BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2345

Length=705
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KJB83793.1|  hypothetical protein B456_013G264900                    198   3e-60   Gossypium raimondii
ref|XP_010109932.1|  Histone H2B.3                                      197   6e-60   Morus notabilis
ref|XP_010557295.1|  PREDICTED: histone H2B.11-like                     197   6e-60   Tarenaya hassleriana [spider flower]
ref|XP_006409905.1|  hypothetical protein EUTSA_v10017370mg             197   7e-60   Eutrema salsugineum
ref|XP_003542467.1|  PREDICTED: probable histone H2B.3                  196   1e-59   Glycine max [soybeans]
ref|XP_010092780.1|  putative histone H2B.1                             196   1e-59   Morus notabilis
ref|XP_011101532.1|  PREDICTED: histone H2B-like                        196   1e-59   Sesamum indicum [beniseed]
ref|XP_002284357.1|  PREDICTED: histone H2B                             196   1e-59   Vitis vinifera
ref|XP_011094461.1|  PREDICTED: histone H2B-like                        196   1e-59   Sesamum indicum [beniseed]
ref|XP_007016500.1|  Histone superfamily protein                        196   1e-59   Theobroma cacao [chocolate]
ref|XP_011101529.1|  PREDICTED: histone H2B-like                        196   1e-59   Sesamum indicum [beniseed]
ref|XP_010521818.1|  PREDICTED: histone H2B                             196   1e-59   Tarenaya hassleriana [spider flower]
ref|XP_011094462.1|  PREDICTED: histone H2B                             196   1e-59   Sesamum indicum [beniseed]
ref|XP_010260098.1|  PREDICTED: histone H2B-like                        196   2e-59   Nelumbo nucifera [Indian lotus]
emb|CBI16181.3|  unnamed protein product                                195   2e-59   Vitis vinifera
ref|XP_012064987.1|  PREDICTED: histone H2B                             196   2e-59   Jatropha curcas
ref|XP_010267292.1|  PREDICTED: histone H2B.3-like                      196   2e-59   Nelumbo nucifera [Indian lotus]
ref|XP_011101528.1|  PREDICTED: histone H2B-like                        196   2e-59   Sesamum indicum [beniseed]
ref|XP_011089968.1|  PREDICTED: probable histone H2B.1                  196   2e-59   Sesamum indicum [beniseed]
gb|EYU39674.1|  hypothetical protein MIMGU_mgv1a015683mg                196   2e-59   Erythranthe guttata [common monkey flower]
ref|WP_039311151.1|  hypothetical protein                               194   3e-59   
ref|XP_010243181.1|  PREDICTED: histone H2B-like isoform X1             195   3e-59   Nelumbo nucifera [Indian lotus]
gb|AEC10951.1|  histone H2B.2                                           195   3e-59   Camellia sinensis [black tea]
ref|XP_012064996.1|  PREDICTED: histone H2B-like                        196   3e-59   Jatropha curcas
emb|CDO99820.1|  unnamed protein product                                195   3e-59   Coffea canephora [robusta coffee]
gb|AFK49087.1|  unknown                                                 195   4e-59   Lotus japonicus
ref|XP_010112903.1|  putative histone H2B.1                             195   4e-59   Morus notabilis
emb|CAN72813.1|  hypothetical protein VITISV_016378                     195   4e-59   Vitis vinifera
ref|XP_006345846.1|  PREDICTED: histone H2B-like                        195   5e-59   Solanum tuberosum [potatoes]
ref|NP_180440.1|  histone H2B                                           195   5e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004143285.1|  PREDICTED: probable histone H2B.3                  194   5e-59   Cucumis sativus [cucumbers]
ref|XP_006384170.1|  hypothetical protein POPTR_0004s09030g             195   5e-59   Populus trichocarpa [western balsam poplar]
ref|NP_001236239.1|  uncharacterized protein LOC100500314               194   5e-59   Glycine max [soybeans]
gb|ADR30786.1|  histone H2B1                                            195   5e-59   Hevea brasiliensis [Para rubber tree]
ref|NP_001235921.1|  uncharacterized protein LOC100305731               194   5e-59   Glycine max [soybeans]
gb|KJB21583.1|  hypothetical protein B456_004G003900                    195   5e-59   Gossypium raimondii
ref|XP_002879182.1|  hypothetical protein ARALYDRAFT_901825             195   5e-59   Arabidopsis lyrata subsp. lyrata
ref|XP_007016494.1|  Histone superfamily protein                        195   5e-59   Theobroma cacao [chocolate]
ref|XP_010041401.1|  PREDICTED: probable histone H2B.1                  194   5e-59   Eucalyptus grandis [rose gum]
ref|XP_007010071.1|  Histone superfamily protein                        194   5e-59   Theobroma cacao [chocolate]
ref|XP_003521344.1|  PREDICTED: probable histone H2B.3                  194   6e-59   Glycine max [soybeans]
ref|XP_006379513.1|  hypothetical protein POPTR_0008s03040g             194   6e-59   Populus trichocarpa [western balsam poplar]
gb|ADR30787.1|  histone H2B2                                            194   6e-59   Hevea brasiliensis [Para rubber tree]
gb|EPS70960.1|  hypothetical protein M569_03796                         195   6e-59   Genlisea aurea
gb|KFK32267.1|  hypothetical protein AALP_AA6G220100                    195   6e-59   Arabis alpina [alpine rockcress]
emb|CBI16180.3|  unnamed protein product                                194   6e-59   Vitis vinifera
ref|XP_006379009.1|  hypothetical protein POPTR_0009s03310g             194   6e-59   Populus trichocarpa [western balsam poplar]
ref|XP_002315380.2|  hypothetical protein POPTR_0010s23730g             195   6e-59   Populus trichocarpa [western balsam poplar]
ref|XP_006383343.1|  histone H2B family protein                         194   6e-59   Populus trichocarpa [western balsam poplar]
ref|NP_001265978.1|  uncharacterized protein LOC101502541               194   7e-59   Cicer arietinum [garbanzo]
ref|XP_010535539.1|  PREDICTED: histone H2B.11-like                     194   7e-59   Tarenaya hassleriana [spider flower]
gb|KCW44378.1|  hypothetical protein EUGRSUZ_L02145                     193   7e-59   Eucalyptus grandis [rose gum]
ref|XP_003625510.1|  Histone H2B                                        194   7e-59   Medicago truncatula
sp|O22582.3|H2B_GOSHI  RecName: Full=Histone H2B                        194   7e-59   Gossypium hirsutum [American cotton]
ref|XP_010033153.1|  PREDICTED: histone H2B                             194   8e-59   Eucalyptus grandis [rose gum]
ref|XP_006488268.1|  PREDICTED: probable histone H2B.1-like             194   8e-59   Citrus sinensis [Valencia orange]
ref|XP_010529850.1|  PREDICTED: histone H2B.9-like                      193   8e-59   Tarenaya hassleriana [spider flower]
ref|XP_010260083.1|  PREDICTED: histone H2B                             194   8e-59   Nelumbo nucifera [Indian lotus]
ref|XP_006424774.1|  hypothetical protein CICLE_v10029539mg             194   8e-59   Citrus clementina
gb|KJB55704.1|  hypothetical protein B456_009G089900                    194   9e-59   Gossypium raimondii
ref|XP_007027099.1|  Histone superfamily protein                        194   9e-59   Theobroma cacao [chocolate]
ref|XP_003590511.1|  Histone H2B                                        194   1e-58   Medicago truncatula
ref|XP_003540207.1|  PREDICTED: histone H2B.3                           194   1e-58   Glycine max [soybeans]
ref|XP_008385152.1|  PREDICTED: probable histone H2B.1                  194   1e-58   Malus domestica [apple tree]
gb|KJB11257.1|  hypothetical protein B456_001G250000                    193   1e-58   Gossypium raimondii
ref|XP_007016059.1|  Histone superfamily protein                        194   1e-58   Theobroma cacao [chocolate]
gb|KCW52702.1|  hypothetical protein EUGRSUZ_J02067                     192   1e-58   Eucalyptus grandis [rose gum]
ref|XP_006379508.1|  hypothetical protein POPTR_0008s02990g             194   1e-58   Populus trichocarpa [western balsam poplar]
ref|XP_007206090.1|  hypothetical protein PRUPE_ppa012932mg             194   1e-58   Prunus persica
ref|XP_007206110.1|  hypothetical protein PRUPE_ppa013013mg             194   1e-58   Prunus persica
ref|XP_011031592.1|  PREDICTED: probable histone H2B.3                  193   1e-58   Populus euphratica
sp|O65819.1|H2B3_SOLLC  RecName: Full=Histone H2B.3; AltName: Ful...    193   1e-58   Solanum lycopersicum
ref|XP_003543443.1|  PREDICTED: probable histone H2B.1-like             193   1e-58   Glycine max [soybeans]
ref|XP_006349986.1|  PREDICTED: probable histone H2B.1-like             194   1e-58   Solanum tuberosum [potatoes]
ref|XP_008385143.1|  PREDICTED: histone H2B-like                        193   1e-58   Malus domestica [apple tree]
ref|XP_010486520.1|  PREDICTED: histone H2B.9-like                      193   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_002284277.1|  PREDICTED: probable histone H2B.1                  194   2e-58   Vitis vinifera
emb|CDY72471.1|  BnaCnng77830D                                          194   2e-58   Brassica napus [oilseed rape]
emb|CDP09006.1|  unnamed protein product                                194   2e-58   Coffea canephora [robusta coffee]
ref|XP_003607010.1|  Histone H2B                                        194   2e-58   Medicago truncatula
ref|XP_009606923.1|  PREDICTED: histone H2B.2-like                      194   2e-58   Nicotiana tomentosiformis
emb|CDX77199.1|  BnaC04g39940D                                          194   2e-58   Brassica napus [oilseed rape]
ref|XP_010553294.1|  PREDICTED: probable histone H2B.3                  193   2e-58   Tarenaya hassleriana [spider flower]
ref|XP_002873061.1|  hypothetical protein ARALYDRAFT_908123             193   2e-58   Arabidopsis lyrata subsp. lyrata
ref|XP_004294593.1|  PREDICTED: histone H2B                             193   2e-58   Fragaria vesca subsp. vesca
ref|XP_010464595.1|  PREDICTED: histone H2B.9-like                      192   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_009768094.1|  PREDICTED: histone H2B-like                        193   2e-58   Nicotiana sylvestris
ref|XP_006827045.1|  PREDICTED: histone H2B.11                          193   2e-58   Amborella trichopoda
ref|XP_010473505.1|  PREDICTED: histone H2B.9-like                      192   2e-58   Camelina sativa [gold-of-pleasure]
ref|NP_195877.1|  histone H2B                                           193   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286660.1|  hypothetical protein CARUB_v10002579mg             193   2e-58   Capsella rubella
ref|XP_004251842.1|  PREDICTED: histone H2B-like                        193   2e-58   Solanum lycopersicum
ref|XP_006379514.1|  hypothetical protein POPTR_0008s03050g             193   2e-58   Populus trichocarpa [western balsam poplar]
ref|XP_009799888.1|  PREDICTED: histone H2B.7-like                      193   2e-58   Nicotiana sylvestris
gb|AGH68506.1|  histone H2B.1                                           193   2e-58   Ipomoea batatas [batate]
ref|XP_009793874.1|  PREDICTED: histone H2B-like                        193   2e-58   Nicotiana sylvestris
gb|KJB35211.1|  hypothetical protein B456_006G104500                    193   2e-58   Gossypium raimondii
gb|KJB35210.1|  hypothetical protein B456_006G104400                    193   2e-58   Gossypium raimondii
gb|KJB35212.1|  hypothetical protein B456_006G104600                    193   2e-58   Gossypium raimondii
ref|XP_009605776.1|  PREDICTED: histone H2B-like                        193   2e-58   Nicotiana tomentosiformis
gb|AFK45369.1|  unknown                                                 192   2e-58   Lotus japonicus
ref|XP_006846063.1|  PREDICTED: histone H2B                             193   2e-58   Amborella trichopoda
ref|XP_009591126.1|  PREDICTED: histone H2B-like                        193   2e-58   Nicotiana tomentosiformis
ref|XP_006349988.1|  PREDICTED: histone H2B-like                        193   2e-58   Solanum tuberosum [potatoes]
ref|XP_011031602.1|  PREDICTED: histone H2B-like                        193   2e-58   Populus euphratica
gb|EPS74382.1|  hypothetical protein M569_00374                         193   2e-58   Genlisea aurea
ref|XP_004234912.1|  PREDICTED: histone H2B                             193   2e-58   Solanum lycopersicum
ref|XP_009774785.1|  PREDICTED: histone H2B.3                           193   2e-58   Nicotiana sylvestris
ref|XP_010423847.1|  PREDICTED: histone H2B.9-like                      192   3e-58   Camelina sativa [gold-of-pleasure]
ref|XP_009798491.1|  PREDICTED: histone H2B-like                        193   3e-58   Nicotiana sylvestris
gb|ABQ23584.1|  putative histone                                        192   3e-58   Medicago truncatula
ref|XP_009764372.1|  PREDICTED: histone H2B-like                        193   3e-58   Nicotiana sylvestris
ref|XP_009607481.1|  PREDICTED: histone H2B-like                        193   3e-58   Nicotiana tomentosiformis
gb|EPS71322.1|  hypothetical protein M569_03437                         193   3e-58   Genlisea aurea
ref|XP_009591125.1|  PREDICTED: histone H2B.3                           193   3e-58   Nicotiana tomentosiformis
gb|AFK36036.1|  unknown                                                 192   3e-58   Medicago truncatula
gb|KEH30941.1|  core histone H2A/H2B/H3/H4                              193   3e-58   Medicago truncatula
ref|XP_012074887.1|  PREDICTED: histone H2B                             192   3e-58   Jatropha curcas
ref|XP_004294720.1|  PREDICTED: histone H2B-like                        193   3e-58   Fragaria vesca subsp. vesca
ref|XP_008442575.1|  PREDICTED: probable histone H2B.3                  192   3e-58   Cucumis melo [Oriental melon]
gb|ABK96597.1|  unknown                                                 192   3e-58   Populus trichocarpa x Populus deltoides
ref|XP_009140934.1|  PREDICTED: histone H2B.3-like                      193   3e-58   Brassica rapa
ref|XP_011461252.1|  PREDICTED: histone H2B-like                        193   3e-58   Fragaria vesca subsp. vesca
ref|XP_011031597.1|  PREDICTED: histone H2B-like                        192   3e-58   Populus euphratica
ref|XP_009774786.1|  PREDICTED: histone H2B-like                        192   3e-58   Nicotiana sylvestris
ref|XP_006364445.1|  PREDICTED: histone H2B-like                        192   3e-58   Solanum tuberosum [potatoes]
ref|XP_008462509.1|  PREDICTED: probable histone H2B.3                  192   3e-58   Cucumis melo [Oriental melon]
ref|XP_010490718.1|  PREDICTED: histone H2B.9                           192   3e-58   Camelina sativa [gold-of-pleasure]
gb|KJB20152.1|  hypothetical protein B456_003G135400                    192   3e-58   Gossypium raimondii
ref|XP_003539696.1|  PREDICTED: probable histone H2B.1-like             193   3e-58   Glycine max [soybeans]
ref|XP_002523734.1|  histone h2b, putative                              192   3e-58   Ricinus communis
gb|KHN21978.1|  Putative histone H2B.1                                  193   3e-58   Glycine soja [wild soybean]
ref|XP_004302789.1|  PREDICTED: histone H2B.9                           192   3e-58   Fragaria vesca subsp. vesca
emb|CDY15776.1|  BnaC04g15480D                                          192   3e-58   Brassica napus [oilseed rape]
ref|XP_010097583.1|  putative histone H2B.1                             192   4e-58   Morus notabilis
emb|CDY71843.1|  BnaA07g37520D                                          192   4e-58   Brassica napus [oilseed rape]
ref|XP_008241461.1|  PREDICTED: probable histone H2B.3                  192   4e-58   Prunus mume [ume]
ref|XP_007207826.1|  hypothetical protein PRUPE_ppa023550mg             192   4e-58   Prunus persica
ref|XP_009374658.1|  PREDICTED: histone H2B.9-like                      192   4e-58   Pyrus x bretschneideri [bai li]
ref|XP_008363846.1|  PREDICTED: histone H2B.9-like                      192   4e-58   Malus domestica [apple tree]
emb|CDP09015.1|  unnamed protein product                                193   4e-58   Coffea canephora [robusta coffee]
ref|XP_011461273.1|  PREDICTED: histone H2B-like                        192   4e-58   Fragaria vesca subsp. vesca
ref|XP_008387734.1|  PREDICTED: histone H2B.9-like                      192   4e-58   Malus domestica [apple tree]
ref|XP_009350089.1|  PREDICTED: histone H2B.9-like                      192   4e-58   Pyrus x bretschneideri [bai li]
ref|XP_007132097.1|  hypothetical protein PHAVU_011G066500g             192   4e-58   Phaseolus vulgaris [French bean]
ref|XP_007132093.1|  hypothetical protein PHAVU_011G066200g             192   4e-58   Phaseolus vulgaris [French bean]
ref|NP_001237892.1|  uncharacterized protein LOC100305866               192   4e-58   Glycine max [soybeans]
gb|ABM67703.1|  histone 2b                                              192   4e-58   Nicotiana benthamiana
ref|XP_007132096.1|  hypothetical protein PHAVU_011G066400g             192   4e-58   Phaseolus vulgaris [French bean]
