BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2317

Length=1140
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009767597.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    381   2e-122   Nicotiana sylvestris
ref|XP_009587639.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    379   2e-121   Nicotiana tomentosiformis
ref|XP_011101144.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    379   2e-121   Sesamum indicum [beniseed]
ref|XP_009628542.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    377   4e-121   
ref|XP_004234150.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    377   7e-121   Solanum lycopersicum
ref|XP_009628541.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    377   7e-121   Nicotiana tomentosiformis
ref|XP_006348047.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    376   1e-120   Solanum tuberosum [potatoes]
ref|XP_006357902.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    375   4e-120   Solanum tuberosum [potatoes]
gb|KHN02770.1|  DEAD-box ATP-dependent RNA helicase 7                   375   5e-120   Glycine soja [wild soybean]
ref|XP_003536498.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    375   6e-120   Glycine max [soybeans]
ref|XP_010275981.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    375   1e-119   Nelumbo nucifera [Indian lotus]
gb|KDO65345.1|  hypothetical protein CISIN_1g005470mg                   369   2e-119   Citrus sinensis [apfelsine]
ref|XP_004240751.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    374   2e-119   Solanum lycopersicum
gb|KDO65346.1|  hypothetical protein CISIN_1g005470mg                   369   5e-119   Citrus sinensis [apfelsine]
gb|KHN15708.1|  DEAD-box ATP-dependent RNA helicase 7                   372   9e-119   Glycine soja [wild soybean]
ref|XP_003556075.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    372   1e-118   Glycine max [soybeans]
gb|EPS64456.1|  hypothetical protein M569_10323                         371   2e-118   Genlisea aurea
gb|KDO65344.1|  hypothetical protein CISIN_1g005470mg                   369   2e-118   Citrus sinensis [apfelsine]
emb|CDP05280.1|  unnamed protein product                                372   2e-118   Coffea canephora [robusta coffee]
ref|XP_009781160.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    370   2e-118   Nicotiana sylvestris
ref|XP_012090373.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    369   3e-118   
gb|KDO65342.1|  hypothetical protein CISIN_1g005470mg                   368   9e-118   Citrus sinensis [apfelsine]
gb|EYU19497.1|  hypothetical protein MIMGU_mgv1a002250mg                369   9e-118   Erythranthe guttata [common monkey flower]
ref|XP_012090372.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    369   2e-117   Jatropha curcas
ref|XP_006421777.1|  hypothetical protein CICLE_v10004459mg             369   2e-117   Citrus clementina [clementine]
gb|KJB39373.1|  hypothetical protein B456_007G009400                    364   2e-117   Gossypium raimondii
ref|XP_011030003.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    368   2e-117   Populus euphratica
gb|KJB39371.1|  hypothetical protein B456_007G009400                    364   3e-117   Gossypium raimondii
ref|XP_010109082.1|  DEAD-box ATP-dependent RNA helicase 7              368   4e-117   Morus notabilis
ref|XP_002318863.2|  DEAD box RNA helicase family protein               367   5e-117   
ref|XP_002269873.2|  PREDICTED: DEAD-box ATP-dependent RNA helica...    368   5e-117   Vitis vinifera
gb|AAF40306.1|AF156667_1  RNA helicase                                  366   2e-116   Vigna radiata [mung bean]
gb|EYU25021.1|  hypothetical protein MIMGU_mgv1a027128mg                362   4e-116   Erythranthe guttata [common monkey flower]
gb|KHG06829.1|  DEAD-box ATP-dependent RNA helicase 7                   365   5e-116   Gossypium arboreum [tree cotton]
gb|KJB39369.1|  hypothetical protein B456_007G009400                    365   5e-116   Gossypium raimondii
gb|KJB39370.1|  hypothetical protein B456_007G009400                    364   6e-116   Gossypium raimondii
ref|XP_010034995.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    364   9e-116   Eucalyptus grandis [rose gum]
ref|XP_008234340.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    363   3e-115   Prunus mume [ume]
