BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2366

Length=763
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010255617.1|  PREDICTED: uncharacterized protein LOC104596236    405   2e-133   Nelumbo nucifera [Indian lotus]
gb|KDO50310.1|  hypothetical protein CISIN_1g005059mg                   398   2e-131   Citrus sinensis [apfelsine]
ref|XP_011099737.1|  PREDICTED: uncharacterized protein LOC105178078    400   3e-131   Sesamum indicum [beniseed]
ref|XP_002309914.2|  SWIM zinc finger family protein                    400   3e-131   
gb|KDO50309.1|  hypothetical protein CISIN_1g005059mg                   399   4e-131   Citrus sinensis [apfelsine]
ref|XP_006432214.1|  hypothetical protein CICLE_v10000430mg             398   8e-131   
emb|CAN60858.1|  hypothetical protein VITISV_039453                     397   1e-130   Vitis vinifera
emb|CAN76964.1|  hypothetical protein VITISV_043960                     397   1e-130   Vitis vinifera
ref|XP_002274170.1|  PREDICTED: uncharacterized protein LOC100247174    398   1e-130   Vitis vinifera
ref|XP_011022940.1|  PREDICTED: uncharacterized protein LOC105124571    397   2e-130   Populus euphratica
ref|NP_974054.1|  SWIM zinc finger domain-containing protein            390   3e-130   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006361419.1|  PREDICTED: uncharacterized protein LOC102587868    396   9e-130   Solanum tuberosum [potatoes]
ref|XP_002886608.1|  predicted protein                                  395   1e-129   Arabidopsis lyrata subsp. lyrata
ref|XP_006596000.1|  PREDICTED: uncharacterized protein LOC100809...    395   2e-129   Glycine max [soybeans]
gb|KHN13990.1|  hypothetical protein glysoja_025007                     395   2e-129   Glycine soja [wild soybean]
gb|KHN17186.1|  hypothetical protein glysoja_010645                     395   2e-129   Glycine soja [wild soybean]
gb|AAB71951.1|  Hypothetical Protein                                    393   2e-129   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010510937.1|  PREDICTED: uncharacterized protein LOC104787...    394   4e-129   Camelina sativa [gold-of-pleasure]
ref|XP_010090844.1|  hypothetical protein L484_020703                   383   5e-129   
ref|XP_003552176.1|  PREDICTED: uncharacterized protein LOC100776331    394   5e-129   
ref|XP_010027651.1|  PREDICTED: uncharacterized protein LOC104418118    393   8e-129   Eucalyptus grandis [rose gum]
ref|XP_004236786.1|  PREDICTED: uncharacterized protein LOC101247514    393   1e-128   Solanum lycopersicum
ref|XP_010473234.1|  PREDICTED: uncharacterized protein LOC104752724    392   2e-128   Camelina sativa [gold-of-pleasure]
ref|XP_006300800.1|  hypothetical protein CARUB_v10019879mg             392   2e-128   Capsella rubella
ref|NP_176256.2|  SWIM zinc finger domain-containing protein            392   2e-128   Arabidopsis thaliana [mouse-ear cress]
gb|EYU23749.1|  hypothetical protein MIMGU_mgv1a002058mg                392   2e-128   Erythranthe guttata [common monkey flower]
ref|XP_007040728.1|  SWIM zinc finger family protein                    392   3e-128   
ref|XP_007133525.1|  hypothetical protein PHAVU_011G186500g             392   3e-128   Phaseolus vulgaris [French bean]
ref|XP_010417988.1|  PREDICTED: uncharacterized protein LOC104703...    391   3e-128   Camelina sativa [gold-of-pleasure]
ref|XP_004511186.1|  PREDICTED: uncharacterized protein LOC101498464    394   4e-128   
emb|CDY24539.1|  BnaA01g22430D                                          391   4e-128   Brassica napus [oilseed rape]
gb|KJB51581.1|  hypothetical protein B456_008G223400                    391   4e-128   Gossypium raimondii
emb|CDY34123.1|  BnaC01g28630D                                          390   4e-128   Brassica napus [oilseed rape]
ref|XP_009103823.1|  PREDICTED: uncharacterized protein LOC103829887    390   6e-128   Brassica rapa
ref|XP_002518981.1|  conserved hypothetical protein                     391   6e-128   Ricinus communis
ref|XP_010542310.1|  PREDICTED: uncharacterized protein LOC104815571    389   3e-127   Tarenaya hassleriana [spider flower]
gb|KDP32636.1|  hypothetical protein JCGZ_13186                         389   3e-127   Jatropha curcas
emb|CDP09645.1|  unnamed protein product                                389   3e-127   Coffea canephora [robusta coffee]
ref|XP_012078506.1|  PREDICTED: uncharacterized protein LOC105639150    389   3e-127   Jatropha curcas
gb|AET02590.2|  SWIM zinc finger protein                                389   4e-127   Medicago truncatula
ref|XP_006392152.1|  hypothetical protein EUTSA_v10023307mg             389   4e-127   Eutrema salsugineum [saltwater cress]
ref|XP_003628114.1|  hypothetical protein MTR_8g043760                  389   5e-127   
ref|XP_008441058.1|  PREDICTED: uncharacterized protein LOC103485285    384   4e-125   Cucumis melo [Oriental melon]
gb|KFK40774.1|  hypothetical protein AALP_AA2G039200                    383   4e-125   Arabis alpina [alpine rockcress]
ref|XP_004148660.1|  PREDICTED: uncharacterized protein LOC101204643    384   5e-125   Cucumis sativus [cucumbers]
ref|XP_007204630.1|  hypothetical protein PRUPE_ppa002073mg             381   4e-124   Prunus persica
ref|XP_008242047.1|  PREDICTED: uncharacterized protein LOC103340404    381   5e-124   Prunus mume [ume]
ref|XP_009613006.1|  PREDICTED: uncharacterized protein LOC104106214    377   1e-122   Nicotiana tomentosiformis
ref|XP_009781835.1|  PREDICTED: uncharacterized protein LOC104230671    377   2e-122   Nicotiana sylvestris
ref|XP_010674758.1|  PREDICTED: uncharacterized protein LOC104890846    375   6e-122   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009348880.1|  PREDICTED: uncharacterized protein LOC103940490    375   1e-121   Pyrus x bretschneideri [bai li]
ref|XP_008351508.1|  PREDICTED: uncharacterized protein LOC103414930    375   1e-121   
ref|XP_008391981.1|  PREDICTED: uncharacterized protein LOC103454170    375   1e-121   
ref|XP_008360601.1|  PREDICTED: uncharacterized protein LOC103424292    374   2e-121   
ref|XP_004287787.1|  PREDICTED: uncharacterized protein LOC101292541    374   3e-121   Fragaria vesca subsp. vesca
ref|XP_008787735.1|  PREDICTED: uncharacterized protein LOC103705694    371   4e-120   Phoenix dactylifera
ref|XP_010921228.1|  PREDICTED: uncharacterized protein LOC105044872    369   2e-119   Elaeis guineensis
ref|XP_011621857.1|  PREDICTED: uncharacterized protein LOC184300...    355   1e-116   Amborella trichopoda
gb|AFW66989.1|  hypothetical protein ZEAMMB73_942101                    349   4e-116   
dbj|BAK04195.1|  predicted protein                                      357   1e-114   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001062830.1|  Os09g0309100                                       357   1e-114   
gb|EPS61942.1|  hypothetical protein M569_12851                         356   1e-114   Genlisea aurea
ref|XP_009383179.1|  PREDICTED: uncharacterized protein LOC103970968    356   2e-114   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006840321.1|  PREDICTED: uncharacterized protein LOC184300...    356   3e-114   Amborella trichopoda
ref|XP_004968166.1|  PREDICTED: uncharacterized protein LOC101763681    355   7e-114   Setaria italica
ref|XP_008644121.1|  PREDICTED: uncharacterized protein LOC100383...    353   4e-113   
ref|XP_002466103.1|  hypothetical protein SORBIDRAFT_01g001310          352   8e-113   Sorghum bicolor [broomcorn]
ref|XP_003628100.1|  hypothetical protein MTR_8g043530                  353   9e-113   
ref|XP_003576405.1|  PREDICTED: uncharacterized protein LOC100828723    352   1e-112   Brachypodium distachyon [annual false brome]
gb|EMT08273.1|  hypothetical protein F775_06016                         351   2e-112   
gb|EEC84321.1|  hypothetical protein OsI_30820                          350   5e-112   Oryza sativa Indica Group [Indian rice]
gb|EMS61136.1|  hypothetical protein TRIUR3_35179                       347   1e-111   Triticum urartu
ref|XP_006660525.1|  PREDICTED: uncharacterized protein LOC102707611    347   9e-111   Oryza brachyantha
gb|KFK40773.1|  hypothetical protein AALP_AA2G039200                    331   1e-105   Arabis alpina [alpine rockcress]
gb|KJB21169.1|  hypothetical protein B456_003G185900                    315   4e-99    Gossypium raimondii
gb|AES96430.2|  zinc ion-binding protein                                283   1e-86    Medicago truncatula
ref|XP_003613472.1|  hypothetical protein MTR_5g037070                  283   2e-86    
ref|XP_009406639.1|  PREDICTED: uncharacterized protein LOC103989501    213   9e-60    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010921093.1|  PREDICTED: uncharacterized protein LOC105044782    214   1e-59    Elaeis guineensis
ref|XP_006858725.1|  PREDICTED: uncharacterized protein LOC18448602     214   2e-59    Amborella trichopoda
ref|XP_006842250.2|  PREDICTED: uncharacterized protein LOC18432077     210   2e-59    
ref|XP_008782616.1|  PREDICTED: uncharacterized protein LOC103702098    213   3e-59    Phoenix dactylifera
gb|ERN03925.1|  hypothetical protein AMTR_s00078p00196690               211   4e-59    Amborella trichopoda
ref|XP_002281999.2|  PREDICTED: uncharacterized protein LOC100245...    208   1e-58    Vitis vinifera
ref|XP_007138737.1|  hypothetical protein PHAVU_009G233100g             209   2e-58    Phaseolus vulgaris [French bean]
ref|XP_006476176.1|  PREDICTED: uncharacterized protein LOC102625...    207   2e-58    Citrus sinensis [apfelsine]
ref|XP_010249825.1|  PREDICTED: uncharacterized protein LOC104592...    207   2e-58    Nelumbo nucifera [Indian lotus]
ref|XP_006450581.1|  hypothetical protein CICLE_v10010703mg             207   2e-58    Citrus clementina [clementine]
gb|KHG17736.1|  Sacsin                                                  204   2e-58    Gossypium arboreum [tree cotton]
ref|XP_010053257.1|  PREDICTED: uncharacterized protein LOC104441745    208   3e-58    Eucalyptus grandis [rose gum]
ref|XP_010249820.1|  PREDICTED: uncharacterized protein LOC104592...    207   4e-58    Nelumbo nucifera [Indian lotus]
gb|KDO79654.1|  hypothetical protein CISIN_1g039513mg                   206   7e-58    Citrus sinensis [apfelsine]
gb|KJB64570.1|  hypothetical protein B456_010G054400                    206   9e-58    Gossypium raimondii
ref|XP_002461610.1|  hypothetical protein SORBIDRAFT_02g005340          207   1e-57    Sorghum bicolor [broomcorn]
ref|XP_007146127.1|  hypothetical protein PHAVU_006G014600g             207   1e-57    Phaseolus vulgaris [French bean]
ref|XP_002528170.1|  conserved hypothetical protein                     206   1e-57    Ricinus communis
ref|XP_010540374.1|  PREDICTED: uncharacterized protein LOC104814172    206   2e-57    Tarenaya hassleriana [spider flower]
ref|XP_004513230.1|  PREDICTED: uncharacterized protein LOC101502422    205   4e-57    Cicer arietinum [garbanzo]
gb|KHG17737.1|  Arrestin-C                                              204   5e-57    Gossypium arboreum [tree cotton]
ref|XP_008232361.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    207   5e-57    
ref|XP_007013717.1|  SWIM zinc finger family protein isoform 1          204   6e-57    
ref|XP_009605496.1|  PREDICTED: uncharacterized protein LOC104100042    205   7e-57    Nicotiana tomentosiformis
dbj|BAC84431.1|  hypothetical protein                                   204   7e-57    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009790578.1|  PREDICTED: uncharacterized protein LOC104238021    205   7e-57    Nicotiana sylvestris
ref|XP_012065273.1|  PREDICTED: uncharacterized protein LOC105628473    204   8e-57    
ref|NP_001059218.1|  Os07g0227700                                       204   8e-57    
ref|XP_008670947.1|  PREDICTED: uncharacterized protein LOC103648233    204   9e-57    Zea mays [maize]
ref|XP_010269623.1|  PREDICTED: uncharacterized protein LOC104606193    206   1e-56    Nelumbo nucifera [Indian lotus]
ref|XP_007013718.1|  SWIM zinc finger family protein isoform 2          203   1e-56    
ref|XP_003528591.1|  PREDICTED: uncharacterized protein LOC100819...    204   1e-56    Glycine max [soybeans]
ref|XP_007052246.1|  Zinc ion binding protein isoform 1                 205   1e-56    
gb|EPS74375.1|  hypothetical protein M569_00380                         197   1e-56    Genlisea aurea
ref|XP_011019705.1|  PREDICTED: uncharacterized protein LOC105122...    203   1e-56    Populus euphratica
gb|KDP43797.1|  hypothetical protein JCGZ_23005                         203   1e-56    Jatropha curcas
ref|XP_012083677.1|  PREDICTED: uncharacterized protein LOC105643205    205   1e-56    Jatropha curcas
ref|XP_011019704.1|  PREDICTED: uncharacterized protein LOC105122...    202   2e-56    Populus euphratica
ref|XP_002309581.2|  hypothetical protein POPTR_0006s26200g             202   2e-56    
ref|XP_006445380.1|  hypothetical protein CICLE_v10018658mg             205   2e-56    
ref|XP_004245794.1|  PREDICTED: uncharacterized protein LOC101264658    203   2e-56    Solanum lycopersicum
ref|XP_007203395.1|  hypothetical protein PRUPE_ppa021037mg             205   2e-56    
ref|XP_010095498.1|  hypothetical protein L484_014926                   202   2e-56    
ref|XP_006359246.1|  PREDICTED: uncharacterized protein LOC102601...    202   3e-56    Solanum tuberosum [potatoes]
ref|XP_004135549.1|  PREDICTED: uncharacterized protein LOC101211068    202   4e-56    Cucumis sativus [cucumbers]
ref|XP_010108922.1|  hypothetical protein L484_027117                   195   5e-56    
ref|XP_008445258.1|  PREDICTED: uncharacterized protein LOC103488...    202   5e-56    
gb|EMS58193.1|  hypothetical protein TRIUR3_12822                       202   5e-56    Triticum urartu
ref|XP_004292961.2|  PREDICTED: uncharacterized protein LOC101313282    201   5e-56    Fragaria vesca subsp. vesca
ref|XP_008445298.1|  PREDICTED: uncharacterized protein LOC103488...    202   6e-56    Cucumis melo [Oriental melon]
ref|NP_193133.3|  zinc ion binding protein                              201   6e-56    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006578182.1|  PREDICTED: uncharacterized protein LOC100779025    201   7e-56    Glycine max [soybeans]
dbj|BAK03605.1|  predicted protein                                      201   8e-56    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHN10289.1|  hypothetical protein glysoja_017893                     201   9e-56    Glycine soja [wild soybean]
ref|XP_006375216.1|  hypothetical protein POPTR_0014s05360g             203   9e-56    
gb|EYU33119.1|  hypothetical protein MIMGU_mgv1a009920mg                193   9e-56    Erythranthe guttata [common monkey flower]
gb|EMT07282.1|  hypothetical protein F775_09518                         202   1e-55    
ref|XP_002516601.1|  conserved hypothetical protein                     200   1e-55    
gb|EYU37722.1|  hypothetical protein MIMGU_mgv1a023319mg                200   1e-55    Erythranthe guttata [common monkey flower]
ref|XP_006375222.1|  hypothetical protein POPTR_0014s05410g             203   1e-55    
ref|XP_011032909.1|  PREDICTED: uncharacterized protein LOC105131568    202   1e-55    Populus euphratica
gb|KHG00863.1|  CUE domain-containing 5                                 201   2e-55    Gossypium arboreum [tree cotton]
gb|KJB22894.1|  hypothetical protein B456_004G072100                    202   2e-55    Gossypium raimondii
emb|CDP15763.1|  unnamed protein product                                200   2e-55    Coffea canephora [robusta coffee]
ref|XP_006414836.1|  hypothetical protein EUTSA_v10024472mg             199   3e-55    Eutrema salsugineum [saltwater cress]
ref|XP_006283161.1|  hypothetical protein CARUB_v10004191mg             199   4e-55    Capsella rubella
emb|CDY50427.1|  BnaCnng19360D                                          199   4e-55    Brassica napus [oilseed rape]
ref|XP_011081859.1|  PREDICTED: uncharacterized protein LOC105164...    198   5e-55    Sesamum indicum [beniseed]
emb|CBI29086.3|  unnamed protein product                                200   6e-55    Vitis vinifera
ref|XP_008378289.1|  PREDICTED: uncharacterized protein LOC103441391    198   6e-55    
ref|XP_009377375.1|  PREDICTED: uncharacterized protein LOC103965988    198   6e-55    Pyrus x bretschneideri [bai li]
ref|XP_010450122.1|  PREDICTED: uncharacterized protein LOC104732283    199   7e-55    Camelina sativa [gold-of-pleasure]
ref|XP_002271166.1|  PREDICTED: uncharacterized protein LOC100264354    200   7e-55    Vitis vinifera
ref|XP_004501270.1|  PREDICTED: uncharacterized protein LOC101505...    198   9e-55    
gb|AES89835.2|  zinc ion-binding protein                                198   1e-54    Medicago truncatula
ref|XP_009139573.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    198   1e-54    Brassica rapa
ref|XP_007137090.1|  hypothetical protein PHAVU_009G098900g             198   1e-54    Phaseolus vulgaris [French bean]
ref|XP_002868324.1|  zinc ion binding protein                           198   1e-54    Arabidopsis lyrata subsp. lyrata
emb|CDY01179.1|  BnaA04g06400D                                          198   1e-54    
ref|XP_003607638.1|  hypothetical protein MTR_4g080580                  198   1e-54    
ref|XP_010450143.1|  PREDICTED: uncharacterized protein LOC104732307    198   1e-54    Camelina sativa [gold-of-pleasure]
ref|XP_008466358.1|  PREDICTED: uncharacterized protein LOC103503...    197   2e-54    
ref|XP_008466356.1|  PREDICTED: uncharacterized protein LOC103503...    197   2e-54    
ref|XP_007224640.1|  hypothetical protein PRUPE_ppa026389mg             197   2e-54    
ref|XP_003566605.1|  PREDICTED: uncharacterized protein LOC100828484    197   6e-54    Brachypodium distachyon [annual false brome]
ref|XP_002301246.2|  hypothetical protein POPTR_0002s14170g             196   6e-54    
ref|XP_004295012.1|  PREDICTED: uncharacterized protein LOC101310972    197   7e-54    Fragaria vesca subsp. vesca
ref|XP_010692100.1|  PREDICTED: uncharacterized protein LOC104905308    196   1e-53    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009349923.1|  PREDICTED: uncharacterized protein LOC103941455    196   2e-53    Pyrus x bretschneideri [bai li]
ref|XP_008219841.1|  PREDICTED: uncharacterized protein LOC103320013    194   2e-53    Prunus mume [ume]
ref|XP_008381415.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    196   2e-53    
ref|XP_011652504.1|  PREDICTED: uncharacterized protein LOC101215653    193   4e-53    Cucumis sativus [cucumbers]
gb|EYU21901.1|  hypothetical protein MIMGU_mgv1a023458mg                192   5e-53    Erythranthe guttata [common monkey flower]
ref|XP_010049049.1|  PREDICTED: uncharacterized protein LOC104437...    189   2e-51    Eucalyptus grandis [rose gum]
ref|XP_011088310.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    179   2e-47    
gb|KHN38118.1|  hypothetical protein glysoja_007160                     165   3e-45    Glycine soja [wild soybean]
gb|KDO36953.1|  hypothetical protein CISIN_1g034580mg                   154   8e-44    Citrus sinensis [apfelsine]
ref|XP_003603488.1|  hypothetical protein MTR_3g108220                  154   2e-39    
gb|AES73739.2|  zinc ion-binding protein                                154   2e-39    Medicago truncatula
gb|EEC81754.1|  hypothetical protein OsI_25420                          150   2e-37    Oryza sativa Indica Group [Indian rice]
gb|EYU23542.1|  hypothetical protein MIMGU_mgv1a019642mg                135   2e-36    Erythranthe guttata [common monkey flower]
gb|EYU40888.1|  hypothetical protein MIMGU_mgv1a018026mg                133   2e-35    Erythranthe guttata [common monkey flower]
ref|XP_007052247.1|  Zinc ion binding protein isoform 2                 131   1e-30    
gb|AGZ89234.1|  MLOC_22581-like protein                                 120   3e-30    Hordeum vulgare subsp. spontaneum [wild barley]
ref|XP_008445306.1|  PREDICTED: uncharacterized protein LOC103488...    126   4e-29    Cucumis melo [Oriental melon]
gb|ERM94292.1|  hypothetical protein AMTR_s00010p00231990               122   1e-27    Amborella trichopoda
ref|XP_010049050.1|  PREDICTED: uncharacterized protein LOC104437...    115   2e-25    Eucalyptus grandis [rose gum]
ref|XP_011622982.1|  PREDICTED: uncharacterized protein LOC18422177     107   2e-22    
ref|XP_010648578.1|  PREDICTED: uncharacterized protein LOC100245...    105   3e-22    Vitis vinifera
ref|XP_007013719.1|  SWIM zinc finger family protein isoform 3          102   3e-21    
ref|XP_011019706.1|  PREDICTED: uncharacterized protein LOC105122...    102   4e-21    Populus euphratica
ref|XP_011081862.1|  PREDICTED: uncharacterized protein LOC105164...  93.6    4e-18    Sesamum indicum [beniseed]
ref|XP_011627619.1|  PREDICTED: uncharacterized protein LOC18445750   74.3    8e-13    Amborella trichopoda
gb|ERN17409.1|  hypothetical protein AMTR_s00037p00218460             74.3    1e-12    Amborella trichopoda
emb|CAB10176.1|  hypothetical protein                                 65.1    1e-08    Arabidopsis thaliana [mouse-ear cress]
ref|XP_003628101.1|  hypothetical protein MTR_8g043550                59.3    8e-08    
tpg|DAA42494.1|  TPA: hypothetical protein ZEAMMB73_619750            54.3    1e-05    
tpg|DAA42489.1|  TPA: hypothetical protein ZEAMMB73_890904            51.2    3e-04    
gb|KHN16480.1|  hypothetical protein glysoja_036582                   50.4    8e-04    Glycine soja [wild soybean]



>ref|XP_010255617.1| PREDICTED: uncharacterized protein LOC104596236 [Nelumbo nucifera]
 ref|XP_010255624.1| PREDICTED: uncharacterized protein LOC104596236 [Nelumbo nucifera]
 ref|XP_010255633.1| PREDICTED: uncharacterized protein LOC104596236 [Nelumbo nucifera]
 ref|XP_010255642.1| PREDICTED: uncharacterized protein LOC104596236 [Nelumbo nucifera]
Length=718

 Score =   405 bits (1040),  Expect = 2e-133, Method: Compositional matrix adjust.
 Identities = 184/207 (89%), Positives = 198/207 (96%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            MDI+ESI ++ VQ+PP EDFSSADLNWTKFG+AEH D+VALIPYDRVDAFIIGECSNVEC
Sbjct  1    MDIIESILNIPVQDPPEEDFSSADLNWTKFGTAEHHDDVALIPYDRVDAFIIGECSNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR +GSLK Y+ DEYLEYR+YWCSFGPENYGEGGGILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRSKGSLKTYKSDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLAL+I+N RRH+NKSGFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALIIYNERRHINKSGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLG+PEENVL+KHI
Sbjct  181  ICNEIQQQTMSMIYLGLPEENVLQKHI  207



>gb|KDO50310.1| hypothetical protein CISIN_1g005059mg [Citrus sinensis]
Length=656

 Score =   398 bits (1023),  Expect = 2e-131, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            MDIVES+  + VQ+PP EDFSS DL WTKFG+AEH DEVALIPY RVD+FIIGECSNVEC
Sbjct  1    MDIVESLFDIQVQDPPEEDFSSIDLTWTKFGTAEHHDEVALIPYARVDSFIIGECSNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYR+YWCSFGPENYGEGGG+LPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLKEYKDDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLALLI+N+RRHVNKSGF+CHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALLIYNDRRHVNKSGFICHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEE+VLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEESVLEKHI  207



>ref|XP_011099737.1| PREDICTED: uncharacterized protein LOC105178078 [Sesamum indicum]
Length=716

 Score =   400 bits (1027),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            MDI+ESI +L VQ+PPGEDFS+ADL+W K GS +  D+VALIPYDRVDAFIIGECSNVEC
Sbjct  1    MDIIESIDNLSVQDPPGEDFSAADLDWVKLGSEDRYDDVALIPYDRVDAFIIGECSNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR +GSLK+Y+ DEYLEYR+YWCSFGPENYGEGGGILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRAKGSLKQYKNDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLALLI+N RRHVNK+GFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALLIYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            +C+EIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  VCSEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_002309914.2| SWIM zinc finger family protein [Populus trichocarpa]
 gb|EEE90364.2| SWIM zinc finger family protein [Populus trichocarpa]
Length=727

 Score =   400 bits (1027),  Expect = 3e-131, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            MDIVES+ +L VQNP  EDFS+ADL WTKFG+AEH DEVALIPYDRVDAFIIGECSN EC
Sbjct  1    MDIVESVLNLAVQNPAEEDFSAADLTWTKFGTAEHHDEVALIPYDRVDAFIIGECSNPEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  G+LK+Y+ DEYLEY++YWCSFGPENYGEGGG+LPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRARGTLKDYKTDEYLEYKLYWCSFGPENYGEGGGVLPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PS AL+I+N RRHVNKSGFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSQALIIYNERRHVNKSGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLEKHI  207



>gb|KDO50309.1| hypothetical protein CISIN_1g005059mg [Citrus sinensis]
Length=716

 Score =   399 bits (1026),  Expect = 4e-131, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            MDIVES+  + VQ+PP EDFSS DL WTKFG+AEH DEVALIPY RVD+FIIGECSNVEC
Sbjct  1    MDIVESLFDIQVQDPPEEDFSSIDLTWTKFGTAEHHDEVALIPYARVDSFIIGECSNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYR+YWCSFGPENYGEGGG+LPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLKEYKDDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLALLI+N+RRHVNKSGF+CHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALLIYNDRRHVNKSGFICHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEE+VLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEESVLEKHI  207



>ref|XP_006432214.1| hypothetical protein CICLE_v10000430mg [Citrus clementina]
 ref|XP_006464992.1| PREDICTED: uncharacterized protein LOC102609999 isoform X1 [Citrus 
sinensis]
 ref|XP_006464993.1| PREDICTED: uncharacterized protein LOC102609999 isoform X2 [Citrus 
sinensis]
 ref|XP_006464994.1| PREDICTED: uncharacterized protein LOC102609999 isoform X3 [Citrus 
sinensis]
 ref|XP_006464995.1| PREDICTED: uncharacterized protein LOC102609999 isoform X4 [Citrus 
sinensis]
 ref|XP_006464996.1| PREDICTED: uncharacterized protein LOC102609999 isoform X5 [Citrus 
sinensis]
 gb|ESR45454.1| hypothetical protein CICLE_v10000430mg [Citrus clementina]
Length=716

 Score =   398 bits (1023),  Expect = 8e-131, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 195/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            MDIVES+  + VQ+PP EDFSS DL WTKFG+AEH DEVALIPY RVD+FIIGECSNVEC
Sbjct  1    MDIVESLFDIQVQDPPEEDFSSIDLTWTKFGTAEHHDEVALIPYARVDSFIIGECSNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYR+YWCSFGPENYGEGGG+LPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLKEYKDDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLALLI+N+RRHVNKSGF+CHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALLIYNDRRHVNKSGFICHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEE+VLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEESVLEKHI  207