gb|KHN32108.1|  Putative histone H2B.1                                  192   5e-58   Glycine soja [wild soybean]
ref|XP_003538012.1|  PREDICTED: probable histone H2B.1                  192   5e-58   Glycine max [soybeans]
ref|XP_010541381.1|  PREDICTED: histone H2B.7-like                      192   5e-58   Tarenaya hassleriana [spider flower]
ref|XP_009377099.1|  PREDICTED: histone H2B.9-like                      192   5e-58   Pyrus x bretschneideri [bai li]
ref|XP_010541377.1|  PREDICTED: histone H2B.11-like isoform X1          192   6e-58   Tarenaya hassleriana [spider flower]
ref|XP_003606631.1|  Histone H2B                                        192   8e-58   Medicago truncatula
ref|XP_010520307.1|  PREDICTED: histone H2B.7-like                      191   1e-57   Tarenaya hassleriana [spider flower]
ref|XP_007144462.1|  hypothetical protein PHAVU_007G158200g             191   1e-57   Phaseolus vulgaris [French bean]
ref|XP_003556299.1|  PREDICTED: probable histone H2B.3                  191   1e-57   Glycine max [soybeans]
ref|XP_006424763.1|  hypothetical protein CICLE_v10029263mg             193   2e-57   Citrus clementina
ref|NP_200799.1|  histone H2B                                           191   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006841044.1|  PREDICTED: histone H2B.3                           190   2e-57   Amborella trichopoda
ref|XP_010535544.1|  PREDICTED: histone H2B.11                          191   2e-57   Tarenaya hassleriana [spider flower]
ref|XP_006360516.1|  PREDICTED: histone H2B.6-like                      195   3e-57   
ref|XP_002284332.2|  PREDICTED: histone H2B-like                        195   3e-57   Vitis vinifera
ref|XP_006281264.1|  hypothetical protein CARUB_v10027310mg             190   3e-57   Capsella rubella
ref|XP_006400898.1|  hypothetical protein EUTSA_v10014927mg             190   3e-57   Eutrema salsugineum
ref|XP_002862747.1|  hypothetical protein ARALYDRAFT_333229             189   5e-57   Arabidopsis lyrata subsp. lyrata
gb|KHN37876.1|  Histone H2B.3                                           192   5e-57   Glycine soja [wild soybean]
gb|AFK47985.1|  unknown                                                 189   5e-57   Lotus japonicus
ref|XP_004250026.1|  PREDICTED: histone H2B-like                        194   5e-57   
ref|XP_007144307.1|  hypothetical protein PHAVU_007G145100g             189   7e-57   Phaseolus vulgaris [French bean]
emb|CAA57778.1|  histone 2B                                             189   8e-57   Asparagus officinalis
gb|AAM63259.1|  histone H2B-like protein                                189   1e-56   Arabidopsis thaliana [mouse-ear cress]
gb|KJB16909.1|  hypothetical protein B456_002G253900                    191   1e-56   Gossypium raimondii
ref|XP_008794946.1|  PREDICTED: histone H2B.11-like                     188   2e-56   Phoenix dactylifera
ref|XP_004505884.1|  PREDICTED: probable histone H2B.1-like             193   2e-56   
ref|XP_003538007.2|  PREDICTED: probable histone H2B.1-like isofo...    193   2e-56   Glycine max [soybeans]
ref|XP_003539691.2|  PREDICTED: probable histone H2B.1-like isofo...    193   2e-56   Glycine max [soybeans]
ref|XP_010937687.1|  PREDICTED: histone H2B-like                        188   2e-56   Elaeis guineensis
ref|XP_008795023.1|  PREDICTED: histone H2B.11-like                     188   2e-56   Phoenix dactylifera
ref|XP_010260063.1|  PREDICTED: histone H2B-like                        188   3e-56   Nelumbo nucifera [Indian lotus]
gb|AAC05126.1|  histone H2B                                             186   3e-56   Malus domestica [apple tree]
ref|XP_009416254.1|  PREDICTED: histone H2B-like                        188   3e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008810801.1|  PREDICTED: histone H2B.11-like                     188   3e-56   Phoenix dactylifera
emb|CDY09241.1|  BnaA02g06670D                                          187   3e-56   Brassica napus [oilseed rape]
gb|KFK27531.1|  hypothetical protein AALP_AA8G395500                    187   5e-56   Arabis alpina [alpine rockcress]
ref|XP_010045297.1|  PREDICTED: histone H2B-like                        187   5e-56   Eucalyptus grandis [rose gum]
ref|XP_009612958.1|  PREDICTED: histone H2B-like                        187   5e-56   Nicotiana tomentosiformis
ref|XP_004494001.1|  PREDICTED: uncharacterized protein LOC101504461    193   5e-56   
ref|XP_009769838.1|  PREDICTED: histone H2B-like                        187   5e-56   Nicotiana sylvestris
ref|XP_002534080.1|  histone h2b, putative                              187   5e-56   Ricinus communis
ref|XP_002532620.1|  histone h2b, putative                              187   6e-56   
ref|XP_010937676.1|  PREDICTED: histone H2B.11-like                     187   6e-56   Elaeis guineensis
ref|XP_008776513.1|  PREDICTED: probable histone H2B.1                  187   6e-56   Phoenix dactylifera
ref|XP_002532621.1|  histone h2b, putative                              187   6e-56   
ref|XP_010920668.1|  PREDICTED: histone H2B.11-like                     187   7e-56   Elaeis guineensis
ref|XP_002864658.1|  hypothetical protein ARALYDRAFT_496128             187   7e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_004294582.1|  PREDICTED: histone H2B-like                        191   7e-56   Fragaria vesca subsp. vesca
ref|XP_007144308.1|  hypothetical protein PHAVU_007G145200g             186   7e-56   Phaseolus vulgaris [French bean]
ref|XP_010920677.1|  PREDICTED: histone H2B-like                        187   8e-56   Elaeis guineensis
ref|XP_001762764.1|  histone H2B                                        186   9e-56   Physcomitrella patens
ref|XP_002264142.1|  PREDICTED: histone H2B.3-like                      186   9e-56   Vitis vinifera
ref|NP_001275621.1|  uncharacterized protein LOC102589130               186   1e-55   Solanum tuberosum [potatoes]
gb|AAT68209.1|  putative histone H2B                                    184   1e-55   Cynodon dactylon
emb|CAN67222.1|  hypothetical protein VITISV_029051                     186   1e-55   Vitis vinifera
ref|XP_006429023.1|  hypothetical protein CICLE_v10013909mg             186   1e-55   Citrus clementina
ref|XP_009593026.1|  PREDICTED: histone H2B.2                           186   1e-55   Nicotiana tomentosiformis
ref|XP_010031420.1|  PREDICTED: histone H2B.7                           186   1e-55   Eucalyptus grandis [rose gum]
ref|XP_009757021.1|  PREDICTED: probable histone H2B.1                  186   1e-55   Nicotiana sylvestris
ref|XP_009627380.1|  PREDICTED: probable histone H2B.1                  186   1e-55   Nicotiana tomentosiformis
ref|XP_004143093.1|  PREDICTED: histone H2B                             186   2e-55   Cucumis sativus [cucumbers]
ref|XP_002316408.2|  hypothetical protein POPTR_0010s23770g             186   2e-55   Populus trichocarpa [western balsam poplar]
ref|XP_008807740.1|  PREDICTED: histone H2B.11-like                     186   2e-55   Phoenix dactylifera
ref|XP_010253293.1|  PREDICTED: histone H2B-like                        186   2e-55   Nelumbo nucifera [Indian lotus]
ref|XP_009622927.1|  PREDICTED: histone H2B.2                           186   2e-55   Nicotiana tomentosiformis
ref|XP_004137790.1|  PREDICTED: probable histone H2B.3                  186   2e-55   Cucumis sativus [cucumbers]
ref|XP_011024315.1|  PREDICTED: probable histone H2B.3                  186   2e-55   Populus euphratica
gb|KJB08855.1|  hypothetical protein B456_001G108300                    186   2e-55   Gossypium raimondii
gb|KFK38332.1|  hypothetical protein AALP_AA3G100500                    185   2e-55   Arabis alpina [alpine rockcress]
ref|XP_003606924.1|  Histone H2B                                        191   2e-55   
gb|AFK41221.1|  unknown                                                 184   2e-55   Lotus japonicus
ref|XP_009613501.1|  PREDICTED: histone H2B-like                        186   2e-55   Nicotiana tomentosiformis
ref|XP_008448382.1|  PREDICTED: histone H2B                             186   2e-55   Cucumis melo [Oriental melon]
ref|XP_004496143.1|  PREDICTED: probable histone H2B.3-like             185   2e-55   
ref|XP_008788090.1|  PREDICTED: histone H2B.11-like                     186   2e-55   Phoenix dactylifera
ref|XP_012090395.1|  PREDICTED: histone H2B-like                        185   2e-55   Jatropha curcas
ref|XP_010937686.1|  PREDICTED: histone H2B                             186   2e-55   Elaeis guineensis
ref|XP_004240357.1|  PREDICTED: histone H2B.7-like                      186   2e-55   Solanum lycopersicum
ref|XP_006379515.1|  hypothetical protein POPTR_0008s03060g             185   2e-55   Populus trichocarpa [western balsam poplar]
gb|ACJ84158.1|  unknown                                                 186   2e-55   Medicago truncatula
ref|XP_003606627.1|  Histone H2B                                        186   2e-55   Medicago truncatula
emb|CDX95762.1|  BnaC03g26430D                                          186   2e-55   Brassica napus [oilseed rape]
ref|XP_010248551.1|  PREDICTED: histone H2B.9-like                      185   2e-55   Nelumbo nucifera [Indian lotus]
ref|XP_006418979.1|  hypothetical protein EUTSA_v10002699mg             186   2e-55   Eutrema salsugineum
gb|EYU32448.1|  hypothetical protein MIMGU_mgv1a019785mg                185   2e-55   Erythranthe guttata [common monkey flower]
gb|EPS65705.1|  hypothetical protein M569_09073                         185   2e-55   Genlisea aurea
ref|XP_002876219.1|  predicted protein                                  184   2e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_010922381.1|  PREDICTED: histone H2B.11                          186   3e-55   Elaeis guineensis
ref|XP_006418973.1|  hypothetical protein EUTSA_v10002705mg             185   3e-55   Eutrema salsugineum
ref|XP_011077441.1|  PREDICTED: histone H2B.9-like                      185   3e-55   Sesamum indicum [beniseed]
ref|XP_008776479.1|  PREDICTED: histone H2B.11-like                     185   3e-55   Phoenix dactylifera
ref|XP_004239714.1|  PREDICTED: histone H2B.3                           185   3e-55   Solanum lycopersicum
emb|CDP06648.1|  unnamed protein product                                184   3e-55   Coffea canephora [robusta coffee]
ref|XP_008357680.1|  PREDICTED: probable histone H2B.1                  185   4e-55   Malus domestica [apple tree]
sp|O49118.3|H2B_CAPAN  RecName: Full=Histone H2B; AltName: Full=C...    185   4e-55   Capsicum annuum
ref|XP_010455739.1|  PREDICTED: histone H2B.11-like                     185   4e-55   Camelina sativa [gold-of-pleasure]
gb|AFK44468.1|  unknown                                                 184   4e-55   Lotus japonicus
gb|AFK35932.1|  unknown                                                 184   4e-55   Lotus japonicus
ref|XP_004251839.1|  PREDICTED: histone H2B-like                        184   4e-55   Solanum lycopersicum
ref|XP_006428483.1|  hypothetical protein CICLE_v10013076mg             184   5e-55   Citrus clementina
ref|XP_009358337.1|  PREDICTED: probable histone H2B.1                  185   5e-55   Pyrus x bretschneideri [bai li]
ref|XP_008796725.1|  PREDICTED: histone H2B-like                        185   5e-55   Phoenix dactylifera
ref|XP_010443777.1|  PREDICTED: histone H2B.11                          185   5e-55   Camelina sativa [gold-of-pleasure]
gb|EYU37023.1|  hypothetical protein MIMGU_mgv1a015651mg                185   5e-55   Erythranthe guttata [common monkey flower]
ref|XP_007148799.1|  hypothetical protein PHAVU_005G015300g             184   5e-55   Phaseolus vulgaris [French bean]
ref|XP_010483639.1|  PREDICTED: histone H2B.11-like                     184   5e-55   Camelina sativa [gold-of-pleasure]
ref|XP_011094827.1|  PREDICTED: histone H2B.9                           184   5e-55   Sesamum indicum [beniseed]
ref|XP_004241245.1|  PREDICTED: probable histone H2B.1                  184   6e-55   Solanum lycopersicum
gb|AAM66958.1|  histone H2B                                             184   6e-55   Arabidopsis thaliana [mouse-ear cress]
gb|AFK45166.1|  unknown                                                 184   6e-55   Lotus japonicus
ref|XP_002889664.1|  hypothetical protein ARALYDRAFT_470811             184   6e-55   Arabidopsis lyrata subsp. lyrata
gb|ABK94031.1|  unknown                                                 184   6e-55   Populus trichocarpa [western balsam poplar]
ref|XP_002315342.1|  putative histone H2B family protein                184   7e-55   Populus trichocarpa [western balsam poplar]
ref|XP_009133865.1|  PREDICTED: histone H2B.3                           184   7e-55   Brassica rapa
ref|NP_172258.1|  histone H2B                                           184   7e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011031603.1|  PREDICTED: histone H2B-like                        184   7e-55   Populus euphratica
ref|XP_011024306.1|  PREDICTED: probable histone H2B.1                  184   7e-55   Populus euphratica
ref|XP_010487998.1|  PREDICTED: histone H2B.1                           184   7e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010905724.1|  PREDICTED: histone H2B.1                           184   7e-55   Elaeis guineensis
ref|XP_010457984.1|  PREDICTED: histone H2B.1-like                      184   7e-55   Camelina sativa [gold-of-pleasure]
gb|ACU16873.1|  unknown                                                 183   7e-55   Glycine max [soybeans]
ref|XP_007132092.1|  hypothetical protein PHAVU_011G066100g             184   8e-55   Phaseolus vulgaris [French bean]
ref|XP_007132098.1|  hypothetical protein PHAVU_011G066600g             184   8e-55   Phaseolus vulgaris [French bean]
ref|XP_011654070.1|  PREDICTED: histone H2B.7                           184   8e-55   Cucumis sativus [cucumbers]
ref|XP_004139453.1|  PREDICTED: histone H2B.7-like                      184   8e-55   Cucumis sativus [cucumbers]
ref|XP_010520303.1|  PREDICTED: histone H2B.7                           184   9e-55   Tarenaya hassleriana [spider flower]
ref|XP_010520392.1|  PREDICTED: histone H2B.10 isoform X1               184   9e-55   Tarenaya hassleriana [spider flower]
ref|XP_009409532.1|  PREDICTED: histone H2B.11                          184   9e-55   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP07023.1|  unnamed protein product                                184   1e-54   Coffea canephora [robusta coffee]
ref|XP_007206093.1|  hypothetical protein PRUPE_ppa012937mg             183   1e-54   
gb|KJB62588.1|  hypothetical protein B456_009G424400                    183   1e-54   
ref|XP_001776159.1|  histone H2B                                        183   1e-54   
ref|XP_006846079.1|  PREDICTED: histone H2B                             183   1e-54   
ref|XP_009406979.1|  PREDICTED: histone H2B                             184   1e-54   
ref|XP_007206094.1|  hypothetical protein PRUPE_ppa012937mg             183   1e-54   
ref|XP_009150049.1|  PREDICTED: histone H2B.7-like                      183   1e-54   
emb|CDX86049.1|  BnaC03g55640D                                          183   2e-54   
ref|XP_004231635.1|  PREDICTED: histone H2B-like                        183   2e-54   
ref|XP_010475554.1|  PREDICTED: histone H2B.1-like                      183   2e-54   
ref|XP_009103710.1|  PREDICTED: histone H2B.3-like                      183   2e-54   
ref|XP_010503210.1|  PREDICTED: histone H2B.6 isoform X1                183   2e-54   
ref|NP_190184.1|  histone HTB9                                          183   2e-54   
ref|XP_012064675.1|  PREDICTED: histone H2B                             183   2e-54   
ref|XP_006292858.1|  hypothetical protein CARUB_v10019117mg             183   2e-54   
ref|XP_009414311.1|  PREDICTED: histone H2B-like                        183   2e-54   
ref|XP_010503218.1|  PREDICTED: histone H2B.7-like                      183   2e-54   
ref|XP_009356943.1|  PREDICTED: probable histone H2B.1                  182   2e-54   
ref|XP_008385496.1|  PREDICTED: probable histone H2B.1                  182   2e-54   
gb|ERN07751.1|  hypothetical protein AMTR_s00012p00085960               183   2e-54   
ref|XP_009116061.1|  PREDICTED: histone H2B.8-like                      182   3e-54   
ref|XP_009139383.1|  PREDICTED: histone H2B.8-like                      182   3e-54   
ref|XP_006292034.1|  hypothetical protein CARUB_v10018224mg             182   4e-54   
ref|NP_190189.1|  histone HTB11                                         182   4e-54   
ref|XP_006410934.1|  hypothetical protein EUTSA_v10017408mg             182   4e-54   
ref|XP_008788069.1|  PREDICTED: histone H2B                             182   4e-54   
ref|XP_004487556.1|  PREDICTED: histone H2B-like                        182   4e-54   
