical protein H257_07690 [Aphanomyces astaci]
Length=177

 Score =   213 bits (543),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 129/172 (75%), Gaps = 0/172 (0%)
 Frame = +1

Query  91   FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINE  270
             H YQVVGR  PTETD +P  +RMKL+A NEV AKS+FWYFL ++KK+KK  G++L++NE
Sbjct  4    IHHYQVVGRKAPTETDPNPPAFRMKLFAPNEVLAKSRFWYFLHQMKKMKKTTGEILSVNE  63

Query  271  IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  450
            + EKN   + NYGVW+RY SR+G HNMYKE+RD TLN A+EQ+Y E+A RHR R   IQI
Sbjct  64   LREKNKRIVKNYGVWIRYNSRSGTHNMYKEYRDVTLNSAIEQLYAELAGRHRARPRSIQI  123

Query  451  IKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF  606
            ++TA + AK CK+ +T Q+ NS IKFPL  +  RP  +K +T +KA+RP+ F
Sbjct  124  MRTAILAAKDCKKPNTLQYHNSAIKFPLSHRVPRPSLKKFRTIFKANRPSTF  175



>ref|XP_008604133.1| 50S ribosomal protein L18Ae [Saprolegnia diclina VS20]
 gb|EQC42710.1| 50S ribosomal protein L18Ae [Saprolegnia diclina VS20]
Length=177

 Score =   213 bits (542),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 99/172 (58%), Positives = 128/172 (74%), Gaps = 0/172 (0%)
 Frame = +1

Query  91   FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINE  270
             HQYQVVGR  PTE+D +P  +RMKL+A NEV AKS+FWYFL ++KK+KK  G++L +NE
Sbjct  4    IHQYQVVGRKAPTESDPNPPAFRMKLFAPNEVLAKSRFWYFLHQMKKMKKTTGEILCLNE  63

Query  271  IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  450
            + EKN   + NYGVW+RY SR+G HNMYKE+RD TL GAVEQMY E+A RHR R   IQI
Sbjct  64   LREKNKRIVKNYGVWIRYNSRSGTHNMYKEYRDVTLCGAVEQMYAELAGRHRARPRSIQI  123

Query  451  IKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF  606
            ++TA + AK CK+ +T Q+ +S IKFPL  +  RP ++  +T +KASRP  F
Sbjct  124  MRTAILAAKDCKKPNTLQYHDSAIKFPLSHRVPRPANKNQRTVFKASRPTTF  175



>ref|XP_002501229.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62487.1| predicted protein [Micromonas sp. RCC299]
Length=188

 Score =   213 bits (543),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 131/173 (76%), Gaps = 2/173 (1%)
 Frame = +1

Query  91   FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINE  270
            + Q+ +VGR +PT+    P++YRMKLW+T++ RAKSKFWYFL +LKKVKKANGQ+LA NE
Sbjct  13   YRQFHIVGRHVPTDAMPDPQVYRMKLWSTDDTRAKSKFWYFLSRLKKVKKANGQILACNE  72

Query  271  IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  450
            IFE++ T I N+G+W+RYQSRTG+HN YKE+R+ ++N AV+ +Y EMASRHRVR  C+QI
Sbjct  73   IFEEDVTTIKNFGIWIRYQSRTGFHNAYKEYREVSMNKAVDALYEEMASRHRVRAPCLQI  132

Query  451  IKTATIPAKLCKRESTKQFLNSK--IKFPLVFKKVRPPSRKLKTTYKASRPNL  603
            IK A +     KR++T QFL  K  + FP+V K +R  S+  KTT+K  RPN 
Sbjct  133  IKIAQVADADVKRDNTIQFLGVKEPVSFPVVNKVLRHDSKSQKTTFKYKRPNF  185



>gb|AFW81143.1| hypothetical protein ZEAMMB73_376835 [Zea mays]
Length=119

 Score =   210 bits (535),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 111/119 (93%), Gaps = 0/119 (0%)
 Frame = +1

Query  253  VLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  432
            +LAINEIFE+NPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR
Sbjct  1    MLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVR  60