>emb|CAN60858.1| hypothetical protein VITISV_039453 [Vitis vinifera]
Length=706

 Score =   397 bits (1021),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            MDI+ESI  + VQ+P  E+FSSADLNWTKFG+ EH D+VALIPY RVDAFIIGECSNVEC
Sbjct  1    MDIIESILDIPVQDPKEEEFSSADLNWTKFGNPEHHDDVALIPYARVDAFIIGECSNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR +GSLKEY+ DEYLEYR+YWCSFGPENYGEGGGILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRSKGSLKEYKNDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLAL+I+N+RRHVNKSGFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALIIYNDRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            IC+EIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICSEIQQQTMSMIYLGIPEENVLEKHI  207



>emb|CAN76964.1| hypothetical protein VITISV_043960 [Vitis vinifera]
Length=706

 Score =   397 bits (1021),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            MDI+ESI  + VQ+P  E+FSSADLNWTKFG+ EH D+VALIPY RVDAFIIGECSNVEC
Sbjct  1    MDIIESILDIPVQDPKEEEFSSADLNWTKFGNPEHHDDVALIPYARVDAFIIGECSNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR +GSLKEY+ DEYLEYR+YWCSFGPENYGEGGGILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRSKGSLKEYKNDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLAL+I+N+RRHVNKSGFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALIIYNDRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            IC+EIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICSEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_002274170.1| PREDICTED: uncharacterized protein LOC100247174 [Vitis vinifera]
 ref|XP_010649364.1| PREDICTED: uncharacterized protein LOC100247174 [Vitis vinifera]
 ref|XP_010649365.1| PREDICTED: uncharacterized protein LOC100247174 [Vitis vinifera]
 emb|CBI37532.3| unnamed protein product [Vitis vinifera]
Length=720

 Score =   398 bits (1022),  Expect = 1e-130, Method: Compositional matrix adjust.
 Identities = 183/207 (88%), Positives = 196/207 (95%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            MDI+ESI  + VQ+P  E+FSSADLNWTKFG+ EH D+VALIPY RVDAFIIGECSNVEC
Sbjct  1    MDIIESILDIPVQDPKEEEFSSADLNWTKFGNPEHHDDVALIPYARVDAFIIGECSNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR +GSLKEY+ DEYLEYR+YWCSFGPENYGEGGGILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRSKGSLKEYKNDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLAL+I+N+RRHVNKSGFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALIIYNDRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            IC+EIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICSEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_011022940.1| PREDICTED: uncharacterized protein LOC105124571 [Populus euphratica]
Length=720

 Score =   397 bits (1021),  Expect = 2e-130, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            MDIVES+ +L VQNP  EDFS+ADL WTKFG+AEH DEVALIPYDRVDAFIIGECSN EC
Sbjct  1    MDIVESVHNLAVQNPAEEDFSAADLTWTKFGTAEHHDEVALIPYDRVDAFIIGECSNPEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  G+LK+Y+ DEYLEY++YWCSFGPENYGEGGG+LPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRARGTLKDYKTDEYLEYKLYWCSFGPENYGEGGGVLPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA  S AL+I+N RRHVNKSGFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARSSQALIIYNERRHVNKSGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|NP_974054.1| SWIM zinc finger domain-containing protein [Arabidopsis thaliana]
 gb|AEE33697.1| SWIM zinc finger-like protein [Arabidopsis thaliana]
Length=500

 Score =   390 bits (1001),  Expect = 3e-130, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+IVES++ + VQNP  EDFS ADL WTKFG++EH D+VAL+PY RVD FIIGECSN EC
Sbjct  1    MEIVESLEEIPVQNPQVEDFSWADLTWTKFGTSEHHDQVALVPYARVDEFIIGECSNAEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYR+YWCSFGPENYGEGGG+LPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLALLI+N RRHVNK+GFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALLIYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_006361419.1| PREDICTED: uncharacterized protein LOC102587868 [Solanum tuberosum]
Length=719

 Score =   396 bits (1017),  Expect = 9e-130, Method: Compositional matrix adjust.
 Identities = 182/207 (88%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+IVESI  L VQ+PPGEDFS++DL+WTKFG+ E  D+VALI YDRVDAFIIGEC NVE 
Sbjct  1    MEIVESIPDLAVQDPPGEDFSASDLSWTKFGTEERHDDVALIHYDRVDAFIIGECCNVEF  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR +GSLKEY+PDEYLEYR+YWCSFGPENYGEGGGILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRSKGSLKEYKPDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHF+VKRLYA PSLALLI+NNRRHVNKSGFVCHGPLDRDAIGPGAK IPY
Sbjct  121  ARPQSMRGCTCHFIVKRLYARPSLALLIYNNRRHVNKSGFVCHGPLDRDAIGPGAKNIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVL KHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLAKHI  207



>ref|XP_002886608.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62867.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=703

 Score =   395 bits (1014),  Expect = 1e-129, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+IVESI+ + VQNP  EDFS ADL WTKFG++EH DEVALIPY RVD FIIGECSN EC
Sbjct  1    MEIVESIEEIPVQNPQIEDFSWADLTWTKFGTSEHHDEVALIPYSRVDEFIIGECSNAEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYR+YWCSFGPENYGEGGG+LPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLALLI+N RRHVNK+GFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALLIYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_006596000.1| PREDICTED: uncharacterized protein LOC100809744 isoform X1 [Glycine 
max]
 ref|XP_006596001.1| PREDICTED: uncharacterized protein LOC100809744 isoform X2 [Glycine 
max]
 ref|XP_006596002.1| PREDICTED: uncharacterized protein LOC100809744 isoform X3 [Glycine 
max]
Length=720

 Score =   395 bits (1015),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M IVES+  + +Q+PP E+F +ADL WTKFG+AEH DEVALIPYDRVDAFIIGEC+NVEC
Sbjct  1    MAIVESVGKIPLQDPPEEEFCAADLTWTKFGNAEHHDEVALIPYDRVDAFIIGECTNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYR+YWCSFGPENYGEGGGILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRTIGSLKEYKDDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLAL+++N RRH+NKSGF+CHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYAQPSLALIVYNERRHINKSGFICHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEEN+LEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENILEKHI  207



>gb|KHN13990.1| hypothetical protein glysoja_025007 [Glycine soja]
Length=719

 Score =   395 bits (1015),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M IVES+  + +Q+PP E+F +ADL WTKFG+AEH DEVALIPYDRVDAFIIGEC+NVEC
Sbjct  1    MAIVESVGKIPLQDPPEEEFCAADLTWTKFGNAEHHDEVALIPYDRVDAFIIGECTNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYR+YWCSFGPENYGEGGGILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRTIGSLKEYKDDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLAL+++N RRH+NKSGF+CHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYAQPSLALIVYNERRHINKSGFICHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEEN+LEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENILEKHI  207



>gb|KHN17186.1| hypothetical protein glysoja_010645 [Glycine soja]
Length=720

 Score =   395 bits (1014),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M IVES+  + +Q+PP E+F +ADL WTKFG+AEH DEVALIPYDRVDAFIIGEC+NVEC
Sbjct  1    MAIVESVGKIPLQDPPEEEFCAADLTWTKFGNAEHHDEVALIPYDRVDAFIIGECTNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYR+YWCSFGPENYGEGGGILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRTIGSLKEYKDDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLAL+++N RRH+NKSGF+CHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYAQPSLALIVYNERRHINKSGFICHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEEN+LEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENILEKHI  207



>gb|AAB71951.1| Hypothetical Protein [Arabidopsis thaliana]
Length=653

 Score =   393 bits (1009),  Expect = 2e-129, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+IVES++ + VQNP  EDFS ADL WTKFG++EH D+VAL+PY RVD FIIGECSN EC
Sbjct  1    MEIVESLEEIPVQNPQVEDFSWADLTWTKFGTSEHHDQVALVPYARVDEFIIGECSNAEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYR+YWCSFGPENYGEGGG+LPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLALLI+N RRHVNK+GFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALLIYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_010510937.1| PREDICTED: uncharacterized protein LOC104787116 isoform X1 [Camelina 
sativa]
 ref|XP_010510938.1| PREDICTED: uncharacterized protein LOC104787116 isoform X2 [Camelina 
sativa]
Length=703

 Score =   394 bits (1011),  Expect = 4e-129, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+IVES++ + VQNP  EDFS ADL WTKFG++EH DEVAL+PY RVD FIIGECSN EC
Sbjct  1    MEIVESLEEIQVQNPQVEDFSWADLTWTKFGTSEHHDEVALVPYARVDEFIIGECSNAEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYR+YWCSFGPENYGEGGG+LPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLALLI+N RRHVNK+GFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALLIYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_010090844.1| hypothetical protein L484_020703 [Morus notabilis]
 gb|EXB40969.1| hypothetical protein L484_020703 [Morus notabilis]
Length=382

 Score =   383 bits (983),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M IVESI  + VQ+P  E+FSSADL WTKFG+++H D+VALIPY+RVD FIIGECSNVEC
Sbjct  1    MAIVESILDIPVQDPSEEEFSSADLTWTKFGTSDHHDDVALIPYERVDEFIIGECSNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYR+YWCSFGPENYGEGGGILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRSIGSLKEYKDDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTC+FVVKRL+A PSLAL+I++ RRHVNKSGFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCNFVVKRLFARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_003552176.1| PREDICTED: uncharacterized protein LOC100776331 [Glycine max]
Length=719

 Score =   394 bits (1012),  Expect = 5e-129, Method: Compositional matrix adjust.
 Identities = 177/207 (86%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M IVES+  + +Q+PP E+F +ADL WTKFG+AEH DEVALIPYDRVDAFIIGEC+NVEC
Sbjct  1    MAIVESVGKIPLQDPPEEEFCAADLTWTKFGNAEHHDEVALIPYDRVDAFIIGECTNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  G+LKEY+ DEYLEYR+YWCSFGPENYGEGGGILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRTIGNLKEYKDDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLAL+++N RRH+NKSGF+CHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYAQPSLALIVYNERRHINKSGFICHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEEN+LEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENILEKHI  207



>ref|XP_010027651.1| PREDICTED: uncharacterized protein LOC104418118 [Eucalyptus grandis]
 gb|KCW54219.1| hypothetical protein EUGRSUZ_I00201 [Eucalyptus grandis]
Length=720

 Score =   393 bits (1010),  Expect = 8e-129, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            MDIV SI  + VQ+P  EDFS+ADL WTKFG+ EH D+VALIPY RVDAFIIGECSNVEC
Sbjct  1    MDIVGSIVDIPVQDPQDEDFSAADLTWTKFGTPEHHDDVALIPYPRVDAFIIGECSNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR +GSLKEY+ DEYLEY+MYWCSFGPENYGEGGGILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRSKGSLKEYKSDEYLEYKMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLALLI+N+RRH+NK+GFVCHGPLDRDAIGPGAK IPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALLIYNDRRHINKAGFVCHGPLDRDAIGPGAKNIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            IC+EIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICSEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_004236786.1| PREDICTED: uncharacterized protein LOC101247514 [Solanum lycopersicum]
Length=719

 Score =   393 bits (1010),  Expect = 1e-128, Method: Compositional matrix adjust.
 Identities = 181/207 (87%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+IVESI  L VQ+PPGEDFS++DL+WTKFG+ E  D+VALI YDRVDAFIIGEC NVE 
Sbjct  1    MEIVESIPDLAVQDPPGEDFSASDLSWTKFGTEERHDDVALIHYDRVDAFIIGECCNVEF  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR +GSLKEY+PDEYLE+R+YWCSFGPENYGEGGGILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRSKGSLKEYKPDEYLEHRLYWCSFGPENYGEGGGILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHF+VKRLYA PSLALLI+NNRRHVNKSGFVCHGPLDRDAIGPGAK IPY
Sbjct  121  ARPQSMRGCTCHFIVKRLYARPSLALLIYNNRRHVNKSGFVCHGPLDRDAIGPGAKNIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVL KHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLAKHI  207



>ref|XP_010473234.1| PREDICTED: uncharacterized protein LOC104752724 [Camelina sativa]
Length=703

 Score =   392 bits (1007),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+I+ES++ + VQNP  EDFS ADL WTKFG++EH DEVAL+PY RVD FIIGECSN EC
Sbjct  1    MEIIESLEEIPVQNPQVEDFSWADLTWTKFGTSEHHDEVALVPYARVDEFIIGECSNAEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYR+YWCSFGPENYGEGGG+LPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLALLI+N RRHVNK+GFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALLIYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_006300800.1| hypothetical protein CARUB_v10019879mg [Capsella rubella]
 gb|EOA33698.1| hypothetical protein CARUB_v10019879mg [Capsella rubella]
Length=703

 Score =   392 bits (1007),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+IVES++ + VQNP  EDFS ADL WTKFG++EH DEVAL+PY RVD FIIGECSN EC
Sbjct  1    MEIVESLEEIPVQNPHVEDFSWADLTWTKFGTSEHHDEVALVPYARVDEFIIGECSNAEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYR+YWCSFGPENYGEGGG+LPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLALLI+N RRHVNK+GFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALLIYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|NP_176256.2| SWIM zinc finger domain-containing protein [Arabidopsis thaliana]
 gb|AAL91647.1| At1g60560/F8A5_10 [Arabidopsis thaliana]
 gb|AAO11540.1| At1g60560/F8A5_10 [Arabidopsis thaliana]
 gb|AEE33698.1| SWIM zinc finger-like protein [Arabidopsis thaliana]
Length=703

 Score =   392 bits (1007),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+IVES++ + VQNP  EDFS ADL WTKFG++EH D+VAL+PY RVD FIIGECSN EC
Sbjct  1    MEIVESLEEIPVQNPQVEDFSWADLTWTKFGTSEHHDQVALVPYARVDEFIIGECSNAEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYR+YWCSFGPENYGEGGG+LPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLALLI+N RRHVNK+GFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALLIYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLEKHI  207



>gb|EYU23749.1| hypothetical protein MIMGU_mgv1a002058mg [Erythranthe guttata]
Length=720

 Score =   392 bits (1008),  Expect = 2e-128, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 194/207 (94%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+I+ESI +L VQ+PPGEDFSSADL W KFG+AE  D+VALIPYDRVDAFIIGECS VEC
Sbjct  1    MEIIESIDNLQVQDPPGEDFSSADLEWVKFGTAERCDDVALIPYDRVDAFIIGECSCVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLK+Y+ DEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRARGSLKQYKNDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            A PQSMRGCTCHFVVKRLYA PSLALLI+N+RRHVNKSGF+CHGPLD+DAIGPGAK IPY
Sbjct  121  AIPQSMRGCTCHFVVKRLYARPSLALLIYNDRRHVNKSGFICHGPLDKDAIGPGAKNIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            +C+E+QQQTMSMIYLGIPEENVLEKHI
Sbjct  181  VCSEVQQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_007040728.1| SWIM zinc finger family protein [Theobroma cacao]
 gb|EOY25229.1| SWIM zinc finger family protein [Theobroma cacao]
Length=718

 Score =   392 bits (1007),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+IVESI  + VQ+PP E+FSSADL WTKFG+AEH D+VALIPY RVD FIIGECSNVEC
Sbjct  1    MEIVESILDIPVQDPPEEEFSSADLTWTKFGAAEHHDDVALIPYARVDEFIIGECSNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR +GSLKEY+ DEYLEYR+YWCSFGPENYGEGGGILPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRSKGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGILPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGC CHFVVKRLYA PSLAL+I+N RRH+NKSGFVCHGPLD+DAIGPGAKKIPY
Sbjct  121  ARPQSMRGCMCHFVVKRLYAQPSLALIIYNERRHINKSGFVCHGPLDKDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            I NEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ISNEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_007133525.1| hypothetical protein PHAVU_011G186500g [Phaseolus vulgaris]
 gb|ESW05519.1| hypothetical protein PHAVU_011G186500g [Phaseolus vulgaris]
Length=719

 Score =   392 bits (1007),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M IVES+  + +Q+P  E+F +ADL WTKFG+AEH D VALIPYDRVDAFIIGECSNVEC
Sbjct  1    MAIVESVGKIPLQDPSEEEFGAADLTWTKFGTAEHHDVVALIPYDRVDAFIIGECSNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYR+YWCSFGPENYGEGGGILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRTIGSLKEYKDDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLAL+I+N RRH+NKSGF+CHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALIIYNERRHINKSGFICHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEEN+LEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENILEKHI  207



>ref|XP_010417988.1| PREDICTED: uncharacterized protein LOC104703643 isoform X1 [Camelina 
sativa]
 ref|XP_010417989.1| PREDICTED: uncharacterized protein LOC104703643 isoform X2 [Camelina 
sativa]
 ref|XP_010417991.1| PREDICTED: uncharacterized protein LOC104703643 isoform X3 [Camelina 
sativa]
Length=703

 Score =   391 bits (1005),  Expect = 3e-128, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+IVES++ + VQNP  EDFS ADL WTKFG++EH DEVAL+PY RVD FIIGECSN EC
Sbjct  1    MEIVESLEEIPVQNPQVEDFSWADLTWTKFGTSEHHDEVALVPYARVDEFIIGECSNAEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYR+YWCSFGPENYGEGGG+LPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLALLI+N RRHVNK+GFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALLIYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEI+QQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIKQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_004511186.1| PREDICTED: uncharacterized protein LOC101498464 [Cicer arietinum]
Length=790

 Score =   394 bits (1011),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 184/219 (84%), Positives = 199/219 (91%), Gaps = 3/219 (1%)
 Frame = +3

Query  105  SASLLSGRSFSGMDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVD  284
            + S L  +SF+    VESI+ + +Q+PP E+FSSADL WTKFG+AEH DEVALIPYDRVD
Sbjct  64   APSFLLYQSFTS---VESIEKIPLQDPPEEEFSSADLTWTKFGNAEHHDEVALIPYDRVD  120

Query  285  AFIIGECSNVECPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILP  464
            AFIIGEC NV CPTRFHIERGRKR  G+LKEY+ DEYLEYR+YWCSFGPENYGEGGGILP
Sbjct  121  AFIIGECCNVLCPTRFHIERGRKRTIGTLKEYKDDEYLEYRLYWCSFGPENYGEGGGILP  180

Query  465  SRRYRLNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDR  644
            SRRYRLNTRNRAARPQSMRGCTCHFVVKRLYA PSLAL+I+N RRHVNKSGFVCHGPLDR
Sbjct  181  SRRYRLNTRNRAARPQSMRGCTCHFVVKRLYARPSLALIIYNERRHVNKSGFVCHGPLDR  240

Query  645  DAIGPGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
            DAIGPGAKKIPYICNEIQQQTMSMIYLGIPEEN+LEKHI
Sbjct  241  DAIGPGAKKIPYICNEIQQQTMSMIYLGIPEENILEKHI  279



>emb|CDY24539.1| BnaA01g22430D [Brassica napus]
Length=708

 Score =   391 bits (1005),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+I+ES++ + VQNP  EDFS +DL+WTKFG+ EH DEVALIPY RV+ FIIGECSN EC
Sbjct  1    MEIIESLEEIPVQNPQAEDFSYSDLSWTKFGTTEHHDEVALIPYARVEEFIIGECSNPEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSL+EY+PDEYLEYR+YWCSFGPENYGEGGG+LPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLREYKPDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLALL++N RRHVNK+GFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALLVYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLEKHI  207



>gb|KJB51581.1| hypothetical protein B456_008G223400 [Gossypium raimondii]
 gb|KJB51582.1| hypothetical protein B456_008G223400 [Gossypium raimondii]
Length=717

 Score =   391 bits (1005),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 180/207 (87%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+IVESI  + VQ+PP E+FSSADL WTKFG+AEH D+VALIPY RVD FIIGECSNVEC
Sbjct  1    MEIVESILDIPVQDPPEEEFSSADLIWTKFGTAEHHDDVALIPYARVDEFIIGECSNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYR+YWCSFGPENYGEGGG+LPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRSMGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGVLPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA P+LAL+IFN RRH+NKSGFVCHGPLD+DAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPALALIIFNERRHINKSGFVCHGPLDKDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            I NEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ISNEIQQQTMSMIYLGIPEENVLEKHI  207



>emb|CDY34123.1| BnaC01g28630D [Brassica napus]
Length=693

 Score =   390 bits (1003),  Expect = 4e-128, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 193/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+I+ES++ + VQNP  EDFS +DL+WTKFG+ EH DEVALIPY RV+ FIIGECSN EC
Sbjct  1    MEIIESLEEIPVQNPQAEDFSYSDLSWTKFGTTEHHDEVALIPYARVEEFIIGECSNPEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSL+EY+PDEYLEYR+YWCSFGPENYGEGGG+LPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLREYKPDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLALL++N RRHVNK+GFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALLVYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_009103823.1| PREDICTED: uncharacterized protein LOC103829887 [Brassica rapa]
Length=703

 Score =   390 bits (1003),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+I+ES++ + VQNP  EDFS +DL WTKFG+ EH DEVALIPY RV+ FIIGECSN EC
Sbjct  1    MEIIESLEEIPVQNPQAEDFSYSDLTWTKFGTTEHHDEVALIPYARVEEFIIGECSNPEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSL+EY+PDEYLEYR+YWCSFGPENYGEGGG+LPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLREYKPDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLALL++N RRHVNK+GFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALLVYNERRHVNKAGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_002518981.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43514.1| conserved hypothetical protein [Ricinus communis]
Length=719

 Score =   391 bits (1004),  Expect = 6e-128, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 190/207 (92%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            MDIVESI  + VQNPP E+FSSADL WTKFG+A+  D+VALIPYDRVD FIIGECSNVEC
Sbjct  1    MDIVESIFDIPVQNPPDEEFSSADLTWTKFGTADRHDDVALIPYDRVDTFIIGECSNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIER RKR  GSLKEY+ DEYLEY++YWCSFGPENYGEGG  LPSRRYRLNTRNRA
Sbjct  61   PTRFHIERQRKRSRGSLKEYKNDEYLEYKLYWCSFGPENYGEGGDTLPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
             RPQSMRGCTCHFVVKRLY  PSLAL+I+N+RRHVNKSGFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  PRPQSMRGCTCHFVVKRLYTRPSLALIIYNDRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_010542310.1| PREDICTED: uncharacterized protein LOC104815571 [Tarenaya hassleriana]
 ref|XP_010542311.1| PREDICTED: uncharacterized protein LOC104815571 [Tarenaya hassleriana]
Length=709

 Score =   389 bits (999),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+I+ ++  ++VQNPP EDFSSADL WTKFG+AEH D+VALIPY RVD FIIGECSNVEC
Sbjct  1    MEIIGALDEILVQNPPLEDFSSADLTWTKFGTAEHHDDVALIPYARVDEFIIGECSNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKE++ D+YLEYR+YWCSFGPENYGEGG +LPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRPRGSLKEHKSDDYLEYRLYWCSFGPENYGEGGSVLPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLY  PS+ALLI+N RRH+NKSGF+CHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYTRPSVALLIYNERRHINKSGFICHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLEKHI  207



>gb|KDP32636.1| hypothetical protein JCGZ_13186 [Jatropha curcas]
Length=721

 Score =   389 bits (1000),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            MDIVE+I  + VQNP  E+F+SADL WTK+G+AE  D+VALIPY+RVD FIIGECSNVEC
Sbjct  1    MDIVENILDIPVQNPSEEEFASADLTWTKYGTAERYDDVALIPYERVDTFIIGECSNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEY++YWCSFGPENYGEGG ILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLKEYKNDEYLEYKLYWCSFGPENYGEGGSILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PS+AL+I+N RRHVNKSGFVCHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSVALIIYNERRHVNKSGFVCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLEKHI  207



>emb|CDP09645.1| unnamed protein product [Coffea canephora]
Length=728

 Score =   389 bits (1000),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 179/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+IVESI  + VQ+PP E+FS+ADL+WTKFG+ E  D+VALIPY RVDAFIIGEC N EC
Sbjct  1    MEIVESIFDIPVQSPPAEEFSAADLDWTKFGTIERHDDVALIPYARVDAFIIGECLNAEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSL+EY+ DEYLEYR+YWCSFGPENYGEGGGILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRARGSLQEYKDDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLALLI+NNRRHVNKSG +CHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALLIYNNRRHVNKSGSICHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_012078506.1| PREDICTED: uncharacterized protein LOC105639150 [Jatropha curcas]
 ref|XP_012078508.1| PREDICTED: uncharacterized protein LOC105639150 [Jatropha curcas]
Length=722

 Score =   389 bits (1000),  Expect = 3e-127, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            MDIVE+I  + VQNP  E+F+SADL WTK+G+AE  D+VALIPY+RVD FIIGECSNVEC
Sbjct  2    MDIVENILDIPVQNPSEEEFASADLTWTKYGTAERYDDVALIPYERVDTFIIGECSNVEC  61

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEY++YWCSFGPENYGEGG ILPSRRYRLNTRNRA
Sbjct  62   PTRFHIERGRKRSRGSLKEYKNDEYLEYKLYWCSFGPENYGEGGSILPSRRYRLNTRNRA  121

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PS+AL+I+N RRHVNKSGFVCHGPLDRDAIGPGAKKIPY
Sbjct  122  ARPQSMRGCTCHFVVKRLYARPSVALIIYNERRHVNKSGFVCHGPLDRDAIGPGAKKIPY  181

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  182  ICNEIQQQTMSMIYLGIPEENVLEKHI  208



>gb|AET02590.2| SWIM zinc finger protein [Medicago truncatula]
Length=721

 Score =   389 bits (999),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M IVES++++ +Q+P  E+FS+ADL WTKFGSAEH DEVALIPYDRVDAFIIGECSNV C
Sbjct  3    MAIVESVRNIPLQDPSEEEFSAADLTWTKFGSAEHYDEVALIPYDRVDAFIIGECSNVLC  62

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  G+LKEY+ DEYLEYR YWCSFGPENYGEGG ILPSRRYRLNTRNRA
Sbjct  63   PTRFHIERGRKRTIGTLKEYKDDEYLEYRQYWCSFGPENYGEGGEILPSRRYRLNTRNRA  122

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLAL+I+N RRHVN SGF+CHGPLDRDAIGPGAKKIPY
Sbjct  123  ARPQSMRGCTCHFVVKRLYARPSLALIIYNERRHVNTSGFICHGPLDRDAIGPGAKKIPY  182

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEEN+LEKHI
Sbjct  183  ICNEIQQQTMSMIYLGIPEENILEKHI  209



>ref|XP_006392152.1| hypothetical protein EUTSA_v10023307mg [Eutrema salsugineum]
 gb|ESQ29438.1| hypothetical protein EUTSA_v10023307mg [Eutrema salsugineum]
Length=710

 Score =   389 bits (998),  Expect = 4e-127, Method: Compositional matrix adjust.
 Identities = 177/206 (86%), Positives = 191/206 (93%), Gaps = 0/206 (0%)
 Frame = +3

Query  144  DIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVECP  323
            +IVES++ + VQNP  EDFS ADL+WTKFG++EH D VALIPY RVD FIIGECSN ECP
Sbjct  9    EIVESLEEIPVQNPQVEDFSWADLSWTKFGTSEHHDVVALIPYARVDEFIIGECSNAECP  68

Query  324  TRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAA  503
            TRFHIERGRKR  GSLKEY+ DEYLEYR+YWCSFGPENYGEGGG+LPSR+YRLNTRNRAA
Sbjct  69   TRFHIERGRKRSRGSLKEYKSDEYLEYRLYWCSFGPENYGEGGGVLPSRKYRLNTRNRAA  128

Query  504  RPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYI  683
            RPQSMRGCTCHFVVKRLYA PSLALLI+N RRHVNK+GF+CHGPLDRDAIGPGAKKIPYI
Sbjct  129  RPQSMRGCTCHFVVKRLYARPSLALLIYNERRHVNKAGFICHGPLDRDAIGPGAKKIPYI  188

Query  684  CNEIQQQTMSMIYLGIPEENVLEKHI  761
            CNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  189  CNEIQQQTMSMIYLGIPEENVLEKHI  214



>ref|XP_003628114.1| hypothetical protein MTR_8g043760 [Medicago truncatula]
Length=732

 Score =   389 bits (999),  Expect = 5e-127, Method: Compositional matrix adjust.
 Identities = 178/207 (86%), Positives = 192/207 (93%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M IVES++++ +Q+P  E+FS+ADL WTKFGSAEH DEVALIPYDRVDAFIIGECSNV C
Sbjct  3    MAIVESVRNIPLQDPSEEEFSAADLTWTKFGSAEHYDEVALIPYDRVDAFIIGECSNVLC  62

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  G+LKEY+ DEYLEYR YWCSFGPENYGEGG ILPSRRYRLNTRNRA
Sbjct  63   PTRFHIERGRKRTIGTLKEYKDDEYLEYRQYWCSFGPENYGEGGEILPSRRYRLNTRNRA  122