gb|ABK23506.1|  unknown                                                 182   4e-54   
ref|XP_006654514.1|  PREDICTED: histone H2B.11-like                     182   4e-54   
ref|XP_002986360.1|  hypothetical protein SELMODRAFT_182308             182   4e-54   
gb|ABK22321.1|  unknown                                                 182   5e-54   
emb|CDY31584.1|  BnaA10g12870D                                          182   5e-54   
ref|NP_190933.1|  histone H2B                                           182   5e-54   
gb|ABB55372.1|  histone H2B-like                                        182   5e-54   
ref|NP_001044754.1|  Os01g0839500                                       182   5e-54   
ref|XP_009388463.1|  PREDICTED: histone H2B.3-like                      182   5e-54   
ref|XP_002879676.1|  hypothetical protein ARALYDRAFT_482740             181   5e-54   
gb|KFK33961.1|  hypothetical protein AALP_AA5G084100                    182   5e-54   
ref|XP_006304288.1|  hypothetical protein CARUB_v10010582mg             182   5e-54   
ref|XP_004961843.1|  PREDICTED: histone H2B.2-like                      182   5e-54   
gb|KFK33963.1|  hypothetical protein AALP_AA5G084300                    182   6e-54   
gb|EMS50505.1|  Histone H2B.2                                           182   6e-54   
ref|XP_009120513.1|  PREDICTED: histone H2B.11                          182   6e-54   
ref|XP_009387428.1|  PREDICTED: histone H2B.2-like                      182   6e-54   
ref|XP_010515863.1|  PREDICTED: histone H2B.4-like                      181   6e-54   
gb|ABK22371.1|  unknown                                                 181   6e-54   
ref|XP_010504133.1|  PREDICTED: histone H2B.4-like isoform X1           181   7e-54   
ref|XP_010427020.1|  PREDICTED: histone H2B.4-like                      181   7e-54   
ref|XP_011024316.1|  PREDICTED: probable histone H2B.3                  181   7e-54   
ref|XP_009120626.1|  PREDICTED: histone H2B.10                          181   8e-54   
ref|XP_010322415.1|  PREDICTED: histone H2B.1-like                      181   8e-54   
gb|ERN07750.1|  hypothetical protein AMTR_s00012p00085300               181   9e-54   
ref|XP_009399875.1|  PREDICTED: histone H2B-like                        181   9e-54   
ref|XP_010685820.1|  PREDICTED: probable histone H2B.1 isoform X1       181   1e-53   
ref|XP_006349042.1|  PREDICTED: histone H2B.2-like                      181   1e-53   
emb|CDY30852.1|  BnaC04g27070D                                          181   1e-53   
ref|XP_006403666.1|  hypothetical protein EUTSA_v10010811mg             181   1e-53   
gb|AFG46519.1|  hypothetical protein UMN_CL388Contig1_03                179   1e-53   
emb|CDX71064.1|  BnaC03g11480D                                          181   1e-53   
ref|XP_010493386.1|  PREDICTED: histone H2B.10-like                     181   1e-53   
ref|XP_009338373.1|  PREDICTED: probable histone H2B.1                  181   1e-53   
ref|XP_009131960.1|  PREDICTED: histone H2B.3                           181   1e-53   
ref|XP_001767944.1|  histone H2B                                        181   1e-53   
ref|XP_006649859.1|  PREDICTED: histone H2B.1-like                      181   1e-53   
sp|Q1SWQ1.3|H2B2_MEDTR  RecName: Full=Probable histone H2B.2            181   1e-53   
dbj|BAJ87490.1|  predicted protein                                      181   1e-53   
ref|XP_001758785.1|  histone H2B                                        181   1e-53   
ref|XP_001768018.1|  histone H2B                                        181   1e-53   
gb|ABK23375.1|  unknown                                                 181   1e-53   
gb|ABK20995.1|  unknown                                                 181   1e-53   
emb|CAC84679.1|  putative histone H4                                    181   1e-53   
sp|A2XF66.1|H2B1_ORYSI  RecName: Full=Histone H2B.1                     181   1e-53   
ref|XP_006643764.1|  PREDICTED: histone H2B.5-like                      181   1e-53   
emb|CDY52745.1|  BnaA07g37600D                                          181   1e-53   
ref|XP_001759419.1|  predicted protein                                  180   1e-53   
ref|NP_001062114.2|  Os08g0490900                                       181   1e-53   
ref|XP_010683996.1|  PREDICTED: probable histone H2B.1                  181   2e-53   
ref|XP_011461274.1|  PREDICTED: histone H2B-like                        185   2e-53   
ref|XP_001768016.1|  histone H2B                                        180   2e-53   
ref|XP_010674961.1|  PREDICTED: histone H2B-like                        180   2e-53   
ref|XP_004970520.1|  PREDICTED: histone H2B.11-like                     180   2e-53   
gb|KFK34613.1|  hypothetical protein AALP_AA5G168600                    180   2e-53   
ref|XP_006400797.1|  hypothetical protein EUTSA_v10014958mg             180   2e-53   
gb|ABK25499.1|  unknown                                                 180   2e-53   
ref|XP_009419949.1|  PREDICTED: histone H2B.4                           181   2e-53   
ref|XP_010231299.1|  PREDICTED: histone H2B.11-like                     180   2e-53   
emb|CDX71019.1|  BnaC03g11030D                                          180   2e-53   
ref|XP_009126639.1|  PREDICTED: histone H2B.7-like                      180   2e-53   
ref|XP_006289049.1|  hypothetical protein CARUB_v10002441mg             180   2e-53   
ref|NP_181283.1|  histone H2B                                           180   2e-53   
gb|EMT23028.1|  Histone H2B.2                                           180   2e-53   
ref|XP_009380667.1|  PREDICTED: histone H2B.11                          180   2e-53   
gb|ADC42108.1|  H2B                                                     180   3e-53   
ref|NP_197679.1|  histone H2B                                           180   3e-53   
dbj|BAF00024.1|  histone H2B like protein                               180   3e-53   
gb|AAT39167.1|  putative histone H2B                                    179   3e-53   
emb|CAA69025.1|  histone H2B like protein                               180   3e-53   
gb|KFK27608.1|  hypothetical protein AALP_AA8G405800                    180   3e-53   
gb|ADE76279.1|  unknown                                                 180   3e-53   
ref|XP_010421087.1|  PREDICTED: histone H2B.10                          180   3e-53   
emb|CAA12230.1|  histone H2B-2                                          180   3e-53   
ref|XP_004250986.1|  PREDICTED: histone H2B.2                           180   3e-53   
ref|XP_002439923.1|  hypothetical protein SORBIDRAFT_09g022610          180   3e-53   
ref|XP_001769639.1|  histone H2B                                        179   4e-53   
gb|ABK25288.1|  unknown                                                 179   4e-53   
gb|EYU36125.1|  hypothetical protein MIMGU_mgv1a015485mg                180   5e-53   
ref|NP_001233989.1|  histone H2B.1                                      179   5e-53   
ref|XP_009131894.1|  PREDICTED: histone H2B.10-like                     179   5e-53   
ref|XP_009372489.1|  PREDICTED: histone H2B.7-like                      179   5e-53   
ref|XP_009103877.1|  PREDICTED: histone H2B.8                           179   5e-53   
gb|EMT24731.1|  Histone H2B.2                                           179   5e-53   
sp|P05621.2|H2B2_WHEAT  RecName: Full=Histone H2B.2                     179   5e-53   
gb|ABS17661.1|  histone H2B                                             177   5e-53   
gb|ABK22224.1|  unknown                                                 179   6e-53   
gb|ABK26370.1|  unknown                                                 179   6e-53   
ref|XP_010412913.1|  PREDICTED: histone H2B.4                           178   6e-53   
gb|ABK20875.1|  unknown                                                 179   6e-53   
gb|EMS53370.1|  Histone H2B.2                                           179   6e-53   
gb|EMS49652.1|  putative histone H2B.1                                  179   6e-53   
gb|AEW08190.1|  hypothetical protein 2_2676_01                          178   7e-53   
gb|ADE76146.1|  unknown                                                 179   7e-53   
gb|ABK22615.1|  unknown                                                 179   8e-53   
ref|XP_002874101.1|  hypothetical protein ARALYDRAFT_489144             179   9e-53   
gb|EMT26655.1|  Putative histone H2B.1                                  179   1e-52   
gb|AAS20969.1|  histone H2B                                             179   1e-52   
ref|XP_010505335.1|  PREDICTED: histone H2B.4-like                      178   1e-52   
ref|XP_010426025.1|  PREDICTED: histone H2B.7-like                      178   1e-52   
gb|EMS53441.1|  Histone H2B.2                                           177   1e-52   
ref|XP_010685815.1|  PREDICTED: probable histone H2B.1                  179   1e-52   
dbj|BAK06939.1|  predicted protein                                      178   1e-52   
ref|XP_006643766.1|  PREDICTED: histone H2B.5-like                      179   1e-52   
sp|Q43216.3|H2B5_WHEAT  RecName: Full=Histone H2B.5; AltName: Ful...    178   1e-52   
ref|XP_006846076.2|  PREDICTED: histone H2B                             182   2e-52   
gb|KFK24715.1|  hypothetical protein AALP_AA8G015300                    177   2e-52   
gb|KEH30112.1|  core histone H2A/H2B/H3/H4                              178   2e-52   
dbj|BAJ87396.1|  predicted protein                                      178   2e-52   
sp|P93354.3|H2B_TOBAC  RecName: Full=Histone H2B                        178   2e-52   
ref|XP_011015660.1|  PREDICTED: probable histone H2B.3                  177   2e-52   
ref|XP_006347207.1|  PREDICTED: histone H2B.1-like                      182   2e-52   
ref|XP_003568596.1|  PREDICTED: histone H2B.1-like                      178   2e-52   
ref|XP_002461154.1|  hypothetical protein SORBIDRAFT_02g041800          178   3e-52   
gb|ABK24120.1|  unknown                                                 177   3e-52   
ref|XP_006659527.1|  PREDICTED: histone H2B.2-like                      178   3e-52   
gb|EMT29883.1|  Histone H2B.2                                           177   3e-52   
gb|ABR17925.1|  unknown                                                 177   3e-52   
emb|CDM81357.1|  unnamed protein product                                177   3e-52   
ref|NP_001183565.1|  uncharacterized LOC100502158                       177   3e-52   
dbj|BAK01750.1|  predicted protein                                      177   3e-52   
ref|NP_001182987.1|  uncharacterized LOC100501306                       177   3e-52   
ref|XP_004957531.1|  PREDICTED: histone H2B.2-like                      177   3e-52   
dbj|BAK06478.1|  predicted protein                                      177   3e-52   
ref|XP_006350485.1|  PREDICTED: probable histone H2B.1-like             176   3e-52   
ref|XP_004968247.1|  PREDICTED: histone H2B.3-like                      177   3e-52   
sp|P27807.3|H2B1_WHEAT  RecName: Full=Histone H2B.1                     177   3e-52   
ref|XP_002972717.1|  hypothetical protein SELMODRAFT_18569              176   4e-52   
ref|XP_002455184.1|  hypothetical protein SORBIDRAFT_03g005720          177   4e-52   
gb|EMT09018.1|  Histone H2B.2                                           177   4e-52   
gb|EMT22578.1|  Histone H2B.2                                           177   4e-52   
gb|EMT23886.1|  Histone H2B.2                                           177   4e-52   
ref|XP_003568603.1|  PREDICTED: histone H2B.1-like                      177   4e-52   
ref|XP_002960295.1|  hypothetical protein SELMODRAFT_73644              177   4e-52   
ref|XP_002454410.1|  hypothetical protein SORBIDRAFT_04g030340          177   4e-52   
ref|XP_008225870.1|  PREDICTED: probable histone H2B.1 isoform X2       176   4e-52   
ref|XP_008670625.1|  PREDICTED: histone H2B.2-like                      177   5e-52   
gb|EMS67491.1|  Histone H2B.2                                           177   5e-52   
ref|XP_004968241.1|  PREDICTED: histone H2B.2-like                      177   5e-52   
gb|EMS52104.1|  Histone H2B.4                                           176   5e-52   
gb|ACG33311.1|  histone H2B.1                                           177   5e-52   
ref|XP_002967418.1|  hypothetical protein SELMODRAFT_87493              177   5e-52   
sp|Q9LGH8.1|H2B8_ORYSJ  RecName: Full=Histone H2B.8                     177   5e-52   
sp|A2WKT1.1|H2B6_ORYSI  RecName: Full=Histone H2B.6                     177   5e-52   
gb|EMT16626.1|  Histone H2B.2                                           177   6e-52   
ref|XP_010509330.1|  PREDICTED: histone H2B.8-like                      176   7e-52   
ref|XP_010685822.1|  PREDICTED: histone H2B isoform X2                  181   7e-52   
gb|EMT31147.1|  hypothetical protein F775_43898                         176   7e-52   
ref|XP_003564232.1|  PREDICTED: histone H2B.1-like                      177   7e-52   
ref|XP_003568875.1|  PREDICTED: histone H2B.1-like                      177   8e-52   
ref|XP_002460249.1|  hypothetical protein SORBIDRAFT_02g025410          177   8e-52   
ref|XP_002533106.1|  histone h2b, putative                              176   8e-52   
gb|EMS55286.1|  Histone H2B.2                                           176   8e-52   
ref|XP_009607114.1|  PREDICTED: histone H2B-like                        176   9e-52   
ref|XP_002458055.1|  hypothetical protein SORBIDRAFT_03g026260          176   9e-52   
ref|XP_003564576.1|  PREDICTED: histone H2B.5                           176   9e-52   
ref|XP_006663803.1|  PREDICTED: histone H2B.2-like                      176   9e-52   
emb|CDM84141.1|  unnamed protein product                                176   1e-51   
ref|XP_008225869.1|  PREDICTED: probable histone H2B.1 isoform X1       176   1e-51   
gb|EMS52598.1|  Histone H2B.2                                           176   1e-51   
dbj|BAK01633.1|  predicted protein                                      176   1e-51   
emb|CBX25346.1|  hypothetical_protein                                   176   1e-51   
ref|NP_001142082.1|  histone H2B.3                                      176   1e-51   
sp|Q43261.3|H2B3_MAIZE  RecName: Full=Histone H2B.3                     176   1e-51   
ref|XP_002503973.1|  histone H2B                                        175   1e-51   
gb|EMS53674.1|  Histone H2B.2                                           179   1e-51   
gb|EMT02988.1|  Histone H2B.2                                           176   1e-51   
ref|XP_001779336.1|  histone H2B                                        175   1e-51   
dbj|BAK06188.1|  predicted protein                                      176   1e-51   
ref|XP_010918500.1|  PREDICTED: histone H2B.2-like                      176   1e-51   
gb|EMS55473.1|  Histone H2B.2                                           176   1e-51   
ref|XP_003570350.1|  PREDICTED: histone H2B.3                           176   2e-51   
ref|XP_010228311.1|  PREDICTED: histone H2B.1-like                      176   2e-51   
dbj|BAJ94839.1|  predicted protein                                      175   2e-51   
gb|KJB83791.1|  hypothetical protein B456_013G264700                    175   2e-51   
ref|XP_010230326.1|  PREDICTED: histone H2B.3-like                      176   2e-51   
ref|XP_002501781.1|  histone H2B                                        174   2e-51   
gb|EMT14835.1|  Histone H2B.2                                           175   2e-51   
ref|XP_003558216.1|  PREDICTED: histone H2B.1-like                      175   2e-51   
ref|XP_003055512.1|  histone H2B                                        174   2e-51   
ref|XP_002455185.1|  hypothetical protein SORBIDRAFT_03g005730          175   3e-51   
gb|EMT23888.1|  Histone H2B.3                                           174   3e-51   
ref|NP_001140951.1|  histone H2B.1                                      175   3e-51   
gb|EMT07161.1|  Histone H2B.2                                           175   3e-51   
ref|NP_001042044.2|  Os01g0152300                                       175   3e-51   
sp|A2WKS3.1|H2B10_ORYSI  RecName: Full=Histone H2B.10                   175   3e-51   
ref|XP_010230038.1|  PREDICTED: histone H2B.1-like                      175   3e-51   
ref|NP_001042026.1|  Os01g0149600                                       175   4e-51   
sp|Q94JJ7.1|H2B3_ORYSJ  RecName: Full=Histone H2B.3                     175   4e-51   
sp|A2WKP3.1|H2B3_ORYSI  RecName: Full=Histone H2B.3                     175   4e-51   
emb|CEF99822.1|  Histone core                                           173   4e-51   
dbj|BAK06534.1|  predicted protein                                      174   4e-51   
dbj|BAJ97285.1|  predicted protein                                      174   4e-51   
gb|EMT26886.1|  Histone H2B.2                                           174   4e-51   