Query  433  HHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
              CIQIIKTAT+  KLCKR++TKQF NS+IKFPLV++KVRPP+RKL+TT+KASRPNLF+
Sbjct  61   SPCIQIIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKLRTTFKASRPNLFM  119



>ref|XP_009144150.1| PREDICTED: 60S ribosomal protein L18a-2-like [Brassica rapa]
Length=117

 Score =   209 bits (532),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 98/113 (87%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +1

Query  271  IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  450
            IFEKNPT I N+G+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASRHRVR  CIQI
Sbjct  5    IFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASRHRVRFPCIQI  64

Query  451  IKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IKTAT+PAKLCKRESTK F NSKIKFP VF+KVRPP+RKLKTTYKAS+PNLF+
Sbjct  65   IKTATVPAKLCKRESTKLFHNSKIKFPSVFRKVRPPTRKLKTTYKASKPNLFM  117



>gb|ADV03035.1| ribosomal protein L18A [Karlodinium veneficum]
Length=187

 Score =   211 bits (538),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 128/174 (74%), Gaps = 1/174 (1%)
 Frame = +1

Query  88   RFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAIN  267
            R HQYQ+VGRA PT  +  PKIYRM+L+A N V AKS+FWYF++K+ K K++ G++L +N
Sbjct  14   RMHQYQIVGRAAPTPKNPTPKIYRMRLFAKNAVLAKSRFWYFMKKINKAKRSGGELLGVN  73

Query  268  EIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  447
            E+F++ PTK+ NYG+WLRY+SRT  HNMYKEFRD T+NGAV Q+Y+EMA RHR +   IQ
Sbjct  74   ELFDRAPTKVKNYGIWLRYESRTNTHNMYKEFRDVTINGAVSQLYSEMAGRHRAQPGSIQ  133

Query  448  IIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            II T  + A  CKR+   +   S +KFP V +K+   ++KLKTT+ A RP  FV
Sbjct  134  IIDTKVLKASECKRDHVTEMHKSDLKFP-VIRKMPMSAKKLKTTFTAKRPMTFV  186



>gb|EMS66554.1| 60S ribosomal protein L18a [Triticum urartu]
Length=146

 Score =   210 bits (534),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 123/179 (69%), Gaps = 34/179 (19%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MV +RFHQYQVVGR LPT T++HP+IYRMKLWATNE                        
Sbjct  1    MVAFRFHQYQVVGRGLPTPTEDHPRIYRMKLWATNE------------------------  36

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRH-RVR  432
                 IFEKNPT I N+G+WLRYQSRTGYHNMY E+ DTTLNGAVEQMYTEMASRH    
Sbjct  37   -----IFEKNPTTIENFGIWLRYQSRTGYHNMYNEYSDTTLNGAVEQMYTEMASRHCAAS  91

Query  433  HHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
                Q + T  I    CKR++TKQF  S I+F LV++KVRPPSRKL+TT+KASRPNLFV
Sbjct  92   RSSRQPLSTPNI----CKRDNTKQFHKSDIRFLLVYQKVRPPSRKLQTTFKASRPNLFV  146



>gb|ACS68696.1| 60S RPL18aB [Sonneratia alba]
 gb|ACS68767.1| 60S RPL18aB, partial [Sonneratia alba]
Length=101

 Score =   201 bits (510),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/101 (92%), Positives = 98/101 (97%), Gaps = 0/101 (0%)
 Frame = +1

Query  145  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEIFEKNPTKINNYGVWLRY  324
            PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQVLAINEIFEKNPT+I+NYG+WLRY
Sbjct  1    PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTRIDNYGIWLRY  60

Query  325  QSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  447
            QSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  CIQ
Sbjct  61   QSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRFPCIQ  101



>gb|ACN30573.1| unknown [Zea mays]
Length=117

 Score =   201 bits (511),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +1

Query  268  EIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  447
            +IFE+NPT I NYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASRHRVR  CIQ
Sbjct  4    QIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASRHRVRSPCIQ  63