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLAL+I+N RRHVN SGF+CHGPLDRDAIGPGAKKIPY
Sbjct  123  ARPQSMRGCTCHFVVKRLYARPSLALIIYNERRHVNTSGFICHGPLDRDAIGPGAKKIPY  182

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEEN+LEKHI
Sbjct  183  ICNEIQQQTMSMIYLGIPEENILEKHI  209



>ref|XP_008441058.1| PREDICTED: uncharacterized protein LOC103485285 [Cucumis melo]
Length=718

 Score =   384 bits (985),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M IVESI  L VQ+PP E+F SADL WTKFG+ EH DEVALIPY RVDAFIIGEC+N+EC
Sbjct  1    MAIVESILDLQVQDPPEEEFYSADLTWTKFGTVEHHDEVALIPYARVDAFIIGECTNIEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKE++ DEYLEYR YWCSFGPENYGEGG ILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLKEFKDDEYLEYRQYWCSFGPENYGEGGSILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLAL+I+N RRHVNKSGFVCHGP DR+AIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALIIYNERRHVNKSGFVCHGPFDREAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSM+YLGIPE N++EKH+
Sbjct  181  ICNEIQQQTMSMLYLGIPEANIVEKHL  207



>gb|KFK40774.1| hypothetical protein AALP_AA2G039200 [Arabis alpina]
Length=703

 Score =   383 bits (984),  Expect = 4e-125, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 189/207 (91%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+IVES++ + VQNP  EDFS +DL WTKFG++EH D+VALIPY RVD FIIGECSN EC
Sbjct  1    MEIVESLEEIPVQNPQVEDFSWSDLTWTKFGTSEHHDDVALIPYSRVDEFIIGECSNAEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYR+YWCSFGPENYGEGG +LPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLKEYKTDEYLEYRLYWCSFGPENYGEGGDVLPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA P LALLI+N RRHVNK+GF+CHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPLLALLIYNKRRHVNKAGFICHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            + NEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  VSNEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_004148660.1| PREDICTED: uncharacterized protein LOC101204643 [Cucumis sativus]
 gb|KGN48347.1| hypothetical protein Csa_6G483290 [Cucumis sativus]
Length=718

 Score =   384 bits (985),  Expect = 5e-125, Method: Compositional matrix adjust.
 Identities = 174/207 (84%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M IVESI  L VQ+PP E+F SADL WTKFG+ EH DEVALIPY RVDAFIIGEC+N+EC
Sbjct  1    MAIVESILDLQVQDPPEEEFYSADLTWTKFGTVEHHDEVALIPYARVDAFIIGECTNIEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKE++ DEYLEYR YWCSFGPENYGEGG ILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLKEFKDDEYLEYRQYWCSFGPENYGEGGSILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLAL+I+N RRHVNKSGFVCHGP DR+AIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPSLALIIYNERRHVNKSGFVCHGPFDREAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSM+YLGIPE N++EKH+
Sbjct  181  ICNEIQQQTMSMLYLGIPEANIVEKHL  207



>ref|XP_007204630.1| hypothetical protein PRUPE_ppa002073mg [Prunus persica]
 gb|EMJ05829.1| hypothetical protein PRUPE_ppa002073mg [Prunus persica]
Length=720

 Score =   381 bits (979),  Expect = 4e-124, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 189/207 (91%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M IVE I  L VQ+PP E+FS+ADL WTKFG+AEH D+ ALIPYDRVD FIIGE SN+EC
Sbjct  1    MAIVECIGDLPVQDPPEEEFSAADLTWTKFGTAEHHDDAALIPYDRVDEFIIGEGSNLEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYRMYWCSFGPENYGEGG ILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRKMGSLKEYKDDEYLEYRMYWCSFGPENYGEGGSILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTC+FVVKRLYA PSLAL+I++ RRHVNKSGFVCHGPLDRDAIGPGAK +PY
Sbjct  121  ARPQSMRGCTCNFVVKRLYARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGPGAKTVPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEEN+LEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENILEKHI  207



>ref|XP_008242047.1| PREDICTED: uncharacterized protein LOC103340404 [Prunus mume]
Length=720

 Score =   381 bits (978),  Expect = 5e-124, Method: Compositional matrix adjust.
 Identities = 176/207 (85%), Positives = 189/207 (91%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M IVE I  L VQ+PP E+FS+ADL WTKFG+AEH D+ ALIPYDRVD FIIGE SN+EC
Sbjct  1    MAIVEFIGDLPVQDPPEEEFSAADLTWTKFGTAEHHDDAALIPYDRVDEFIIGEGSNLEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYRMYWCSFGPENYGEGG ILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRKMGSLKEYKDDEYLEYRMYWCSFGPENYGEGGSILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTC+FVVKRLYA PSLAL+I++ RRHVNKSGFVCHGPLDRDAIGPGAK +PY
Sbjct  121  ARPQSMRGCTCNFVVKRLYARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGPGAKTVPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEEN+LEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENILEKHI  207



>ref|XP_009613006.1| PREDICTED: uncharacterized protein LOC104106214 [Nicotiana tomentosiformis]
Length=718

 Score =   377 bits (968),  Expect = 1e-122, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+IVESI +L +Q+PPGEDFS++DL+WTK G+ E  D+VALI YDRVDAFIIGEC NVE 
Sbjct  1    MEIVESILNLPLQDPPGEDFSASDLSWTKVGNVERYDDVALILYDRVDAFIIGECCNVEF  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ D+YLEYR+YWCSFGPENYGEGG ILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLKEYKHDDYLEYRLYWCSFGPENYGEGGDILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHF+VKRLY  PSLAL+I+NNRRHVNKSG +CHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFIVKRLYTRPSLALIIYNNRRHVNKSGSLCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            +CNEIQQQTMSMIYLGIPE+NVLEKHI
Sbjct  181  VCNEIQQQTMSMIYLGIPEKNVLEKHI  207



>ref|XP_009781835.1| PREDICTED: uncharacterized protein LOC104230671 [Nicotiana sylvestris]
Length=718

 Score =   377 bits (967),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 173/207 (84%), Positives = 191/207 (92%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+IVESI +L VQ+PPGEDFS++DL+WTK G+ E  D+VALI YDRVDAFIIGEC NVE 
Sbjct  1    MEIVESILNLPVQDPPGEDFSASDLSWTKVGNVERYDDVALILYDRVDAFIIGECCNVEF  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLK+Y+ D+YLEYR+YWCSFGPENYGEGG ILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLKDYKHDDYLEYRLYWCSFGPENYGEGGDILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHF+VKRLY  PSLAL+I+NNRRHVNKSG +CHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFIVKRLYNRPSLALIIYNNRRHVNKSGSLCHGPLDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            +CNEIQQQTMSMIYLGIPE+NVLEKHI
Sbjct  181  VCNEIQQQTMSMIYLGIPEKNVLEKHI  207



>ref|XP_010674758.1| PREDICTED: uncharacterized protein LOC104890846 [Beta vulgaris 
subsp. vulgaris]
Length=719

 Score =   375 bits (964),  Expect = 6e-122, Method: Compositional matrix adjust.
 Identities = 169/207 (82%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+IVESI  L +Q+PP  +FSSADL WTKFG+AEH D+VA IPYDRVD FIIGECSNVE 
Sbjct  1    MEIVESIDDLSLQDPPEAEFSSADLKWTKFGTAEHHDDVAKIPYDRVDDFIIGECSNVEF  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ D+YLEY++YWCSFGPENYGEGG ILPSRRYRLNTRNRA
Sbjct  61   PTRFHIERGRKRRRGSLKEYKSDDYLEYKLYWCSFGPENYGEGGDILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYACP+LAL+I+N RRHVNKSGF CHG LDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYACPTLALIIYNERRHVNKSGFPCHGALDRDAIGPGAKKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            +  E+QQQ MSMIYLGIPEENV++KH+
Sbjct  181  VGTEMQQQAMSMIYLGIPEENVVQKHL  207



>ref|XP_009348880.1| PREDICTED: uncharacterized protein LOC103940490 [Pyrus x bretschneideri]
Length=719

 Score =   375 bits (962),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 187/207 (90%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M IVESI  L VQ+PP EDFSSADL WTKFG+ E+ D+ ALIPYDRVD FIIGE SN+EC
Sbjct  1    MAIVESINDLPVQDPPEEDFSSADLTWTKFGTTENHDDAALIPYDRVDDFIIGEGSNLEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGR+R  G   EY+ DEYLEY++YWCSFGPENYGEGGGILPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRRRKMGIFTEYKDDEYLEYKLYWCSFGPENYGEGGGILPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTC+FVVKRLYA PSLAL+I++ RRHVNKSGFVCHGPLDRDAIGPGA KIPY
Sbjct  121  ARPQSMRGCTCNFVVKRLYARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGPGANKIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLG+PEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGLPEENVLEKHI  207



>ref|XP_008351508.1| PREDICTED: uncharacterized protein LOC103414930 [Malus domestica]
Length=719

 Score =   375 bits (962),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M IVESI  L VQ+PP EDFSSADL WTKFG+ E+ D+ ALIPYDRVD FIIGE SN+EC
Sbjct  1    MAIVESINDLPVQDPPEEDFSSADLTWTKFGTTENHDDAALIPYDRVDEFIIGESSNLEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGR+R  G   EY+ DEYLEY++YWCSFGPENYGEGGGILPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRRRKMGIFTEYKDDEYLEYKLYWCSFGPENYGEGGGILPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTC+FVVKRLYA PSLAL+I++ RRHVNKSGFVCHGPLDRDAIGPGA  IPY
Sbjct  121  ARPQSMRGCTCNFVVKRLYARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGPGANXIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_008391981.1| PREDICTED: uncharacterized protein LOC103454170 [Malus domestica]
Length=719

 Score =   375 bits (962),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M IVESI  L VQ+PP EDFSSADL WTKFG+ E+ D+ ALIPYDRVD FIIGE SN+EC
Sbjct  1    MAIVESINDLPVQDPPEEDFSSADLTWTKFGTTENHDDAALIPYDRVDEFIIGESSNLEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGR+R  G   EY+ DEYLEY++YWCSFGPENYGEGGGILPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRRRKMGIFTEYKDDEYLEYKLYWCSFGPENYGEGGGILPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTC+FVVKRLYA PSLAL+I++ RRHVNKSGFVCHGPLDRDAIGPGA  IPY
Sbjct  121  ARPQSMRGCTCNFVVKRLYARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGPGANXIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_008360601.1| PREDICTED: uncharacterized protein LOC103424292 [Malus domestica]
Length=719

 Score =   374 bits (961),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 172/207 (83%), Positives = 186/207 (90%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M IVESI  L VQ+PP EDFSSADL WTKFG+ E+ D+ ALIPYDRVD FIIGE SN+EC
Sbjct  1    MAIVESINDLPVQDPPEEDFSSADLTWTKFGTTENHDDAALIPYDRVDEFIIGESSNLEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGR+R  G   EY+ DEYLEY++YWCSFGPENYGEGGGILPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRRRKMGIFTEYKDDEYLEYKLYWCSFGPENYGEGGGILPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTC+FVVKRLYA PSLAL+I++ RRHVNKSGFVCHGPLDRDAIGPGA  IPY
Sbjct  121  ARPQSMRGCTCNFVVKRLYARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGPGANXIPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEENVLEKHI
Sbjct  181  ICNEIQQQTMSMIYLGIPEENVLEKHI  207



>ref|XP_004287787.1| PREDICTED: uncharacterized protein LOC101292541 [Fragaria vesca 
subsp. vesca]
Length=715

 Score =   374 bits (960),  Expect = 3e-121, Method: Compositional matrix adjust.
 Identities = 170/207 (82%), Positives = 188/207 (91%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            MDIVESI  L VQ+PP E+FSSADL WTKFG+ E+ D+ ALIPYDRVD FIIGECSN+E 
Sbjct  1    MDIVESIHDLPVQDPPVEEFSSADLTWTKFGTYENHDDAALIPYDRVDEFIIGECSNLEY  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR +GSL+EY  D++LEY++YWCSFGPENYGEGGG LPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRKKGSLREYSDDDFLEYKLYWCSFGPENYGEGGGTLPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTC+FVVKRLYA PSLALLI+N RRHVNKSGFVCHGPLD DAIGP AK +PY
Sbjct  121  ARPQSMRGCTCNFVVKRLYARPSLALLIYNQRRHVNKSGFVCHGPLDGDAIGPAAKTVPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLG+PEEN+LEKHI
Sbjct  181  ICNEIQQQTMSMIYLGVPEENILEKHI  207



>ref|XP_008787735.1| PREDICTED: uncharacterized protein LOC103705694 [Phoenix dactylifera]
Length=725

 Score =   371 bits (953),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 167/208 (80%), Positives = 190/208 (91%), Gaps = 1/208 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQ-DEVALIPYDRVDAFIIGECSNVE  317
            M++ +SI  + VQ+PP E+FS+ADL WTKFG+ EH  D+VALIPY RVDAFI GECSN E
Sbjct  1    MEVKDSIDDIPVQDPPDEEFSAADLTWTKFGTTEHHVDDVALIPYARVDAFISGECSNAE  60

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNR  497
            CPTRFHIERGRKR +GSLKEY+ DEYL+YR+YWCSFGPENYGEGG ILPSRRYRLNTRNR
Sbjct  61   CPTRFHIERGRKREKGSLKEYKSDEYLQYRLYWCSFGPENYGEGGSILPSRRYRLNTRNR  120

Query  498  AARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIP  677
            AARPQSMRGCTCHF VKRLYA PS+AL+I++ RRH+NK+GF+CHGPLDRDAIGPGAKKIP
Sbjct  121  AARPQSMRGCTCHFAVKRLYARPSIALIIYHERRHINKAGFICHGPLDRDAIGPGAKKIP  180

Query  678  YICNEIQQQTMSMIYLGIPEENVLEKHI  761
            YIC+EIQQQTMS+IYLGIPEENVL+KHI
Sbjct  181  YICSEIQQQTMSLIYLGIPEENVLQKHI  208



>ref|XP_010921228.1| PREDICTED: uncharacterized protein LOC105044872 [Elaeis guineensis]
Length=725

 Score =   369 bits (948),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 166/208 (80%), Positives = 190/208 (91%), Gaps = 1/208 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQ-DEVALIPYDRVDAFIIGECSNVE  317
            M++ +SI  + VQ+PPGE+FS+ADL+WTKFG+ EH  D+VALIPY RVDAFI GEC N E
Sbjct  1    MEVKDSIDDIPVQDPPGEEFSAADLSWTKFGTTEHHIDDVALIPYARVDAFISGECLNAE  60

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNR  497
            CPTRFHIERGRKR +GSLKEY+ DEYL+YR+YWCSFGPENYGEGG ILPSRRYRLNTRNR
Sbjct  61   CPTRFHIERGRKREKGSLKEYKSDEYLQYRLYWCSFGPENYGEGGSILPSRRYRLNTRNR  120

Query  498  AARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIP  677
            AARPQSMRGCTCHF VKRLYA PS+AL++++ RRH+NKSGF+CHGPLDRDAIGPGAKKIP
Sbjct  121  AARPQSMRGCTCHFAVKRLYARPSIALIVYHERRHINKSGFICHGPLDRDAIGPGAKKIP  180

Query  678  YICNEIQQQTMSMIYLGIPEENVLEKHI  761
            YIC+EIQQQTMS+IYLGIPEENVL+ HI
Sbjct  181  YICSEIQQQTMSLIYLGIPEENVLQTHI  208



>ref|XP_011621857.1| PREDICTED: uncharacterized protein LOC18430096 isoform X2 [Amborella 
trichopoda]
Length=501

 Score =   355 bits (911),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 183/208 (88%), Gaps = 1/208 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQ-DEVALIPYDRVDAFIIGECSNVE  317
            M+ V+SI  LVVQNPP E+FSSAD+ W+K    + Q D+VALIPY RV+ FI GECS VE
Sbjct  1    METVDSILDLVVQNPPNEEFSSADITWSKIQKDKDQTDDVALIPYKRVEEFIKGECSKVE  60

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNR  497
            CPTRFHIERGRKR +GSLK Y+ DEYLEYR+YWCSFGPENYGEGGGILPSRRYRLNTRNR
Sbjct  61   CPTRFHIERGRKRPKGSLKSYQSDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNR  120

Query  498  AARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIP  677
            AARPQSMRGCTC+FVVKRLYA PS+AL+I+N R HVNKSGF+CHGPLD DAIGP AK +P
Sbjct  121  AARPQSMRGCTCNFVVKRLYARPSVALIIYNQRSHVNKSGFICHGPLDGDAIGPRAKTVP  180

Query  678  YICNEIQQQTMSMIYLGIPEENVLEKHI  761
            YICNE QQQTMSMIYLGIPEEN+LEKHI
Sbjct  181  YICNETQQQTMSMIYLGIPEENILEKHI  208



>gb|AFW66989.1| hypothetical protein ZEAMMB73_942101 [Zea mays]
Length=355

 Score =   349 bits (895),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 186/207 (90%), Gaps = 1/207 (0%)
 Frame = +3

Query  144  DIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEH-QDEVALIPYDRVDAFIIGECSNVEC  320
            ++V+S+  L VQ+PPGE+FS+ADL W K+ ++EH +D+VALIPYDR++AFI GE +N EC
Sbjct  6    EVVQSVSDLPVQDPPGEEFSAADLAWVKYATSEHHRDDVALIPYDRMEAFIAGESNNPEC  65

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSL+EYR DEYL YRMYWCSFGPENYGEGG ILPSR+YRLNTRNRA
Sbjct  66   PTRFHIERGRKRERGSLREYRSDEYLLYRMYWCSFGPENYGEGGTILPSRKYRLNTRNRA  125

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHF +KRLYA PSL L+I++ RRHVNKSGF+CHGPLDRDAIGPGA+K+PY
Sbjct  126  ARPQSMRGCTCHFTIKRLYARPSLLLIIYHERRHVNKSGFICHGPLDRDAIGPGARKMPY  185

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            I +EIQQQTMS+IYLG+PEEN+L+ HI
Sbjct  186  IGSEIQQQTMSLIYLGVPEENILQTHI  212



>dbj|BAK04195.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=729

 Score =   357 bits (916),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 160/214 (75%), Positives = 189/214 (88%), Gaps = 1/214 (0%)
 Frame = +3

Query  123  GRSFSGMDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQ-DEVALIPYDRVDAFIIG  299
            G   + M++++S+  L VQ+PPGE+FS+ADL W K+ S+EH  D+VALIPYDR++AFI G
Sbjct  2    GEVMAVMEVLQSVSDLPVQDPPGEEFSAADLRWVKYASSEHHCDDVALIPYDRMEAFISG  61

Query  300  ECSNVECPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYR  479
            EC+N E PTRFHIERGRKR  GSLKE+R DEYL YRMYWCSFGPENYGEGG ILPSRRYR
Sbjct  62   ECNNPEYPTRFHIERGRKRERGSLKEFRSDEYLLYRMYWCSFGPENYGEGGTILPSRRYR  121

Query  480  LNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGP  659
            LNTRNRAARPQSMRGCTCHF +KRLYA PSLAL+I++ RRHVNKSGFVCHGPLDRDAIGP
Sbjct  122  LNTRNRAARPQSMRGCTCHFAIKRLYARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGP  181

Query  660  GAKKIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
            GA+++PY+ +EIQQQTMS+IYLG+PEEN+L+ HI
Sbjct  182  GARRVPYVGSEIQQQTMSLIYLGVPEENILQTHI  215



>ref|NP_001062830.1| Os09g0309100 [Oryza sativa Japonica Group]
 dbj|BAD36226.1| SWIM zinc finger family protein-like [Oryza sativa Japonica Group]
 dbj|BAD36475.1| SWIM zinc finger family protein-like [Oryza sativa Japonica Group]
 dbj|BAF24744.1| Os09g0309100 [Oryza sativa Japonica Group]
 gb|EAZ44181.1| hypothetical protein OsJ_28802 [Oryza sativa Japonica Group]
 dbj|BAG95598.1| unnamed protein product [Oryza sativa Japonica Group]
Length=729

 Score =   357 bits (916),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 156/214 (73%), Positives = 187/214 (87%), Gaps = 1/214 (0%)
 Frame = +3

Query  123  GRSFSGMDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQ-DEVALIPYDRVDAFIIG  299
            G      ++VES+  L VQ+PPGE+FS+ADL W K+ S+EHQ D+VALIPY+R+DAFI G
Sbjct  2    GTEAEAAEVVESVSDLAVQDPPGEEFSAADLRWVKYASSEHQRDDVALIPYERMDAFIAG  61

Query  300  ECSNVECPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYR  479
            ECSN ECPTRFHIERGRKR  G+L+E R D+YL YRMYWCSFGPENYGEGG ILPSR+YR
Sbjct  62   ECSNPECPTRFHIERGRKRDRGTLREVRSDDYLLYRMYWCSFGPENYGEGGTILPSRKYR  121

Query  480  LNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGP  659
            LNTRNRAARPQSMRGCTCHF +KRLYA PSL L+I++ RRH+NKSGF+CHGPLDRDAIGP
Sbjct  122  LNTRNRAARPQSMRGCTCHFAIKRLYARPSLVLIIYHERRHINKSGFICHGPLDRDAIGP  181

Query  660  GAKKIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
            GA+++PY+ +EIQQQTMS+IYLG+PEEN+L+ H+
Sbjct  182  GARRVPYVGSEIQQQTMSLIYLGVPEENILQTHM  215



>gb|EPS61942.1| hypothetical protein M569_12851, partial [Genlisea aurea]
Length=691

 Score =   356 bits (913),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 162/207 (78%), Positives = 185/207 (89%), Gaps = 0/207 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+I+ESI +L VQ+P GEDF S+DL W K  +AE  ++VALIPYDRVDAFIIGECS VE 
Sbjct  1    MEIIESIDTLTVQDPGGEDFCSSDLEWFKLRNAERCEDVALIPYDRVDAFIIGECSRVEF  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFH+ERGRKR  GSLK++  DEYL+Y++YWCSFGPENYGEGG ILPSRRYRLNTRNRA
Sbjct  61   PTRFHVERGRKRARGSLKQHTADEYLDYKLYWCSFGPENYGEGGTILPSRRYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHF+VKRLYA PSLALLI++ RRHVNKSG +CHGPLD DAIGPGAK++PY
Sbjct  121  ARPQSMRGCTCHFIVKRLYARPSLALLIYSERRHVNKSGIICHGPLDGDAIGPGAKRVPY  180

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            +C+ IQQQTMSM+YLGIPEENVLEKHI
Sbjct  181  MCSGIQQQTMSMMYLGIPEENVLEKHI  207



>ref|XP_009383179.1| PREDICTED: uncharacterized protein LOC103970968 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009383259.1| PREDICTED: uncharacterized protein LOC103970968 [Musa acuminata 
subsp. malaccensis]
Length=727

 Score =   356 bits (914),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 186/208 (89%), Gaps = 1/208 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQ-DEVALIPYDRVDAFIIGECSNVE  317
            M+I  SI  L VQ+PP E+F+++DL WTK+GS+EH  D+VAL+PYDRVDAFI GECSN E
Sbjct  1    MEIKYSIDDLPVQDPPTEEFTASDLTWTKYGSSEHHVDDVALVPYDRVDAFIGGECSNPE  60

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNR  497
             PTRFHIERGRKR  GSLKE + DEYL YR+YWCSFGPENYGEGG ILPSRRYRLNTRNR
Sbjct  61   HPTRFHIERGRKRERGSLKECKSDEYLLYRLYWCSFGPENYGEGGSILPSRRYRLNTRNR  120

Query  498  AARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIP  677
            AARPQSMRGCTCHF +KRLYA PS+AL+I++ RRHVNKSGF+CHGPLDRDAIGPGAKK+P
Sbjct  121  AARPQSMRGCTCHFAIKRLYARPSIALIIYHERRHVNKSGFICHGPLDRDAIGPGAKKVP  180

Query  678  YICNEIQQQTMSMIYLGIPEENVLEKHI  761
            YIC+EIQQQTMS+IYLGIPEENVL+ HI
Sbjct  181  YICSEIQQQTMSLIYLGIPEENVLQTHI  208



>ref|XP_006840321.1| PREDICTED: uncharacterized protein LOC18430096 isoform X1 [Amborella 
trichopoda]
 gb|ERN01996.1| hypothetical protein AMTR_s00045p00084300 [Amborella trichopoda]
Length=719

 Score =   356 bits (913),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 165/208 (79%), Positives = 183/208 (88%), Gaps = 1/208 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQ-DEVALIPYDRVDAFIIGECSNVE  317
            M+ V+SI  LVVQNPP E+FSSAD+ W+K    + Q D+VALIPY RV+ FI GECS VE
Sbjct  1    METVDSILDLVVQNPPNEEFSSADITWSKIQKDKDQTDDVALIPYKRVEEFIKGECSKVE  60

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNR  497
            CPTRFHIERGRKR +GSLK Y+ DEYLEYR+YWCSFGPENYGEGGGILPSRRYRLNTRNR
Sbjct  61   CPTRFHIERGRKRPKGSLKSYQSDEYLEYRLYWCSFGPENYGEGGGILPSRRYRLNTRNR  120

Query  498  AARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIP  677
            AARPQSMRGCTC+FVVKRLYA PS+AL+I+N R HVNKSGF+CHGPLD DAIGP AK +P
Sbjct  121  AARPQSMRGCTCNFVVKRLYARPSVALIIYNQRSHVNKSGFICHGPLDGDAIGPRAKTVP  180

Query  678  YICNEIQQQTMSMIYLGIPEENVLEKHI  761
            YICNE QQQTMSMIYLGIPEEN+LEKHI
Sbjct  181  YICNETQQQTMSMIYLGIPEENILEKHI  208



>ref|XP_004968166.1| PREDICTED: uncharacterized protein LOC101763681 [Setaria italica]
Length=727

 Score =   355 bits (910),  Expect = 7e-114, Method: Compositional matrix adjust.
 Identities = 159/207 (77%), Positives = 186/207 (90%), Gaps = 1/207 (0%)
 Frame = +3

Query  144  DIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEH-QDEVALIPYDRVDAFIIGECSNVEC  320
            ++++S+  L VQNPPGE+FS+ADL W K+ S+EH +D+VALIPYDR++AFI GE +N EC
Sbjct  8    EVLQSVSDLPVQNPPGEEFSAADLTWVKYASSEHHRDDVALIPYDRMEAFISGESNNPEC  67

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSL+EYR DEYL YRMYWCSFGPENYGEGG ILPSRRYRLNTRNRA
Sbjct  68   PTRFHIERGRKREMGSLREYRSDEYLLYRMYWCSFGPENYGEGGTILPSRRYRLNTRNRA  127

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHF +KRLYA PSL L+I++ RRHVNKSGF+CHGPLDRDAIGPGA+K+PY
Sbjct  128  ARPQSMRGCTCHFAIKRLYARPSLLLIIYHERRHVNKSGFICHGPLDRDAIGPGARKVPY  187

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            I +EIQQQTMS+IYLG+PEEN+L+ HI
Sbjct  188  IGSEIQQQTMSLIYLGVPEENILQTHI  214



>ref|XP_008644121.1| PREDICTED: uncharacterized protein LOC100383900 isoform X1 [Zea 
mays]
 gb|AFW66990.1| hypothetical protein ZEAMMB73_942101 [Zea mays]
Length=725

 Score =   353 bits (905),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 186/207 (90%), Gaps = 1/207 (0%)
 Frame = +3

Query  144  DIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEH-QDEVALIPYDRVDAFIIGECSNVEC  320
            ++V+S+  L VQ+PPGE+FS+ADL W K+ ++EH +D+VALIPYDR++AFI GE +N EC
Sbjct  6    EVVQSVSDLPVQDPPGEEFSAADLAWVKYATSEHHRDDVALIPYDRMEAFIAGESNNPEC  65

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSL+EYR DEYL YRMYWCSFGPENYGEGG ILPSR+YRLNTRNRA
Sbjct  66   PTRFHIERGRKRERGSLREYRSDEYLLYRMYWCSFGPENYGEGGTILPSRKYRLNTRNRA  125

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHF +KRLYA PSL L+I++ RRHVNKSGF+CHGPLDRDAIGPGA+K+PY
Sbjct  126  ARPQSMRGCTCHFTIKRLYARPSLLLIIYHERRHVNKSGFICHGPLDRDAIGPGARKMPY  185