>gb|KJB83793.1| hypothetical protein B456_013G264900 [Gossypium raimondii]
Length=147

 Score =   198 bits (503),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/96 (100%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  52   RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>ref|XP_010109932.1| Histone H2B.3 [Morus notabilis]
 gb|EXC24908.1| Histone H2B.3 [Morus notabilis]
Length=146

 Score =   197 bits (501),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  51   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  110

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  111  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  146



>ref|XP_010557295.1| PREDICTED: histone H2B.11-like [Tarenaya hassleriana]
Length=150

 Score =   197 bits (501),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPT
Sbjct  55   RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPT  114

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  115  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  150



>ref|XP_006409905.1| hypothetical protein EUTSA_v10017370mg [Eutrema salsugineum]
 gb|ESQ51358.1| hypothetical protein EUTSA_v10017370mg [Eutrema salsugineum]
Length=152

 Score =   197 bits (501),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPT
Sbjct  57   RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPT  116

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  117  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  152



>ref|XP_003542467.1| PREDICTED: probable histone H2B.3 [Glycine max]
 gb|KHN48992.1| Histone H2B.4 [Glycine soja]
Length=139

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  44   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  103

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  104  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  139



>ref|XP_010092780.1| putative histone H2B.1 [Morus notabilis]
 gb|EXB52245.1| putative histone H2B.1 [Morus notabilis]
Length=148

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  53   RVKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  112

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  113  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>ref|XP_011101532.1| PREDICTED: histone H2B-like [Sesamum indicum]
Length=147

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  52   RMKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>ref|XP_002284357.1| PREDICTED: histone H2B [Vitis vinifera]
Length=146

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  51   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  110

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  111  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  146



>ref|XP_011094461.1| PREDICTED: histone H2B-like [Sesamum indicum]
Length=146

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  51   RMKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  110

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  111  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  146



>ref|XP_007016500.1| Histone superfamily protein [Theobroma cacao]
 gb|EOY34119.1| Histone superfamily protein [Theobroma cacao]
Length=148

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  53   RVKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  112

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  113  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>ref|XP_011101529.1| PREDICTED: histone H2B-like [Sesamum indicum]
Length=147

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  52   RMKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>ref|XP_010521818.1| PREDICTED: histone H2B [Tarenaya hassleriana]
Length=151

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  56   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  115

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  116  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  151



>ref|XP_011094462.1| PREDICTED: histone H2B [Sesamum indicum]
Length=147

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  52   RMKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>ref|XP_010260098.1| PREDICTED: histone H2B-like [Nelumbo nucifera]
Length=158

 Score =   196 bits (499),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  63   RTKKSSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  122

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  123  ITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS  158



>emb|CBI16181.3| unnamed protein product [Vitis vinifera]
 emb|CBI16182.3| unnamed protein product [Vitis vinifera]
Length=116

 Score =   195 bits (495),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  21   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  80

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  81   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  116



>ref|XP_012064987.1| PREDICTED: histone H2B [Jatropha curcas]
 gb|KDP44200.1| hypothetical protein JCGZ_05667 [Jatropha curcas]
Length=147

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  52   RIKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>ref|XP_010267292.1| PREDICTED: histone H2B.3-like [Nelumbo nucifera]
Length=148

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  53   RSKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  112

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  113  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>ref|XP_011101528.1| PREDICTED: histone H2B-like [Sesamum indicum]
Length=141

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  46   RIKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  105

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  106  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  141



>ref|XP_011089968.1| PREDICTED: probable histone H2B.1 [Sesamum indicum]
Length=147

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  52   RMKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>gb|EYU39674.1| hypothetical protein MIMGU_mgv1a015683mg [Erythranthe guttata]
 gb|EYU39675.1| hypothetical protein MIMGU_mgv1a015697mg [Erythranthe guttata]
Length=149

 Score =   196 bits (497),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEA+RLARYNKKPT
Sbjct  54   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAARLARYNKKPT  113

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  114  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  149



>ref|WP_039311151.1| hypothetical protein, partial [Paenibacillus sp. IHB B 3415]
 gb|KHL91135.1| hypothetical protein QW71_36400, partial [Paenibacillus sp. IHB 
B 3415]
Length=121

 Score =   194 bits (494),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/96 (99%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  26   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  85

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  86   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  121



>ref|XP_010243181.1| PREDICTED: histone H2B-like isoform X1 [Nelumbo nucifera]
 ref|XP_010243182.1| PREDICTED: histone H2B-like isoform X2 [Nelumbo nucifera]
Length=144

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS+ETYKIYIFKVLKQVHPDIG SSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  49   RTKKSSETYKIYIFKVLKQVHPDIGXSSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  108

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  109  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  144



>gb|AEC10951.1| histone H2B.2 [Camellia sinensis]
Length=138

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  43   RSKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  102

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  103  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  138



>ref|XP_012064996.1| PREDICTED: histone H2B-like [Jatropha curcas]
 gb|KDP44206.1| hypothetical protein JCGZ_05673 [Jatropha curcas]
Length=152

 Score =   196 bits (497),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  57   RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  116

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAV+LVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  117  ITSREIQTAVKLVLPGELAKHAVSEGTKAVTKFTSS  152



>emb|CDO99820.1| unnamed protein product [Coffea canephora]
Length=147

 Score =   195 bits (496),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  52   RVKKSSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>gb|AFK49087.1| unknown [Lotus japonicus]
Length=140

 Score =   195 bits (495),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  45   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  104

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  105  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  140



>ref|XP_010112903.1| putative histone H2B.1 [Morus notabilis]
 gb|EXC35052.1| putative histone H2B.1 [Morus notabilis]
Length=148

 Score =   195 bits (496),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KK TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  53   RVKKGTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  112

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  113  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>emb|CAN72813.1| hypothetical protein VITISV_016378 [Vitis vinifera]
Length=145

 Score =   195 bits (495),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKK+ ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  50   RTKKNVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  109

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  110  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  145



>ref|XP_006345846.1| PREDICTED: histone H2B-like [Solanum tuberosum]
Length=147

 Score =   195 bits (495),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  52   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>ref|NP_180440.1| histone H2B  [Arabidopsis thaliana]
 sp|Q9SI96.3|H2B3_ARATH RecName: Full=Histone H2B.3; Short=HTB3 [Arabidopsis thaliana]
 gb|AAK17143.1|AF325075_1 putative histone H2B [Arabidopsis thaliana]
 gb|AAD24363.1| putative histone H2B [Arabidopsis thaliana]
 gb|AAL14400.1| At2g28720/T11P11.3 [Arabidopsis thaliana]
 gb|AAM62619.1| putative histone H2B [Arabidopsis thaliana]
 gb|AAM70544.1| At2g28720/T11P11.3 [Arabidopsis thaliana]
 gb|AEC08163.1| histone H2B [Arabidopsis thaliana]
Length=151

 Score =   195 bits (495),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPT
Sbjct  56   RVKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPT  115

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  116  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  151



>ref|XP_004143285.1| PREDICTED: probable histone H2B.3 [Cucumis sativus]
 gb|KGN48209.1| Histone H2B [Cucumis sativus]
Length=139

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  44   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  103

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  104  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  139



>ref|XP_006384170.1| hypothetical protein POPTR_0004s09030g [Populus trichocarpa]
 ref|XP_011002796.1| PREDICTED: histone H2B [Populus euphratica]
 gb|ERP61967.1| hypothetical protein POPTR_0004s09030g [Populus trichocarpa]
Length=147

 Score =   195 bits (495),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  52   RVKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>ref|NP_001236239.1| uncharacterized protein LOC100500314 [Glycine max]
 gb|ACU15352.1| unknown [Glycine max]
 gb|KHN02417.1| Histone H2B.4 [Glycine soja]
Length=138

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  43   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  102

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  103  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  138



>gb|ADR30786.1| histone H2B1 [Hevea brasiliensis]
Length=144

 Score =   195 bits (495),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  49   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  108

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  109  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  144



>ref|NP_001235921.1| uncharacterized protein LOC100305731 [Glycine max]
 gb|ACU13572.1| unknown [Glycine max]
Length=137

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  42   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  101

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  102  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  137



>gb|KJB21583.1| hypothetical protein B456_004G003900 [Gossypium raimondii]
Length=147

 Score =   195 bits (495),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  52   RVKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>ref|XP_002879182.1| hypothetical protein ARALYDRAFT_901825 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55441.1| hypothetical protein ARALYDRAFT_901825 [Arabidopsis lyrata subsp. 
lyrata]
Length=154

 Score =   195 bits (495),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPT
Sbjct  59   RVKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPT  118

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  119  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  154



>ref|XP_007016494.1| Histone superfamily protein [Theobroma cacao]
 gb|EOY34113.1| Histone superfamily protein [Theobroma cacao]
Length=151

 Score =   195 bits (495),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  56   RSKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  115

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  116  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  151