Query  448  IIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IIKTAT+  KLCKR++TKQF NS+IKFPLV++KVRPP+RKLKTT+KASRPNLF+
Sbjct  64   IIKTATVHFKLCKRDNTKQFHNSEIKFPLVYRKVRPPTRKLKTTFKASRPNLFM  117



>gb|KFH68950.1| 60S ribosomal protein L20 [Mortierella verticillata NRRL 6337]
Length=176

 Score =   202 bits (513),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 122/173 (71%), Gaps = 0/173 (0%)
 Frame = +1

Query  88   RFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAIN  267
            R H+YQ+VGR LPTE D  PK++RM+L+A NEV AKS+FWYF+RKLKKVKK NG+++ IN
Sbjct  3    RLHEYQLVGRHLPTEKDATPKLFRMRLFAPNEVIAKSRFWYFMRKLKKVKKVNGEIVGIN  62

Query  268  EIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  447
            EI EK P +I N+G+W+RY SR+G HNMYKE+R+ T N AVE  Y++MASRHR R   IQ
Sbjct  63   EIHEKKPLQIKNFGIWIRYDSRSGTHNMYKEYRELTRNAAVEACYSDMASRHRARSRSIQ  122

Query  448  IIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF  606
            II+ A +     +R   KQ L   IKFPL  + +R   +  +  +  SRP+ F
Sbjct  123  IIRVAEVANADVRRPYIKQILVPGIKFPLPHRVIRAADKSHRALFMGSRPSTF  175



>emb|CBN79653.1| ribosomal protein L18 [Ectocarpus siliculosus]
Length=238

 Score =   203 bits (517),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/179 (54%), Positives = 126/179 (70%), Gaps = 2/179 (1%)
 Frame = +1

Query  73   KMVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQ  252
            KMV  R  QYQVVGR   TE + +P +YRMK++A NEV   S+FWY + +++K+KK  G+
Sbjct  61   KMVAMR--QYQVVGRKAVTEKEPNPPVYRMKVFAPNEVTGASQFWYLMHQMRKMKKTTGE  118

Query  253  VLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVR  432
            +L I E+ EKN   I NYG+WLRY SR+G HNMY+E+RD TL GAV+QMY+EMA RHR R
Sbjct  119  ILDIVELTEKNARIIKNYGIWLRYDSRSGTHNMYREYRDLTLTGAVDQMYSEMAGRHRCR  178

Query  433  HHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
               IQII+T  + AK  KR   +QF N+ IKFPL  +  R P +K +TT+KASRP  F+
Sbjct  179  PRSIQIIRTGIVAAKDTKRPDVQQFHNANIKFPLTHRLPRAPKKKFRTTFKASRPTTFL  237



>ref|XP_005702735.1| 60S ribosomal protein L18Ae [Galdieria sulphuraria]
 gb|EME26215.1| 60S ribosomal protein L18Ae [Galdieria sulphuraria]
Length=178

 Score =   199 bits (506),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 124/173 (72%), Gaps = 0/173 (0%)
 Frame = +1

Query  91   FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINE  270
             HQY VVGR +PT+ +  P IYR+K++A N V AKS+FWYFLRKLK+VKK++G++L I+E
Sbjct  5    LHQYSVVGRKIPTQEEPEPPIYRLKIFAPNVVNAKSRFWYFLRKLKRVKKSSGEILNISE  64

Query  271  IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  450
            IFEK  T++ NYG+W+RY+SR+   NMY+E+RD T+NGAVEQMY +M+ RHR R   I +
Sbjct  65   IFEKKSTQVKNYGIWIRYKSRSDTINMYREYRDVTVNGAVEQMYKDMSGRHRARWSSIWV  124

Query  451  IKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            +K   + AK C+R    QF +SKIKF L   + R P +K  T +KA RP   V
Sbjct  125  LKAMPVAAKDCRRSKVTQFHDSKIKFALPHMRPRAPLKKYNTPFKAKRPTTIV  177