ref|XP_007220217.1|  hypothetical protein PRUPE_ppa002304mg             362   3e-115   Prunus persica
gb|KHG06828.1|  DEAD-box ATP-dependent RNA helicase 7                   363   4e-115   Gossypium arboreum [tree cotton]
ref|XP_007143335.1|  hypothetical protein PHAVU_007G063700g             362   8e-115   Phaseolus vulgaris [French bean]
ref|XP_009343503.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    361   1e-114   Pyrus x bretschneideri [bai li]
ref|XP_009349718.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    360   2e-114   Pyrus x bretschneideri [bai li]
ref|XP_008364874.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    360   3e-114   
ref|XP_008376504.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    360   3e-114   Malus domestica [apple tree]
ref|XP_010555319.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    360   4e-114   Tarenaya hassleriana [spider flower]
ref|XP_006394423.1|  hypothetical protein EUTSA_v10003756mg             359   4e-114   Eutrema salsugineum [saltwater cress]
ref|XP_002510890.1|  dead box ATP-dependent RNA helicase, putative      358   1e-113   Ricinus communis
ref|XP_004496646.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    357   1e-113   Cicer arietinum [garbanzo]
ref|XP_004496645.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    357   2e-113   
ref|XP_011076505.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    369   2e-113   
ref|XP_011041667.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    357   3e-113   Populus euphratica
ref|XP_004308148.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    355   1e-112   Fragaria vesca subsp. vesca
ref|XP_002322430.2|  DEAD box RNA helicase family protein               355   2e-112   Populus trichocarpa [western balsam poplar]
gb|KFK27951.1|  hypothetical protein AALP_AA8G452500                    355   2e-112   Arabis alpina [alpine rockcress]
ref|XP_004506292.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    355   2e-112   Cicer arietinum [garbanzo]
ref|XP_009345013.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    360   2e-112   
ref|XP_008812489.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    355   3e-112   Phoenix dactylifera
ref|XP_009407947.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    355   4e-112   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009112011.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    352   1e-111   Brassica rapa
ref|XP_009130201.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    352   1e-111   Brassica rapa
ref|XP_010934579.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    353   2e-111   Elaeis guineensis
gb|KEH26427.1|  DEAD-box ATP-dependent RNA helicase                     352   2e-111   Medicago truncatula
emb|CDX87236.1|  BnaC09g05510D                                          351   2e-111   
emb|CDY16789.1|  BnaA09g05930D                                          350   3e-111   Brassica napus [oilseed rape]
ref|XP_010940916.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    352   6e-111   Elaeis guineensis
ref|XP_009346936.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    356   7e-111   
gb|KJB52898.1|  hypothetical protein B456_008G282800                    352   8e-111   Gossypium raimondii
gb|KJB52899.1|  hypothetical protein B456_008G282800                    352   8e-111   Gossypium raimondii
ref|XP_007038495.1|  DEAD-box ATP-dependent RNA helicase 7              359   2e-110   
ref|XP_009398738.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    350   3e-110   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008467258.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    347   4e-109   Cucumis melo [Oriental melon]
ref|XP_002866477.1|  hypothetical protein ARALYDRAFT_496396             346   5e-109   Arabidopsis lyrata subsp. lyrata
ref|XP_006279587.1|  hypothetical protein CARUB_v10026032mg             342   1e-107   Capsella rubella
ref|XP_003592391.1|  DEAD-box ATP-dependent RNA helicase                341   2e-107   Medicago truncatula
ref|NP_201025.1|  DEAD/DEAH box RNA helicase PRH75                      341   3e-107   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011654884.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    341   5e-107   Cucumis sativus [cucumbers]