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            I +EIQQQTMS+IYLG+PEEN+L+ HI
Sbjct  186  IGSEIQQQTMSLIYLGVPEENILQTHI  212



>ref|XP_002466103.1| hypothetical protein SORBIDRAFT_01g001310 [Sorghum bicolor]
 gb|EER93101.1| hypothetical protein SORBIDRAFT_01g001310 [Sorghum bicolor]
Length=728

 Score =   352 bits (903),  Expect = 8e-113, Method: Compositional matrix adjust.
 Identities = 158/207 (76%), Positives = 186/207 (90%), Gaps = 1/207 (0%)
 Frame = +3

Query  144  DIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEH-QDEVALIPYDRVDAFIIGECSNVEC  320
            ++++S+  L VQ+PPGE+FS+ADL W K+ S+EH +D+VALIPYDR++AFI GE +N EC
Sbjct  11   EVLQSVSDLPVQDPPGEEFSAADLTWVKYASSEHHRDDVALIPYDRMEAFIGGESNNPEC  70

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSL+EYR DEYL YRMYWCSFGPENYGEGG ILPSR+YRLNTRNRA
Sbjct  71   PTRFHIERGRKRERGSLREYRSDEYLLYRMYWCSFGPENYGEGGTILPSRKYRLNTRNRA  130

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHF VKRLYA PSL L+I++ RRHVNKSGF+CHGPLDRDAIGPGA+K+PY
Sbjct  131  ARPQSMRGCTCHFTVKRLYARPSLLLIIYHERRHVNKSGFICHGPLDRDAIGPGARKMPY  190

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            I +EIQQQTMS+IYLG+PEEN+L+ HI
Sbjct  191  IGSEIQQQTMSLIYLGVPEENILQTHI  217



>ref|XP_003628100.1| hypothetical protein MTR_8g043530 [Medicago truncatula]
Length=792

 Score =   353 bits (907),  Expect = 9e-113, Method: Compositional matrix adjust.
 Identities = 177/267 (66%), Positives = 191/267 (72%), Gaps = 60/267 (22%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M IVES++++ +Q+P  E+FS+ADL WTKFGSAEH DEVALIPYDRVDAFIIGECSNV C
Sbjct  3    MAIVESVRNIPLQDPSEEEFSAADLTWTKFGSAEHYDEVALIPYDRVDAFIIGECSNVLC  62

Query  321  PTRFHIERGRKRVEGSLKEYRPDE---------YLEYR----------------------  407
            PTRFHIERGRKR  G+LKEY+ DE         YLE R                      
Sbjct  63   PTRFHIERGRKRTIGTLKEYKDDEYLEYRQWFGYLERRHVGSLVSRVDQMGSSQITSGRG  122

Query  408  -----------------------------MYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
                                          YWCSFGPENYGEGG ILPSRRYRLNTRNRA
Sbjct  123  RPRKFIRETIKKDQEINGFDRDMIYDRTLWYWCSFGPENYGEGGEILPSRRYRLNTRNRA  182

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA PSLAL+I+N RRHVN SGF+CHGPLDRDAIGPGAKKIPY
Sbjct  183  ARPQSMRGCTCHFVVKRLYARPSLALIIYNERRHVNTSGFICHGPLDRDAIGPGAKKIPY  242

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            ICNEIQQQTMSMIYLGIPEEN+LEKHI
Sbjct  243  ICNEIQQQTMSMIYLGIPEENILEKHI  269



>ref|XP_003576405.1| PREDICTED: uncharacterized protein LOC100828723 [Brachypodium 
distachyon]
Length=726

 Score =   352 bits (903),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 157/207 (76%), Positives = 185/207 (89%), Gaps = 1/207 (0%)
 Frame = +3

Query  144  DIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQ-DEVALIPYDRVDAFIIGECSNVEC  320
            ++++S+  L VQ+PPGE+FS+ADL W K+ S+EH  D+VALIPYDR +AFI GEC+N E 
Sbjct  6    EVLQSVSDLPVQDPPGEEFSAADLRWVKYASSEHHCDDVALIPYDRTEAFISGECNNPEY  65

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKE+R DEYL YRMYWCSFGPENYGEGG ILPSR+YRLNTRNRA
Sbjct  66   PTRFHIERGRKRERGSLKEFRSDEYLLYRMYWCSFGPENYGEGGAILPSRKYRLNTRNRA  125

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHF +KRLYA PSLAL+I++ RRHVNKSGFVCHGPLDRDAIGPGA+++PY
Sbjct  126  ARPQSMRGCTCHFAIKRLYARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGPGARRVPY  185

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            + +EIQQQTMS+IYLG+PEEN+L+ HI
Sbjct  186  VGSEIQQQTMSLIYLGVPEENILQTHI  212



>gb|EMT08273.1| hypothetical protein F775_06016 [Aegilops tauschii]
Length=724

 Score =   351 bits (901),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/214 (74%), Positives = 186/214 (87%), Gaps = 1/214 (0%)
 Frame = +3

Query  123  GRSFSGMDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQ-DEVALIPYDRVDAFIIG  299
            G      ++++S+  L VQ+PPGE+FS+ADL W K+ S+EH  D+VALIPYDR++AFI G
Sbjct  2    GEVMEMTEVLQSVSDLPVQDPPGEEFSAADLRWVKYASSEHHCDDVALIPYDRMEAFISG  61

Query  300  ECSNVECPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYR  479
            EC+N E PTRFHIERGRKR  G+LKE R D+YL YRMYWCSFGPENYGEGG ILPSRRYR
Sbjct  62   ECNNPEYPTRFHIERGRKRERGTLKEVRSDDYLLYRMYWCSFGPENYGEGGTILPSRRYR  121

Query  480  LNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGP  659
            LNTRNRAARPQSMRGCTCHF +KRLYA PSLAL+I++ RRHVNKSGFVCHGPLDRDAIGP
Sbjct  122  LNTRNRAARPQSMRGCTCHFAIKRLYARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGP  181

Query  660  GAKKIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
            GA+K+PY+ +EIQQQTMS+IYLG+PEEN+L+ HI
Sbjct  182  GARKVPYVGSEIQQQTMSLIYLGVPEENILQTHI  215



>gb|EEC84321.1| hypothetical protein OsI_30820 [Oryza sativa Indica Group]
Length=733

 Score =   350 bits (898),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 153/203 (75%), Positives = 182/203 (90%), Gaps = 1/203 (0%)
 Frame = +3

Query  156  SIQSLVVQNPPGEDFSSADLNWTKFGSAEHQ-DEVALIPYDRVDAFIIGECSNVECPTRF  332
            S+  L VQ+PPGE+FS+ADL W K+ S+EHQ D+VALIPY+R+DAFI GECSN ECPTRF
Sbjct  17   SVSDLAVQDPPGEEFSAADLRWVKYASSEHQRDDVALIPYERMDAFIAGECSNPECPTRF  76

Query  333  HIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARPQ  512
            HIERGRKR  G+L+E R D+YL YRMYWCSFGPENYGEGG ILPSR+YRLNTRNRAARPQ
Sbjct  77   HIERGRKRDRGTLREVRSDDYLLYRMYWCSFGPENYGEGGTILPSRKYRLNTRNRAARPQ  136

Query  513  SMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICNE  692
            SMRGCTCHF +KRLYA PSL L+I++ RRH+NKSGF+CHGPLDRDAIGPGA+++PY+ +E
Sbjct  137  SMRGCTCHFAIKRLYARPSLVLIIYHERRHINKSGFICHGPLDRDAIGPGARRVPYVGSE  196

Query  693  IQQQTMSMIYLGIPEENVLEKHI  761
            IQQQTMS+IYLG+PEEN+L+ H+
Sbjct  197  IQQQTMSLIYLGVPEENILQTHM  219



>gb|EMS61136.1| hypothetical protein TRIUR3_35179 [Triticum urartu]
Length=654

 Score =   347 bits (891),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 156/206 (76%), Positives = 184/206 (89%), Gaps = 1/206 (0%)
 Frame = +3

Query  147  IVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQ-DEVALIPYDRVDAFIIGECSNVECP  323
            +++S+  L VQ+PPGE+FS+ADL W K+ S+EH  D+VALIPYDR++AFI GEC+N E P
Sbjct  10   VLQSVSDLPVQDPPGEEFSAADLRWVKYASSEHHCDDVALIPYDRMEAFISGECNNPEYP  69

Query  324  TRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAA  503
            TRFHIERGRKR  G+LKE R D+YL YRMYWCSFGPENYGEGG ILPSRRYRLNTRNRAA
Sbjct  70   TRFHIERGRKRERGTLKEVRSDDYLLYRMYWCSFGPENYGEGGTILPSRRYRLNTRNRAA  129

Query  504  RPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYI  683
            RPQSMRGCTCHF +K+LYA PSLAL+I++ RRHVNKSGFVCHGPLDRDAIGPGA+K+PY+
Sbjct  130  RPQSMRGCTCHFAIKQLYARPSLALIIYHERRHVNKSGFVCHGPLDRDAIGPGARKVPYV  189

Query  684  CNEIQQQTMSMIYLGIPEENVLEKHI  761
             +EIQQQTMS+IYLG+PEEN+L+ HI
Sbjct  190  GSEIQQQTMSLIYLGVPEENILQTHI  215



>ref|XP_006660525.1| PREDICTED: uncharacterized protein LOC102707611 [Oryza brachyantha]
Length=728

 Score =   347 bits (890),  Expect = 9e-111, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 185/207 (89%), Gaps = 1/207 (0%)
 Frame = +3

Query  144  DIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQ-DEVALIPYDRVDAFIIGECSNVEC  320
            ++VES+  L VQ+PP E+FS+ADL W K+ S+EHQ D+VALIPY+R++AFI GEC++ EC
Sbjct  8    EVVESVSDLPVQDPPAEEFSAADLRWAKYASSEHQRDDVALIPYERMEAFIAGECNSPEC  67

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  G+L+E R D+YL YRMYWCSFGPENYGEGG ILPSR+YRLNTRNRA
Sbjct  68   PTRFHIERGRKRDRGTLREVRSDDYLLYRMYWCSFGPENYGEGGTILPSRKYRLNTRNRA  127

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHF +KRLYA PSL L+I++ RRH+NKSGF+CHGPLDRDAIGPGA+++PY
Sbjct  128  ARPQSMRGCTCHFAIKRLYARPSLVLIIYHERRHINKSGFICHGPLDRDAIGPGARRVPY  187

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKHI  761
            + +EIQQQTMS+IYLG+PEEN+L+ H+
Sbjct  188  VGSEIQQQTMSLIYLGVPEENILQTHM  214



>gb|KFK40773.1| hypothetical protein AALP_AA2G039200 [Arabis alpina]
Length=642

 Score =   331 bits (849),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+IVES++ + VQNP  EDFS +DL WTKFG++EH D+VALIPY RVD FIIGECSN EC
Sbjct  1    MEIVESLEEIPVQNPQVEDFSWSDLTWTKFGTSEHHDDVALIPYSRVDEFIIGECSNAEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            PTRFHIERGRKR  GSLKEY+ DEYLEYR+YWCSFGPENYGEGG +LPSR+YRLNTRNRA
Sbjct  61   PTRFHIERGRKRSRGSLKEYKTDEYLEYRLYWCSFGPENYGEGGDVLPSRKYRLNTRNRA  120

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
            ARPQSMRGCTCHFVVKRLYA P LALLI+N RRHVNK+GF+CHGPLDRDAIGPGAKKIPY
Sbjct  121  ARPQSMRGCTCHFVVKRLYARPLLALLIYNKRRHVNKAGFICHGPLDRDAIGPGAKKIPY  180



>gb|KJB21169.1| hypothetical protein B456_003G185900 [Gossypium raimondii]
Length=677

 Score =   315 bits (808),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 151/211 (72%), Positives = 172/211 (82%), Gaps = 16/211 (8%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+IV+SI  + VQ+P  E FSSADL W KFG+ EHQD+VALIPY RV+ FIIGEC NVEC
Sbjct  1    MEIVKSILDIPVQDPQAE-FSSADLTWKKFGTVEHQDDVALIPYTRVNDFIIGECCNVEC  59

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRN--  494
            P RFHIERGRKR +GS+KEY+ D+YLEY++YWCSFGPENYGEGGGILPSR+YRLNTR   
Sbjct  60   PKRFHIERGRKRSKGSVKEYKNDDYLEYKLYWCSFGPENYGEGGGILPSRKYRLNTRFKH  119

Query  495  --RAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAK  668
              RAARPQSMRGCTCHFVVKRLY  PSL L+I+N + H+NKSGFVCHGPLD+D IGP   
Sbjct  120  PIRAARPQSMRGCTCHFVVKRLYTRPSLVLIIYNVKCHINKSGFVCHGPLDKDTIGP---  176

Query  669  KIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
                    IQQQTMSMIY GIP+ENVL K+I
Sbjct  177  --------IQQQTMSMIYQGIPKENVLGKNI  199



>gb|AES96430.2| zinc ion-binding protein [Medicago truncatula]
Length=676

 Score =   283 bits (723),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 167/211 (79%), Gaps = 19/211 (9%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M IVES+  + +Q+PP E+FSSADL WTKFG+A+H DE                CSNV C
Sbjct  1    MAIVESVSKIPLQDPPEEEFSSADLTWTKFGNADHHDEA---------------CSNVLC  45

Query  321  PTRFHIERGRKRVEG----SLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNT  488
            PT+FHIE G K  +G    +LK+Y+ DE++EY+ Y CSFGPENYGEGG ILPSRR R NT
Sbjct  46   PTQFHIEGGTKLPKGQSRDTLKKYKGDEHIEYKKYQCSFGPENYGEGGEILPSRRCRTNT  105

Query  489  RNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAK  668
            RNRAARPQSMRGCTCHFVVKRLYA PSLAL+++N RRHVNKSGF+CHGPLDRDAIGP A 
Sbjct  106  RNRAARPQSMRGCTCHFVVKRLYARPSLALIVYNERRHVNKSGFICHGPLDRDAIGPRAT  165

Query  669  KIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
             IPYI NEIQQQT+SMI+LGIPEEN+LEKHI
Sbjct  166  NIPYISNEIQQQTISMIHLGIPEENILEKHI  196



>ref|XP_003613472.1| hypothetical protein MTR_5g037070 [Medicago truncatula]
Length=705

 Score =   283 bits (723),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 145/211 (69%), Positives = 167/211 (79%), Gaps = 19/211 (9%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M IVES+  + +Q+PP E+FSSADL WTKFG+A+H DE                CSNV C
Sbjct  1    MAIVESVSKIPLQDPPEEEFSSADLTWTKFGNADHHDEA---------------CSNVLC  45

Query  321  PTRFHIERGRKRVEG----SLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNT  488
            PT+FHIE G K  +G    +LK+Y+ DE++EY+ Y CSFGPENYGEGG ILPSRR R NT
Sbjct  46   PTQFHIEGGTKLPKGQSRDTLKKYKGDEHIEYKKYQCSFGPENYGEGGEILPSRRCRTNT  105

Query  489  RNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAK  668
            RNRAARPQSMRGCTCHFVVKRLYA PSLAL+++N RRHVNKSGF+CHGPLDRDAIGP A 
Sbjct  106  RNRAARPQSMRGCTCHFVVKRLYARPSLALIVYNERRHVNKSGFICHGPLDRDAIGPRAT  165

Query  669  KIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
             IPYI NEIQQQT+SMI+LGIPEEN+LEKHI
Sbjct  166  NIPYISNEIQQQTISMIHLGIPEENILEKHI  196



>ref|XP_009406639.1| PREDICTED: uncharacterized protein LOC103989501 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406640.1| PREDICTED: uncharacterized protein LOC103989501 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406641.1| PREDICTED: uncharacterized protein LOC103989501 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406642.1| PREDICTED: uncharacterized protein LOC103989501 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009406643.1| PREDICTED: uncharacterized protein LOC103989501 [Musa acuminata 
subsp. malaccensis]
Length=970

 Score =   213 bits (543),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I +L VQNPP  +FS+AD+ W++  G  E  D +ALIP+ RV+ F+ GE +N ECPTR
Sbjct  5    DEILTLPVQNPPTLEFSAADIVWSRVEGWREKMDRLALIPFSRVNDFVRGESNNKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R      + + D  LEY +YWCSFGP+++ +GG + PSR Y    +  A RP
Sbjct  65   FHVEARRRRPPEMAYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRNYATKRKTPAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGC CHF+VKRL A PS+AL+I+N  +HV+K G  CHGPLD+ A G  A   PYI +
Sbjct  125  NTKRGCVCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPLDKKAAGTRAMFAPYISD  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            E++ Q MS++Y+G+P E ++++H
Sbjct  185  ELRLQIMSLLYVGVPVETIMQRH  207



>ref|XP_010921093.1| PREDICTED: uncharacterized protein LOC105044782 [Elaeis guineensis]
Length=1104

 Score =   214 bits (546),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 140/203 (69%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I +L VQNPP  +FS+AD+ W++  G  E  D +ALIP+ RV+ F+ GE +N ECPTR
Sbjct  5    DEILTLPVQNPPTLEFSAADIVWSRVEGWREQMDRLALIPFSRVNDFVRGESNNKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R      + + D  LEY +YWCSFGP+++ +GG + PSR Y    +  A RP
Sbjct  65   FHVEARRRRPPEMAYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRNYTAKRKTPAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGC CHF+VKRL A PS+AL+I+N  +HV+K G  CHGP+D+ A+G  A   PYI +
Sbjct  125  NTKRGCVCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPMDKKAVGTRAMFAPYISD  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            E++ Q MS++Y+G+P E ++++H
Sbjct  185  ELRLQIMSLLYVGVPVETIMQRH  207



>ref|XP_006858725.1| PREDICTED: uncharacterized protein LOC18448602 [Amborella trichopoda]
 gb|ERN20192.1| hypothetical protein AMTR_s00066p00115970 [Amborella trichopoda]
Length=1173

 Score =   214 bits (544),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/202 (49%), Positives = 144/202 (71%), Gaps = 1/202 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I ++ VQ P   +FSSADL W+K  G  +  D+VALIP+ RVD F+ GE +N ECPTR
Sbjct  6    DQILTMPVQQPSTIEFSSADLTWSKVEGWRQVMDKVALIPFSRVDDFVRGESANPECPTR  65

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R++ +G   + R D Y+EY +YWCSFGP+++  GG   PSR ++   ++ A RP
Sbjct  66   FHVEARRRKPKGMGYKPRVDGYIEYILYWCSFGPDDHRVGGISRPSRSFKPPKKSPAGRP  125

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
               RGCTCHF+VKRL A PS+AL+I+N+R H++KSG  CHGP D  A+G GA   PYI +
Sbjct  126  GQKRGCTCHFIVKRLMAEPSVALIIYNHREHIDKSGLPCHGPQDGQALGTGAMFAPYISD  185

Query  690  EIQQQTMSMIYLGIPEENVLEK  755
            E++QQ +S++Y+G+P E+++++
Sbjct  186  ELRQQVISLLYVGVPVESIMQR  207



>ref|XP_006842250.2| PREDICTED: uncharacterized protein LOC18432077, partial [Amborella 
trichopoda]
Length=690

 Score =   210 bits (535),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 105/214 (49%), Positives = 141/214 (66%), Gaps = 4/214 (2%)
 Frame = +3

Query  129  SFSGMDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGEC  305
            S + M  +E I +L VQ+PP  +FS+A LNW K  G  +  D++ALIP+ RVD F+ GE 
Sbjct  4    SENKMPRMEDILNLPVQDPPYAEFSAAHLNWVKVDGGRQGGDDIALIPFSRVDDFVKGES  63

Query  306  SNVECPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGE---GGGILPSRRY  476
            + VECP  F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y +   G G  P+ + 
Sbjct  64   NKVECPASFRIESRRKRSEGSVSKPRVDGYLEYTIYWCSYGPEDYRDCDSGIGDFPNNKP  123

Query  477  RLNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIG  656
                 +R  R   MRGC CHF VKRLY  P LAL+IFN + HV+K+G  CHG LDRDAIG
Sbjct  124  TSGKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIFNQKNHVDKTGAPCHGSLDRDAIG  183

Query  657  PGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
              A   P I  E++Q+ MS++Y+G+P +N+++ H
Sbjct  184  TRAMYAPRISEELRQRIMSLLYIGVPLDNIIQHH  217



>ref|XP_008782616.1| PREDICTED: uncharacterized protein LOC103702098 [Phoenix dactylifera]
Length=1107

 Score =   213 bits (542),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 140/203 (69%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I +L VQNPP  +FS+AD+ W++  G  E  D +ALIP+ RV+ F+ GE +N ECPTR
Sbjct  5    DEILTLPVQNPPTLEFSAADIVWSRVEGWREQMDRLALIPFSRVNDFVRGESNNKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R      + + D  LEY +YWCSFGP+++ +GG + PSR Y    +  A RP
Sbjct  65   FHVEARRRRPPEMAYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRNYTAKRKTPAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGC CHF+VKRL A PS+AL+I+N  +HV+K G  CHGP+D+ A+G  A   PYI +
Sbjct  125  NTKRGCVCHFIVKRLIAEPSVALIIYNQDKHVDKKGNPCHGPMDKKAVGTRAMFAPYISD  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            E++ Q MS++Y+G+P E ++++H
Sbjct  185  ELRLQIMSLLYVGVPVETIMQRH  207



>gb|ERN03925.1| hypothetical protein AMTR_s00078p00196690 [Amborella trichopoda]
Length=786

 Score =   211 bits (536),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 139/210 (66%), Gaps = 4/210 (2%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVE  317
            M  +E I +L VQ+PP  +FS+A LNW K  G  +  D++ALIP+ RVD F+ GE + VE
Sbjct  23   MPRMEDILNLPVQDPPYAEFSAAHLNWVKVDGGRQGGDDIALIPFSRVDDFVKGESNKVE  82

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGE---GGGILPSRRYRLNT  488
            CP  F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y +   G G  P+ +     
Sbjct  83   CPASFRIESRRKRSEGSVSKPRVDGYLEYTIYWCSYGPEDYRDCDSGIGDFPNNKPTSGK  142

Query  489  RNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAK  668
             +R  R   MRGC CHF VKRLY  P LAL+IFN + HV+K+G  CHG LDRDAIG  A 
Sbjct  143  GSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIFNQKNHVDKTGAPCHGSLDRDAIGTRAM  202

Query  669  KIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
              P I  E++Q+ MS++Y+G+P +N+++ H
Sbjct  203  YAPRISEELRQRIMSLLYIGVPLDNIIQHH  232



>ref|XP_002281999.2| PREDICTED: uncharacterized protein LOC100245761 isoform X1 [Vitis 
vinifera]
 ref|XP_010648575.1| PREDICTED: uncharacterized protein LOC100245761 isoform X1 [Vitis 
vinifera]
 ref|XP_010648576.1| PREDICTED: uncharacterized protein LOC100245761 isoform X1 [Vitis 
vinifera]
 ref|XP_010648577.1| PREDICTED: uncharacterized protein LOC100245761 isoform X1 [Vitis 
vinifera]
 emb|CBI20949.3| unnamed protein product [Vitis vinifera]
Length=697

 Score =   208 bits (530),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/213 (48%), Positives = 139/213 (65%), Gaps = 4/213 (2%)
 Frame = +3

Query  135  SGMDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSN  311
            S M  +E I +L VQ+PP  +FS+A +NW K  G  +  D++ALIP+ RVD F+ GE +N
Sbjct  6    SKMPRMEDILNLPVQDPPCAEFSAAHINWKKVEGGRQGGDDIALIPFSRVDDFVKGESTN  65

Query  312  VECPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTR  491
             ECP  F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y +    L          
Sbjct  66   AECPASFRIESRRKRPEGSISKPRVDGYLEYTLYWCSYGPEDYRDSESGLGDSSNNKPAS  125

Query  492  NRAARP---QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPG  662
             + +RP     MRGC CHF VKRLY  PSLAL+I+N R+HV+K+G  CHG LDRDA+G  
Sbjct  126  GKGSRPGRRHMMRGCLCHFTVKRLYTRPSLALIIYNQRKHVDKTGAPCHGILDRDAVGTR  185

Query  663  AKKIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
            A   P I  E++Q+ MSM+Y+GI  +N+++ H+
Sbjct  186  AMYAPRISEELRQKVMSMLYVGISLDNIIQHHM  218



>ref|XP_007138737.1| hypothetical protein PHAVU_009G233100g [Phaseolus vulgaris]
 ref|XP_007138738.1| hypothetical protein PHAVU_009G233100g [Phaseolus vulgaris]
 ref|XP_007138739.1| hypothetical protein PHAVU_009G233100g [Phaseolus vulgaris]
 gb|ESW10731.1| hypothetical protein PHAVU_009G233100g [Phaseolus vulgaris]
 gb|ESW10732.1| hypothetical protein PHAVU_009G233100g [Phaseolus vulgaris]
 gb|ESW10733.1| hypothetical protein PHAVU_009G233100g [Phaseolus vulgaris]
Length=810

 Score =   209 bits (531),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            ++I SL VQNPP  + SS DL W+K  G  +  D VALIP+ RVD F+ GE +N ECPTR
Sbjct  5    DAILSLPVQNPPTLEISSLDLVWSKVEGWHDKLDRVALIPFARVDDFVRGESNNKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRSPSTPFKQKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N+ +HV+K GF CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALIIYNDDKHVDKKGFPCHGPQDKKAAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            E++ + +S++Y+G+  E ++++H
Sbjct  185  ELRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_006476176.1| PREDICTED: uncharacterized protein LOC102625159 isoform X1 [Citrus 
sinensis]
Length=697

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 141/217 (65%), Gaps = 12/217 (6%)
 Frame = +3

Query  135  SGMDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSN  311
            S M  +E I +L VQ+PP  +FS+A+L W K  G  +  D++ALIP+ RV+ F+ GE SN
Sbjct  6    SKMPRMEDILNLPVQDPPCVEFSAANLKWVKVEGGRQGGDDIALIPFARVEEFVKGESSN  65

Query  312  VECPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENY-------GEGGGILPSR  470
             ECP  F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y       G+G  + P+ 
Sbjct  66   AECPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDSESGNGDGSNVKPAT  125

Query  471  RYRLNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDA  650
                   +R  R   MRGC CHF VKRLY  P LAL+I+N R+HV+K+G  CHG LDRDA
Sbjct  126  ----GKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRKHVDKTGAPCHGILDRDA  181

Query  651  IGPGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
            +G  A   P I  +++Q+ MSM+Y+GI  +N+++ HI
Sbjct  182  VGTRAMYAPRISEDLRQKVMSMLYVGISLDNIIQHHI  218



>ref|XP_010249825.1| PREDICTED: uncharacterized protein LOC104592258 isoform X2 [Nelumbo 
nucifera]
Length=681

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 138/215 (64%), Gaps = 12/215 (6%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVE  317
            M  +E I SL VQ+PP  +FS+A +NW K  G  +  D++ALIP+ RVD F+ GE +N E
Sbjct  8    MPRMEDILSLPVQDPPCAEFSAAHINWVKVEGGRQGGDDIALIPFSRVDDFVKGESTNAE  67

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENY-------GEGGGILPSRRY  476
            CP  F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y       G+G    P+   
Sbjct  68   CPANFRIESRRKRPEGSVSKPRVDGYLEYTLYWCSYGPEDYRDSESGVGDGSNSKPTS--  125

Query  477  RLNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIG  656
                 +R  R   MRGC CHF VKRLY  P LAL+I+N R HV+K+G  CHG LDRDA+G
Sbjct  126  --GKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRNHVDKTGAPCHGILDRDAVG  183

Query  657  PGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
              A   P I  E++Q+ MSM+Y+GI  +N+++ HI
Sbjct  184  TRAMYAPRISEELRQKVMSMLYVGISLDNIIQHHI  218



>ref|XP_006450581.1| hypothetical protein CICLE_v10010703mg [Citrus clementina]
 gb|ESR63821.1| hypothetical protein CICLE_v10010703mg [Citrus clementina]
Length=697

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 104/217 (48%), Positives = 141/217 (65%), Gaps = 12/217 (6%)
 Frame = +3

Query  135  SGMDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSN  311
            S M  +E I +L VQ+PP  +FS+A+L W K  G  +  D++ALIP+ RV+ F+ GE SN
Sbjct  6    SKMPRMEDILNLPVQDPPCVEFSAANLKWVKVEGGRQGGDDIALIPFARVEEFVKGESSN  65

Query  312  VECPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENY-------GEGGGILPSR  470
             ECP  F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y       G+G  + P+ 
Sbjct  66   AECPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDSESGNGDGSNVKPAT  125

Query  471  RYRLNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDA  650
                   +R  R   MRGC CHF VKRLY  P LAL+I+N R+HV+K+G  CHG LDRDA
Sbjct  126  ----GKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRKHVDKTGAPCHGILDRDA  181

Query  651  IGPGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
            +G  A   P I  +++Q+ MSM+Y+GI  +N+++ HI
Sbjct  182  VGTRAMYAPRISEDLRQKVMSMLYVGISLDNIIQHHI  218



>gb|KHG17736.1| Sacsin [Gossypium arboreum]
Length=504

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 137/215 (64%), Gaps = 12/215 (6%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVE  317
            M  +E I +L VQ+PP  +FS+A + W K  G  +  D++ALIP+ RVD F+ GE SN E
Sbjct  1    MARMEDILNLPVQDPPCAEFSAAHITWVKVEGGRQGGDDIALIPFSRVDDFVKGESSNAE  60

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENY-------GEGGGILPSRRY  476
            CP  F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y       G+G    P+   
Sbjct  61   CPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDCESGLGDGSNFKPT---  117

Query  477  RLNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIG  656
                 +R  R   MRGC CHF VKRLY  P LAL+I+N R HV+K+G  CHG LD+DA+G
Sbjct  118  -TGKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRNHVDKTGSPCHGILDQDAVG  176

Query  657  PGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
              A   P I  E++Q+ MSM+Y+GI  +N+++ H+
Sbjct  177  TRAMYAPRISEELRQKVMSMLYVGISLDNIIQHHM  211



>ref|XP_010053257.1| PREDICTED: uncharacterized protein LOC104441745 [Eucalyptus grandis]
 ref|XP_010053258.1| PREDICTED: uncharacterized protein LOC104441745 [Eucalyptus grandis]
 gb|KCW77515.1| hypothetical protein EUGRSUZ_D01843 [Eucalyptus grandis]
 gb|KCW77516.1| hypothetical protein EUGRSUZ_D01843 [Eucalyptus grandis]
Length=797

 Score =   208 bits (530),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/203 (48%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNPP  +FS+ADL W+K  G  ++ D VALIPY RVD F+ GE SN +CP+R
Sbjct  5    DEILSLPVQNPPSLEFSAADLVWSKVEGWRDNIDRVALIPYARVDDFVRGESSNKDCPSR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  RKR      + + D  LEY +YWCSFGP+++ +GG + PSR   +  +N A RP
Sbjct  65   FHVEARRKRPLEMAYKPKVDGILEYILYWCSFGPDDHRKGGIVRPSRTNYVPKKNNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_010249820.1| PREDICTED: uncharacterized protein LOC104592258 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010249821.1| PREDICTED: uncharacterized protein LOC104592258 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010249822.1| PREDICTED: uncharacterized protein LOC104592258 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010249823.1| PREDICTED: uncharacterized protein LOC104592258 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010249824.1| PREDICTED: uncharacterized protein LOC104592258 isoform X1 [Nelumbo 
nucifera]
Length=694

 Score =   207 bits (527),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 138/215 (64%), Gaps = 12/215 (6%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVE  317
            M  +E I SL VQ+PP  +FS+A +NW K  G  +  D++ALIP+ RVD F+ GE +N E
Sbjct  8    MPRMEDILSLPVQDPPCAEFSAAHINWVKVEGGRQGGDDIALIPFSRVDDFVKGESTNAE  67

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENY-------GEGGGILPSRRY  476
            CP  F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y       G+G    P+   
Sbjct  68   CPANFRIESRRKRPEGSVSKPRVDGYLEYTLYWCSYGPEDYRDSESGVGDGSNSKPTS--  125

Query  477  RLNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIG  656
                 +R  R   MRGC CHF VKRLY  P LAL+I+N R HV+K+G  CHG LDRDA+G
Sbjct  126  --GKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRNHVDKTGAPCHGILDRDAVG  183

Query  657  PGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
              A   P I  E++Q+ MSM+Y+GI  +N+++ HI
Sbjct  184  TRAMYAPRISEELRQKVMSMLYVGISLDNIIQHHI  218



>gb|KDO79654.1| hypothetical protein CISIN_1g039513mg [Citrus sinensis]
Length=690

 Score =   206 bits (525),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 103/215 (48%), Positives = 140/215 (65%), Gaps = 12/215 (6%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVE  317
            M  +E I +L VQ+PP  +FS+A+L W K  G  +  D++ALIP+ RV+ F+ GE SN E
Sbjct  1    MPRMEDILNLPVQDPPCVEFSAANLKWVKVEGGRQGGDDIALIPFARVEEFVKGESSNAE  60

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENY-------GEGGGILPSRRY  476
            CP  F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y       G+G  + P+   
Sbjct  61   CPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDSESGNGDGSNVKPAT--  118

Query  477  RLNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIG  656
                 +R  R   MRGC CHF VKRLY  P LAL+I+N R+HV+K+G  CHG LDRDA+G
Sbjct  119  --GKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRKHVDKTGAPCHGILDRDAVG  176

Query  657  PGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
              A   P I  +++Q+ MSM+Y+GI  +N+++ HI
Sbjct  177  TRAMYAPRISEDLRQKVMSMLYVGISLDNIIQHHI  211



>gb|KJB64570.1| hypothetical protein B456_010G054400 [Gossypium raimondii]
 gb|KJB64571.1| hypothetical protein B456_010G054400 [Gossypium raimondii]
Length=697

 Score =   206 bits (524),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 103/217 (47%), Positives = 139/217 (64%), Gaps = 12/217 (6%)
 Frame = +3

Query  135  SGMDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSN  311
            S M  +E I +L VQ+PP  +FS+A + W K  G  +  D++ALIP+ RVD F+ GE SN
Sbjct  6    SKMARMEDILNLPVQDPPCAEFSAAHITWVKVEGGRQGGDDIALIPFSRVDDFVKGESSN  65

Query  312  VECPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENY-------GEGGGILPSR  470
             ECP  F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y       G+G    P+ 
Sbjct  66   AECPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDCESGLGDGSNFKPAT  125

Query  471  RYRLNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDA  650
                   +R  R   MRGC CHF VKRLY  P LAL+I+N R+HV+K+G  CHG LD+DA
Sbjct  126  ----GKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRKHVDKTGSPCHGILDQDA  181

Query  651  IGPGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
            +G  A   P I  E++Q+ MSM+Y+GI  +N+++ H+
Sbjct  182  VGTRAMYAPRISEELRQKVMSMLYVGISLDNIIQHHM  218



>ref|XP_002461610.1| hypothetical protein SORBIDRAFT_02g005340 [Sorghum bicolor]
 gb|EER98131.1| hypothetical protein SORBIDRAFT_02g005340 [Sorghum bicolor]
Length=831

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 138/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I +L VQNPP  +FS+AD++W+   G  +  D +ALIPY RV+ F+ GE +N +CPTR
Sbjct  5    DEILTLPVQNPPSLEFSAADISWSMVEGWKDSMDRLALIPYSRVNDFVRGESNNKDCPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R      + + D  LEY +YWCSFGP++Y +GG + PSR      +  A RP
Sbjct  65   FHVEARRRRPPTMNCKPKVDGILEYILYWCSFGPDDYRKGGNVRPSRPISEKRKTPAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGC CHF+VKRL   PS+AL+I+N+ +HV+K G  CHG +D+ A+G  A   PYI +
Sbjct  125  NTKRGCVCHFIVKRLIVEPSVALVIYNHNKHVDKKGMPCHGSMDKMAVGTKAMFAPYISD  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            E++ Q MS++Y+GIP E ++++H
Sbjct  185  ELRLQVMSLLYVGIPVETIMQRH  207



>ref|XP_007146127.1| hypothetical protein PHAVU_006G014600g [Phaseolus vulgaris]
 ref|XP_007146128.1| hypothetical protein PHAVU_006G014600g [Phaseolus vulgaris]
 ref|XP_007146129.1| hypothetical protein PHAVU_006G014600g [Phaseolus vulgaris]
 gb|ESW18121.1| hypothetical protein PHAVU_006G014600g [Phaseolus vulgaris]
 gb|ESW18122.1| hypothetical protein PHAVU_006G014600g [Phaseolus vulgaris]
 gb|ESW18123.1| hypothetical protein PHAVU_006G014600g [Phaseolus vulgaris]
Length=861

 Score =   207 bits (526),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/203 (48%), Positives = 138/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            ++I SL VQNPP  + SS DL W+K  G  +  D VALIP+ RVD F+ GE +N ECPTR
Sbjct  5    DAILSLPVQNPPTLEISSLDLVWSKVEGWHDKLDRVALIPFARVDDFVRGESNNKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRSPSTPFKQKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N+ +HV+K GF CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALIIYNDDKHVDKKGFPCHGPQDKKAAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            E+  + +S++Y+G+  E ++++H
Sbjct  185  ELCLRVLSLLYVGVSVETIMQRH  207



>ref|XP_002528170.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34221.1| conserved hypothetical protein [Ricinus communis]
Length=681

 Score =   206 bits (523),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/204 (48%), Positives = 141/204 (69%), Gaps = 3/204 (1%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNPP  +FS+ DL W+K  G  ++ D +ALIP+DRV  F+ GE +N +CPTR
Sbjct  5    DEILSLPVQNPPTLEFSANDLVWSKIEGWRDNIDRLALIPFDRVADFVRGESANKDCPTR  64

Query  330  FHIERGRKR-VEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAAR  506
            FH+E  R+R  E S K+ + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A R
Sbjct  65   FHVEARRRRPTEASYKQ-KVDGILEYILYWCSFGPDDHRKGGIVRPSRTTNVPKKKNAGR  123

Query  507  PQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYIC  686
            P + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP D+ A G  A   PYI 
Sbjct  124  PNTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAEGTRAMYAPYIS  183

Query  687  NEIQQQTMSMIYLGIPEENVLEKH  758
            +E++ + +S++Y+G+  E ++++H
Sbjct  184  DELRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_010540374.1| PREDICTED: uncharacterized protein LOC104814172 [Tarenaya hassleriana]
 ref|XP_010540375.1| PREDICTED: uncharacterized protein LOC104814172 [Tarenaya hassleriana]
Length=825

 Score =   206 bits (525),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 102/206 (50%), Positives = 139/206 (67%), Gaps = 7/206 (3%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNP   +FSSADL W+K  G  ++ D VALIPY RVD F+ GE SN +CPT 
Sbjct  5    DQIFSLPVQNPTSLEFSSADLVWSKVEGYRDNIDRVALIPYTRVDDFVRGESSNKDCPTS  64

Query  330  FHIE-RGRKRVEGSLKEYRP--DEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRA  500
            FH+E R RK VE   K Y+P  D  LEY +YWCSFGP++  +GG + PSR   +  +N A
Sbjct  65   FHVEARRRKSVE---KNYKPKVDGILEYILYWCSFGPDDNRKGGAVRPSRSTYVRKKNNA  121

Query  501  ARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPY  680
             RP S RGC CHF+VKRL A P++AL+I+NN +H ++ G  CHGP DR A G  A   PY
Sbjct  122  GRPNSKRGCRCHFIVKRLIAEPTVALIIYNNDKHADEKGLPCHGPQDRQAAGTRAMFAPY  181

Query  681  ICNEIQQQTMSMIYLGIPEENVLEKH  758
            I  +++ + +S++Y+G+  E ++++H
Sbjct  182  ISEDLRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_004513230.1| PREDICTED: uncharacterized protein LOC101502422 [Cicer arietinum]
Length=803

 Score =   205 bits (522),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            ++I SL VQNPP  + SSA++ W+K  G  +  D VALIP+ RVD F+ GE +N ECPTR
Sbjct  5    DAILSLPVQNPPTLEISSAEIVWSKVEGWHDKLDRVALIPFPRVDDFVRGESNNKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRAPSTSFKQKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N+ +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALIIYNDDKHVDKKGLPCHGPQDKKAAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>gb|KHG17737.1| Arrestin-C [Gossypium arboreum]
Length=690

 Score =   204 bits (519),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 102/215 (47%), Positives = 137/215 (64%), Gaps = 12/215 (6%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVE  317
            M  +E I +L VQ+PP  +FS+A + W K  G  +  D++ALIP+ RVD F+ GE SN E
Sbjct  1    MARMEDILNLPVQDPPCAEFSAAHITWVKVEGGRQGGDDIALIPFSRVDDFVKGESSNAE  60

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENY-------GEGGGILPSRRY  476
            CP  F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y       G+G    P+   
Sbjct  61   CPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDCESGLGDGSNFKPTT--  118

Query  477  RLNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIG  656
                 +R  R   MRGC CHF VKRLY  P LAL+I+N R HV+K+G  CHG LD+DA+G
Sbjct  119  --GKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRNHVDKTGSPCHGILDQDAVG  176

Query  657  PGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
              A   P I  E++Q+ MSM+Y+GI  +N+++ H+
Sbjct  177  TRAMYAPRISEELRQKVMSMLYVGISLDNIIQHHM  211



>ref|XP_008232361.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103331512 
[Prunus mume]
Length=1089

 Score =   207 bits (526),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 140/203 (69%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQ+PP  +FSSAD+ W+K  G  +++D VALIP+ RVD F+ GE +N ECPTR
Sbjct  5    DEILSLPVQSPPTLEFSSADIVWSKVEGWRDNKDRVALIPFARVDDFLRGESANKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR   L  +  A RP
Sbjct  65   FHVEARRRRQAKTPYKPKVDGVLEYILYWCSFGPDDHRKGGVVRPSRTTYLPKKKNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALVIYNQDKHVDKKGVPCHGPQDKMAAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_007013717.1| SWIM zinc finger family protein isoform 1 [Theobroma cacao]
 gb|EOY31336.1| SWIM zinc finger family protein isoform 1 [Theobroma cacao]
Length=701

 Score =   204 bits (518),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 102/216 (47%), Positives = 141/216 (65%), Gaps = 5/216 (2%)
 Frame = +3

Query  129  SFSG-MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQ-DEVALIPYDRVDAFIIGE  302
            +FSG +  +E I +L VQ+PP  +FS+A + W K     H  D++ALIP+ RVD F+ GE
Sbjct  7    TFSGKIPRMEDILNLPVQDPPCSEFSAAHIKWVKVEGGRHGGDDIALIPFARVDDFVKGE  66

Query  303  CSNVECPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGE---GGGILPSRR  473
             SN ECP  F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y +   G G + + +
Sbjct  67   SSNAECPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDSESGLGDVSNMK  126

Query  474  YRLNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAI  653
                  +R  R   MRGC CHF VKRLY  P LAL+I+N R+HV+K+G  CHG LD+DA+
Sbjct  127  PATGKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRKHVDKTGAPCHGILDQDAV  186

Query  654  GPGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
            G  A   P I  E++Q+ +SM+Y+GI  +N+ + H+
Sbjct  187  GTRAMYAPRISEELRQKVISMLYVGISLDNIFQHHM  222



>ref|XP_009605496.1| PREDICTED: uncharacterized protein LOC104100042 [Nicotiana tomentosiformis]
Length=895

 Score =   205 bits (521),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNPP  +FSSA+L W+K  G  ++ D VALIP+ RVD F+ GE +N ECPTR
Sbjct  5    DQILSLPVQNPPTLEFSSAELVWSKVEGWRDNIDRVALIPFARVDDFVRGESANRECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R      + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRPAEITYKPKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKPAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV+K+G  CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKNGLPCHGPQDKKAAGTRAMYAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>dbj|BAC84431.1| hypothetical protein [Oryza sativa Japonica Group]
Length=814

 Score =   204 bits (520),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 138/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I +L VQNPP  +FS++D+ W++  G  +  D +ALIP+ RV+ F+ GE +N ECPTR
Sbjct  5    DEILTLPVQNPPTPEFSASDIMWSRVEGWKDSMDRLALIPFSRVNDFVRGESNNKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R      + + D  LEY +YWCSFGP++Y +GG + PSR      +  A RP
Sbjct  65   FHVEARRRRPPTMNCKPKVDGILEYILYWCSFGPDDYRKGGSVRPSRNSSTKRKTPAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGC CHF+VKRL A PS+AL+I+N+ +HV+K G  CHGP+D  AIG  A   PYI +
Sbjct  125  HTKRGCICHFIVKRLIAEPSVALVIYNHDKHVDKIGKPCHGPMDNMAIGTKAMFAPYISD  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            E++ Q MS++ +GIP E ++++H
Sbjct  185  ELRLQIMSLLCVGIPVETIMQRH  207



>ref|XP_009790578.1| PREDICTED: uncharacterized protein LOC104238021 [Nicotiana sylvestris]
 ref|XP_009790580.1| PREDICTED: uncharacterized protein LOC104238021 [Nicotiana sylvestris]
Length=898

 Score =   205 bits (521),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNPP  +FSSA+L W+K  G  ++ D VALIP+ RVD F+ GE +N ECPTR
Sbjct  5    DQILSLPVQNPPTLEFSSAELVWSKVEGWRDNIDRVALIPFARVDDFVRGESANKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R      + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRPAEITYKPKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKPAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +H++K+G  CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHIDKNGLPCHGPQDKKAAGTRAMYAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_012065273.1| PREDICTED: uncharacterized protein LOC105628473 [Jatropha curcas]
Length=702

 Score =   204 bits (518),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 102/222 (46%), Positives = 140/222 (63%), Gaps = 12/222 (5%)
 Frame = +3

Query  117  LSGRSFSGMDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFI  293
            + G   + M  +E I +L VQ+PP  +FS++ + W K  G  +  D++AL+P+ RVD F+
Sbjct  1    MKGGHETKMPRMEDILNLPVQDPPCAEFSASHIKWVKIEGGRQGGDDIALVPFSRVDDFV  60

Query  294  IGECSNVECPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENY-------GEGG  452
             GE SNVECP  F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y       G+G 
Sbjct  61   KGESSNVECPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDNESGIGDGS  120

Query  453  GILPSRRYRLNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHG  632
               P+        +R  R   MRGC CHF VKRLY  P LAL+I+N R+HV+K+G  CHG
Sbjct  121  NAKPAT----GKGSRPGRRHMMRGCLCHFTVKRLYTRPFLALIIYNQRKHVDKTGAPCHG  176

Query  633  PLDRDAIGPGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
             LD DA+G  A   P I  E++Q+ MSM+Y+GI  +N+++ H
Sbjct  177  MLDLDAVGTRAMYAPRISEELRQKVMSMLYVGISLDNIIQHH  218



>ref|NP_001059218.1| Os07g0227700 [Oryza sativa Japonica Group]
 dbj|BAF21132.1| Os07g0227700 [Oryza sativa Japonica Group]
 gb|EEE66828.1| hypothetical protein OsJ_23599 [Oryza sativa Japonica Group]
Length=835

 Score =   204 bits (520),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 138/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I +L VQNPP  +FS++D+ W++  G  +  D +ALIP+ RV+ F+ GE +N ECPTR
Sbjct  5    DEILTLPVQNPPTPEFSASDIMWSRVEGWKDSMDRLALIPFSRVNDFVRGESNNKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R      + + D  LEY +YWCSFGP++Y +GG + PSR      +  A RP
Sbjct  65   FHVEARRRRPPTMNCKPKVDGILEYILYWCSFGPDDYRKGGSVRPSRNSSTKRKTPAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGC CHF+VKRL A PS+AL+I+N+ +HV+K G  CHGP+D  AIG  A   PYI +
Sbjct  125  HTKRGCICHFIVKRLIAEPSVALVIYNHDKHVDKIGKPCHGPMDNMAIGTKAMFAPYISD  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            E++ Q MS++ +GIP E ++++H
Sbjct  185  ELRLQIMSLLCVGIPVETIMQRH  207



>ref|XP_008670947.1| PREDICTED: uncharacterized protein LOC103648233 [Zea mays]
Length=828

 Score =   204 bits (519),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 138/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I +L VQNPP  +FS+AD++W+   G  +  D +ALIPY RV+ F+ GE +N +CP+R
Sbjct  5    DEILTLPVQNPPSLEFSAADISWSMVEGWRDSMDRLALIPYSRVNDFVRGESNNKDCPSR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R      + + D  LEY +YWCSFGP++Y +GG + PSR      +  A RP
Sbjct  65   FHVEARRRRPPTMNCKPKVDGILEYILYWCSFGPDDYRKGGNVRPSRPIAEKRKTPAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGC CHF+VKRL   PS+AL+I+N+ +HV+K G  CHG +D+ A+G  A   PYI +
Sbjct  125  NTKRGCVCHFIVKRLIVEPSVALVIYNHNKHVDKKGMPCHGSMDKMAVGTKAMFAPYISD  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            E++ Q MS++Y+GIP E ++++H
Sbjct  185  ELRLQVMSLLYVGIPVETIMQRH  207



>ref|XP_010269623.1| PREDICTED: uncharacterized protein LOC104606193 [Nelumbo nucifera]
Length=1107

 Score =   206 bits (524),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 140/203 (69%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQ+PP  +FSSAD+ W+K  G  ++ D VALIP+ RVD F+ GE SN ECPTR
Sbjct  5    DEILSLPVQSPPTLEFSSADIVWSKVEGWRDNIDRVALIPFARVDDFVRGESSNKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R      + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRPPEMPYKPKVDGILEYILYWCSFGPDDHRKGGIVRPSRSTYIPKKKSAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP D+ A+G  A   PYI +
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAVGTRAMFAPYISD  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_007013718.1| SWIM zinc finger family protein isoform 2 [Theobroma cacao]
 ref|XP_007013720.1| SWIM zinc finger family protein isoform 2 [Theobroma cacao]
 gb|EOY31337.1| SWIM zinc finger family protein isoform 2 [Theobroma cacao]
 gb|EOY31339.1| SWIM zinc finger family protein isoform 2 [Theobroma cacao]
Length=697

 Score =   203 bits (517),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 136/208 (65%), Gaps = 4/208 (2%)
 Frame = +3

Query  150  VESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQ-DEVALIPYDRVDAFIIGECSNVECPT  326
            +E I +L VQ+PP  +FS+A + W K     H  D++ALIP+ RVD F+ GE SN ECP 
Sbjct  11   MEDILNLPVQDPPCSEFSAAHIKWVKVEGGRHGGDDIALIPFARVDDFVKGESSNAECPA  70

Query  327  RFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGE---GGGILPSRRYRLNTRNR  497
             F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y +   G G + + +      +R
Sbjct  71   SFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDSESGLGDVSNMKPATGKGSR  130

Query  498  AARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIP  677
              R   MRGC CHF VKRLY  P LAL+I+N R+HV+K+G  CHG LD+DA+G  A   P
Sbjct  131  PGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRKHVDKTGAPCHGILDQDAVGTRAMYAP  190

Query  678  YICNEIQQQTMSMIYLGIPEENVLEKHI  761
             I  E++Q+ +SM+Y+GI  +N+ + H+
Sbjct  191  RISEELRQKVISMLYVGISLDNIFQHHM  218



>ref|XP_003528591.1| PREDICTED: uncharacterized protein LOC100819719 isoform X1 [Glycine 
max]
 ref|XP_006583971.1| PREDICTED: uncharacterized protein LOC100819719 isoform X2 [Glycine 
max]
 gb|KHN28159.1| hypothetical protein glysoja_023977 [Glycine soja]
Length=893

 Score =   204 bits (519),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 138/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            ++I SL VQNPP  + SSA+L W+K  G  +  D VALIPY RVD F+ GE +N ECPTR
Sbjct  5    DAILSLPVQNPPTLEISSAELVWSKVEGWHDKLDRVALIPYARVDDFVRGESNNKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRSPSTPFKQKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGC CHF+VKRL A PS+AL+I+N+ +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCICHFIVKRLIAEPSVALIIYNDDKHVDKKGLPCHGPQDKKAAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_007052246.1| Zinc ion binding protein isoform 1 [Theobroma cacao]
 gb|EOX96403.1| Zinc ion binding protein isoform 1 [Theobroma cacao]
Length=1030

 Score =   205 bits (522),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNPP  +FS+ADL W+K  G  ++ D VALIP+ RVD F+ GE +N +CPTR
Sbjct  5    DQILSLPVQNPPTLEFSAADLVWSKVEGWRDNIDRVALIPFARVDDFVRGESANKDCPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRPPKAPYKPKVDGILEYILYWCSFGPDDHRKGGIVRPSRNTYIPKKTNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A P++AL+I+N  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPTVALIIYNQEKHVDKKGLPCHGPQDKKAAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>gb|EPS74375.1| hypothetical protein M569_00380, partial [Genlisea aurea]
Length=374

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/205 (47%), Positives = 137/205 (67%), Gaps = 4/205 (2%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNP   +FSS DL W+K  G  +  D +ALIP+ RVD F+ GE +++ECPTR
Sbjct  6    DEIFSLPVQNPSTMEFSSVDLVWSKIEGWRDKIDRLALIPFSRVDDFVRGESNSMECPTR  65

Query  330  FHIERGRKRVEGSLKEYRP--DEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAA  503
            FH+E  RKR   +   ++P  D  LEY +YWCSFGP+++ +GG I PSR   +     + 
Sbjct  66   FHVEARRKRT-ATHTSFKPKIDGVLEYILYWCSFGPDDHRKGGLIRPSRNTYVPKNKPSG  124

Query  504  RPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYI  683
            RP + RGCTCHF+VKRL A PS+AL+I+N  +H++K G  CHGP DR A G  A   PYI
Sbjct  125  RPNTKRGCTCHFIVKRLNAEPSVALVIYNQDKHIDKKGLPCHGPHDRKAAGTRAMYAPYI  184

Query  684  CNEIQQQTMSMIYLGIPEENVLEKH  758
              E++ + +S+++ G+  E++++KH
Sbjct  185  SEELRLRIVSLLHSGVSVESIMQKH  209



>ref|XP_011019705.1| PREDICTED: uncharacterized protein LOC105122342 isoform X2 [Populus 
euphratica]
Length=690

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 135/210 (64%), Gaps = 4/210 (2%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVE  317
            M  +E I SL VQ+PP  +FS+A + W K  G  +  D++ALIP+ RVD F+ GE SN E
Sbjct  1    MPRMEDILSLPVQDPPCAEFSAAHIKWVKVEGGRQGGDDIALIPFARVDDFVKGESSNAE  60

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNR  497
            CP  F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y +    +    +      +
Sbjct  61   CPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDSESTMGDGSHTKPATGK  120

Query  498  AARP---QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAK  668
             +RP     MRGC CHF VKRLY  P LAL+I+N R+HV+K+G  CHG LD DA+G  A 
Sbjct  121  GSRPGRRHMMRGCLCHFTVKRLYTRPFLALIIYNQRKHVDKTGAPCHGILDVDAVGTRAM  180

Query  669  KIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
              P I  E++Q+ MS++Y+GI  +N+++ H
Sbjct  181  YAPRISEELRQKVMSLLYIGISLDNIIQHH  210



>gb|KDP43797.1| hypothetical protein JCGZ_23005 [Jatropha curcas]
Length=694

 Score =   203 bits (516),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 101/214 (47%), Positives = 137/214 (64%), Gaps = 12/214 (6%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVE  317
            M  +E I +L VQ+PP  +FS++ + W K  G  +  D++AL+P+ RVD F+ GE SNVE
Sbjct  1    MPRMEDILNLPVQDPPCAEFSASHIKWVKIEGGRQGGDDIALVPFSRVDDFVKGESSNVE  60

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENY-------GEGGGILPSRRY  476
            CP  F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y       G+G    P+   
Sbjct  61   CPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDNESGIGDGSNAKPAT--  118

Query  477  RLNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIG  656
                 +R  R   MRGC CHF VKRLY  P LAL+I+N R+HV+K+G  CHG LD DA+G
Sbjct  119  --GKGSRPGRRHMMRGCLCHFTVKRLYTRPFLALIIYNQRKHVDKTGAPCHGMLDLDAVG  176

Query  657  PGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
              A   P I  E++Q+ MSM+Y+GI  +N+++ H
Sbjct  177  TRAMYAPRISEELRQKVMSMLYVGISLDNIIQHH  210



>ref|XP_012083677.1| PREDICTED: uncharacterized protein LOC105643205 [Jatropha curcas]
 gb|KDP28838.1| hypothetical protein JCGZ_14609 [Jatropha curcas]
Length=979

 Score =   205 bits (521),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 137/203 (67%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNPP  +FS+ DL W+K  G  +  D +ALIP+ RVD F+ GE +N ECPTR
Sbjct  5    DEILSLPVQNPPTLEFSATDLVWSKIEGWRDKIDRLALIPFARVDDFVRGESANKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRPSETSYKQKVDGILEYILYWCSFGPDDHRKGGIVRPSRSVYVPKKKNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAEGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_011019704.1| PREDICTED: uncharacterized protein LOC105122342 isoform X1 [Populus 
euphratica]
Length=697