>gb|EPZ32213.1| 60S ribosomal protein L20-B [Rozella allomycis CSF55]
Length=178

 Score =   199 bits (505),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 123/177 (69%), Gaps = 0/177 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            M   ++H+YQ++GR LPT  +  P++Y+M+++A NEV  KS+FWYFL+KLKKVKKANG++
Sbjct  1    MTESKYHEYQIIGRKLPTAAEPVPRLYKMRVFAKNEVVGKSRFWYFLQKLKKVKKANGEI  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRH  435
            +A+NEIFEK P ++ NYG+WLRY SRTG HNMYKE+R+ +   AV   Y +MASRHR R 
Sbjct  61   VAVNEIFEKRPNQVKNYGIWLRYDSRTGTHNMYKEYREMSRVDAVHSCYQDMASRHRARF  120

Query  436  HCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF  606
              IQIIK   I     +R   KQ L   +KFPL  +  R PSR+ K  + A RP+ F
Sbjct  121  RSIQIIKVEEIANSDVRRPYIKQLLEPGLKFPLPHRVYRAPSRRYKKLFVAHRPSTF  177



>gb|KFH68928.1| large subunit ribosomal protein L18Ae [Mortierella verticillata 
NRRL 6337]
Length=244

 Score =   200 bits (509),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 121/172 (70%), Gaps = 0/172 (0%)
 Frame = +1

Query  91   FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINE  270
             H+YQ+VGR LPTE D  PK++RM+L+A NEV AKS+FWYF+RKLKKVKK NG+++ INE
Sbjct  72   LHEYQLVGRHLPTEKDATPKLFRMRLFAPNEVIAKSRFWYFMRKLKKVKKVNGEIVGINE  131

Query  271  IFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQI  450
            I EK P +I N+G+W+RY SR+G HNMYKE+R+ T N AVE  Y++MASRHR R   IQI
Sbjct  132  IHEKKPLQIKNFGIWIRYDSRSGTHNMYKEYRELTRNAAVEACYSDMASRHRARSRSIQI  191

Query  451  IKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF  606
            I+ A +     +R   KQ L   IKFPL  + +R   +  +  +  SRP+ F
Sbjct  192  IRVAEVANADVRRPYIKQILVPGIKFPLPHRVIRAADKSHRALFMGSRPSTF  243



>gb|KHN49096.1| 60S ribosomal protein L18a-2, partial [Glycine soja]
Length=116

 Score =   196 bits (497),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  262  INEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHC  441
            I + FEKNPTKI NYG+WLRYQSRTGY +MYKE+RDTTLNGA+  MY EMASRHRVR  C
Sbjct  1    IFQTFEKNPTKIKNYGIWLRYQSRTGYDSMYKEYRDTTLNGAIRVMYNEMASRHRVRSPC  60

Query  442  IQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            IQIIK  TIPAKLCKRESTKQF NSKI FPLV+KKVRPP+RKLK TYKA +PNLF+
Sbjct  61   IQIIKIVTIPAKLCKRESTKQFHNSKINFPLVYKKVRPPTRKLKATYKAKKPNLFM  116



>gb|AGE89254.1| 60S ribosomal protein L18a [Cryptocaryon irritans]
Length=188

 Score =   197 bits (502),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/182 (52%), Positives = 126/182 (69%), Gaps = 1/182 (1%)
 Frame = +1

Query  61   QLVEKMVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK  240
            Q+ +K +    HQY V GR LP+E D+ P+IY ++++A NE+ AKSKFWY +    K+K+
Sbjct  4    QIQDKSLQMNIHQYLVTGRRLPSEQDKEPQIYAIRVFAKNEILAKSKFWYQMSLQHKIKR  63

Query  241  ANGQVLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  420
            ANG+VLA+NEI EKN   I  YG+ LR+QSRTG HNMYKEFRD +LNGA+ Q+Y EM+  
Sbjct  64   ANGEVLAVNEILEKNTRHIKTYGICLRFQSRTGQHNMYKEFRDVSLNGAISQLYMEMSGN  123

Query  421  HRVRHHCIQIIKTATI-PAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRP  597
            HR RH  IQI++TA +      +R  T ++ NS IKFP+V    R   +K KT +KA+RP
Sbjct  124  HRARHETIQILRTAILKKTDHMRRSKTFKYRNSSIKFPIVKSLPRASEKKFKTIFKANRP  183