gb|AAK62631.1|  AT5g62190/mmi9_10                                       338   4e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003578458.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    339   4e-106   Brachypodium distachyon [annual false brome]
emb|CAA68194.1|  RNA helicase                                           337   9e-106   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006858006.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    336   1e-104   Amborella trichopoda
tpg|DAA40575.1|  TPA: putative DEAD-box ATP-dependent RNA helicas...    334   2e-104   
ref|XP_008670328.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    334   4e-104   Zea mays [maize]
gb|ACF80743.1|  unknown                                                 326   3e-103   Zea mays [maize]
ref|XP_004957391.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    332   5e-103   Setaria italica
ref|XP_002460541.1|  hypothetical protein SORBIDRAFT_02g030210          330   2e-102   Sorghum bicolor [broomcorn]
ref|XP_008652955.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    327   3e-102   Zea mays [maize]
ref|XP_010483921.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    328   3e-102   Camelina sativa [gold-of-pleasure]
gb|EAZ09787.1|  hypothetical protein OsI_32075                          328   7e-102   Oryza sativa Indica Group [Indian rice]
ref|XP_008652954.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    326   9e-102   
ref|XP_010444062.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    327   9e-102   Camelina sativa [gold-of-pleasure]
ref|XP_010458375.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    327   1e-101   Camelina sativa [gold-of-pleasure]
ref|XP_006660856.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    327   2e-101   Oryza brachyantha
ref|XP_008652953.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    327   3e-101   Zea mays [maize]
gb|EMT03655.1|  DEAD-box ATP-dependent RNA helicase 7                   326   3e-101   
gb|EAZ45398.1|  hypothetical protein OsJ_30047                          325   9e-101   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001063702.1|  Os09g0520700                                       325   1e-100   
emb|CBI24488.3|  unnamed protein product                                320   2e-100   Vitis vinifera
ref|XP_010693660.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    322   2e-99    Beta vulgaris subsp. vulgaris [field beet]
sp|Q41382.1|RH7_SPIOL  RecName: Full=DEAD-box ATP-dependent RNA h...    310   5e-95    Spinacia oleracea
gb|EMS52016.1|  DEAD-box ATP-dependent RNA helicase 7                   311   2e-93    Triticum urartu
ref|XP_001764376.1|  predicted protein                                  296   6e-90    
ref|XP_002975210.1|  hypothetical protein SELMODRAFT_150370             293   4e-89    
ref|XP_002977618.1|  hypothetical protein SELMODRAFT_107027             293   6e-89    
ref|XP_010059508.1|  PREDICTED: nucleolar RNA helicase 2-like           281   4e-85    
ref|XP_004496647.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    277   2e-83    
ref|XP_004300425.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    260   8e-80    Fragaria vesca subsp. vesca
gb|KCW45478.1|  hypothetical protein EUGRSUZ_L00808                     264   3e-79    Eucalyptus grandis [rose gum]
ref|XP_011399479.1|  DEAD-box ATP-dependent RNA helicase 7              266   7e-78    Auxenochlorella protothecoides
ref|XP_005849733.1|  hypothetical protein CHLNCDRAFT_20835              262   1e-77    Chlorella variabilis
ref|XP_005645158.1|  DEAD-domain-containing protein                     261   2e-76    Coccomyxa subellipsoidea C-169
ref|XP_001417262.1|  predicted protein                                  251   5e-73    Ostreococcus lucimarinus CCE9901
ref|XP_003078811.1|  putative RNA helicase (ISS)                        245   1e-70    Ostreococcus tauri
ref|XP_003058076.1|  predicted protein                                  246   2e-70    Micromonas pusilla CCMP1545
ref|XP_002507890.1|  predicted protein                                  241   2e-69    Micromonas commoda
ref|XP_007512398.1|  predicted protein                                  238   1e-67    Bathycoccus prasinos