>ref|XP_010041401.1| PREDICTED: probable histone H2B.1 [Eucalyptus grandis]
 ref|XP_010042296.1| PREDICTED: probable histone H2B.1 [Eucalyptus grandis]
Length=144

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  49   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  108

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  109  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  144



>ref|XP_007010071.1| Histone superfamily protein [Theobroma cacao]
 gb|EOY18881.1| Histone superfamily protein [Theobroma cacao]
Length=143

 Score =   194 bits (494),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  48   RAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  107

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  108  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  143



>ref|XP_003521344.1| PREDICTED: probable histone H2B.3 [Glycine max]
 gb|KHN09431.1| Histone H2B.4 [Glycine soja]
Length=138

 Score =   194 bits (494),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  43   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  102

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  103  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  138



>ref|XP_006379513.1| hypothetical protein POPTR_0008s03040g [Populus trichocarpa]
 gb|ERP57310.1| hypothetical protein POPTR_0008s03040g [Populus trichocarpa]
Length=145

 Score =   194 bits (494),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  50   RAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  109

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  110  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  145



>gb|ADR30787.1| histone H2B2 [Hevea brasiliensis]
Length=144

 Score =   194 bits (494),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  49   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  108

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  109  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  144



>gb|EPS70960.1| hypothetical protein M569_03796, partial [Genlisea aurea]
Length=156

 Score =   195 bits (495),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKK+ ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  61   RTKKAIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  120

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  121  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  156



>gb|KFK32267.1| hypothetical protein AALP_AA6G220100 [Arabis alpina]
Length=150

 Score =   195 bits (495),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPT
Sbjct  55   RVKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPT  114

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  115  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  150



>emb|CBI16180.3| unnamed protein product [Vitis vinifera]
Length=117

 Score =   194 bits (492),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  22   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  81

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  82   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  117



>ref|XP_006379009.1| hypothetical protein POPTR_0009s03310g [Populus trichocarpa]
 ref|XP_011042673.1| PREDICTED: histone H2B-like [Populus euphratica]
 ref|XP_011016060.1| PREDICTED: histone H2B-like [Populus euphratica]
 gb|ERP56806.1| hypothetical protein POPTR_0009s03310g [Populus trichocarpa]
Length=148

 Score =   194 bits (494),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  53   RVKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  112

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  113  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>ref|XP_002315380.2| hypothetical protein POPTR_0010s23730g [Populus trichocarpa]
 gb|EEF01551.2| hypothetical protein POPTR_0010s23730g [Populus trichocarpa]
Length=151

 Score =   195 bits (495),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  56   RAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  115

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  116  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  151



>ref|XP_006383343.1| histone H2B family protein [Populus trichocarpa]
 ref|XP_011021360.1| PREDICTED: histone H2B-like [Populus euphratica]
 gb|ABK96616.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP61140.1| histone H2B family protein [Populus trichocarpa]
Length=148

 Score =   194 bits (494),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  53   RVKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  112

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  113  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>ref|NP_001265978.1| uncharacterized protein LOC101502541 [Cicer arietinum]
 emb|CAB88668.1| histone H2B [Cicer arietinum]
Length=139

 Score =   194 bits (493),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  44   RVKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  103

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  104  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  139



>ref|XP_010535539.1| PREDICTED: histone H2B.11-like [Tarenaya hassleriana]
Length=144

 Score =   194 bits (494),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/94 (100%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = +1

Query  241  KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT  420
            KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT
Sbjct  51   KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT  110

Query  421  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  111  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  144



>gb|KCW44378.1| hypothetical protein EUGRSUZ_L02145 [Eucalyptus grandis]
Length=114

 Score =   193 bits (491),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  19   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  78

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  79   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  114



>ref|XP_003625510.1| Histone H2B [Medicago truncatula]
 sp|Q1SU99.3|H2B3_MEDTR RecName: Full=Probable histone H2B.3 [Medicago truncatula]
 gb|ACJ84097.1| unknown [Medicago truncatula]
 gb|AES81728.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AFK43488.1| unknown [Medicago truncatula]
Length=138

 Score =   194 bits (493),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIG+SSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  43   RTKKSVETYKIYIFKVLKQVHPDIGVSSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  102

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  103  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  138



>sp|O22582.3|H2B_GOSHI RecName: Full=Histone H2B [Gossypium hirsutum]
 gb|AAB97163.1| histone H2B1 [Gossypium hirsutum]
 gb|KJB20162.1| hypothetical protein B456_003G136000 [Gossypium raimondii]
Length=147

 Score =   194 bits (494),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  52   RVKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>ref|XP_010033153.1| PREDICTED: histone H2B [Eucalyptus grandis]
 ref|XP_010041400.1| PREDICTED: histone H2B [Eucalyptus grandis]
 gb|KCW44377.1| hypothetical protein EUGRSUZ_L02144 [Eucalyptus grandis]
Length=149

 Score =   194 bits (494),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  54   RVKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  113

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  114  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  149



>ref|XP_006488268.1| PREDICTED: probable histone H2B.1-like [Citrus sinensis]
 gb|KDO72942.1| hypothetical protein CISIN_1g032181mg [Citrus sinensis]
Length=146

 Score =   194 bits (494),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  51   RAKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  110

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  111  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  146



>ref|XP_010529850.1| PREDICTED: histone H2B.9-like [Tarenaya hassleriana]
Length=121

 Score =   193 bits (491),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  26   KAKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  85

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  86   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  121



>ref|XP_010260083.1| PREDICTED: histone H2B [Nelumbo nucifera]
Length=147

 Score =   194 bits (494),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 96/96 (100%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            +TKK++ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  52   KTKKNSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>ref|XP_006424774.1| hypothetical protein CICLE_v10029539mg [Citrus clementina]
 ref|XP_006488281.1| PREDICTED: probable histone H2B.1-like [Citrus sinensis]
 gb|ESR38014.1| hypothetical protein CICLE_v10029539mg [Citrus clementina]
 gb|KDO72929.1| hypothetical protein CISIN_1g032404mg [Citrus sinensis]
Length=141

 Score =   194 bits (493),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  46   RTKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  105

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  106  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  141



>gb|KJB55704.1| hypothetical protein B456_009G089900 [Gossypium raimondii]
Length=141

 Score =   194 bits (493),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  46   RPKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  105

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  106  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  141



>ref|XP_007027099.1| Histone superfamily protein [Theobroma cacao]
 gb|EOY07601.1| Histone superfamily protein [Theobroma cacao]
Length=139

 Score =   194 bits (492),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  44   KIKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  103

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  104  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  139



>ref|XP_003590511.1| Histone H2B [Medicago truncatula]
 ref|XP_003637465.1| Histone H2B [Medicago truncatula]
 gb|AES60762.1| histone H2A 6 [Medicago truncatula]
 gb|AFK43341.1| unknown [Medicago truncatula]
Length=136

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  41   RVKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  100

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  101  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  136



>ref|XP_003540207.1| PREDICTED: histone H2B.3 [Glycine max]
 gb|KHN27700.1| Histone H2B.3 [Glycine soja]
Length=134

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEA+RLARYNKKPT
Sbjct  39   RSKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAARLARYNKKPT  98

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  99   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  134



>ref|XP_008385152.1| PREDICTED: probable histone H2B.1 [Malus domestica]
 ref|XP_008344843.1| PREDICTED: probable histone H2B.1 [Malus domestica]
 ref|XP_008349713.1| PREDICTED: probable histone H2B.1 [Malus domestica]
 ref|XP_009358338.1| PREDICTED: probable histone H2B.1 [Pyrus x bretschneideri]
 ref|XP_009358349.1| PREDICTED: probable histone H2B.1 [Pyrus x bretschneideri]
 ref|XP_009338362.1| PREDICTED: probable histone H2B.1 [Pyrus x bretschneideri]
Length=148

 Score =   194 bits (493),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  53   RSKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  112

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  113  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>gb|KJB11257.1| hypothetical protein B456_001G250000 [Gossypium raimondii]
Length=133

 Score =   193 bits (491),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  38   KIKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  97

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  98   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  133



>ref|XP_007016059.1| Histone superfamily protein [Theobroma cacao]
 gb|EOY33678.1| Histone superfamily protein [Theobroma cacao]
Length=142

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEA+RLARYNKKPT
Sbjct  47   RAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAARLARYNKKPT  106

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  107  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  142



>gb|KCW52702.1| hypothetical protein EUGRSUZ_J02067 [Eucalyptus grandis]
Length=112

 Score =   192 bits (489),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  17   RVKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  76

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  77   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  112



>ref|XP_006379508.1| hypothetical protein POPTR_0008s02990g [Populus trichocarpa]
 gb|ABK92758.1| unknown [Populus trichocarpa]
 gb|ERP57305.1| hypothetical protein POPTR_0008s02990g [Populus trichocarpa]
Length=139

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKK+ ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  44   RTKKNVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  103

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  104  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  139



>ref|XP_007206090.1| hypothetical protein PRUPE_ppa012932mg [Prunus persica]
 ref|XP_007206096.1| hypothetical protein PRUPE_ppa012937mg [Prunus persica]
 ref|XP_007206100.1| hypothetical protein PRUPE_ppa012954mg [Prunus persica]
 ref|XP_008223048.1| PREDICTED: probable histone H2B.1 [Prunus mume]
 ref|XP_008223081.1| PREDICTED: probable histone H2B.1 [Prunus mume]
 ref|XP_008223153.1| PREDICTED: probable histone H2B.1 [Prunus mume]
 gb|EMJ07289.1| hypothetical protein PRUPE_ppa012932mg [Prunus persica]
 gb|EMJ07295.1| hypothetical protein PRUPE_ppa012937mg [Prunus persica]
 gb|EMJ07299.1| hypothetical protein PRUPE_ppa012954mg [Prunus persica]
Length=148

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  53   RSKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  112

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  113  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>ref|XP_007206110.1| hypothetical protein PRUPE_ppa013013mg [Prunus persica]
 ref|XP_008226696.1| PREDICTED: probable histone H2B.1 [Prunus mume]
 gb|EMJ07309.1| hypothetical protein PRUPE_ppa013013mg [Prunus persica]
Length=144

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  49   RSKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  108

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  109  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  144



>ref|XP_011031592.1| PREDICTED: probable histone H2B.3 [Populus euphratica]
Length=139

 Score =   193 bits (491),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKK+ ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  44   RTKKTVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  103

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  104  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  139



>sp|O65819.1|H2B3_SOLLC RecName: Full=Histone H2B.3; AltName: Full=LeH2B-3, partial [Solanum 
lycopersicum]
 emb|CAA12231.1| histone H2B-3 [Solanum lycopersicum]
Length=137

 Score =   193 bits (491),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KK+ ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  42   RSKKAVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  101

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  102  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  137



>ref|XP_003543443.1| PREDICTED: probable histone H2B.1-like [Glycine max]
 gb|KHN21479.1| Putative histone H2B.1 [Glycine soja]
Length=133

 Score =   193 bits (491),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEA+RLARYNKKPT
Sbjct  38   RSKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAARLARYNKKPT  97

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  98   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  133



>ref|XP_006349986.1| PREDICTED: probable histone H2B.1-like [Solanum tuberosum]
Length=144

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  49   RSKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  108

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  109  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  144



>ref|XP_008385143.1| PREDICTED: histone H2B-like [Malus domestica]
 ref|XP_009353717.1| PREDICTED: histone H2B-like [Pyrus x bretschneideri]
Length=141

 Score =   193 bits (491),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  46   RSKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  105

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  106  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  141



>ref|XP_010486520.1| PREDICTED: histone H2B.9-like [Camelina sativa]
Length=126

 Score =   193 bits (490),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            +TKKSTETYKIYIFKVLKQVHPDIGIS KAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  31   KTKKSTETYKIYIFKVLKQVHPDIGISGKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  90

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  91   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  126



>ref|XP_002284277.1| PREDICTED: probable histone H2B.1 [Vitis vinifera]
 emb|CAN78863.1| hypothetical protein VITISV_032908 [Vitis vinifera]
Length=152

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KK+ ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  57   RSKKNVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  116

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  117  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  152



>emb|CDY72471.1| BnaCnng77830D [Brassica napus]
Length=153

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPT
Sbjct  58   RSKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPT  117

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  118  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  153



>emb|CDP09006.1| unnamed protein product [Coffea canephora]
Length=148

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  53   KAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  112

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  113  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>ref|XP_003607010.1| Histone H2B [Medicago truncatula]
 sp|Q1S9I9.3|H2B1_MEDTR RecName: Full=Probable histone H2B.1 [Medicago truncatula]
 gb|AES89207.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AFK43335.1| unknown [Medicago truncatula]
 gb|AES89121.2| core histone H2A/H2B/H3/H4 [Medicago truncatula]
Length=148

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  53   RSKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  112

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  113  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>ref|XP_009606923.1| PREDICTED: histone H2B.2-like [Nicotiana tomentosiformis]
Length=147

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  52   RSKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>emb|CDX77199.1| BnaC04g39940D [Brassica napus]
Length=154

 Score =   194 bits (492),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPT
Sbjct  59   RSKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPT  118

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  119  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  154



>ref|XP_010553294.1| PREDICTED: probable histone H2B.3 [Tarenaya hassleriana]
Length=132

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  37   KAKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  96

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  97   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  132



>ref|XP_002873061.1| hypothetical protein ARALYDRAFT_908123 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49320.1| hypothetical protein ARALYDRAFT_908123 [Arabidopsis lyrata subsp. 
lyrata]
Length=132

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            +TKKSTETYKIYIFKVLKQVHPDIGIS KAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  37   KTKKSTETYKIYIFKVLKQVHPDIGISGKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  96

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  97   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  132



>ref|XP_004294593.1| PREDICTED: histone H2B [Fragaria vesca subsp. vesca]
Length=145

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  50   RSKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  109

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  110  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  145



>ref|XP_010464595.1| PREDICTED: histone H2B.9-like [Camelina sativa]
Length=126

 Score =   192 bits (489),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            +TKKSTETYKIYIFKVLKQVHPDIGIS KAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  31   KTKKSTETYKIYIFKVLKQVHPDIGISGKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  90

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  91   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  126



>ref|XP_009768094.1| PREDICTED: histone H2B-like [Nicotiana sylvestris]
Length=134

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  39   RSKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  98

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  99   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  134



>ref|XP_006827045.1| PREDICTED: histone H2B.11 [Amborella trichopoda]
 gb|ERM94282.1| hypothetical protein AMTR_s00010p00228620 [Amborella trichopoda]
Length=150

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  55   RSKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  114

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  115  ITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS  150



>ref|XP_010473505.1| PREDICTED: histone H2B.9-like [Camelina sativa]
Length=126

 Score =   192 bits (489),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            +TKKSTETYKIYIFKVLKQVHPDIGIS KAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  31   KTKKSTETYKIYIFKVLKQVHPDIGISGKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  90

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  91   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  126



>ref|NP_195877.1| histone H2B  [Arabidopsis thaliana]
 sp|Q9LZ45.3|H2B9_ARATH RecName: Full=Histone H2B.9; AltName: Full=HTB10 [Arabidopsis 
thaliana]
 emb|CAB85994.1| putative protein [Arabidopsis thaliana]
 gb|AED90491.1| histone H2B [Arabidopsis thaliana]
Length=132