Query  598  NL  603
            NL
Sbjct  184  NL  185



>ref|XP_637982.2| S60 ribosomal protein L18a [Dictyostelium discoideum AX4]
 sp|Q54MK8.2|RL18A_DICDI RecName: Full=60S ribosomal protein L18a [Dictyostelium discoideum]
 gb|EAL64475.2| S60 ribosomal protein L18a [Dictyostelium discoideum AX4]
Length=171

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 121/171 (71%), Gaps = 5/171 (3%)
 Frame = +1

Query  94   HQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEI  273
            H++QVVGR +PTE D +PKIYRM+L+A   + AKS+FWYFL K+ K+KK+ G++L + EI
Sbjct  4    HEFQVVGRHVPTERDANPKIYRMRLFAQTSIHAKSRFWYFLSKIVKMKKSTGEILNVTEI  63

Query  274  FEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQII  453
            FE  P K+ N+GV++RY SR+G HN+YKE+RD T  GAV QMY EMASRH  R   I II
Sbjct  64   FEDKPQKVKNFGVFIRYNSRSGTHNIYKEYRDLTRCGAVSQMYDEMASRHSARESSIHII  123

Query  454  KTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF  606
                I A L +R +TKQF +SKIKFPL  +       K K+T+ A+RPN F
Sbjct  124  DIKEIAASLTRRANTKQFHDSKIKFPLTHRIA-----KSKSTFVANRPNTF  169



>ref|XP_009521845.1| hypothetical protein PHYSODRAFT_354168 [Phytophthora sojae]
 gb|EGZ19128.1| hypothetical protein PHYSODRAFT_354168 [Phytophthora sojae]
Length=176

 Score =   195 bits (496),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 123/170 (72%), Gaps = 0/170 (0%)
 Frame = +1

Query  97   QYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEIF  276
            Q+QVVGR  PTE + +P  YRMKL+A N V A+S+FWYFL ++KK+KK  G++L INE+ 
Sbjct  5    QFQVVGRKAPTEKEPNPPAYRMKLFAPNPVLAQSRFWYFLHQMKKMKKTTGEILDINELT  64

Query  277  EKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIK  456
            EKN   +NNYG+W+RY SR+G HNMYKE+RD TL  AVEQMY+E+A RHR R   IQI++
Sbjct  65   EKNRRVVNNYGIWIRYNSRSGTHNMYKEYRDVTLCKAVEQMYSELAGRHRARPRSIQIMR  124

Query  457  TATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF  606
            TA + AK  ++ + +QF +SKI FPL  +  R   +  KT +KASRP  F
Sbjct  125  TAIVAAKDTQKTNVQQFHDSKISFPLSHRLPRAAEKHHKTVFKASRPCTF  174



>ref|XP_005830017.1| large subunit ribosomal protein L18Ae, cytoplasmic [Guillardia 
theta CCMP2712]
 gb|EKX43037.1| large subunit ribosomal protein L18Ae, cytoplasmic [Guillardia 
theta CCMP2712]
Length=187

 Score =   195 bits (496),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 87/176 (49%), Positives = 129/176 (73%), Gaps = 2/176 (1%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPT--ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANG  249
            +V  R+HQYQVVGR  P+  +      IY+M ++A N+V AKS+FWY++  LK+VKKANG
Sbjct  6    LVQTRYHQYQVVGRLKPSAEKGTRKADIYKMNIFAPNKVVAKSRFWYYMSLLKRVKKANG  65

Query  250  QVLAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRV  429
            ++L INEIFEK P+ ++NYG+W+RY SRTG+HNMY+E+RD ++ GAV +MY ++A+RHR 
Sbjct  66   EILQINEIFEKKPSTVSNYGIWMRYDSRTGHHNMYREYRDVSICGAVSKMYQDVAARHRS  125