 Score =   202 bits (515),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 135/210 (64%), Gaps = 4/210 (2%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVE  317
            M  +E I SL VQ+PP  +FS+A + W K  G  +  D++ALIP+ RVD F+ GE SN E
Sbjct  8    MPRMEDILSLPVQDPPCAEFSAAHIKWVKVEGGRQGGDDIALIPFARVDDFVKGESSNAE  67

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNR  497
            CP  F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y +    +    +      +
Sbjct  68   CPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDSESTMGDGSHTKPATGK  127

Query  498  AARP---QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAK  668
             +RP     MRGC CHF VKRLY  P LAL+I+N R+HV+K+G  CHG LD DA+G  A 
Sbjct  128  GSRPGRRHMMRGCLCHFTVKRLYTRPFLALIIYNQRKHVDKTGAPCHGILDVDAVGTRAM  187

Query  669  KIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
              P I  E++Q+ MS++Y+GI  +N+++ H
Sbjct  188  YAPRISEELRQKVMSLLYIGISLDNIIQHH  217



>ref|XP_002309581.2| hypothetical protein POPTR_0006s26200g [Populus trichocarpa]
 gb|EEE93104.2| hypothetical protein POPTR_0006s26200g [Populus trichocarpa]
Length=667

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 135/210 (64%), Gaps = 4/210 (2%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVE  317
            M  +E I SL VQ+PP  +FS+A + W K  G  +  D++ALIP+ RVD F+ GE SN E
Sbjct  8    MPRMEDILSLPVQDPPCAEFSAAHIKWEKVEGGRQGGDDIALIPFARVDDFVKGESSNAE  67

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNR  497
            CP  F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y +    +    +      +
Sbjct  68   CPASFRIESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDSESTMGDGSHTKPATGK  127

Query  498  AARP---QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAK  668
             +RP     MRGC CHF VKRLY  P LAL+I+N R+HV+K+G  CHG LD DA+G  A 
Sbjct  128  GSRPGRRHMMRGCLCHFTVKRLYTRPFLALIIYNQRKHVDKTGAPCHGILDVDAVGTRAM  187

Query  669  KIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
              P I  E++Q+ MS++Y+GI  +N+++ H
Sbjct  188  YAPRISEELRQKVMSLLYIGISLDNIIQHH  217



>ref|XP_006445380.1| hypothetical protein CICLE_v10018658mg [Citrus clementina]
 ref|XP_006464455.1| PREDICTED: uncharacterized protein LOC102610616 isoform X1 [Citrus 
sinensis]
 ref|XP_006464456.1| PREDICTED: uncharacterized protein LOC102610616 isoform X2 [Citrus 
sinensis]
 gb|ESR58620.1| hypothetical protein CICLE_v10018658mg [Citrus clementina]
 gb|KDO85575.1| hypothetical protein CISIN_1g001712mg [Citrus sinensis]
 gb|KDO85576.1| hypothetical protein CISIN_1g001712mg [Citrus sinensis]
 gb|KDO85577.1| hypothetical protein CISIN_1g001712mg [Citrus sinensis]
Length=1021

 Score =   205 bits (521),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNPP  +F+S DL W+K  G  +  D VALIP+ RVD F+ GE SN +CPTR
Sbjct  5    DEILSLPVQNPPTLEFASVDLVWSKVEGWRDKLDRVALIPFARVDDFVRGESSNKDCPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRSTSTSCKPKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N+ +HV+K+G  CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALIIYNDEKHVDKNGLPCHGPQDKKAAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++++G+  E ++++H
Sbjct  185  DLRLRVLSLLHVGVSVETIMQRH  207



>ref|XP_004245794.1| PREDICTED: uncharacterized protein LOC101264658 [Solanum lycopersicum]
 ref|XP_010325505.1| PREDICTED: uncharacterized protein LOC101264658 [Solanum lycopersicum]
 ref|XP_010325506.1| PREDICTED: uncharacterized protein LOC101264658 [Solanum lycopersicum]
Length=788

 Score =   203 bits (517),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQ+PP  +FSSA+L W+K  G  ++ D VALIP+ RVD F+ GE +N ECPTR
Sbjct  5    DQILSLPVQSPPTLEFSSAELVWSKVEGWRDNIDRVALIPFARVDDFVRGESANKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   S  + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  + RP
Sbjct  65   FHVEARRRRPAESTYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKPSGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP D+ + G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKSAGTRAMYAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_007203395.1| hypothetical protein PRUPE_ppa021037mg [Prunus persica]
 gb|EMJ04594.1| hypothetical protein PRUPE_ppa021037mg [Prunus persica]
Length=1053

 Score =   205 bits (521),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQ+PP  +FSS D+ W+K  G  +++D VALIP+ RVD F+ GE +N ECPTR
Sbjct  5    DEILSLPVQSPPTLEFSSGDIVWSKVEGWRDNKDRVALIPFARVDDFLRGESANKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR   L  +  A RP
Sbjct  65   FHVEARRRRQAKTPYKPKVDGVLEYILYWCSFGPDDHRKGGVVRPSRTTYLPKKKNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALVIYNQDKHVDKKGVPCHGPQDKMAAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_010095498.1| hypothetical protein L484_014926 [Morus notabilis]
 gb|EXB60472.1| hypothetical protein L484_014926 [Morus notabilis]
Length=690

 Score =   202 bits (514),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/211 (48%), Positives = 136/211 (64%), Gaps = 12/211 (6%)
 Frame = +3

Query  150  VESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPT  326
            +E I +L VQ+PP  +FS+  L W K  G  +  D+VALIP+ RVD F+ GE SN ECP 
Sbjct  1    MEDILNLPVQDPPCAEFSADHLKWVKVEGGRQGGDDVALIPFARVDDFVKGESSNAECPA  60

Query  327  RFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGE-------GGGILPSRRYRLN  485
             F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y E       G  I P+      
Sbjct  61   SFRIESRRKRPEGSISKPRVDGYLEYTLYWCSYGPEDYRESHSGLEDGSNIKPAS----G  116

Query  486  TRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGA  665
              +R  R   MRGC CHF VKRLY  P LAL+I+N R+HV+KSG  CHG LDRD++G  A
Sbjct  117  KGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRKHVDKSGAPCHGILDRDSLGTRA  176

Query  666  KKIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
               P I  +++Q+ MSM+Y+G+P +++++ H
Sbjct  177  MYAPRISEDLRQKVMSMLYIGVPLDSIIQHH  207



>ref|XP_006359246.1| PREDICTED: uncharacterized protein LOC102601875 isoform X1 [Solanum 
tuberosum]
 ref|XP_006359247.1| PREDICTED: uncharacterized protein LOC102601875 isoform X2 [Solanum 
tuberosum]
Length=788

 Score =   202 bits (515),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQ+PP  +FSSA+L W+K  G  ++ D VALIP+ RVD F+ GE +N ECPTR
Sbjct  5    DQILSLPVQSPPSLEFSSAELVWSKVEGWRDNIDRVALIPFARVDDFVRGESANKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   S  + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  + RP
Sbjct  65   FHVEARRRRPAESTYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKPSGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +H++K G  CHGP D+ + G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHMDKKGLPCHGPQDKKSAGTRAMYAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_004135549.1| PREDICTED: uncharacterized protein LOC101211068 [Cucumis sativus]
 gb|KGN65922.1| hypothetical protein Csa_1G538200 [Cucumis sativus]
Length=855

 Score =   202 bits (515),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 137/203 (67%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNPP  +FSSADL W+K  G  ++ D VA+IP+ RV  F+ GE SN ECPTR
Sbjct  5    DEIFSLPVQNPPTLEFSSADLVWSKVEGWRDNMDRVAVIPFARVGDFVRGESSNKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG   PSR   +  +  A RP
Sbjct  65   FHVEARRRRALKAPFKAKVDGVLEYILYWCSFGPDDHRKGGVRRPSRSTYVPKKKNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSIALIIYNEDKHVDKKGLPCHGPQDKKAEGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRILSLLYVGVSVETIMQRH  207



>ref|XP_010108922.1| hypothetical protein L484_027117 [Morus notabilis]
 gb|EXC20562.1| hypothetical protein L484_027117 [Morus notabilis]
Length=375

 Score =   195 bits (496),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 138/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNPP  +FS+ D+ W+K  G  ++ D VALIP+ RVD FI GE SN +CPT+
Sbjct  5    DEILSLPVQNPPILEFSAGDIVWSKVEGWRDNIDRVALIPFARVDDFIRGESSNKDCPTK  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRRPTTPYKPKVDGVLEYILYWCSFGPDDHRKGGIVRPSRTTYVAKKKNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP D+ A G  A   P I +
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALIIYNEDKHVDKKGLPCHGPQDKKAAGTRAVFAPDISD  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_008445258.1| PREDICTED: uncharacterized protein LOC103488340 isoform X1 [Cucumis 
melo]
 ref|XP_008445266.1| PREDICTED: uncharacterized protein LOC103488340 isoform X1 [Cucumis 
melo]
 ref|XP_008445273.1| PREDICTED: uncharacterized protein LOC103488340 isoform X1 [Cucumis 
melo]
 ref|XP_008445282.1| PREDICTED: uncharacterized protein LOC103488340 isoform X1 [Cucumis 
melo]
 ref|XP_008445289.1| PREDICTED: uncharacterized protein LOC103488340 isoform X1 [Cucumis 
melo]
Length=874

 Score =   202 bits (514),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 140/214 (65%), Gaps = 1/214 (0%)
 Frame = +3

Query  120  SGRSFSGMDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFII  296
            S    + M   + I SL VQNPP  +FSSADL W+K  G  ++ D VA+IP+ RV  F+ 
Sbjct  13   SAEEKTKMARWDEIFSLPVQNPPTLEFSSADLVWSKVEGWRDNMDRVAVIPFARVGDFVR  72

Query  297  GECSNVECPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRY  476
            GE SN ECPTRFH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG   PSR  
Sbjct  73   GESSNKECPTRFHVEARRRRALKAPFKAKVDGVLEYILYWCSFGPDDHRKGGVRRPSRST  132

Query  477  RLNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIG  656
             +  +  A RP + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP D+ A G
Sbjct  133  YVPKKKNAGRPNTKRGCTCHFIVKRLIAEPSIALIIYNEDKHVDKKGLPCHGPQDKKAEG  192

Query  657  PGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
              A   PYI  +++ + +S++Y+G+  E ++++H
Sbjct  193  TRAMFAPYISEDLRLRILSLLYVGVSVETIMQRH  226



>gb|EMS58193.1| hypothetical protein TRIUR3_12822 [Triticum urartu]
Length=869

 Score =   202 bits (514),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 135/203 (67%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I +L VQNP   +FS+AD+ W+   G  +  D +ALIP+ RV  F+ GE +N  CPTR
Sbjct  11   DEILTLPVQNPTILEFSAADITWSMVEGWKDSMDRLALIPFSRVGDFVRGESNNKACPTR  70

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R      + + D  LEY +YWCSFGP++Y +GG + PSR      +  A RP
Sbjct  71   FHVEARRRRSPTMTCKPKVDGILEYILYWCSFGPDDYRKGGAVRPSRSSCGKRKTPAGRP  130

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGC CHF+VKRL A PSLAL+I+N+ +HV+K G  CHGP+D+ A+G  A   PYI +
Sbjct  131  NTKRGCVCHFIVKRLIAEPSLALVIYNHNKHVDKKGTPCHGPMDKMAVGTKAMFAPYISD  190

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            E+  + MS++Y+GIP E ++++H
Sbjct  191  ELLLEVMSLLYVGIPVETIMQRH  213



>ref|XP_004292961.2| PREDICTED: uncharacterized protein LOC101313282 [Fragaria vesca 
subsp. vesca]
Length=697

 Score =   201 bits (511),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 134/211 (64%), Gaps = 5/211 (2%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQ-DEVALIPYDRVDAFIIGECSNVE  317
            M  +E I +L VQ+PP  +FS+A + W K     H  D++ALIPY RVD F+ GE  N +
Sbjct  8    MARMEDILNLPVQDPPCAEFSAAHIKWVKVDGGRHGGDDIALIPYARVDDFVKGESLNAD  67

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEG-GGILPSRRYRLNTRN  494
            CP  F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y E   G++           
Sbjct  68   CPASFRIESKRKRAEGSVSKPRVDGYLEYTLYWCSYGPEDYRESESGMVDGSSMTKPAAG  127

Query  495  RAARP---QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGA  665
            + +RP     MRGC CHF VKRLY  P +AL+I+N R HV+KSG  CHG LDRD++G  A
Sbjct  128  KGSRPGRRHMMRGCLCHFTVKRLYTRPLIALIIYNQRTHVDKSGAPCHGILDRDSMGTRA  187

Query  666  KKIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
               P I  E +Q+ MSM+Y+GIP +++++ H
Sbjct  188  MYAPRISEEQRQKVMSMLYVGIPLDSIIQHH  218



>ref|XP_008445298.1| PREDICTED: uncharacterized protein LOC103488340 isoform X2 [Cucumis 
melo]
Length=855

 Score =   202 bits (514),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 137/203 (67%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNPP  +FSSADL W+K  G  ++ D VA+IP+ RV  F+ GE SN ECPTR
Sbjct  5    DEIFSLPVQNPPTLEFSSADLVWSKVEGWRDNMDRVAVIPFARVGDFVRGESSNKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG   PSR   +  +  A RP
Sbjct  65   FHVEARRRRALKAPFKAKVDGVLEYILYWCSFGPDDHRKGGVRRPSRSTYVPKKKNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSIALIIYNEDKHVDKKGLPCHGPQDKKAEGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRILSLLYVGVSVETIMQRH  207



>ref|NP_193133.3| zinc ion binding protein [Arabidopsis thaliana]
 gb|AEE83354.1| zinc ion binding protein [Arabidopsis thaliana]
Length=778

 Score =   201 bits (512),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 96/203 (47%), Positives = 138/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNP   +FSS DL W+K  G  ++ D +ALIPY RVD F+ GECSN +CPT 
Sbjct  5    DQIFSLPVQNPTLPEFSSTDLVWSKVEGYRDNIDRLALIPYTRVDDFVRGECSNKDCPTS  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R++ +G   + + D  LEY +YWCSFGP++  +GG + PSR   +  +N A RP
Sbjct  65   FHVEARRRKAKGKKYKPKVDGILEYILYWCSFGPDDNRKGGTVRPSRSTYVPKKNNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             S RGC CHF+VKRL A P++AL+I+NN +HV++ GF CHGP D+ A G  A   PYI  
Sbjct  125  NSKRGCRCHFIVKRLIAEPTVALVIYNNDKHVDEKGFPCHGPQDKKAAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ +  S++Y+G+  E ++++H
Sbjct  185  DLRLRVSSLLYVGVSVETIMQRH  207



>ref|XP_006578182.1| PREDICTED: uncharacterized protein LOC100779025 [Glycine max]
Length=690

 Score =   201 bits (510),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 104/210 (50%), Positives = 136/210 (65%), Gaps = 4/210 (2%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVE  317
            M  +E I +L VQ+P   +FS+A +NW K  G  +  D++ALIP+ RVD F+ GE SN E
Sbjct  1    MPRMEDILNLPVQDPLYPEFSAAHINWVKLEGGRQGGDDIALIPFARVDDFVKGESSNPE  60

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGE---GGGILPSRRYRLNT  488
            CP  F IE  RKR  GS+ + R D YLEY +YWCS+GPE+Y E   G G   S +     
Sbjct  61   CPASFRIESRRKRPVGSIAKPRVDGYLEYTLYWCSYGPEDYRESDSGVGDGTSTKPASGK  120

Query  489  RNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAK  668
             +R  R   MRGC CHF VKRLY  P LAL+I+N RRHV+KSG  CHG LDRDA+G  A 
Sbjct  121  GSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRRHVDKSGAPCHGLLDRDAVGTRAM  180

Query  669  KIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
              P I +E++Q+ MSM+Y+GI  + +++ H
Sbjct  181  YAPRISDELRQKVMSMLYVGISLDKIIQHH  210



>dbj|BAK03605.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=814

 Score =   201 bits (512),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 135/203 (67%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I +L VQNP   +FS+AD+ W+   G  +  D +ALIP+ RV  F+ GE ++ ECPTR
Sbjct  5    DEILTLPVQNPTILEFSAADITWSMVEGWKDSMDRLALIPFSRVGDFVRGESNSKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R      + + D  LEY +YWCSFGP++Y  GG + PSR      +  A RP
Sbjct  65   FHVEARRRRSPTMTCKPKVDGILEYILYWCSFGPDDYRMGGAVRPSRSSYGKRKTPAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGC CHF+VKRL A PSLAL+I+N+ +H++K G  CHGP+D+ A+G  A   PYI +
Sbjct  125  NTKRGCVCHFIVKRLIAEPSLALVIYNHNKHIDKKGTPCHGPMDKMAVGTKAMFAPYISD  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            E+  + MS++Y+GIP E ++++H
Sbjct  185  ELLLEVMSLLYVGIPVETIMQRH  207



>gb|KHN10289.1| hypothetical protein glysoja_017893 [Glycine soja]
Length=723

 Score =   201 bits (510),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 137/212 (65%), Gaps = 4/212 (2%)
 Frame = +3

Query  135  SGMDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSN  311
            + M  +E I +L VQ+P   +FS+A +NW K  G  +  D++ALIP+ RVD F+ GE SN
Sbjct  32   TKMPRMEDILNLPVQDPLYPEFSAAHINWVKLEGGRQGGDDIALIPFARVDDFVKGESSN  91

Query  312  VECPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGE---GGGILPSRRYRL  482
             ECP  F IE  RKR  GS+ + R D YLEY +YWCS+GPE+Y E   G G   S +   
Sbjct  92   PECPASFRIESRRKRPVGSIAKPRVDGYLEYTLYWCSYGPEDYRESDSGVGDGTSTKPAS  151

Query  483  NTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPG  662
               +R  R   MRGC CHF VKRLY  P LAL+I+N RRHV+KSG  CHG LDRDA+G  
Sbjct  152  GKGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRRHVDKSGAPCHGLLDRDAVGTR  211

Query  663  AKKIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
            A   P I +E++Q+ MSM+Y+GI  + +++ H
Sbjct  212  AMYAPRISDELRQKVMSMLYVGISLDKIIQHH  243



>ref|XP_006375216.1| hypothetical protein POPTR_0014s05360g [Populus trichocarpa]
 gb|ERP53013.1| hypothetical protein POPTR_0014s05360g [Populus trichocarpa]
Length=1059

 Score =   203 bits (516),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNPP  +FS++D+ W+K  G  ++ D +ALIP+ RVD F+ GE +N +CPTR
Sbjct  5    DEILSLPVQNPPTLEFSASDIVWSKVEGWRDNLDRLALIPFARVDDFVRGESANKDCPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRPPQTSYKQKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPRDKKAEGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>gb|EYU33119.1| hypothetical protein MIMGU_mgv1a009920mg [Erythranthe guttata]
Length=327

 Score =   193 bits (490),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 98/217 (45%), Positives = 135/217 (62%), Gaps = 12/217 (6%)
 Frame = +3

Query  135  SGMDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSN  311
            S M  +E I +L VQ+PP  +FS+A +NW K  G  +  D++ALIP+ RV+ F+ GE  N
Sbjct  6    SKMARMEDILNLPVQDPPYTEFSAAHINWVKVEGGRQGGDDIALIPFSRVEDFVKGESGN  65

Query  312  VECPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENY-------GEGGGILPSR  470
             +CP  F +E  RKR EGSL + R D YLEY +YWCS+GPE+Y       GE     PS 
Sbjct  66   ADCPANFRVESRRKRPEGSLNKPRVDGYLEYTLYWCSYGPEDYRDIEPQIGEKTSTKPSS  125

Query  471  RYRLNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDA  650
                   +R  R   MRGC CHF VKRLY  P LAL+I+N R HV+KSG  CHG LD ++
Sbjct  126  ----GKGSRPGRRHMMRGCICHFTVKRLYTRPQLALIIYNQRSHVDKSGAPCHGILDHES  181

Query  651  IGPGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
            +G  A   P I  E++Q+ MS++++GI  + +++ H+
Sbjct  182  VGTRAMYAPRISEELRQKVMSLLHVGISLDAIVQHHM  218



>gb|EMT07282.1| hypothetical protein F775_09518 [Aegilops tauschii]
Length=947

 Score =   202 bits (514),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 135/203 (67%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I +L VQNP   +FS+AD+ W+   G  +  D +ALIP+ RV  F+ GE +N  CPTR
Sbjct  194  DEILTLPVQNPTILEFSAADITWSMVEGWKDSMDRLALIPFSRVGDFVRGESNNKACPTR  253

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R      + + D  LEY +YWCSFGP++Y +GG + PSR      +  A RP
Sbjct  254  FHVEARRRRSPTMTCKPKVDGILEYILYWCSFGPDDYRKGGAVRPSRSSCGKRKTPAGRP  313

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGC CHF+VKRL A PSLAL+I+N+ +HV+K G  CHGP+D+ A+G  A   PYI +
Sbjct  314  NTKRGCVCHFIVKRLIAEPSLALVIYNHNKHVDKKGTPCHGPMDKMAVGTKAMFAPYISD  373

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            E+  + MS++Y+GIP E ++++H
Sbjct  374  ELLLEVMSLLYVGIPVETIMQRH  396



>ref|XP_002516601.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF45942.1| conserved hypothetical protein [Ricinus communis]
Length=686

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 137/211 (65%), Gaps = 12/211 (6%)
 Frame = +3

Query  150  VESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPT  326
            +E I +L VQ+PP  +FS+A++ W K  G  +  D++AL+P+ RV+ F+ GE SN ECP 
Sbjct  1    MEDILNLPVQDPPCAEFSAANIKWVKVEGGRQGGDDIALVPFSRVEDFVKGESSNAECPA  60

Query  327  RFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENY-------GEGGGILPSRRYRLN  485
             F +E  RKR EGS+ + R D YLEY +YWCS+GPE+Y       G+G  + P+      
Sbjct  61   SFRVESRRKRSEGSISKPRVDGYLEYTLYWCSYGPEDYRDSESGIGDGSNVKPAT----G  116

Query  486  TRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGA  665
              +R  R   MRGC CHF VKRLY  P LAL+I+N R+HV+K+G  CHG LD DA+G  A
Sbjct  117  KGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRKHVDKTGAPCHGILDLDAVGTRA  176

Query  666  KKIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
               P I  E++Q+ M+M+Y+G+  +N+++ H
Sbjct  177  MYAPRISEELRQKVMAMLYVGMSLDNIIQHH  207



>gb|EYU37722.1| hypothetical protein MIMGU_mgv1a023319mg, partial [Erythranthe 
guttata]
Length=672

 Score =   200 bits (508),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQ+PP  +F+S+DL W+K  G  ++ D +ALIP+ RVD F+ GE +N ECPTR
Sbjct  5    DEILSLPVQSPPTLEFASSDLVWSKIEGWRDNIDRLALIPFARVDDFVRGESNNKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR   +     + RP
Sbjct  65   FHVEARRRRTAKTSYKPKVDGILEYILYWCSFGPDDHRKGGIVRPSRSTYVPKNKPSGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP D+ A+G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALVIYNQDKHVDKKGSPCHGPQDKKAVGTRAMYAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            E++ + +S++++G+  E ++++H
Sbjct  185  ELRLRVLSLLHVGVSVETIMQRH  207



>ref|XP_006375222.1| hypothetical protein POPTR_0014s05410g [Populus trichocarpa]
 gb|ERP53019.1| hypothetical protein POPTR_0014s05410g [Populus trichocarpa]
Length=1067

 Score =   203 bits (516),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNPP  +FS++D+ W+K  G  ++ D +ALIP+ RVD F+ GE +N +CPTR
Sbjct  5    DEILSLPVQNPPTLEFSASDIVWSKVEGWRDNLDRLALIPFARVDDFVRGESANKDCPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRPPQTSYKQKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPRDKKAEGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_011032909.1| PREDICTED: uncharacterized protein LOC105131568 [Populus euphratica]
 ref|XP_011012198.1| PREDICTED: uncharacterized protein LOC105116502 [Populus euphratica]
Length=1080

 Score =   202 bits (515),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 139/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNPP  +FS++D+ W+K  G  ++ D +ALIP+ RVD F+ GE +N +CPTR
Sbjct  5    DEILSLPVQNPPTLEFSASDIVWSKVEGWRDNLDRLALIPFARVDDFVRGESANKDCPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRPPQTSYKQKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPRDKKAEGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>gb|KHG00863.1| CUE domain-containing 5 [Gossypium arboreum]
 gb|KHG00916.1| CUE domain-containing 5 [Gossypium arboreum]
Length=997

 Score =   201 bits (512),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 138/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNPP  +FS+ D+ W+K  G  ++ D VALIP+ RVD F+ GE SN +CPTR
Sbjct  5    DEILSLPVQNPPTLEFSAHDIVWSKVEGWRDNIDRVALIPFARVDDFVRGESSNKDCPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRSPKAPYKPKVDGILEYILYWCSFGPDDHRKGGLVRPSRNTYIPKKTNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++++G+  E ++++H
Sbjct  185  DLRLRVLSLLHVGVSVETIMQRH  207



>gb|KJB22894.1| hypothetical protein B456_004G072100 [Gossypium raimondii]
Length=1015

 Score =   202 bits (513),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 138/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNPP  +FS+ D+ W+K  G  ++ D VALIP+ RVD F+ GE SN +CPTR
Sbjct  5    DEILSLPVQNPPTLEFSAHDIVWSKVEGWRDNIDRVALIPFARVDDFVRGESSNKDCPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRSPKAPYKPKVDGILEYILYWCSFGPDDHRKGGLVRPSRNTYIPKKTNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++++G+  E ++++H
Sbjct  185  DLRLRVLSLLHVGVSVETIMQRH  207



>emb|CDP15763.1| unnamed protein product [Coffea canephora]
Length=750

 Score =   200 bits (508),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 137/203 (67%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNPP  +FSS+DL W+K  G  ++ D V LIP+ RVD F+ GE +N +CPTR
Sbjct  5    DEILSLPVQNPPTLEFSSSDLVWSKVEGWRDNIDRVCLIPFARVDDFVRGESANNDCPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R      + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRPPEMSYKPKVDGILEYILYWCSFGPDDHRKGGVVRPSRTTYVPKKKSAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMYAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++++G+  E ++++H
Sbjct  185  DLRLRVLSLLHVGVSVETIMQRH  207



>ref|XP_006414836.1| hypothetical protein EUTSA_v10024472mg [Eutrema salsugineum]
 gb|ESQ56289.1| hypothetical protein EUTSA_v10024472mg [Eutrema salsugineum]
Length=772

 Score =   199 bits (507),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 138/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNP   +FSSADL W+K  G  ++ D +ALIPY RVD F+ GE SN +CPT 
Sbjct  5    DQIFSLPVQNPTLPEFSSADLVWSKIEGYRDNIDRLALIPYARVDDFVRGESSNKDCPTS  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R++ +G   + + D  LEY +YWCSFGP++  +GG + PSR   +  +N A RP
Sbjct  65   FHVEARRRKAKGKKYKPKVDGILEYILYWCSFGPDDNRKGGAVRPSRSTYVPKKNNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             S RGC CHF+VKRL A P++AL+I+NN +HV++ G  CHGP D+ A G  A   PYI  
Sbjct  125  NSKRGCRCHFIVKRLIAEPTVALVIYNNDKHVDEKGLPCHGPQDKKAAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_006283161.1| hypothetical protein CARUB_v10004191mg [Capsella rubella]
 gb|EOA16059.1| hypothetical protein CARUB_v10004191mg [Capsella rubella]
Length=777

 Score =   199 bits (507),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 138/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNP   +FSSADL W+K  G  ++ D +ALIPY RVD F+ GE SN +CPT 
Sbjct  5    DQIFSLPVQNPTLPEFSSADLVWSKVEGYRDNIDRLALIPYTRVDDFVRGESSNKDCPTS  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R++ +G   + + D  LEY +YWCSFGP++  +GG + PSR   +  +N A RP
Sbjct  65   FHVEARRRKAKGKKYKPKVDGILEYILYWCSFGPDDNRKGGAVRPSRSTYVPKKNNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             S RGC CHF+VKRL A P++AL+I+NN +HV++ G  CHGP D+ A G  A   PYI  
Sbjct  125  NSKRGCRCHFIVKRLIAEPTVALVIYNNDKHVDEKGLPCHGPQDKKAAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>emb|CDY50427.1| BnaCnng19360D [Brassica napus]
Length=760