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            +TKKSTETYKIYIFKVLKQVHPDIGIS KAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  37   KTKKSTETYKIYIFKVLKQVHPDIGISGKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  96

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  97   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  132



>ref|XP_006286660.1| hypothetical protein CARUB_v10002579mg [Capsella rubella]
 gb|EOA19558.1| hypothetical protein CARUB_v10002579mg [Capsella rubella]
Length=129

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            +TKKSTETYKIYIFKVLKQVHPDIGIS KAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  34   KTKKSTETYKIYIFKVLKQVHPDIGISGKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  93

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  94   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  129



>ref|XP_004251842.1| PREDICTED: histone H2B-like [Solanum lycopersicum]
Length=139

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  44   RSKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  103

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  104  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  139



>ref|XP_006379514.1| hypothetical protein POPTR_0008s03050g [Populus trichocarpa]
 gb|ABK94388.1| unknown [Populus trichocarpa]
 gb|ERP57311.1| hypothetical protein POPTR_0008s03050g [Populus trichocarpa]
Length=143

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  48   KAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  107

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  108  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  143



>ref|XP_009799888.1| PREDICTED: histone H2B.7-like [Nicotiana sylvestris]
Length=148

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  53   RAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  112

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  113  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>gb|AGH68506.1| histone H2B.1, partial [Ipomoea batatas]
Length=145

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  50   RVKKSSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  109

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  110  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  145



>ref|XP_009793874.1| PREDICTED: histone H2B-like [Nicotiana sylvestris]
Length=147

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  52   RAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>gb|KJB35211.1| hypothetical protein B456_006G104500 [Gossypium raimondii]
Length=141

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  46   RSKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  105

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  106  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  141



>gb|KJB35210.1| hypothetical protein B456_006G104400 [Gossypium raimondii]
Length=141

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  46   RSKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  105

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  106  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  141



>gb|KJB35212.1| hypothetical protein B456_006G104600 [Gossypium raimondii]
Length=141

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  46   RSKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  105

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  106  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  141



>ref|XP_009605776.1| PREDICTED: histone H2B-like [Nicotiana tomentosiformis]
Length=146

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  51   RVKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  110

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  111  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  146



>gb|AFK45369.1| unknown [Lotus japonicus]
Length=109

 Score =   192 bits (487),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  14   RSKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  73

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  74   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  109



>ref|XP_006846063.1| PREDICTED: histone H2B [Amborella trichopoda]
 gb|ERN07738.1| hypothetical protein AMTR_s00012p00067980 [Amborella trichopoda]
Length=148

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  53   RSKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  112

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  113  ITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>ref|XP_009591126.1| PREDICTED: histone H2B-like [Nicotiana tomentosiformis]
Length=142

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  47   RSKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  106

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  107  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  142



>ref|XP_006349988.1| PREDICTED: histone H2B-like [Solanum tuberosum]
Length=144

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  49   RSKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  108

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  109  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  144



>ref|XP_011031602.1| PREDICTED: histone H2B-like [Populus euphratica]
Length=139

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  44   KAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  103

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  104  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  139



>gb|EPS74382.1| hypothetical protein M569_00374 [Genlisea aurea]
Length=150

 Score =   193 bits (491),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  55   KAKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  114

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  115  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  150



>ref|XP_004234912.1| PREDICTED: histone H2B [Solanum lycopersicum]
Length=141

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  46   RVKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  105

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  106  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  141



>ref|XP_009774785.1| PREDICTED: histone H2B.3 [Nicotiana sylvestris]
Length=146

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  51   RAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  110

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  111  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  146



>ref|XP_010423847.1| PREDICTED: histone H2B.9-like [Camelina sativa]
Length=130

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            +TKKSTETYKIYIFKVLKQVHPDIGIS KAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  35   KTKKSTETYKIYIFKVLKQVHPDIGISGKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  94

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  95   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  130



>ref|XP_009798491.1| PREDICTED: histone H2B-like [Nicotiana sylvestris]
Length=146

 Score =   193 bits (490),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  51   RVKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  110

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  111  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  146



>gb|ABQ23584.1| putative histone [Medicago truncatula]
 gb|KEH43336.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
Length=137

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  42   RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  101

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  102  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  137



>ref|XP_009764372.1| PREDICTED: histone H2B-like [Nicotiana sylvestris]
Length=145

 Score =   193 bits (490),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  50   RAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  109

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  110  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  145



>ref|XP_009607481.1| PREDICTED: histone H2B-like [Nicotiana tomentosiformis]
Length=145

 Score =   193 bits (490),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  50   RAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  109

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  110  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  145



>gb|EPS71322.1| hypothetical protein M569_03437, partial [Genlisea aurea]
Length=148

 Score =   193 bits (490),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  53   KAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  112

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  113  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>ref|XP_009591125.1| PREDICTED: histone H2B.3 [Nicotiana tomentosiformis]
Length=146

 Score =   193 bits (490),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  51   RAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  110

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  111  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  146



>gb|AFK36036.1| unknown [Medicago truncatula]
 gb|KEH43433.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
Length=137

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  42   RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  101

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  102  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  137



>gb|KEH30941.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
Length=143

 Score =   193 bits (490),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  48   RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  107

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  108  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  143



>ref|XP_012074887.1| PREDICTED: histone H2B [Jatropha curcas]
 gb|KDP35592.1| hypothetical protein JCGZ_09030 [Jatropha curcas]
Length=139

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKS+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  44   KIKKSSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  103

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  104  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  139



>ref|XP_004294720.1| PREDICTED: histone H2B-like [Fragaria vesca subsp. vesca]
Length=145

 Score =   193 bits (490),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  50   RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  109

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  110  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  145



>ref|XP_008442575.1| PREDICTED: probable histone H2B.3 [Cucumis melo]
Length=139

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPT
Sbjct  44   KIKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPT  103

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  104  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  139



>gb|ABK96597.1| unknown [Populus trichocarpa x Populus deltoides]
Length=139

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  44   RAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  103

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  104  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  139



>ref|XP_009140934.1| PREDICTED: histone H2B.3-like [Brassica rapa]
Length=149

 Score =   193 bits (490),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPT
Sbjct  54   RSKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPT  113

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  114  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  149



>ref|XP_011461252.1| PREDICTED: histone H2B-like [Fragaria vesca subsp. vesca]
Length=145

 Score =   193 bits (490),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  50   RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  109

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  110  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  145



>ref|XP_011031597.1| PREDICTED: histone H2B-like [Populus euphratica]
Length=140

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  45   KAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  104

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  105  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  140



>ref|XP_009774786.1| PREDICTED: histone H2B-like [Nicotiana sylvestris]
Length=142

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  47   RAKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  106

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  107  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  142



>ref|XP_006364445.1| PREDICTED: histone H2B-like [Solanum tuberosum]
Length=141

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  46   RVKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  105

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  106  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  141



>ref|XP_008462509.1| PREDICTED: probable histone H2B.3 [Cucumis melo]
Length=139

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  44   RMKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  103

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  104  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  139



>ref|XP_010490718.1| PREDICTED: histone H2B.9 [Camelina sativa]
Length=131

 Score =   192 bits (488),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            +TKKSTETYKIYIFKVLKQVHPDIGIS KAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  36   KTKKSTETYKIYIFKVLKQVHPDIGISGKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  95

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  96   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  131



>gb|KJB20152.1| hypothetical protein B456_003G135400 [Gossypium raimondii]
Length=147

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  52   KAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>ref|XP_003539696.1| PREDICTED: probable histone H2B.1-like [Glycine max]
 gb|KHN32105.1| Putative histone H2B.1 [Glycine soja]
 gb|KHN32107.1| Putative histone H2B.1 [Glycine soja]
Length=149

 Score =   193 bits (490),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  54   RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  113

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  114  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  149



>ref|XP_002523734.1| histone h2b, putative [Ricinus communis]
 gb|EEF38674.1| histone h2b, putative [Ricinus communis]
Length=141

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEA+RLARYNKKPT
Sbjct  46   RAKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAARLARYNKKPT  105

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  106  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  141



>gb|KHN21978.1| Putative histone H2B.1 [Glycine soja]
Length=156

 Score =   193 bits (490),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  61   RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  120

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  121  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  156



>ref|XP_004302789.1| PREDICTED: histone H2B.9 [Fragaria vesca subsp. vesca]
Length=130

 Score =   192 bits (488),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  35   KVKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  94

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 
Sbjct  95   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSC  130



>emb|CDY15776.1| BnaC04g15480D [Brassica napus]
Length=148

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPT
Sbjct  53   RNKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPT  112

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  113  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>ref|XP_010097583.1| putative histone H2B.1 [Morus notabilis]
 ref|XP_010103707.1| putative histone H2B.1 [Morus notabilis]
 ref|XP_010111853.1| putative histone H2B.1 [Morus notabilis]
 gb|EXB69115.1| putative histone H2B.1 [Morus notabilis]
 gb|EXB96786.1| putative histone H2B.1 [Morus notabilis]
 gb|EXC31818.1| putative histone H2B.1 [Morus notabilis]
Length=148

 Score =   192 bits (489),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KK  ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  53   RVKKGIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  112

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  113  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>emb|CDY71843.1| BnaA07g37520D [Brassica napus]
Length=149

 Score =   192 bits (489),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPT
Sbjct  54   RNKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPT  113

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  114  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  149



>ref|XP_008241461.1| PREDICTED: probable histone H2B.3 [Prunus mume]
Length=134

 Score =   192 bits (488),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  39   KVKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  98

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 
Sbjct  99   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSC  134



>ref|XP_007207826.1| hypothetical protein PRUPE_ppa023550mg [Prunus persica]
 gb|EMJ09025.1| hypothetical protein PRUPE_ppa023550mg [Prunus persica]
Length=134

 Score =   192 bits (488),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  39   KVKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  98

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 
Sbjct  99   ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSC  134



>ref|XP_009374658.1| PREDICTED: histone H2B.9-like [Pyrus x bretschneideri]
Length=139

 Score =   192 bits (488),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  44   KVKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  103

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 
Sbjct  104  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSC  139



>ref|XP_008363846.1| PREDICTED: histone H2B.9-like [Malus domestica]
Length=137

 Score =   192 bits (488),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  42   KVKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  101

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 
Sbjct  102  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSC  137



>emb|CDP09015.1| unnamed protein product [Coffea canephora]
Length=153

 Score =   193 bits (490),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIF+VLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  58   RLKKSVETYKIYIFRVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  117

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  118  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  153



>ref|XP_011461273.1| PREDICTED: histone H2B-like [Fragaria vesca subsp. vesca]
Length=135

 Score =   192 bits (488),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  40   RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  99

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  100  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  135



>ref|XP_008387734.1| PREDICTED: histone H2B.9-like [Malus domestica]
 ref|XP_008350423.1| PREDICTED: histone H2B.9-like [Malus domestica]
Length=139

 Score =   192 bits (488),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  44   KVKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  103

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 
Sbjct  104  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSC  139



>ref|XP_009350089.1| PREDICTED: histone H2B.9-like [Pyrus x bretschneideri]
Length=139

 Score =   192 bits (488),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  44   KVKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  103

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 
Sbjct  104  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSC  139



>ref|XP_007132097.1| hypothetical protein PHAVU_011G066500g [Phaseolus vulgaris]
 gb|ESW04091.1| hypothetical protein PHAVU_011G066500g [Phaseolus vulgaris]
Length=147

 Score =   192 bits (489),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  52   RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>ref|XP_007132093.1| hypothetical protein PHAVU_011G066200g [Phaseolus vulgaris]
 gb|ESW04087.1| hypothetical protein PHAVU_011G066200g [Phaseolus vulgaris]
Length=147

 Score =   192 bits (489),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  52   RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>ref|NP_001237892.1| uncharacterized protein LOC100305866 [Glycine max]
 gb|ACU13758.1| unknown [Glycine max]
 gb|KHN21976.1| Putative histone H2B.1 [Glycine soja]
Length=148

 Score =   192 bits (489),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  53   RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  112

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  113  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>gb|ABM67703.1| histone 2b [Nicotiana benthamiana]
Length=147

 Score =   192 bits (489),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  52   RLKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>ref|XP_007132096.1| hypothetical protein PHAVU_011G066400g [Phaseolus vulgaris]
 gb|ESW04090.1| hypothetical protein PHAVU_011G066400g [Phaseolus vulgaris]
Length=147

 Score =   192 bits (489),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  52   RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>gb|KHN32108.1| Putative histone H2B.1 [Glycine soja]
Length=149

 Score =   192 bits (489),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  54   RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  113

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  114  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  149



>ref|XP_003538012.1| PREDICTED: probable histone H2B.1 [Glycine max]
 gb|KHN21977.1| Putative histone H2B.1 [Glycine soja]
Length=143

 Score =   192 bits (488),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  48   RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  107

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  108  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  143



>ref|XP_010541381.1| PREDICTED: histone H2B.7-like [Tarenaya hassleriana]
Length=145

 Score =   192 bits (488),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  241  KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT  420
            KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT
Sbjct  52   KKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT  111

Query  421  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  145



>ref|XP_009377099.1| PREDICTED: histone H2B.9-like [Pyrus x bretschneideri]
Length=137

 Score =   192 bits (487),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  42   KVKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  101

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS 
Sbjct  102  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSC  137



>ref|XP_010541377.1| PREDICTED: histone H2B.11-like isoform X1 [Tarenaya hassleriana]
 ref|XP_010541379.1| PREDICTED: histone H2B.11-like isoform X2 [Tarenaya hassleriana]
Length=144

 Score =   192 bits (487),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  241  KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT  420
            KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT
Sbjct  51   KKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT  110

Query  421  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  111  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  144



>ref|XP_003606631.1| Histone H2B [Medicago truncatula]
 gb|AES88828.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
Length=147

 Score =   192 bits (487),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 92/96 (96%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KK+ ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  52   RSKKNVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>ref|XP_010520307.1| PREDICTED: histone H2B.7-like [Tarenaya hassleriana]
Length=144

 Score =   191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = +1

Query  241  KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT  420
            KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT
Sbjct  51   KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT  110

Query  421  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            SREIQTAVRLVLPGEL+KHAVSEGTKAVTKFTS+
Sbjct  111  SREIQTAVRLVLPGELSKHAVSEGTKAVTKFTSA  144



>ref|XP_007144462.1| hypothetical protein PHAVU_007G158200g [Phaseolus vulgaris]
 gb|ESW16456.1| hypothetical protein PHAVU_007G158200g [Phaseolus vulgaris]
Length=138

 Score =   191 bits (485),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFIND FEKLAQEASRLARYNKKPT
Sbjct  43   RVKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDNFEKLAQEASRLARYNKKPT  102

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  103  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  138



>ref|XP_003556299.1| PREDICTED: probable histone H2B.3 [Glycine max]
 gb|KHN00944.1| Putative histone H2B.1 [Glycine soja]
Length=136

 Score =   191 bits (484),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  42   RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  101

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS  519
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS
Sbjct  102  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS  136