Query  430  RHHCIQIIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRP  597
            R   +QI++TA +P  + ++   K++L   IKFP+  + +RP S+ LK T+ A RP
Sbjct  126  RFSNVQIVRTAQVPDDMLRKTWNKEYLEKDIKFPITHRVLRPSSKALKKTFVARRP  181



>gb|ADV03042.1| ribosomal protein L18A [Amphidinium carterae]
Length=187

 Score =   194 bits (493),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 124/174 (71%), Gaps = 1/174 (1%)
 Frame = +1

Query  88   RFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAIN  267
            + HQ+Q+VGRA PT     PKIYRM+L+A N V AKS+FWYF++K+ K KK+ G++LA+N
Sbjct  14   KMHQFQIVGRAAPTTKRPTPKIYRMRLFAKNTVMAKSRFWYFMKKMCKAKKSGGELLAVN  73

Query  268  EIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQ  447
            EI ++ P  + NYG+WLRY+SRT  HNMYKE+RD  +N AV +MY EM+ RHR     IQ
Sbjct  74   EIKDRRPLVVKNYGIWLRYESRTNTHNMYKEYRDVDINNAVGKMYQEMSGRHRANPGSIQ  133

Query  448  IIKTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLFV  609
            II TA +P   C+R+   +     ++FP+V +K+  P +K ++T+KASRPN FV
Sbjct  134  IINTAVLPDDKCRRDHVTEMHQKMLRFPVV-RKLPLPLKKYRSTFKASRPNTFV  186



>dbj|GAM28311.1| hypothetical protein SAMD00019534_114870, partial [Acytostelium 
subglobosum LB1]
 dbj|GAM22826.1| hypothetical protein SAMD00019534_060010, partial [Acytostelium 
subglobosum LB1]
Length=173

 Score =   193 bits (490),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/173 (53%), Positives = 124/173 (72%), Gaps = 5/173 (3%)
 Frame = +1

Query  94   HQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEI  273
            H++QVVGR +PTE + HPK++RM+L+A   V AKS+FWYFL K++K+KKA G++L + EI
Sbjct  4    HEFQVVGRHVPTEREAHPKLFRMRLFAKTSVHAKSRFWYFLSKIQKMKKATGEILNVTEI  63

Query  274  FEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQII  453
            FE+ P +I N+G+++RY SR+G HN+YKE+RD T  GAV QMY EMASRH  R   I II
Sbjct  64   FEEKPQQIKNFGIFIRYNSRSGTHNIYKEYRDVTRVGAVAQMYDEMASRHSAREKTIHII  123

Query  454  KTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSR--KLKTTYKASRPNLF  606
            +   + A   +R +TKQF +SKI+FPL     R P R  + K T+KA+RP  F
Sbjct  124  EIKEVAAAQTRRTNTKQFHDSKIRFPLTH---RVPKRLPQFKATFKATRPKTF  173



>ref|XP_008897642.1| hypothetical protein PPTG_05682 [Phytophthora parasitica INRA-310]
 gb|ETI32919.1| hypothetical protein F443_20346 [Phytophthora parasitica P1569]
 gb|ETK73262.1| hypothetical protein L915_19781 [Phytophthora parasitica]
 gb|ETL26699.1| hypothetical protein L916_19666 [Phytophthora parasitica]
 gb|ETL79915.1| hypothetical protein L917_19518 [Phytophthora parasitica]
 gb|ETM33177.1| hypothetical protein L914_19553 [Phytophthora parasitica]
 gb|ETN16482.1| hypothetical protein PPTG_05682 [Phytophthora parasitica INRA-310]
 gb|ETO61650.1| hypothetical protein F444_20347 [Phytophthora parasitica P1976]
 gb|ETP02736.1| hypothetical protein F441_20219 [Phytophthora parasitica CJ01A1]
 gb|ETP30905.1| hypothetical protein F442_20160 [Phytophthora parasitica P10297]
Length=176

 Score =   193 bits (490),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 121/170 (71%), Gaps = 0/170 (0%)
 Frame = +1

Query  97   QYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEIF  276
            Q+QVVGR  PTE + +P  YRMKL+A N V A+S+FWYFL ++KK+KK  G++L INE+ 
Sbjct  5    QFQVVGRKAPTEKEPNPPAYRMKLFAPNPVLAQSRFWYFLHQMKKMKKTTGEILDINELT  64