ref|XP_001760070.1|  predicted protein                                  228   2e-64    
gb|KIZ06880.1|  cystathionine gamma-synthase                            221   5e-60    Monoraphidium neglectum
ref|XP_001702450.1|  RNA helicase                                       216   2e-59    Chlamydomonas reinhardtii
ref|XP_009064553.1|  hypothetical protein LOTGIDRAFT_221850             214   5e-59    Lottia gigantea
ref|XP_005854803.1|  dead deah box rna                                  214   1e-58    Nannochloropsis gaditana CCMP526
ref|XP_002112077.1|  hypothetical protein TRIADDRAFT_55752              212   1e-58    Trichoplax adhaerens
gb|EWM21167.1|  dead deah box rna                                       211   1e-57    Nannochloropsis gaditana
ref|XP_002955657.1|  hypothetical protein VOLCADRAFT_66087              210   2e-57    Volvox carteri f. nagariensis
ref|XP_008914911.1|  hypothetical protein PPTG_18629                    208   8e-57    Phytophthora parasitica INRA-310
ref|XP_002130533.1|  PREDICTED: nucleolar RNA helicase 2                207   2e-56    Ciona intestinalis [sea vase]
ref|XP_006630629.1|  PREDICTED: nucleolar RNA helicase 2-like           207   2e-56    Lepisosteus oculatus
gb|ETP29814.1|  hypothetical protein F442_21078                         206   3e-56    Phytophthora parasitica P10297
gb|ETI31844.1|  hypothetical protein F443_21248                         206   3e-56    Phytophthora parasitica P1569
ref|XP_008290699.1|  PREDICTED: nucleolar RNA helicase 2-like           206   7e-56    Stegastes partitus
ref|XP_009837773.1|  hypothetical protein H257_12310                    205   1e-55    Aphanomyces astaci
ref|XP_006023203.1|  PREDICTED: nucleolar RNA helicase 2-like           205   1e-55    
ref|XP_005815128.1|  PREDICTED: nucleolar RNA helicase 2-like           205   1e-55    Xiphophorus maculatus
ref|XP_007549868.1|  PREDICTED: nucleolar RNA helicase 2-like           205   2e-55    Poecilia formosa
ref|XP_006273547.1|  PREDICTED: nucleolar RNA helicase 2-like           203   4e-55    Alligator mississippiensis
ref|XP_001417991.1|  predicted protein                                  196   7e-55    Ostreococcus lucimarinus CCE9901
ref|XP_005733301.1|  PREDICTED: nucleolar RNA helicase 2-like           203   9e-55    Pundamilia nyererei
ref|XP_005467227.1|  PREDICTED: nucleolar RNA helicase 2-like           202   1e-54    
ref|XP_004334405.1|  DEAD/DEAH box helicase domain containing pro...    202   1e-54    Acanthamoeba castellanii str. Neff
ref|XP_005297367.1|  PREDICTED: nucleolar RNA helicase 2                203   1e-54    
ref|XP_005915179.1|  PREDICTED: nucleolar RNA helicase 2-like           202   1e-54    Haplochromis burtoni
ref|XP_004539930.1|  PREDICTED: nucleolar RNA helicase 2-like           202   1e-54    
ref|XP_006780037.1|  PREDICTED: nucleolar RNA helicase 2-like           202   2e-54    Neolamprologus brichardi [lyretail cichlid]
ref|XP_006820781.1|  PREDICTED: nucleolar RNA helicase 2-like iso...    202   2e-54    Saccoglossus kowalevskii
ref|XP_002738237.2|  PREDICTED: nucleolar RNA helicase 2-like iso...    202   2e-54    Saccoglossus kowalevskii
ref|XP_008873274.1|  hypothetical protein H310_09087                    201   2e-54    Aphanomyces invadans
ref|XP_007054740.1|  PREDICTED: nucleolar RNA helicase 2-like           201   2e-54    
ref|XP_006125341.1|  PREDICTED: nucleolar RNA helicase 2                201   2e-54    
ref|XP_009674650.1|  PREDICTED: nucleolar RNA helicase 2-like           199   3e-54    Struthio camelus australis
ref|XP_010753600.1|  PREDICTED: nucleolar RNA helicase 2-like iso...    201   4e-54    
ref|XP_010887236.1|  PREDICTED: nucleolar RNA helicase 2-like           201   4e-54    Esox lucius
ref|XP_010073942.1|  PREDICTED: nucleolar RNA helicase 2-like           198   6e-54    Pterocles gutturalis
gb|ACH85363.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 21               199   7e-54    Salmo salar
dbj|BAE87690.1|  unnamed protein product                                193   8e-54    Macaca fascicularis [crab eating macaque]
emb|CDQ75565.1|  unnamed protein product                                199   1e-53    Oncorhynchus mykiss
ref|XP_009703721.1|  PREDICTED: nucleolar RNA helicase 2-like           196   2e-53    Cariama cristata