>ref|XP_006424763.1| hypothetical protein CICLE_v10029263mg [Citrus clementina]
 gb|ESR38003.1| hypothetical protein CICLE_v10029263mg [Citrus clementina]
Length=215

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  120  RAKKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  179

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  180  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  215



>ref|NP_200799.1| histone H2B  [Arabidopsis thaliana]
 sp|P40283.5|H2B11_ARATH RecName: Full=Histone H2B.11; AltName: Full=HTB4 [Arabidopsis 
thaliana]
 dbj|BAB08359.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL15274.1| AT5g59910/mmn10_130 [Arabidopsis thaliana]
 gb|AAV84518.1| At5g59910 [Arabidopsis thaliana]
 gb|ABF58930.1| At5g59910 [Arabidopsis thaliana]
 gb|AED97250.1| histone H2B [Arabidopsis thaliana]
Length=150

 Score =   191 bits (485),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  241  KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT  420
            KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTIT
Sbjct  57   KKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT  116

Query  421  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  117  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  150



>ref|XP_006841044.1| PREDICTED: histone H2B.3 [Amborella trichopoda]
 gb|ERN02719.1| hypothetical protein AMTR_s00085p00145460 [Amborella trichopoda]
Length=136

 Score =   190 bits (483),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/96 (96%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KK TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  41   RSKKVTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  100

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRL LPGELAKHAVSEGTKAVTKFTS 
Sbjct  101  ITSREIQTAVRLTLPGELAKHAVSEGTKAVTKFTSG  136



>ref|XP_010535544.1| PREDICTED: histone H2B.11 [Tarenaya hassleriana]
Length=150

 Score =   191 bits (484),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  241  KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT  420
            KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTIT
Sbjct  57   KKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT  116

Query  421  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  117  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  150



>ref|XP_006360516.1| PREDICTED: histone H2B.6-like [Solanum tuberosum]
Length=280

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  185  RAKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  244

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  245  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  280


 Score =   189 bits (481),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+S+LARYNKKPT
Sbjct  47   RSKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYNKKPT  106

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT  516
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT
Sbjct  107  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT  140



>ref|XP_002284332.2| PREDICTED: histone H2B-like [Vitis vinifera]
Length=289

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  194  RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  253

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  254  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  289


 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/94 (99%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  52   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  111

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT  516
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT
Sbjct  112  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT  145



>ref|XP_006281264.1| hypothetical protein CARUB_v10027310mg [Capsella rubella]
 gb|EOA14162.1| hypothetical protein CARUB_v10027310mg [Capsella rubella]
Length=150

 Score =   190 bits (483),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  241  KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT  420
            KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTIT
Sbjct  57   KKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT  116

Query  421  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  117  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  150



>ref|XP_006400898.1| hypothetical protein EUTSA_v10014927mg [Eutrema salsugineum]
 gb|ESQ42351.1| hypothetical protein EUTSA_v10014927mg [Eutrema salsugineum]
Length=150

 Score =   190 bits (483),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  241  KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT  420
            KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTIT
Sbjct  57   KKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT  116

Query  421  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  117  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  150



>ref|XP_002862747.1| hypothetical protein ARALYDRAFT_333229 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39005.1| hypothetical protein ARALYDRAFT_333229 [Arabidopsis lyrata subsp. 
lyrata]
Length=137

 Score =   189 bits (481),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  241  KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT  420
            KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTIT
Sbjct  44   KKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT  103

Query  421  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  104  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  137



>gb|KHN37876.1| Histone H2B.3 [Glycine soja]
Length=227

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/95 (98%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  132  RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  191

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS  519
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS
Sbjct  192  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS  226



>gb|AFK47985.1| unknown [Lotus japonicus]
Length=139

 Score =   189 bits (481),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 92/96 (96%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  44   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  103

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            IT REIQTAVRLV PGELAKHAVSEGTKAVTKFTSS
Sbjct  104  ITPREIQTAVRLVFPGELAKHAVSEGTKAVTKFTSS  139



>ref|XP_004250026.1| PREDICTED: histone H2B-like [Solanum lycopersicum]
Length=276

 Score =   194 bits (493),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KK+ ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  181  RSKKAVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  240

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  241  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  276


 Score =   189 bits (480),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 90/95 (95%), Positives = 94/95 (99%), Gaps = 0/95 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            ++KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+S+LARYNKKPT
Sbjct  43   KSKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYNKKPT  102

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS  519
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS
Sbjct  103  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS  137



>ref|XP_007144307.1| hypothetical protein PHAVU_007G145100g [Phaseolus vulgaris]
 gb|ESW16301.1| hypothetical protein PHAVU_007G145100g [Phaseolus vulgaris]
Length=139

 Score =   189 bits (480),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 91/93 (98%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +1

Query  244  KSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITS  423
            KS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITS
Sbjct  47   KSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITS  106

Query  424  REIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            REIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  107  REIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  139



>emb|CAA57778.1| histone 2B [Asparagus officinalis]
Length=152

 Score =   189 bits (481),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 91/93 (98%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +1

Query  244  KSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITS  423
            KS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITS
Sbjct  60   KSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITS  119

Query  424  REIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            REIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  120  REIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS  152



>gb|AAM63259.1| histone H2B-like protein [Arabidopsis thaliana]
Length=150

 Score =   189 bits (479),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  241  KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT  420
            KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNK PTIT
Sbjct  57   KKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKXPTIT  116

Query  421  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  117  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  150



>gb|KJB16909.1| hypothetical protein B456_002G253900 [Gossypium raimondii]
Length=217

 Score =   191 bits (485),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  122  KVKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  181

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  182  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  217



>ref|XP_008794946.1| PREDICTED: histone H2B.11-like [Phoenix dactylifera]
Length=154

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR
Sbjct  63   SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  122

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  123  EIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS  154



>ref|XP_004505884.1| PREDICTED: probable histone H2B.1-like [Cicer arietinum]
Length=292

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  197  RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  256

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  257  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  292


 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  54   RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  113

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT  516
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT
Sbjct  114  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT  147



>ref|XP_003538007.2| PREDICTED: probable histone H2B.1-like isoform 1 [Glycine max]
Length=290

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  195  RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  254

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  255  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  290


 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  53   RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  112

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT  516
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT
Sbjct  113  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT  146



>ref|XP_003539691.2| PREDICTED: probable histone H2B.1-like isoform 1 [Glycine max]
Length=292

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/96 (97%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  197  RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  256

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  257  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  292


 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  54   RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  113

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT  516
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT
Sbjct  114  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT  147



>ref|XP_010937687.1| PREDICTED: histone H2B-like [Elaeis guineensis]
 ref|XP_010937688.1| PREDICTED: histone H2B-like [Elaeis guineensis]
 ref|XP_010937689.1| PREDICTED: histone H2B-like [Elaeis guineensis]
Length=149

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR
Sbjct  58   SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  117

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  118  EIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS  149



>ref|XP_008795023.1| PREDICTED: histone H2B.11-like [Phoenix dactylifera]
Length=154

 Score =   188 bits (478),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR
Sbjct  63   SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  122

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  123  EIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS  154



>ref|XP_010260063.1| PREDICTED: histone H2B-like [Nelumbo nucifera]
Length=154

 Score =   188 bits (477),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/93 (97%), Positives = 93/93 (100%), Gaps = 0/93 (0%)
 Frame = +1

Query  244  KSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITS  423
            +S+ETYKIYIFKVLKQVHPDIG+SSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITS
Sbjct  62   RSSETYKIYIFKVLKQVHPDIGVSSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITS  121

Query  424  REIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            REIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  122  REIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  154



>gb|AAC05126.1| histone H2B [Malus domestica]
Length=93

 Score =   186 bits (472),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/93 (97%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +1

Query  244  KSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITS  423
            KS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITS
Sbjct  1    KSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITS  60

Query  424  REIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            REIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  61   REIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS  93



>ref|XP_009416254.1| PREDICTED: histone H2B-like [Musa acuminata subsp. malaccensis]
Length=158

 Score =   188 bits (477),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/96 (95%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KK TETYKIYIFKVLKQVHPDIGISSKAM IMNSFINDIFEKLAQEASRLARYNKKPT
Sbjct  63   KAKKGTETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEASRLARYNKKPT  122

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  123  ITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS  158



>ref|XP_008810801.1| PREDICTED: histone H2B.11-like [Phoenix dactylifera]
Length=154

 Score =   188 bits (477),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR
Sbjct  63   SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  122

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  123  EIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS  154



>emb|CDY09241.1| BnaA02g06670D [Brassica napus]
Length=142

 Score =   187 bits (476),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  241  KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT  420
            KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLA EAS+LARYNKKPTIT
Sbjct  49   KKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASKLARYNKKPTIT  108

Query  421  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  109  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  142



>gb|KFK27531.1| hypothetical protein AALP_AA8G395500 [Arabis alpina]
Length=150

 Score =   187 bits (475),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +1

Query  241  KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT  420
            KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLA EAS+LARYNKKPTIT
Sbjct  57   KKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAGEASKLARYNKKPTIT  116

Query  421  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  117  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  150



>ref|XP_010045297.1| PREDICTED: histone H2B-like [Eucalyptus grandis]
 gb|KCW87456.1| hypothetical protein EUGRSUZ_B03925 [Eucalyptus grandis]
Length=143

 Score =   187 bits (475),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/93 (97%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +1

Query  244  KSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITS  423
            +S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITS
Sbjct  51   RSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITS  110

Query  424  REIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            REIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  111  REIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  143



>ref|XP_009612958.1| PREDICTED: histone H2B-like [Nicotiana tomentosiformis]
Length=138

 Score =   187 bits (474),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTITSR
Sbjct  47   SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR  106

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  107  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  138



>ref|XP_004494001.1| PREDICTED: uncharacterized protein LOC101504461 [Cicer arietinum]
Length=338

 Score =   193 bits (491),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  44   RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  103

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  104  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  139


 Score =   193 bits (491),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 94/96 (98%), Positives = 95/96 (99%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            RTKKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  243  RTKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  302

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  303  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  338



>ref|XP_009769838.1| PREDICTED: histone H2B-like [Nicotiana sylvestris]
Length=143

 Score =   187 bits (474),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTITSR
Sbjct  52   SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR  111

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  112  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  143



>ref|XP_002534080.1| histone h2b, putative [Ricinus communis]
 gb|EEF28303.1| histone h2b, putative [Ricinus communis]
Length=135

 Score =   187 bits (474),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  44   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  103

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  104  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  135



>ref|XP_002532620.1| histone h2b, putative [Ricinus communis]
 gb|EEF29751.1| histone h2b, putative [Ricinus communis]
Length=141

 Score =   187 bits (474),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  50   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  109

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  110  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  141



>ref|XP_010937676.1| PREDICTED: histone H2B.11-like [Elaeis guineensis]
Length=154

 Score =   187 bits (475),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR
Sbjct  63   SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  122

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  123  EIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS  154



>ref|XP_008776513.1| PREDICTED: probable histone H2B.1 [Phoenix dactylifera]
Length=147

 Score =   187 bits (474),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/90 (100%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = +1

Query  253  ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREI  432
            ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREI
Sbjct  58   ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREI  117

Query  433  QTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            QTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  118  QTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>ref|XP_002532621.1| histone h2b, putative [Ricinus communis]
 gb|EEF29752.1| histone h2b, putative [Ricinus communis]
Length=141

 Score =   187 bits (474),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  50   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  109

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  110  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  141



>ref|XP_010920668.1| PREDICTED: histone H2B.11-like [Elaeis guineensis]
Length=154

 Score =   187 bits (475),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR
Sbjct  63   SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  122

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  123  EIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS  154



>ref|XP_002864658.1| hypothetical protein ARALYDRAFT_496128 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH40917.1| hypothetical protein ARALYDRAFT_496128, partial [Arabidopsis 
lyrata subsp. lyrata]
Length=145

 Score =   187 bits (474),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  241  KKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTIT  420
            KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTIT
Sbjct  54   KKSIETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTIT  113

Query  421  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFT  516
            SREIQTAVRLVLPGELAKHAVSEGTKAVTKFT
Sbjct  114  SREIQTAVRLVLPGELAKHAVSEGTKAVTKFT  145



>ref|XP_004294582.1| PREDICTED: histone H2B-like [Fragaria vesca subsp. vesca]
Length=279

 Score =   191 bits (485),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/95 (97%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  184  RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  243

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS  519
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS
Sbjct  244  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS  278


 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/95 (96%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  50   RNKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  109

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS  519
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT+
Sbjct  110  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTT  144



>ref|XP_007144308.1| hypothetical protein PHAVU_007G145200g [Phaseolus vulgaris]
 gb|ESW16302.1| hypothetical protein PHAVU_007G145200g [Phaseolus vulgaris]
Length=136

 Score =   186 bits (473),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  45   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  104

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  105  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  136



>ref|XP_010920677.1| PREDICTED: histone H2B-like [Elaeis guineensis]
Length=154

 Score =   187 bits (474),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR
Sbjct  63   SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  122

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  123  EIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS  154



>ref|XP_001762764.1| histone H2B [Physcomitrella patens]
 gb|EDQ72563.1| histone H2B [Physcomitrella patens]
Length=135

 Score =   186 bits (472),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 88/96 (92%), Positives = 94/96 (98%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            ++KKS ETYKIYI+KVLKQVHPD GISSKAMGIMNSFINDIFEKLAQEA+RLARYNKKPT
Sbjct  40   KSKKSIETYKIYIYKVLKQVHPDTGISSKAMGIMNSFINDIFEKLAQEAARLARYNKKPT  99

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRL+LPGELAKHAVSEGTKAVTKFTS+
Sbjct  100  ITSREIQTAVRLILPGELAKHAVSEGTKAVTKFTSA  135



>ref|XP_002264142.1| PREDICTED: histone H2B.3-like [Vitis vinifera]
Length=145

 Score =   186 bits (473),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            + ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR
Sbjct  54   NVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  113

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  114  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  145



>ref|NP_001275621.1| uncharacterized protein LOC102589130 [Solanum tuberosum]
 gb|ABB72812.1| histone H2B-like protein [Solanum tuberosum]
Length=146

 Score =   186 bits (472),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  55   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  114

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  115  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  146



>gb|AAT68209.1| putative histone H2B [Cynodon dactylon]
Length=98

 Score =   184 bits (468),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/96 (93%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            + KKS ETYKIYIFKVLKQVHPDIGISSKAM IMNSFINDIFEKLAQEA+RLARYNKKPT
Sbjct  3    KAKKSVETYKIYIFKVLKQVHPDIGISSKAMSIMNSFINDIFEKLAQEAARLARYNKKPT  62

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQT+VRLVLPGELAKHAVSEGTKAVTKFTS+
Sbjct  63   ITSREIQTSVRLVLPGELAKHAVSEGTKAVTKFTSN  98



>emb|CAN67222.1| hypothetical protein VITISV_029051 [Vitis vinifera]
Length=145

 Score =   186 bits (472),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            + ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR
Sbjct  54   NVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  113

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  114  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  145



>ref|XP_006429023.1| hypothetical protein CICLE_v10013909mg [Citrus clementina]
 ref|XP_006480754.1| PREDICTED: histone H2B-like [Citrus sinensis]
 gb|ESR42263.1| hypothetical protein CICLE_v10013909mg [Citrus clementina]
Length=139