 Score =   199 bits (506),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 136/203 (67%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNP   +FSSADL W+K  G  ++ D +ALIPY RVD F+ GE SN +CPT 
Sbjct  5    DQIFSLPVQNPTLPEFSSADLVWSKVEGYRDNIDRLALIPYTRVDDFVRGESSNKDCPTS  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R++ +    + + D  LEY +YWCSFGP++  +GG + P R   +  +N A RP
Sbjct  65   FHVEARRRKAKEKTYKAKVDGILEYILYWCSFGPDDNRKGGSVRPCRSTYVPKKNNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             S RGC CHF+VKRL A P++AL+I+N+ +HV++ G  CHGP D+ A G  A   PYI  
Sbjct  125  NSKRGCRCHFIVKRLIAEPTVALIIYNHDKHVDEKGLPCHGPQDKKAAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_011081859.1| PREDICTED: uncharacterized protein LOC105164788 isoform X1 [Sesamum 
indicum]
 ref|XP_011081860.1| PREDICTED: uncharacterized protein LOC105164788 isoform X1 [Sesamum 
indicum]
 ref|XP_011081861.1| PREDICTED: uncharacterized protein LOC105164788 isoform X1 [Sesamum 
indicum]
Length=697

 Score =   198 bits (504),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 99/212 (47%), Positives = 136/212 (64%), Gaps = 12/212 (6%)
 Frame = +3

Query  150  VESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPT  326
            +E I SL VQ+PP  +FS+A++NW K  G  +  D++ALIP+ RVD F+ GE SN ECP 
Sbjct  11   MEDILSLPVQDPPYAEFSAANINWVKVEGGRQGGDDIALIPFSRVDDFVKGESSNAECPA  70

Query  327  RFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENY-------GEGGGILPSRRYRLN  485
             F +E  RKR EGSL + R D YLEY +YWCS+GPE+Y       GE     P+      
Sbjct  71   SFRVESRRKRPEGSLNKPRVDGYLEYTLYWCSYGPEDYRDIEPHIGENSSAKPAS----G  126

Query  486  TRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGA  665
              +R  R   MRGC CHF VKRLY  P LAL+I+N R HV+K+G  CHG LD++A+G  A
Sbjct  127  KGSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRNHVDKTGAPCHGILDQEAVGTRA  186

Query  666  KKIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
               P I  E++Q+ M+M+++GI  + +++ H+
Sbjct  187  MYAPRISEELRQKVMAMLHVGISLDMIVQHHM  218



>emb|CBI29086.3| unnamed protein product [Vitis vinifera]
Length=962

 Score =   200 bits (508),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 138/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNPP  +FSSA++ W+K  G  ++ D VALIP+ RVD F+ GE +N +CPTR
Sbjct  59   DEILSLPVQNPPTLEFSSAEIVWSKVEGWRDNIDRVALIPFARVDDFVRGESANKDCPTR  118

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R      + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  119  FHVEARRRRPPEMPYKPKVDGILEYILYWCSFGPDDHRKGGIVRPSRSTYVPKKKSAGRP  178

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  179  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMFAPYISE  238

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++++G+  E ++++H
Sbjct  239  DLRLRVLSLLHVGVSVETIMQRH  261



>ref|XP_008378289.1| PREDICTED: uncharacterized protein LOC103441391 [Malus domestica]
Length=696

 Score =   198 bits (504),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 101/211 (48%), Positives = 136/211 (64%), Gaps = 4/211 (2%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVE  317
            M  +E I +L VQ+PP  +FS+  + W K  G  +  D++ALIP+ RV  F+ GE SN E
Sbjct  8    MARMEDILNLPVQDPPCAEFSATHIKWVKVEGGRQGGDDIALIPFARVGDFVKGESSNAE  67

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEG-GGIL--PSRRYRLNT  488
            CP  F +E  RKR EGS+ + R D YLEY +YWCS+GPE+Y E   G++   S +     
Sbjct  68   CPASFRVESRRKRPEGSISKPRVDGYLEYTLYWCSYGPEDYRENESGLMDGSSTKPASGK  127

Query  489  RNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAK  668
             +R  R   MRGC CHF VKRLY  P LAL+I+N R HV+KSG  CHG LD+DA+G  A 
Sbjct  128  GSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRNHVDKSGSPCHGILDQDAMGTRAM  187

Query  669  KIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
              P I  E +Q+ MSM+Y+GIP +N+++ H+
Sbjct  188  YAPRISEEQRQKVMSMLYVGIPLDNIIQHHM  218



>ref|XP_009377375.1| PREDICTED: uncharacterized protein LOC103965988 [Pyrus x bretschneideri]
Length=696

 Score =   198 bits (504),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 100/211 (47%), Positives = 133/211 (63%), Gaps = 4/211 (2%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVE  317
            M  +E I +L VQ+PP  +FS+  + W K  G  +  D++ALIP+ RV  F+ GE SN E
Sbjct  8    MARMEDILNLPVQDPPCAEFSATHIKWVKVEGGRQGGDDIALIPFARVGDFVKGESSNAE  67

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNR  497
            CP  F +E  RKR EGS+ + R D YLEY +YWCS+GPE+Y E    L           +
Sbjct  68   CPASFRVESRRKRPEGSISKPRVDGYLEYTLYWCSYGPEDYRENESGLVDGSSTKPASGK  127

Query  498  AARP---QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAK  668
             +RP     MRGC CHF VKRLY  P LAL+I+N R HV+KSG  CHG LD+DA+G  A 
Sbjct  128  GSRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRNHVDKSGSPCHGILDQDAMGTRAM  187

Query  669  KIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
              P I  E +Q+ MSM+Y+GIP +N+++ H+
Sbjct  188  YAPRISEEQRQKVMSMLYVGIPLDNIIQHHM  218



>ref|XP_010450122.1| PREDICTED: uncharacterized protein LOC104732283 [Camelina sativa]
Length=777

 Score =   199 bits (505),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 137/203 (67%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNP   +FSSADL W+K  G  ++ D +ALIPY RVD F+ GE  N +CPT 
Sbjct  5    DQIFSLPVQNPALPEFSSADLVWSKVEGYRDNIDRLALIPYTRVDDFVRGESLNTDCPTS  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R++ +G   + + D  LEY +YWCSFGP++   GG + PSR   +  +N+A RP
Sbjct  65   FHVEARRRKAKGKKYKPKVDGILEYILYWCSFGPDDNRTGGAVRPSRSTYVPKKNKAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             S RGC CHF+VKRL A P++AL+I+NN +HV++ G  CHGP D+ A G  A   PYI  
Sbjct  125  NSKRGCRCHFIVKRLIAEPTVALVIYNNDKHVDEKGLPCHGPQDKKAAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_002271166.1| PREDICTED: uncharacterized protein LOC100264354 [Vitis vinifera]
 ref|XP_010658922.1| PREDICTED: uncharacterized protein LOC100264354 [Vitis vinifera]
Length=965

 Score =   200 bits (508),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 138/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNPP  +FSSA++ W+K  G  ++ D VALIP+ RVD F+ GE +N +CPTR
Sbjct  5    DEILSLPVQNPPTLEFSSAEIVWSKVEGWRDNIDRVALIPFARVDDFVRGESANKDCPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R      + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRPPEMPYKPKVDGILEYILYWCSFGPDDHRKGGIVRPSRSTYVPKKKSAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQDKKAAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++++G+  E ++++H
Sbjct  185  DLRLRVLSLLHVGVSVETIMQRH  207



>ref|XP_004501270.1| PREDICTED: uncharacterized protein LOC101505233 isoform X1 [Cicer 
arietinum]
 ref|XP_004501271.1| PREDICTED: uncharacterized protein LOC101505233 isoform X2 [Cicer 
arietinum]
 ref|XP_004501272.1| PREDICTED: uncharacterized protein LOC101505233 isoform X3 [Cicer 
arietinum]
Length=690

 Score =   198 bits (503),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 96/207 (46%), Positives = 132/207 (64%), Gaps = 4/207 (2%)
 Frame = +3

Query  150  VESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPT  326
            +E I +L VQ+ P  +FS+ ++NW K  G  +  D++ALIP+ RVD F+ GE SN  CP 
Sbjct  4    MEDILNLPVQDLPCSEFSAENMNWVKLEGGRQGGDDIALIPFVRVDDFVKGESSNPACPA  63

Query  327  RFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAAR  506
             F +E  RKR  GS+ + R D YLEY +YWCS+GPE+Y E   ++           + +R
Sbjct  64   SFRVESKRKRPVGSVAKPRVDGYLEYTLYWCSYGPEDYRESESVIVDATSAKPASGKGSR  123

Query  507  P---QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIP  677
            P     MRGC CHF VKRLY  P LAL+I+N RRHV+KSG  CHG +D DA+G  A   P
Sbjct  124  PGRRHMMRGCLCHFTVKRLYTRPHLALIIYNQRRHVDKSGMPCHGIIDIDAVGTRAMYAP  183

Query  678  YICNEIQQQTMSMIYLGIPEENVLEKH  758
             I +E++Q+ MSM+Y G+  +N+L+ H
Sbjct  184  RISDELRQKVMSMLYAGVSLDNILQNH  210



>gb|AES89835.2| zinc ion-binding protein [Medicago truncatula]
Length=761

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 137/203 (67%), Gaps = 2/203 (1%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            ++I SL VQNP  E  SS +L W+K  G  +  D VALIP+ RV+ F+ GE +N ECPTR
Sbjct  5    DAILSLPVQNPTLE-ISSDNLVWSKVEGWHDKLDRVALIPFARVNDFVKGESNNKECPTR  63

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR      +  A RP
Sbjct  64   FHVEARRRRSPSTTSKKKVDGILEYILYWCSFGPDDHRKGGVVRPSRTSYAPKKKNAGRP  123

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N+ +HV+K G  CHGP D+ A G  A+  PYI  
Sbjct  124  NTKRGCTCHFIVKRLIAEPSVALIIYNDDKHVDKKGLPCHGPQDKKAAGTPAEFAPYISE  183

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  184  DLRLRVLSLLYVGVSVETIMQRH  206



>ref|XP_009139573.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103863577 
[Brassica rapa]
Length=770

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 136/203 (67%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNP   +FSSADL W+K  G  ++ D +ALIPY RVD F+ GE SN +CPT 
Sbjct  5    DQIFSLPVQNPTLPEFSSADLVWSKVEGYRDNIDRLALIPYTRVDDFVRGESSNKDCPTS  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R++ +    + + D  LEY +YWCSFGP++  +GG + P R   +  +N A RP
Sbjct  65   FHVEARRRKAKEKTYKAKVDGILEYILYWCSFGPDDNRKGGSVRPCRSTYVPKKNNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             S RGC CHF+VKRL A P++AL+I+N+ +HV++ G  CHGP D+ + G  A   PYI  
Sbjct  125  NSKRGCRCHFIVKRLIAEPTVALIIYNHDKHVDEKGLPCHGPQDKKSAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_007137090.1| hypothetical protein PHAVU_009G098900g [Phaseolus vulgaris]
 gb|ESW09084.1| hypothetical protein PHAVU_009G098900g [Phaseolus vulgaris]
Length=744

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/212 (48%), Positives = 136/212 (64%), Gaps = 4/212 (2%)
 Frame = +3

Query  135  SGMDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSN  311
            + M  +E I +L VQ+P   + S+A +NW K  G  +  D++ALIP+ RVD F+ GE SN
Sbjct  53   TKMPRMEDILNLPVQDPLCTELSAAYINWVKLEGGRQGGDDIALIPFARVDDFVKGESSN  112

Query  312  VECPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGE---GGGILPSRRYRL  482
             ECP  F IE  RKR EGS+ + R D YLEY +YWCS+GPE+Y E   G G   S +   
Sbjct  113  PECPASFRIESRRKRAEGSIAKPRVDGYLEYTLYWCSYGPEDYRESDSGVGDGMSTKPVS  172

Query  483  NTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPG  662
               +R  R   MRGC CHF +KRLY  P LAL+I+N RRHV+KSG  CHG LDRDA+G  
Sbjct  173  GKGSRPGRRHMMRGCLCHFTIKRLYTRPLLALIIYNQRRHVDKSGAPCHGLLDRDAVGTR  232

Query  663  AKKIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
            A   P I ++++Q+ MSM+Y G+  + +++ H
Sbjct  233  AMYAPRISDDLRQKVMSMLYAGMSLDKIIQHH  264



>ref|XP_002868324.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44583.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata]
Length=776

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 95/203 (47%), Positives = 137/203 (67%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNP   +FSSADL W+K  G  ++ D +ALIPY RVD F+ GE SN +CPT 
Sbjct  5    DQIFSLPVQNPTLPEFSSADLVWSKVEGYRDNIDRLALIPYTRVDDFVRGESSNKDCPTS  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R++ +G   + + D  LEY +YWCSFGP++  +GG + PSR   +  +N A RP
Sbjct  65   FHVEARRRKAKGKKYKPKVDGILEYILYWCSFGPDDNRKGGAVRPSRSTYVPKKNNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             S RGC CHF+VKRL A P++AL+I+NN +HV++ G  CHGP D+ A G  A   PYI  
Sbjct  125  NSKRGCRCHFIVKRLIAEPTVALVIYNNDKHVDEKGLPCHGPQDKKAAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ +  S++Y+G+  E ++++H
Sbjct  185  DLRLRVSSLLYVGVSVETIMQRH  207



>emb|CDY01179.1| BnaA04g06400D [Brassica napus]
Length=756

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 136/203 (67%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNP   +FSSADL W+K  G  ++ D +ALIPY RVD F+ GE SN +CPT 
Sbjct  5    DQIFSLPVQNPTLPEFSSADLVWSKVEGYRDNIDRLALIPYTRVDDFVRGESSNKDCPTS  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R++ +    + + D  LEY +YWCSFGP++  +GG + P R   +  +N A RP
Sbjct  65   FHVEARRRKAKEKTYKAKVDGILEYILYWCSFGPDDNRKGGSVRPCRSTYVPKKNNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             S RGC CHF+VKRL A P++AL+I+N+ +HV++ G  CHGP D+ + G  A   PYI  
Sbjct  125  NSKRGCRCHFIVKRLIAEPTVALIIYNHDKHVDEKGLPCHGPQDKKSAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_003607638.1| hypothetical protein MTR_4g080580 [Medicago truncatula]
Length=797

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 137/203 (67%), Gaps = 2/203 (1%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            ++I SL VQNP  E  SS +L W+K  G  +  D VALIP+ RV+ F+ GE +N ECPTR
Sbjct  5    DAILSLPVQNPTLE-ISSDNLVWSKVEGWHDKLDRVALIPFARVNDFVKGESNNKECPTR  63

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR      +  A RP
Sbjct  64   FHVEARRRRSPSTTSKKKVDGILEYILYWCSFGPDDHRKGGVVRPSRTSYAPKKKNAGRP  123

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N+ +HV+K G  CHGP D+ A G  A+  PYI  
Sbjct  124  NTKRGCTCHFIVKRLIAEPSVALIIYNDDKHVDKKGLPCHGPQDKKAAGTPAEFAPYISE  183

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  184  DLRLRVLSLLYVGVSVETIMQRH  206



>ref|XP_010450143.1| PREDICTED: uncharacterized protein LOC104732307 [Camelina sativa]
Length=777

 Score =   198 bits (503),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/203 (46%), Positives = 136/203 (67%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNP   +FSSADL W+K  G  ++ D +ALIPY RVD F+ GE  N +CPT 
Sbjct  5    DQIFSLPVQNPALPEFSSADLVWSKVEGYRDNIDRLALIPYTRVDDFVRGESLNTDCPTS  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R++ +G   + + D  LEY +YWCSFGP++   GG + PSR   +  +N A RP
Sbjct  65   FHVEARRRKAKGKKYKPKVDGILEYILYWCSFGPDDNRTGGAVRPSRSTYVAKKNNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             S RGC CHF+VKRL A P++AL+I+NN +HV++ G  CHGP D+ A G  A   PYI  
Sbjct  125  NSKRGCRCHFIVKRLIAEPTVALVIYNNDKHVDEKGLPCHGPQDKKAAGTRAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_008466358.1| PREDICTED: uncharacterized protein LOC103503790 isoform X2 [Cucumis 
melo]
Length=677

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 133/210 (63%), Gaps = 4/210 (2%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVE  317
            M   E I  L VQ+PP  +FS+A + W K  G  +   ++A++P+ RV+ F+ GE SN E
Sbjct  1    MPRTEDILKLQVQDPPCLEFSAAHIKWEKIEGGRQGGADIAVVPFSRVEDFVKGESSNPE  60

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNR  497
            CP RF IE  RKR  GS+ + R D YLEY +YWCS+GPE+Y      + S         +
Sbjct  61   CPARFRIESRRKRTAGSVSKPRVDGYLEYILYWCSYGPEDYRVSEAGVRSSSIIKPASGK  120

Query  498  AARP---QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAK  668
             +RP     MRGC CHF VKRLYA P LAL+I+N R+H++KSG  CHG LDRDA+G  A 
Sbjct  121  GSRPGRRHMMRGCLCHFTVKRLYARPHLALIIYNQRKHIDKSGAPCHGILDRDAVGTRAM  180

Query  669  KIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
                I  E++Q+ MSM+Y+GIP EN+++ H
Sbjct  181  YTQRISEELRQKIMSMLYVGIPIENIVQHH  210



>ref|XP_008466356.1| PREDICTED: uncharacterized protein LOC103503790 isoform X1 [Cucumis 
melo]
 ref|XP_008466357.1| PREDICTED: uncharacterized protein LOC103503790 isoform X1 [Cucumis 
melo]
Length=678

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/210 (47%), Positives = 133/210 (63%), Gaps = 4/210 (2%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVE  317
            M   E I  L VQ+PP  +FS+A + W K  G  +   ++A++P+ RV+ F+ GE SN E
Sbjct  2    MPRTEDILKLQVQDPPCLEFSAAHIKWEKIEGGRQGGADIAVVPFSRVEDFVKGESSNPE  61

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNR  497
            CP RF IE  RKR  GS+ + R D YLEY +YWCS+GPE+Y      + S         +
Sbjct  62   CPARFRIESRRKRTAGSVSKPRVDGYLEYILYWCSYGPEDYRVSEAGVRSSSIIKPASGK  121

Query  498  AARP---QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAK  668
             +RP     MRGC CHF VKRLYA P LAL+I+N R+H++KSG  CHG LDRDA+G  A 
Sbjct  122  GSRPGRRHMMRGCLCHFTVKRLYARPHLALIIYNQRKHIDKSGAPCHGILDRDAVGTRAM  181

Query  669  KIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
                I  E++Q+ MSM+Y+GIP EN+++ H
Sbjct  182  YTQRISEELRQKIMSMLYVGIPIENIVQHH  211



>ref|XP_007224640.1| hypothetical protein PRUPE_ppa026389mg, partial [Prunus persica]
 gb|EMJ25839.1| hypothetical protein PRUPE_ppa026389mg, partial [Prunus persica]
Length=688

 Score =   197 bits (500),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 99/208 (48%), Positives = 133/208 (64%), Gaps = 4/208 (2%)
 Frame = +3

Query  150  VESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPT  326
            +E I +L VQ+PP  +FS+A + W K  G  +  D++ALIP+ RV  F+ GE SN ECP 
Sbjct  4    MEDILNLPVQDPPCAEFSAAHIKWVKVEGGRQGGDDIALIPFARVGDFVKGESSNAECPA  63

Query  327  RFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAAR  506
             F IE  R+R EGS+ + R D YLEY +YWCS+GPE+Y E    L           + +R
Sbjct  64   SFRIESRRRRPEGSISKPRVDGYLEYTLYWCSYGPEDYRENESGLVDGSSTKPASGKGSR  123

Query  507  P---QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIP  677
            P     MRGC CHF VKRLY  P LAL+I+N R HV+KSG  CHG LD+DA+G  A   P
Sbjct  124  PGRRHMMRGCICHFTVKRLYTRPLLALIIYNQRNHVDKSGSPCHGILDQDAMGTRAMYAP  183

Query  678  YICNEIQQQTMSMIYLGIPEENVLEKHI  761
             I  E +Q+ MSM+Y+GIP +++++ H+
Sbjct  184  RISEEQRQKVMSMLYVGIPLDSIVQHHM  211



>ref|XP_003566605.1| PREDICTED: uncharacterized protein LOC100828484 [Brachypodium 
distachyon]
Length=896

 Score =   197 bits (500),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 135/203 (67%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I +L VQNP   +FS+A++ W+   G  +  D +ALIP+ RV+ F+ GE +N  CPTR
Sbjct  5    DEILTLPVQNPTTLEFSAAEITWSMVEGWKDSMDRLALIPFSRVNDFVRGESNNKVCPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R      + + D  LEY +YWCSFGP++Y + G + PSR      +  A RP
Sbjct  65   FHVEARRRRPPTMNCKPKVDGILEYILYWCSFGPDDYRKNGAVRPSRSSCGKRKTPAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGC CHF+VKRL A PSLAL+I+N+ +HV+K G  CHGP+D+ AIG  A   PYI +
Sbjct  125  NTKRGCVCHFIVKRLIAEPSLALVIYNHNKHVDKKGTPCHGPMDKMAIGTKAMFAPYISD  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            E+  + MS++++GIP E ++++H
Sbjct  185  ELHLEVMSLLHVGIPVETIMQRH  207



>ref|XP_002301246.2| hypothetical protein POPTR_0002s14170g [Populus trichocarpa]
 gb|EEE80519.2| hypothetical protein POPTR_0002s14170g [Populus trichocarpa]
Length=873

 Score =   196 bits (499),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 89/203 (44%), Positives = 138/203 (68%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKFGSA-EHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I S+ VQNPP  +FS++D+ W+K G   ++ D +ALIP+ RVD F+ GE +N +CPTR
Sbjct  5    DEILSIPVQNPPTLEFSASDIVWSKVGGWRDNLDRLALIPFARVDDFVRGEPANKDCPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRPPQTSYKQKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKKKNAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RG TCHF+VKRL + PS+AL+I+N  +HV+K G  CHGP D+ A G  A   PYI  
Sbjct  125  NTKRGYTCHFIVKRLISEPSVALIIYNQDKHVDKKGLPCHGPQDKKAEGTHAMFAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_004295012.1| PREDICTED: uncharacterized protein LOC101310972 [Fragaria vesca 
subsp. vesca]
Length=1030

 Score =   197 bits (502),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 92/203 (45%), Positives = 137/203 (67%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNPP  +F +ADL W+K  G  + +D VA+IP+ RVD F+ GE +N ECPT+
Sbjct  5    DEILSLPVQNPPTLEFCAADLVWSKVEGWCDKKDRVAVIPFARVDDFVRGESANKECPTK  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  RKR   +  + + D  LEY +YWCSFGP+++  GG   PSR +    +  + RP
Sbjct  65   FHVEARRKRHAKANFKPKVDGILEYILYWCSFGPDDHRAGGSRRPSRTHFAPKKKNSGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+ALL++N+ +HV+K G  CHGP D+ A G  A   P+I  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALLVYNSFKHVDKKGLPCHGPEDKMAAGTRAMFAPHISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ + +S++Y+G+  E ++++H
Sbjct  185  DLRLRVLSLLYVGVSVETIMQRH  207



>ref|XP_010692100.1| PREDICTED: uncharacterized protein LOC104905308 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692101.1| PREDICTED: uncharacterized protein LOC104905308 [Beta vulgaris 
subsp. vulgaris]
Length=864

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/203 (45%), Positives = 135/203 (67%), Gaps = 1/203 (0%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQ+PP  +FS+ D+ W+K  G  ++ D VALIP+ RV+ FI GE SN +CPT 
Sbjct  5    DEILSLPVQSPPTMEFSACDIVWSKVEGWRDNIDRVALIPFARVNDFIRGESSNKDCPTG  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R R   +  + + D  LEY +YWCSFGP++  +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRHRRAKASYKVKVDGVLEYILYWCSFGPDDLRKGGIVRPSRNTYIPKKKSAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL   PS+AL+I+N  +HV+K+G  CHGP D+ A+G  A   PYI  
Sbjct  125  NTKRGCTCHFIVKRLIVRPSVALIIYNQDKHVDKNGLPCHGPQDKKAVGTRAMYAPYISE  184

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ +  S++Y+G+  E ++++H
Sbjct  185  DLRLRVHSLLYVGVSVETIMQRH  207



>ref|XP_009349923.1| PREDICTED: uncharacterized protein LOC103941455 [Pyrus x bretschneideri]
Length=974

 Score =   196 bits (498),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 138/203 (68%), Gaps = 2/203 (1%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQ+PP  +FSS+DL W+K  G  + +D VALIP+ RVD F+ GE S+ ECPT+
Sbjct  5    DEILSLPVQSPPALEFSSSDLVWSKVEGWRDKKDRVALIPFPRVDDFLRGESSSKECPTK  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRQPKTPYKPKVDGILEYILYWCSFGPDDHRKGGLVRPSR-INVPKKKNAGRP  123

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV++ G  CHGP D+ A G  A   PYI  
Sbjct  124  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDRKGAPCHGPQDKMAAGTRAMFAPYISE  183

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ +  S++Y+G+  E ++++H
Sbjct  184  DLRLRVQSLLYVGVSVETIMQRH  206



>ref|XP_008219841.1| PREDICTED: uncharacterized protein LOC103320013 [Prunus mume]
Length=695

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 100/208 (48%), Positives = 134/208 (64%), Gaps = 4/208 (2%)
 Frame = +3

Query  150  VESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPT  326
            +E I +L VQ+PP  +FS+A + W K  G  +  D +ALIP+ RV  F+ GE SN ECP 
Sbjct  11   MEDILNLPVQDPPCAEFSAAHIKWVKVEGGRQGGDNIALIPFARVGDFVKGESSNAECPA  70

Query  327  RFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEG-GGIL--PSRRYRLNTRNR  497
             F IE  R+R EGS+ + R D YLEY +YWCS+GPE+Y E   G+L   S +      +R
Sbjct  71   SFRIESRRRRPEGSISKPRVDGYLEYTLYWCSYGPEDYRENESGVLDGSSTKPASGKGSR  130

Query  498  AARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIP  677
              R   MRGC CHF VKRLY  P LAL+I+N R HV+KSG  CHG  D+DA+G  A   P
Sbjct  131  PGRRHMMRGCICHFTVKRLYTRPLLALIIYNQRNHVDKSGSPCHGIHDQDAMGTRAMYAP  190

Query  678  YICNEIQQQTMSMIYLGIPEENVLEKHI  761
             I  E +Q+ MSM+Y+GIP +++++ H+
Sbjct  191  RISEEQRQKVMSMLYVGIPLDSIVQHHM  218



>ref|XP_008381415.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103444267 
[Malus domestica]
Length=972

 Score =   196 bits (498),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 93/203 (46%), Positives = 138/203 (68%), Gaps = 2/203 (1%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQ+PP  +FSS+DL W+K  G  + +D VALIP+ RVD F+ GE S+ ECPT+
Sbjct  5    DEILSLPVQSPPALEFSSSDLVWSKVEGWRDKKDRVALIPFPRVDDFLRGESSSKECPTK  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR   +  +  A RP
Sbjct  65   FHVEARRRRQPKTPYKPKVDGILEYILYWCSFGPDDHRKGGLVRPSR-VNIPKKKNAGRP  123

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV++ G  CHGP D+ A G  A   PYI  
Sbjct  124  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDRKGEPCHGPQDKMAAGTRAMFAPYISE  183

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
            +++ +  S++Y+G+  E ++++H
Sbjct  184  DLRLRVQSLLYVGVSVETIMQRH  206



>ref|XP_011652504.1| PREDICTED: uncharacterized protein LOC101215653 [Cucumis sativus]
 ref|XP_011652505.1| PREDICTED: uncharacterized protein LOC101215653 [Cucumis sativus]
 ref|XP_011652506.1| PREDICTED: uncharacterized protein LOC101215653 [Cucumis sativus]
 gb|KGN60133.1| hypothetical protein Csa_3G879510 [Cucumis sativus]
Length=685

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 98/210 (47%), Positives = 132/210 (63%), Gaps = 4/210 (2%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVE  317
            M   E I  L VQ+PP  +FS+A + W K  G  +   ++A++P+ RV+ F+ GE SN E
Sbjct  1    MPRTEDILKLQVQDPPCLEFSAAHVKWEKVEGGRQGGADIAVVPFSRVEDFVKGESSNPE  60