ref|XP_010197456.1|  PREDICTED: nucleolar RNA helicase 2-like           192   2e-53    Colius striatus
emb|CDS09503.1|  hypothetical protein LRAMOSA10863                      198   2e-53    Lichtheimia ramosa
ref|XP_006889064.1|  PREDICTED: nucleolar RNA helicase 2                199   3e-53    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_010938270.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    190   3e-53    Elaeis guineensis
ref|XP_005429044.1|  PREDICTED: nucleolar RNA helicase 2-like           196   4e-53    Geospiza fortis
ref|XP_009990339.1|  PREDICTED: nucleolar RNA helicase 2-like           196   5e-53    Tauraco erythrolophus
ref|XP_005990005.1|  PREDICTED: nucleolar RNA helicase 2                196   5e-53    Latimeria chalumnae
gb|EMP40574.1|  Nucleolar RNA helicase 2                                201   5e-53    Chelonia mydas [green seaturtle]
ref|XP_004067286.1|  PREDICTED: nucleolar RNA helicase 2-like iso...    198   5e-53    
ref|XP_011490446.1|  PREDICTED: nucleolar RNA helicase 2-like iso...    197   5e-53    
ref|XP_003976441.2|  PREDICTED: nucleolar RNA helicase 2-like iso...    197   7e-53    
ref|XP_011615621.1|  PREDICTED: nucleolar RNA helicase 2-like iso...    197   7e-53    
ref|XP_009993187.1|  PREDICTED: nucleolar RNA helicase 2-like           197   8e-53    Chaetura pelagica
ref|XP_008943828.1|  PREDICTED: nucleolar RNA helicase 2-like           196   9e-53    Merops nubicus
emb|CBK20101.2|  unnamed protein product                                195   9e-53    Blastocystis hominis
ref|XP_009094282.1|  PREDICTED: nucleolar RNA helicase 2-like           197   9e-53    
ref|XP_009892318.1|  PREDICTED: nucleolar RNA helicase 2-like           196   1e-52    Charadrius vociferus
ref|XP_008756606.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar RN...    197   1e-52    Rattus norvegicus [brown rat]
ref|NP_001120807.1|  nucleolar RNA helicase 2                           197   1e-52    
ref|XP_010158185.1|  PREDICTED: nucleolar RNA helicase 2-like           195   1e-52    Eurypyga helias
ref|XP_010132216.1|  PREDICTED: nucleolar RNA helicase 2-like           195   1e-52    Buceros rhinoceros silvestris
ref|XP_011782358.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2     196   2e-52    Colobus angolensis palliatus
emb|CDH59679.1|  nucleolar rna helicase 2-like                          196   2e-52    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_002502509.1|  DEAD/DEAH box RNA helicase                         196   2e-52    Micromonas commoda
emb|CEP17128.1|  hypothetical protein                                   196   2e-52    Parasitella parasitica
ref|XP_010153144.1|  PREDICTED: nucleolar RNA helicase 2-like           194   2e-52    Eurypyga helias
ref|XP_010164383.1|  PREDICTED: nucleolar RNA helicase 2-like           195   2e-52    
ref|XP_010295282.1|  PREDICTED: nucleolar RNA helicase 2-like           196   2e-52    Phaethon lepturus
ref|XP_008924427.1|  PREDICTED: nucleolar RNA helicase 2-like           196   2e-52    
ref|XP_011782350.1|  PREDICTED: nucleolar RNA helicase 2 isoform X1     196   2e-52    Colobus angolensis palliatus
ref|XP_005491116.1|  PREDICTED: nucleolar RNA helicase 2-like           196   2e-52    
ref|XP_009581978.1|  PREDICTED: nucleolar RNA helicase 2-like           194   2e-52    Fulmarus glacialis
ref|XP_008611506.1|  hypothetical protein SDRG_07451                    195   2e-52    Saprolegnia diclina VS20
ref|XP_002913778.1|  PREDICTED: nucleolar RNA helicase 2                196   3e-52    Ailuropoda melanoleuca
gb|EFB22545.1|  hypothetical protein PANDA_001614                       196   3e-52    Ailuropoda melanoleuca
ref|XP_009814524.1|  PREDICTED: nucleolar RNA helicase 2-like           194   3e-52    Gavia stellata
ref|XP_004386445.1|  PREDICTED: nucleolar RNA helicase 2                196   3e-52    Trichechus manatus latirostris
ref|XP_005326022.1|  PREDICTED: nucleolar RNA helicase 2                196   3e-52    Ictidomys tridecemlineatus
ref|XP_008308798.1|  PREDICTED: nucleolar RNA helicase 2                196   3e-52    Cynoglossus semilaevis [half-smooth tongue sole]
gb|KDO19871.1|  hypothetical protein SPRG_14901                         194   3e-52    Saprolegnia parasitica CBS 223.65