 Score =   186 bits (471),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            + ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR
Sbjct  48   NVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  107

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  108  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  139



>ref|XP_009593026.1| PREDICTED: histone H2B.2 [Nicotiana tomentosiformis]
Length=141

 Score =   186 bits (472),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  50   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  109

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  110  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  141



>ref|XP_010031420.1| PREDICTED: histone H2B.7 [Eucalyptus grandis]
 gb|KCW50714.1| hypothetical protein EUGRSUZ_J00390 [Eucalyptus grandis]
Length=145

 Score =   186 bits (472),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  54   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  113

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  114  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  145



>ref|XP_009757021.1| PREDICTED: probable histone H2B.1 [Nicotiana sylvestris]
Length=148

 Score =   186 bits (472),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  57   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  116

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  117  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>ref|XP_009627380.1| PREDICTED: probable histone H2B.1 [Nicotiana tomentosiformis]
Length=148

 Score =   186 bits (472),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  57   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  116

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  117  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>ref|XP_004143093.1| PREDICTED: histone H2B [Cucumis sativus]
 gb|KGN47176.1| hypothetical protein Csa_6G193620 [Cucumis sativus]
Length=152

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+S+LARYNKKPTITSR
Sbjct  61   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYNKKPTITSR  120

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  121  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  152



>ref|XP_002316408.2| hypothetical protein POPTR_0010s23770g [Populus trichocarpa]
 gb|ABK93993.1| unknown [Populus trichocarpa]
 gb|EEF02579.2| hypothetical protein POPTR_0010s23770g [Populus trichocarpa]
Length=139

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  48   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  107

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  108  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  139



>ref|XP_008807740.1| PREDICTED: histone H2B.11-like [Phoenix dactylifera]
Length=149

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S+ETYKIYIFKVLKQVHPDIG+SSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR
Sbjct  58   SSETYKIYIFKVLKQVHPDIGVSSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  117

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  118  EIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS  149



>ref|XP_010253293.1| PREDICTED: histone H2B-like [Nelumbo nucifera]
Length=152

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            ++ETYKIYIFKVLKQVHPDIG+SSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR
Sbjct  61   NSETYKIYIFKVLKQVHPDIGVSSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  120

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  121  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  152



>ref|XP_009622927.1| PREDICTED: histone H2B.2 [Nicotiana tomentosiformis]
 ref|XP_009801703.1| PREDICTED: histone H2B.2 [Nicotiana sylvestris]
 dbj|BAF81889.1| histone H2B [Nicotiana tabacum]
Length=141

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  50   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  109

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  110  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  141



>ref|XP_004137790.1| PREDICTED: probable histone H2B.3 [Cucumis sativus]
 gb|KGN58892.1| Histone H2B [Cucumis sativus]
Length=138

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTITSR
Sbjct  47   SNETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR  106

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  107  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  138



>ref|XP_011024315.1| PREDICTED: probable histone H2B.3 [Populus euphratica]
Length=142

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  51   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  110

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  111  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  142



>gb|KJB08855.1| hypothetical protein B456_001G108300 [Gossypium raimondii]
Length=151

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  60   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  119

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  120  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  151



>gb|KFK38332.1| hypothetical protein AALP_AA3G100500 [Arabis alpina]
Length=130

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            STETYKIYIFKVLKQVHPDIGIS KAMGIMNSFINDIFEKLAQE+S+LARYNKKPTITSR
Sbjct  39   STETYKIYIFKVLKQVHPDIGISGKAMGIMNSFINDIFEKLAQESSKLARYNKKPTITSR  98

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  99   EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  130



>ref|XP_003606924.1| Histone H2B [Medicago truncatula]
Length=290

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  53   RSKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  112

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT  516
            ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT
Sbjct  113  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFT  146


 Score =   189 bits (480),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 91/96 (95%), Positives = 93/96 (97%), Gaps = 0/96 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            R+KKS ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKL QE+SRLARYNKKPT
Sbjct  195  RSKKSVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLTQESSRLARYNKKPT  254

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            ITSREIQTAVRLVLPGELAKH VSEGTKAVTKFTSS
Sbjct  255  ITSREIQTAVRLVLPGELAKHDVSEGTKAVTKFTSS  290



>gb|AFK41221.1| unknown [Lotus japonicus]
Length=105

 Score =   184 bits (468),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            + ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  14   NVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  73

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  74   EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  105



>ref|XP_009613501.1| PREDICTED: histone H2B-like [Nicotiana tomentosiformis]
Length=147

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIG+SSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  56   SVETYKIYIFKVLKQVHPDIGVSSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  115

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  116  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>ref|XP_008448382.1| PREDICTED: histone H2B [Cucumis melo]
Length=152

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+S+LARYNKKPTITSR
Sbjct  61   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYNKKPTITSR  120

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  121  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  152



>ref|XP_004496143.1| PREDICTED: probable histone H2B.3-like [Cicer arietinum]
Length=136

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/90 (99%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = +1

Query  253  ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREI  432
            ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSREI
Sbjct  47   ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREI  106

Query  433  QTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            QTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  107  QTAVRLVLPGELAKHAVSEGTKAVTKFTSS  136



>ref|XP_008788090.1| PREDICTED: histone H2B.11-like [Phoenix dactylifera]
Length=154

 Score =   186 bits (472),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/91 (98%), Positives = 91/91 (100%), Gaps = 0/91 (0%)
 Frame = +1

Query  250  TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSRE  429
            +ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSRE
Sbjct  64   SETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSRE  123

Query  430  IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            IQT+VRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  124  IQTSVRLVLPGELAKHAVSEGTKAVTKFTSS  154



>ref|XP_012090395.1| PREDICTED: histone H2B-like [Jatropha curcas]
 ref|XP_012090439.1| PREDICTED: histone H2B-like [Jatropha curcas]
 gb|KDP45066.1| hypothetical protein JCGZ_01566 [Jatropha curcas]
 gb|KDP45069.1| hypothetical protein JCGZ_01569 [Jatropha curcas]
Length=138

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  47   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  106

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  107  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  138



>ref|XP_010937686.1| PREDICTED: histone H2B [Elaeis guineensis]
Length=149

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTITSR
Sbjct  58   STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSR  117

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQT+VRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  118  EIQTSVRLVLPGELAKHAVSEGTKAVTKFTSS  149



>ref|XP_004240357.1| PREDICTED: histone H2B.7-like [Solanum lycopersicum]
 ref|XP_006361212.1| PREDICTED: histone H2B.11-like [Solanum tuberosum]
Length=147

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S+ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+S+LARYNKKPTITSR
Sbjct  56   SSETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYNKKPTITSR  115

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  116  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>ref|XP_006379515.1| hypothetical protein POPTR_0008s03060g [Populus trichocarpa]
 gb|ERP57312.1| hypothetical protein POPTR_0008s03060g [Populus trichocarpa]
Length=139

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  48   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  107

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  108  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  139



>gb|ACJ84158.1| unknown [Medicago truncatula]
 gb|AFK46561.1| unknown [Medicago truncatula]
Length=148

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            + ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  57   NVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  116

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  117  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>ref|XP_003606627.1| Histone H2B [Medicago truncatula]
 ref|XP_003606629.1| Histone H2B [Medicago truncatula]
 gb|AES88824.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AES88826.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|AFK35656.1| unknown [Medicago truncatula]
 gb|KEH30170.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
 gb|KEH30173.1| core histone H2A/H2B/H3/H4 [Medicago truncatula]
Length=148

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            + ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  57   NVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  116

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  117  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>emb|CDX95762.1| BnaC03g26430D [Brassica napus]
Length=151

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/90 (99%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = +1

Query  253  ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREI  432
            ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTITSREI
Sbjct  62   ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSREI  121

Query  433  QTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            QTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  122  QTAVRLVLPGELAKHAVSEGTKAVTKFTSS  151



>ref|XP_010248551.1| PREDICTED: histone H2B.9-like [Nelumbo nucifera]
Length=136

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/93 (95%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +1

Query  244  KSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITS  423
            +++ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITS
Sbjct  44   RASETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITS  103

Query  424  REIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            REIQTAVRL LPGELAKHAVSEGTKAVTKFTS+
Sbjct  104  REIQTAVRLTLPGELAKHAVSEGTKAVTKFTST  136



>ref|XP_006418979.1| hypothetical protein EUTSA_v10002699mg [Eutrema salsugineum]
 gb|ESQ37415.1| hypothetical protein EUTSA_v10002699mg [Eutrema salsugineum]
Length=151

 Score =   186 bits (471),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+S+LARYNKKPTITSR
Sbjct  60   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYNKKPTITSR  119

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  120  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  151



>gb|EYU32448.1| hypothetical protein MIMGU_mgv1a019785mg [Erythranthe guttata]
Length=138

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE++RLARYNKKPTITSR
Sbjct  47   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESARLARYNKKPTITSR  106

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  107  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  138



>gb|EPS65705.1| hypothetical protein M569_09073, partial [Genlisea aurea]
Length=138

 Score =   185 bits (470),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/90 (99%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = +1

Query  253  ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREI  432
            ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREI
Sbjct  49   ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREI  108

Query  433  QTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            QTAVRLVLPGELAKHAVSEGTKAVTKFTS+
Sbjct  109  QTAVRLVLPGELAKHAVSEGTKAVTKFTST  138



>ref|XP_002876219.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52478.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=97

 Score =   184 bits (466),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/95 (93%), Positives = 93/95 (98%), Gaps = 0/95 (0%)
 Frame = +1

Query  235  RTKKSTETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPT  414
            ++KK+ ETYKIYIFKVLKQVHPDIGIS KAMGIMNSFINDIFEKLAQE+SRLARYNKKPT
Sbjct  3    KSKKNIETYKIYIFKVLKQVHPDIGISGKAMGIMNSFINDIFEKLAQESSRLARYNKKPT  62

Query  415  ITSREIQTAVRLVLPGELAKHAVSEGTKAVTKFTS  519
            ITSREIQTAVRLVLPGEL+KHAVSEGTKAVTKFTS
Sbjct  63   ITSREIQTAVRLVLPGELSKHAVSEGTKAVTKFTS  97



>ref|XP_010922381.1| PREDICTED: histone H2B.11 [Elaeis guineensis]
Length=153

 Score =   186 bits (471),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/91 (98%), Positives = 91/91 (100%), Gaps = 0/91 (0%)
 Frame = +1

Query  250  TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSRE  429
            +ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSRE
Sbjct  63   SETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSRE  122

Query  430  IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            IQT+VRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  123  IQTSVRLVLPGELAKHAVSEGTKAVTKFTSS  153



>ref|XP_006418973.1| hypothetical protein EUTSA_v10002705mg [Eutrema salsugineum]
 gb|ESQ37409.1| hypothetical protein EUTSA_v10002705mg [Eutrema salsugineum]
Length=146

 Score =   185 bits (470),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+S+LARYNKKPTITSR
Sbjct  55   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYNKKPTITSR  114

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  115  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  146



>ref|XP_011077441.1| PREDICTED: histone H2B.9-like [Sesamum indicum]
Length=137

 Score =   185 bits (469),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLA E+SRLARYNKKPTITSR
Sbjct  46   STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAMESSRLARYNKKPTITSR  105

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  106  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  137



>ref|XP_008776479.1| PREDICTED: histone H2B.11-like [Phoenix dactylifera]
Length=154

 Score =   185 bits (470),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/91 (97%), Positives = 91/91 (100%), Gaps = 0/91 (0%)
 Frame = +1

Query  250  TETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSRE  429
            +ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEAS+LARYNKKPTITSRE
Sbjct  64   SETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASKLARYNKKPTITSRE  123

Query  430  IQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            IQT+VRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  124  IQTSVRLVLPGELAKHAVSEGTKAVTKFTSS  154



>ref|XP_004239714.1| PREDICTED: histone H2B.3 [Solanum lycopersicum]
Length=147

 Score =   185 bits (470),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            + ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  56   AVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  115

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  116  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  147



>emb|CDP06648.1| unnamed protein product [Coffea canephora]
Length=136

 Score =   184 bits (468),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/92 (96%), Positives = 92/92 (100%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S+ETYKIY+FKVLKQVHPDIGISSKAMGIMNSF+NDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  45   SSETYKIYLFKVLKQVHPDIGISSKAMGIMNSFVNDIFEKLAQESSRLARYNKKPTITSR  104

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  105  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  136



>ref|XP_008357680.1| PREDICTED: probable histone H2B.1 [Malus domestica]
Length=148

 Score =   185 bits (469),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/90 (99%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = +1

Query  253  ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREI  432
            ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSREI
Sbjct  59   ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREI  118

Query  433  QTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            QTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  119  QTAVRLVLPGELAKHAVSEGTKAVTKFTSS  148



>sp|O49118.3|H2B_CAPAN RecName: Full=Histone H2B; AltName: Full=CaH2B [Capsicum annuum]
 gb|AAB94923.1| histone H2B [Capsicum annuum]
Length=145

 Score =   185 bits (469),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSK+MGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  54   SIETYKIYIFKVLKQVHPDIGISSKSMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  113

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  114  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  145



>ref|XP_010455739.1| PREDICTED: histone H2B.11-like [Camelina sativa]
Length=150

 Score =   185 bits (469),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            S ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+S+LARYNKKPTITSR
Sbjct  59   SVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSKLARYNKKPTITSR  118

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  119  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  150



>gb|AFK44468.1| unknown [Lotus japonicus]
Length=136

 Score =   184 bits (468),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/90 (99%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = +1

Query  253  ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREI  432
            ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSREI
Sbjct  47   ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREI  106

Query  433  QTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            QTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  107  QTAVRLVLPGELAKHAVSEGTKAVTKFTSS  136



>gb|AFK35932.1| unknown [Lotus japonicus]
Length=142

 Score =   184 bits (468),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            + ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  51   NVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  110

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  111  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  142



>ref|XP_004251839.1| PREDICTED: histone H2B-like [Solanum lycopersicum]
Length=132

 Score =   184 bits (467),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/90 (99%), Positives = 90/90 (100%), Gaps = 0/90 (0%)
 Frame = +1

Query  253  ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSREI  432
            ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSREI
Sbjct  43   ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSREI  102

Query  433  QTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            QTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  103  QTAVRLVLPGELAKHAVSEGTKAVTKFTSS  132



>ref|XP_006428483.1| hypothetical protein CICLE_v10013076mg [Citrus clementina]
 ref|XP_006495071.1| PREDICTED: histone H2B-like [Citrus sinensis]
 gb|ESR41723.1| hypothetical protein CICLE_v10013076mg [Citrus clementina]
Length=138

 Score =   184 bits (468),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/92 (97%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +1

Query  247  STETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQEASRLARYNKKPTITSR  426
            + ETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQE+SRLARYNKKPTITSR
Sbjct  47   TVETYKIYIFKVLKQVHPDIGISSKAMGIMNSFINDIFEKLAQESSRLARYNKKPTITSR  106

Query  427  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  522
            EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS
Sbjct  107  EIQTAVRLVLPGELAKHAVSEGTKAVTKFTSS  138



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1253469667140