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNR  497
             P RF IE  RKR  GS+ + R D YLEY +YWCS+GPE+Y      + S         +
Sbjct  61   SPARFRIESRRKRTAGSVSKPRVDGYLEYILYWCSYGPEDYRVSEAGVRSSSIIKPASGK  120

Query  498  AARP---QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAK  668
             +RP     MRGC CHF VKRLYA P LAL+I+N R+H++KSG  CHG LDRDA+G  A 
Sbjct  121  GSRPGRRHMMRGCLCHFTVKRLYAQPHLALIIYNQRKHIDKSGAPCHGILDRDAVGTRAM  180

Query  669  KIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
                I  E++Q+ MSM+Y+GIP EN+++ H
Sbjct  181  YTQRISEELRQKIMSMLYVGIPIENIVQHH  210



>gb|EYU21901.1| hypothetical protein MIMGU_mgv1a023458mg [Erythranthe guttata]
Length=679

 Score =   192 bits (489),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 97/215 (45%), Positives = 135/215 (63%), Gaps = 12/215 (6%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVE  317
            M  +E I +L VQ+PP  +FS+A +NW K  G  +  D++ALIP+ RV+ F+ GE SN +
Sbjct  1    MARMEDILNLPVQDPPYTEFSAAHINWVKVEGGRQGGDDIALIPFSRVEDFVKGESSNAD  60

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENY-------GEGGGILPSRRY  476
            CP  F +E  RKR EGSL + R D YLEY +YWCS+GPE+Y       GE     PS   
Sbjct  61   CPANFRVESRRKRPEGSLNKPRVDGYLEYTLYWCSYGPEDYRDIEPQIGENTSTKPSS--  118

Query  477  RLNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIG  656
                 +R  R   MRGC CHF VKRLY  P LAL+I+N R HV+KSG  CHG LD++++G
Sbjct  119  --GKGSRPGRRHMMRGCICHFTVKRLYTRPQLALIIYNQRSHVDKSGAPCHGILDQESVG  176

Query  657  PGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
              A   P I  E++Q+ MS++++G   + +++ H+
Sbjct  177  TRAMYAPRISEELRQKVMSLLHVGTSLDAIVQHHM  211



>ref|XP_010049049.1| PREDICTED: uncharacterized protein LOC104437738 isoform X1 [Eucalyptus 
grandis]
 gb|KCW81512.1| hypothetical protein EUGRSUZ_C02873 [Eucalyptus grandis]
Length=693

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/208 (44%), Positives = 134/208 (64%), Gaps = 4/208 (2%)
 Frame = +3

Query  150  VESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPT  326
            +E I +L VQ+PP  +FS++ L W K  G  +  D+VALIP+ RV+ F+ GE SN +CP 
Sbjct  11   MEDILNLPVQDPPRAEFSASQLKWVKIVGGRQGGDDVALIPFARVEDFVKGESSNADCPA  70

Query  327  RFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAAR  506
             F +E  R+R EGS  + R D Y+EY +YWCS+GPE+Y +   ++           + +R
Sbjct  71   SFRVESRRRRREGSTSKPRVDGYIEYTLYWCSYGPEDYRDNESVVGDSLGMKPLSGKGSR  130

Query  507  P---QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIP  677
            P     MRGC CHF VKRLY  PS+AL+I+N ++HV+K+G  CHG LDR A+G  A   P
Sbjct  131  PGRHHMMRGCLCHFTVKRLYIRPSIALIIYNQQKHVDKTGAPCHGLLDRHAVGTRAMYAP  190

Query  678  YICNEIQQQTMSMIYLGIPEENVLEKHI  761
             I  E++Q+ MSM+Y  IP +++++ H+
Sbjct  191  RISEELRQKVMSMLYAAIPIDDIMQHHM  218



>ref|XP_011088310.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105169583 
[Sesamum indicum]
Length=914

 Score =   179 bits (453),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 87/203 (43%), Positives = 127/203 (63%), Gaps = 20/203 (10%)
 Frame = +3

Query  153  ESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPTR  329
            + I SL VQNPP  +FSS DL W+K  G  ++ D +ALIP+ RVD F+ GE +N ECPTR
Sbjct  5    DEILSLPVQNPPTLEFSSTDLVWSKVEGWRDNIDRLALIPFARVDDFVRGESNNKECPTR  64

Query  330  FHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARP  509
            FH+E  R+R   +  + + D  LEY +YWCSFGP+++ +GG + PSR   +     A RP
Sbjct  65   FHVEARRRRTPKTPYKPKVDGILEYILYWCSFGPDDHRKGGIVRPSRTTYVPKNKSAGRP  124

Query  510  QSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICN  689
             + RGCTCHF+VKRL A PS+AL+I+N  +HV+K G  CHGP                  
Sbjct  125  NTKRGCTCHFIVKRLIAEPSVALIIYNQDKHVDKKGLPCHGPQ-----------------  167

Query  690  EIQQQTMSMIYLGIPEENVLEKH  758
              + + +S++++G+  E ++++H
Sbjct  168  --RLRVLSLLHVGVSVETIMQRH  188



>gb|KHN38118.1| hypothetical protein glysoja_007160 [Glycine soja]
Length=299

 Score =   165 bits (417),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/105 (70%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M IVES+  + +Q+PP E+F +ADL WTKFG++EH DEV  IPYDRVDAFIIGECSNVEC
Sbjct  1    MAIVESVGKIPLQDPPEEEFCAADLTWTKFGNSEHHDEVPFIPYDRVDAFIIGECSNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGG  455
             TRFHIERG+K   GSLK+Y+ DEYLEYR+YWCSFGPENY    G
Sbjct  61   TTRFHIERGKKPTIGSLKDYKDDEYLEYRLYWCSFGPENYSVEPG  105



>gb|KDO36953.1| hypothetical protein CISIN_1g034580mg [Citrus sinensis]
Length=90

 Score =   154 bits (390),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 72/90 (80%), Positives = 79/90 (88%), Gaps = 0/90 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            MDIVES+  + VQ+PP EDFSS DL WTKFG+AEH DEVALIPY RVD+FIIGECSNVEC
Sbjct  1    MDIVESLFDIQVQDPPEEDFSSIDLTWTKFGTAEHHDEVALIPYARVDSFIIGECSNVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPDEYLEYRM  410
            PTRFHIERGRKR  GSLKEY+ DEYLEYR+
Sbjct  61   PTRFHIERGRKRSRGSLKEYKDDEYLEYRL  90



>ref|XP_003603488.1| hypothetical protein MTR_3g108220 [Medicago truncatula]
Length=552

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 115/204 (56%), Gaps = 30/204 (15%)
 Frame = +3

Query  150  VESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPT  326
            +E I +L VQ+PP  +FS+  +N     G  +  D++ALIP+ RVD F+  E SN  CP 
Sbjct  21   MEEILTLPVQDPPCAEFSAETINLLNLEGGRQGGDDIALIPFARVDDFVKEESSNPTCPA  80

Query  327  RFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAAR  506
             F +E  RKR  GS+ + R D YLEY +YWCS+GPE+Y E          R+N  +R  R
Sbjct  81   NFRVESRRKRASGSVAKPRVDGYLEYTLYWCSYGPEDYRESE--------RVNRGSRLGR  132

Query  507  PQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYIC  686
               MRGC CHF VKRLY  P LAL+I++ +R                     A   P I 
Sbjct  133  RHMMRGCLCHFTVKRLYTRPHLALIIYDQKR---------------------AMYAPRIS  171

Query  687  NEIQQQTMSMIYLGIPEENVLEKH  758
            +E++Q+ MSM+Y+GI  +N+L+ H
Sbjct  172  DELRQKVMSMLYVGISLDNILQHH  195



>gb|AES73739.2| zinc ion-binding protein [Medicago truncatula]
Length=540

 Score =   154 bits (388),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/204 (41%), Positives = 115/204 (56%), Gaps = 30/204 (15%)
 Frame = +3

Query  150  VESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVECPT  326
            +E I +L VQ+PP  +FS+  +N     G  +  D++ALIP+ RVD F+  E SN  CP 
Sbjct  1    MEEILTLPVQDPPCAEFSAETINLLNLEGGRQGGDDIALIPFARVDDFVKEESSNPTCPA  60

Query  327  RFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAAR  506
             F +E  RKR  GS+ + R D YLEY +YWCS+GPE+Y E          R+N  +R  R
Sbjct  61   NFRVESRRKRASGSVAKPRVDGYLEYTLYWCSYGPEDYRESE--------RVNRGSRLGR  112

Query  507  PQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYIC  686
               MRGC CHF VKRLY  P LAL+I++ +R                     A   P I 
Sbjct  113  RHMMRGCLCHFTVKRLYTRPHLALIIYDQKR---------------------AMYAPRIS  151

Query  687  NEIQQQTMSMIYLGIPEENVLEKH  758
            +E++Q+ MSM+Y+GI  +N+L+ H
Sbjct  152  DELRQKVMSMLYVGISLDNILQHH  175



>gb|EEC81754.1| hypothetical protein OsI_25420 [Oryza sativa Indica Group]
Length=900

 Score =   150 bits (380),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 80/210 (38%), Positives = 117/210 (56%), Gaps = 33/210 (16%)
 Frame = +3

Query  132  FSGMDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECS  308
               M   + I +L VQNPP  +FS++D+ W++  G  +  D +ALIP+ RV+ F+ GE +
Sbjct  111  LEAMARWDEILTLPVQNPPTPEFSASDIMWSRVEGWKDSMDRLALIPFSRVNDFVRGESN  170

Query  309  NVECPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNT  488
            N ECPTRFH+   R  +                              G + P R+     
Sbjct  171  NKECPTRFHMIIERAALSAL--------------------------AGTLQPKRK-----  199

Query  489  RNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAK  668
               A RP + RGC CHF+VKRL A PS+AL+I+N+ +HV+K G  CHGP+D  AIG  A 
Sbjct  200  -TPAGRPHTKRGCICHFIVKRLIAEPSVALVIYNHDKHVDKIGKPCHGPMDNMAIGTKAM  258

Query  669  KIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
              PYI +E++ Q MS++ +GIP E ++++H
Sbjct  259  FAPYISDELRLQIMSLLCVGIPVETIMQRH  288



>gb|EYU23542.1| hypothetical protein MIMGU_mgv1a019642mg [Erythranthe guttata]
 gb|EYU41892.1| hypothetical protein MIMGU_mgv1a017160mg [Erythranthe guttata]
Length=90

 Score =   135 bits (341),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+I+ESI +L VQ+PPGEDFSSADL W KFG+AE  D+VALIPYDRVDAFIIGECS VEC
Sbjct  1    MEIIESIDNLQVQDPPGEDFSSADLEWVKFGTAERCDDVALIPYDRVDAFIIGECSCVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPD  389
            PTRFHIERGRKR  GSLK+ + D
Sbjct  61   PTRFHIERGRKRARGSLKQCKND  83



>gb|EYU40888.1| hypothetical protein MIMGU_mgv1a018026mg [Erythranthe guttata]
Length=90

 Score =   133 bits (334),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVEC  320
            M+I+E I +L VQ+PPGEDFSSADL W KFG+AE  D+VALIPYDRVDAFIIGECS VEC
Sbjct  1    MEIIEFIDNLQVQDPPGEDFSSADLEWVKFGTAERCDDVALIPYDRVDAFIIGECSCVEC  60

Query  321  PTRFHIERGRKRVEGSLKEYRPD  389
            PTRFHIERGRKR  GSLK+ + D
Sbjct  61   PTRFHIERGRKRARGSLKQCKND  83



>ref|XP_007052247.1| Zinc ion binding protein isoform 2 [Theobroma cacao]
 gb|EOX96404.1| Zinc ion binding protein isoform 2 [Theobroma cacao]
Length=973

 Score =   131 bits (330),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 84/122 (69%), Gaps = 0/122 (0%)
 Frame = +3

Query  393  YLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARPQSMRGCTCHFVVKRLYACPSL  572
            +L  + YWCSFGP+++ +GG + PSR   +  +  A RP + RGCTCHF+VKRL A P++
Sbjct  29   HLTSQRYWCSFGPDDHRKGGIVRPSRNTYIPKKTNAGRPNTKRGCTCHFIVKRLIAEPTV  88

Query  573  ALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICNEIQQQTMSMIYLGIPEENVLE  752
            AL+I+N  +HV+K G  CHGP D+ A G  A   PYI  +++ + +S++Y+G+  E +++
Sbjct  89   ALIIYNQEKHVDKKGLPCHGPQDKKAAGTRAMFAPYISEDLRLRVLSLLYVGVSVETIMQ  148

Query  753  KH  758
            +H
Sbjct  149  RH  150



>gb|AGZ89234.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89235.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89236.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89237.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89238.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89239.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89240.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89241.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89242.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89243.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89244.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89245.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89246.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89247.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89248.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89249.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89250.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89251.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89252.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89253.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89254.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89255.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89256.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89257.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89258.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89259.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89260.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89261.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89262.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89263.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89264.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89265.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89266.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89267.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89268.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89269.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89270.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89271.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89272.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89273.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89274.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89275.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89276.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89277.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89278.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89279.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89280.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89281.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89282.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89283.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
 gb|AGZ89284.1| MLOC_22581-like protein, partial [Hordeum vulgare subsp. spontaneum]
Length=135

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/135 (44%), Positives = 82/135 (61%), Gaps = 1/135 (1%)
 Frame = +3

Query  141  MDIVESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSNVE  317
            M   + I +L VQNP   +FS+AD+ W+   G  +  D +ALIP+ RV  F+ GE ++ E
Sbjct  1    MTRWDEILTLPVQNPTILEFSAADITWSMVEGWKDSMDRLALIPFSRVGDFVRGESNSKE  60

Query  318  CPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNR  497
            CPTRFH+E  R+R      + + D  LEY +YWCSFGP++Y  GG + PSR      +  
Sbjct  61   CPTRFHVEARRRRSPTMTCKPKVDGILEYILYWCSFGPDDYRMGGAVRPSRSSYGKRKTP  120

Query  498  AARPQSMRGCTCHFV  542
            A RP + RGC CHF+
Sbjct  121  AGRPNTKRGCVCHFI  135



>ref|XP_008445306.1| PREDICTED: uncharacterized protein LOC103488340 isoform X3 [Cucumis 
melo]
Length=801

 Score =   126 bits (317),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = +3

Query  411  YWCSFGPENYGEGGGILPSRRYRLNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFN  590
            YWCSFGP+++ +GG   PSR   +  +  A RP + RGCTCHF+VKRL A PS+AL+I+N
Sbjct  38   YWCSFGPDDHRKGGVRRPSRSTYVPKKKNAGRPNTKRGCTCHFIVKRLIAEPSIALIIYN  97

Query  591  NRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
              +HV+K G  CHGP D+ A G  A   PYI  +++ + +S++Y+G+  E ++++H
Sbjct  98   EDKHVDKKGLPCHGPQDKKAEGTRAMFAPYISEDLRLRILSLLYVGVSVETIMQRH  153



>gb|ERM94292.1| hypothetical protein AMTR_s00010p00231990 [Amborella trichopoda]
Length=797

 Score =   122 bits (305),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 70/201 (35%), Positives = 106/201 (53%), Gaps = 6/201 (3%)
 Frame = +3

Query  159  IQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVECPTRFHI  338
            I SL VQN P   F+S+ L W      +   +VA+IPYDR+D F+ GE S  +C T F  
Sbjct  16   ILSLPVQNLPEGYFNSSQLTWYTMNRGKSPVDVAVIPYDRMDDFVCGESSLSQCSTSFAR  75

Query  339  ERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARPQSM  518
             +  K+   +         L    YWCS+G  +Y +   I P      + ++R  R +  
Sbjct  76   TKSSKQPLHTASVTLEHRSLVSCTYWCSYGGADYRDQM-IHPE-----HNKHRPNRERKK  129

Query  519  RGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICNEIQ  698
            RGCTCHF+ K+L A PS  L+ +  RRHV+K+G  CHGP D  + G       ++ +E +
Sbjct  130  RGCTCHFICKQLAARPSDVLITYVERRHVDKNGLPCHGPEDISSGGKRPLHAMHLSSEKK  189

Query  699  QQTMSMIYLGIPEENVLEKHI  761
                S++Y+G+  + + +KHI
Sbjct  190  HWVYSLLYMGLSYKTIYDKHI  210



>ref|XP_010049050.1| PREDICTED: uncharacterized protein LOC104437738 isoform X2 [Eucalyptus 
grandis]
Length=640

 Score =   115 bits (288),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/120 (43%), Positives = 77/120 (64%), Gaps = 3/120 (3%)
 Frame = +3

Query  411  YWCSFGPENYGEGGGILPSRRYRLNTRNRAARP---QSMRGCTCHFVVKRLYACPSLALL  581
            YWCS+GPE+Y +   ++           + +RP     MRGC CHF VKRLY  PS+AL+
Sbjct  46   YWCSYGPEDYRDNESVVGDSLGMKPLSGKGSRPGRHHMMRGCLCHFTVKRLYIRPSIALI  105

Query  582  IFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
            I+N ++HV+K+G  CHG LDR A+G  A   P I  E++Q+ MSM+Y  IP +++++ H+
Sbjct  106  IYNQQKHVDKTGAPCHGLLDRHAVGTRAMYAPRISEELRQKVMSMLYAAIPIDDIMQHHM  165



>ref|XP_011622982.1| PREDICTED: uncharacterized protein LOC18422177 [Amborella trichopoda]
Length=759

 Score =   107 bits (266),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/170 (35%), Positives = 92/170 (54%), Gaps = 6/170 (4%)
 Frame = +3

Query  252  EVALIPYDRVDAFIIGECSNVECPTRFHIERGRKRVEGSLKEYRPDEYLEYRMYWCSFGP  431
            +VA+IPYDR+D F+ GE S  +C T F   +  K+   +         L    YWCS+G 
Sbjct  9    DVAVIPYDRMDDFVCGESSLSQCSTSFARTKSSKQPLHTASVTLEHRSLVSCTYWCSYGG  68

Query  432  ENYGEGGGILPSRRYRLNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNK  611
             +Y +   I P      + ++R  R +  RGCTCHF+ K+L A PS  L+ +  RRHV+K
Sbjct  69   ADYRDQM-IHPE-----HNKHRPNRERKKRGCTCHFICKQLAARPSDVLITYVERRHVDK  122

Query  612  SGFVCHGPLDRDAIGPGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
            +G  CHGP D  + G       ++ +E +    S++Y+G+  + + +KHI
Sbjct  123  NGLPCHGPEDISSGGKRPLHAMHLSSEKKHWVYSLLYMGLSYKTIYDKHI  172



>ref|XP_010648578.1| PREDICTED: uncharacterized protein LOC100245761 isoform X2 [Vitis 
vinifera]
 ref|XP_010648579.1| PREDICTED: uncharacterized protein LOC100245761 isoform X2 [Vitis 
vinifera]
 ref|XP_010648580.1| PREDICTED: uncharacterized protein LOC100245761 isoform X2 [Vitis 
vinifera]
Length=562

 Score =   105 bits (263),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 46/82 (56%), Positives = 62/82 (76%), Gaps = 0/82 (0%)
 Frame = +3

Query  516  MRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICNEI  695
            MRGC CHF VKRLY  PSLAL+I+N R+HV+K+G  CHG LDRDA+G  A   P I  E+
Sbjct  2    MRGCLCHFTVKRLYTRPSLALIIYNQRKHVDKTGAPCHGILDRDAVGTRAMYAPRISEEL  61

Query  696  QQQTMSMIYLGIPEENVLEKHI  761
            +Q+ MSM+Y+GI  +N+++ H+
Sbjct  62   RQKVMSMLYVGISLDNIIQHHM  83



>ref|XP_007013719.1| SWIM zinc finger family protein isoform 3 [Theobroma cacao]
 ref|XP_007013721.1| SWIM zinc finger family protein isoform 3 [Theobroma cacao]
 ref|XP_007013722.1| SWIM zinc finger family protein isoform 3 [Theobroma cacao]
 gb|EOY31338.1| SWIM zinc finger family protein isoform 3 [Theobroma cacao]
 gb|EOY31340.1| SWIM zinc finger family protein isoform 3 [Theobroma cacao]
 gb|EOY31341.1| SWIM zinc finger family protein isoform 3 [Theobroma cacao]
Length=577

 Score =   102 bits (255),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 63/90 (70%), Gaps = 0/90 (0%)
 Frame = +3

Query  492  NRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKK  671
            +R  R   MRGC CHF VKRLY  P LAL+I+N R+HV+K+G  CHG LD+DA+G  A  
Sbjct  9    SRPGRRHMMRGCLCHFTVKRLYTRPLLALIIYNQRKHVDKTGAPCHGILDQDAVGTRAMY  68

Query  672  IPYICNEIQQQTMSMIYLGIPEENVLEKHI  761
             P I  E++Q+ +SM+Y+GI  +N+ + H+
Sbjct  69   APRISEELRQKVISMLYVGISLDNIFQHHM  98



>ref|XP_011019706.1| PREDICTED: uncharacterized protein LOC105122342 isoform X3 [Populus 
euphratica]
Length=583

 Score =   102 bits (254),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 45/89 (51%), Positives = 62/89 (70%), Gaps = 0/89 (0%)
 Frame = +3

Query  492  NRAARPQSMRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKK  671
            +R  R   MRGC CHF VKRLY  P LAL+I+N R+HV+K+G  CHG LD DA+G  A  
Sbjct  15   SRPGRRHMMRGCLCHFTVKRLYTRPFLALIIYNQRKHVDKTGAPCHGILDVDAVGTRAMY  74

Query  672  IPYICNEIQQQTMSMIYLGIPEENVLEKH  758
             P I  E++Q+ MS++Y+GI  +N+++ H
Sbjct  75   APRISEELRQKVMSLLYIGISLDNIIQHH  103



>ref|XP_011081862.1| PREDICTED: uncharacterized protein LOC105164788 isoform X2 [Sesamum 
indicum]
Length=562

 Score = 93.6 bits (231),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/82 (49%), Positives = 59/82 (72%), Gaps = 0/82 (0%)
 Frame = +3

Query  516  MRGCTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICNEI  695
            MRGC CHF VKRLY  P LAL+I+N R HV+K+G  CHG LD++A+G  A   P I  E+
Sbjct  2    MRGCLCHFTVKRLYTRPLLALIIYNQRNHVDKTGAPCHGILDQEAVGTRAMYAPRISEEL  61

Query  696  QQQTMSMIYLGIPEENVLEKHI  761
            +Q+ M+M+++GI  + +++ H+
Sbjct  62   RQKVMAMLHVGISLDMIVQHHM  83



>ref|XP_011627619.1| PREDICTED: uncharacterized protein LOC18445750 [Amborella trichopoda]
Length=183

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 83/176 (47%), Gaps = 27/176 (15%)
 Frame = +3

Query  159  IQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVECPTRFHI  338
            I SL VQN     F S+ L+W++        +VA+IP+DRVD F+ GE  + +CPT F  
Sbjct  11   IYSLPVQNNGEGYFDSSKLSWSQISERGKVVDVAVIPFDRVDDFVNGESRHKKCPTNFFR  70

Query  339  ERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARPQSM  518
               RK      K  +  + ++   Y CS+G ++Y        S    L+  + A   +++
Sbjct  71   RSTRK------KNTKMGKGIDI-TYMCSYGRKDYRP-----QSTEQELDAHSDAQVQKNV  118

Query  519  RG---------------CTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLD  641
            R                C C F + +L      A++ +  RRHV+K+G+ CHGP D
Sbjct  119  RSESNVRKRRRLGRKRGCLCTFTISQLPDSHMNAVIKYRERRHVDKNGWPCHGPDD  174



>gb|ERN17409.1| hypothetical protein AMTR_s00037p00218460 [Amborella trichopoda]
Length=210

 Score = 74.3 bits (181),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/176 (30%), Positives = 83/176 (47%), Gaps = 27/176 (15%)
 Frame = +3

Query  159  IQSLVVQNPPGEDFSSADLNWTKFGSAEHQDEVALIPYDRVDAFIIGECSNVECPTRFHI  338
            I SL VQN     F S+ L+W++        +VA+IP+DRVD F+ GE  + +CPT F  
Sbjct  38   IYSLPVQNNGEGYFDSSKLSWSQISERGKVVDVAVIPFDRVDDFVNGESRHKKCPTNFFR  97

Query  339  ERGRKRVEGSLKEYRPDEYLEYRMYWCSFGPENYGEGGGILPSRRYRLNTRNRAARPQSM  518
               RK      K  +  + ++   Y CS+G ++Y        S    L+  + A   +++
Sbjct  98   RSTRK------KNTKMGKGIDI-TYMCSYGRKDYRP-----QSTEQELDAHSDAQVQKNV  145

Query  519  RG---------------CTCHFVVKRLYACPSLALLIFNNRRHVNKSGFVCHGPLD  641
            R                C C F + +L      A++ +  RRHV+K+G+ CHGP D
Sbjct  146  RSESNVRKRRRLGRKRGCLCTFTISQLPDSHMNAVIKYRERRHVDKNGWPCHGPDD  201



>emb|CAB10176.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78439.1| hypothetical protein [Arabidopsis thaliana]
Length=675

 Score = 65.1 bits (157),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/62 (40%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +3

Query  573  ALLIFNNRRHVNKSGFVCHGPLDRDAIGPGAKKIPYICNEIQQQTMSMIYLGIPEENVLE  752
            AL+I+NN +HV++ GF CHGP D+ A G  A   PYI  +++ +  S++Y+G+  E +++
Sbjct  78   ALVIYNNDKHVDEKGFPCHGPQDKKAAGTRAMFAPYISEDLRLRVSSLLYVGVSVETIMQ  137

Query  753  KH  758
            +H
Sbjct  138  RH  139



>ref|XP_003628101.1| hypothetical protein MTR_8g043550 [Medicago truncatula]
Length=135

 Score = 59.3 bits (142),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 42/124 (34%), Positives = 58/124 (47%), Gaps = 44/124 (35%)
 Frame = +3

Query  231  GSAEHQDEVALIPYDRVDAFIIGECSNVECPTRFHIERGRKRVEGSLKEYRPDEYLEYRM  410
            G++ H DEVALIPY+RVDAFII                GRK+  GSLKEY+  EYLEY +
Sbjct  31   GTSIHNDEVALIPYNRVDAFII----------------GRKQTVGSLKEYKDYEYLEYML  74

Query  411  YWCSFGPENYGEGGGILPSRRYRLNTRNRAARPQSMRGCTCHFVVKRLYACPSLALLIFN  590
                          GI    +++L    R  +  ++             A P   LL+F+
Sbjct  75   -------------AGI--QTQWQLQQMVRFGQHSAV-------------AYPLFTLLVFD  106

Query  591  NRRH  602
            +R+H
Sbjct  107  SRQH  110



>tpg|DAA42494.1| TPA: hypothetical protein ZEAMMB73_619750 [Zea mays]
Length=172

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 20/45 (44%), Positives = 33/45 (73%), Gaps = 0/45 (0%)
 Frame = +3

Query  624  CHGPLDRDAIGPGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
            CHG +D+ A+G  A   PYI +E++ Q MS++Y+GIP E ++++H
Sbjct  3    CHGSMDKMAVGTKAMFAPYISDELRLQVMSLLYVGIPVETIMQRH  47



>tpg|DAA42489.1| TPA: hypothetical protein ZEAMMB73_890904 [Zea mays]
Length=237

 Score = 51.2 bits (121),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +3

Query  624  CHGPLDRDAIGPGAKKIPYICNEIQQQTMSMIYLGIPEENVLEKH  758
            CHG +D+ A+G  A   PYI + ++ Q MS++Y+GIP E ++++H
Sbjct  3    CHGSMDKMAVGTKAMFAPYISDVLRLQVMSVLYVGIPVETIMQRH  47



>gb|KHN16480.1| hypothetical protein glysoja_036582 [Glycine soja]
Length=430

 Score = 50.4 bits (119),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 36/55 (65%), Gaps = 1/55 (2%)
 Frame = +3

Query  150  VESIQSLVVQNPPGEDFSSADLNWTKF-GSAEHQDEVALIPYDRVDAFIIGECSN  311
            +E I +L VQ+P   +FS+A +NW K  G  +  D +ALIP+ RVD F+ GE SN
Sbjct  4    MEGILNLPVQDPLCPEFSAAHINWVKLEGGRQCGDNIALIPFARVDDFVKGESSN  58



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1497111138900