Query  277  EKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIK  456
            EKN   +NNYG+W+RY SR+G HNMYKE+RD TL  AVEQMY E+A RHR R   IQI++
Sbjct  65   EKNRRVVNNYGIWIRYNSRSGTHNMYKEYRDVTLCKAVEQMYAELAGRHRARPRSIQIMR  124

Query  457  TATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF  606
            TA + AK  ++ + +QF +SKI FPL  +  R   +   T +KASRP  F
Sbjct  125  TAIVAAKDTQKTNVQQFHDSKISFPLSHRLPRAAEKHHNTVFKASRPCTF  174



>ref|XP_011653978.1| PREDICTED: 60S ribosomal protein L18a-like [Cucumis sativus]
Length=102

 Score =   190 bits (483),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 87/100 (87%), Positives = 95/100 (95%), Gaps = 0/100 (0%)
 Frame = +1

Query  76   MVTYRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQV  255
            MVT+RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVTFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  256  LAINEIFEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTT  375
            LAINEIFEKNPTKI NYG+WLRYQSRTGYHNM  + R+ T
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMSNKNRNQT  100



>ref|XP_002897608.1| 60S ribosomal protein L18a [Phytophthora infestans T30-4]
 gb|AAY43426.1| ribosomal protein L18 [Phytophthora infestans]
 gb|EEY64878.1| 60S ribosomal protein L18a [Phytophthora infestans T30-4]
Length=176

 Score =   192 bits (488),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 121/170 (71%), Gaps = 0/170 (0%)
 Frame = +1

Query  97   QYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEIF  276
            Q+QVVGR  PTE + +P  YRMKL+A N V A+S+FWYFL ++KK+KK  G++L INE+ 
Sbjct  5    QFQVVGRKAPTEKEPNPPAYRMKLFAPNPVLAQSRFWYFLHQMKKMKKTTGEILDINELT  64

Query  277  EKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQIIK  456
            EKN   +NNYG+W+RY SR+G HNMYKE+RD TL  AVEQMY E+A RHR R   IQI++
Sbjct  65   EKNRRVVNNYGIWIRYNSRSGTHNMYKEYRDLTLCSAVEQMYAELAGRHRARPRSIQIMR  124

Query  457  TATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF  606
            TA + AK  ++ + +QF +SKI FPL  +  R   +   + +KASRP  F
Sbjct  125  TAIVAAKDTQKTNVQQFHDSKIAFPLSHRLPRAAEKHHNSVFKASRPCTF  174



>ref|XP_003292885.1| ribosomal protein L18a [Dictyostelium purpureum]
 gb|EGC30597.1| ribosomal protein L18a [Dictyostelium purpureum]
Length=170

 Score =   191 bits (486),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 119/171 (70%), Gaps = 5/171 (3%)
 Frame = +1

Query  94   HQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQVLAINEI  273
            H+YQVVGR +PTE D  PKI+RM+L+A   + AKS+FWYFL K+ K+KKA G++L + EI
Sbjct  3    HEYQVVGRHVPTERDASPKIFRMRLFAQTPIHAKSRFWYFLSKINKMKKATGEILNVTEI  62

Query  274  FEKNPTKINNYGVWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASRHRVRHHCIQII  453
            FE  P K+ N+GV++RY SR+G HN+YKE+RD T  GA+ QMY EMASRH  R   I II
Sbjct  63   FEDKPQKVKNFGVFIRYNSRSGTHNIYKEYRDLTRCGAIAQMYDEMASRHSAREQSIHII  122

Query  454  KTATIPAKLCKRESTKQFLNSKIKFPLVFKKVRPPSRKLKTTYKASRPNLF  606
                I A L +R +TKQF +SKIKFPL  +      +K  +T+ A+RP  F
Sbjct  123  DIKEIAAGLTRRTNTKQFHDSKIKFPLTHR-----IQKTNSTFVANRPTTF  168



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 984062932160