ref|XP_005360167.1|  PREDICTED: nucleolar RNA helicase 2                196   4e-52    Microtus ochrogaster [prairie voles]
gb|EDL92966.1|  rCG22008, isoform CRA_c                                 194   4e-52    Rattus norvegicus [brown rat]
ref|XP_006972790.1|  PREDICTED: nucleolar RNA helicase 2                195   4e-52    Peromyscus maniculatus bairdii
ref|NP_001032278.1|  nucleolar RNA helicase 2                           195   4e-52    Rattus norvegicus [brown rat]
dbj|BAE26522.1|  unnamed protein product                                196   4e-52    Mus musculus [mouse]
ref|XP_009505570.1|  PREDICTED: nucleolar RNA helicase 2-like           193   4e-52    Phalacrocorax carbo [common cormorant]
gb|AAF61690.1|AF220365_1  nucleolar RNA helicase II/Gu                  195   5e-52    Mus musculus [mouse]
dbj|BAB26817.2|  unnamed protein product                                195   5e-52    Mus musculus [mouse]
ref|XP_005154050.1|  PREDICTED: nucleolar RNA helicase 2-like           194   5e-52    Melopsittacus undulatus
ref|XP_008641093.1|  PREDICTED: nucleolar RNA helicase 2-like           194   6e-52    
gb|AAD43959.3|AF159131_1  nucleolar RNA helicase II/Gu                  195   6e-52    Mus musculus [mouse]
ref|XP_009563565.1|  PREDICTED: nucleolar RNA helicase 2-like           194   6e-52    Cuculus canorus
gb|AAH59237.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 21               195   6e-52    Mus musculus [mouse]
ref|XP_009288813.1|  PREDICTED: nucleolar RNA helicase 2-like           194   6e-52    
gb|AAH30895.1|  Ddx21 protein                                           194   6e-52    Mus musculus [mouse]
ref|XP_005070877.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2     195   6e-52    
ref|XP_002904811.1|  DEAD/DEAH box RNA helicase, putative               194   6e-52    Phytophthora infestans T30-4
ref|XP_005070876.1|  PREDICTED: nucleolar RNA helicase 2 isoform X1     195   6e-52    
ref|NP_062426.2|  nucleolar RNA helicase 2                              195   6e-52    Mus musculus [mouse]
emb|CEG79803.1|  hypothetical protein RMATCC62417_14224                 191   7e-52    Rhizopus microsporus
gb|KFH66922.1|  hypothetical protein MVEG_07447                         194   7e-52    Mortierella verticillata NRRL 6337
ref|XP_002820927.1|  PREDICTED: nucleolar RNA helicase 2                195   7e-52    Pongo abelii [orang utan]
ref|XP_010399213.1|  PREDICTED: nucleolar RNA helicase 2-like           194   7e-52    
ref|XP_009487807.1|  PREDICTED: nucleolar RNA helicase 2-like           192   7e-52    Pelecanus crispus
ref|XP_009892319.1|  PREDICTED: nucleolar RNA helicase 2-like           194   8e-52    Charadrius vociferus
ref|XP_001110939.1|  PREDICTED: nucleolar RNA helicase 2-like iso...    194   8e-52    
ref|XP_003409350.1|  PREDICTED: nucleolar RNA helicase 2                194   9e-52    Loxodonta africana [African bush elephant]
ref|XP_421574.3|  PREDICTED: nucleolar RNA helicase 2-like              194   9e-52    
gb|EHH64804.1|  hypothetical protein EGM_18115                          194   9e-52    Macaca fascicularis [crab eating macaque]
ref|XP_011846565.1|  PREDICTED: nucleolar RNA helicase 2                194   9e-52    Mandrillus leucophaeus
emb|CDY46329.1|  BnaC01g31630D                                          192   9e-52    Brassica napus [oilseed rape]
ref|XP_004583494.1|  PREDICTED: nucleolar RNA helicase 2                194   9e-52    Ochotona princeps [southern American pika]
ref|XP_009993186.1|  PREDICTED: nucleolar RNA helicase 2-like           190   9e-52    Chaetura pelagica
gb|ETE62473.1|  Nucleolar RNA helicase 2                                197   1e-51    Ophiophagus hannah
ref|XP_011666060.1|  PREDICTED: nucleolar RNA helicase 2                194   1e-51    Strongylocentrotus purpuratus [purple urchin]
ref|XP_005530565.1|  PREDICTED: nucleolar RNA helicase 2-like           194   1e-51    Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_009499705.1|  PREDICTED: nucleolar RNA helicase 2-like           194   1e-51    Phalacrocorax carbo [common cormorant]
ref|XP_011713343.1|  PREDICTED: nucleolar RNA helicase 2                194   1e-51    Macaca nemestrina [pigtail macaque]
ref|XP_008830862.1|  PREDICTED: nucleolar RNA helicase 2                194   1e-51    Nannospalax galili
ref|XP_005565735.1|  PREDICTED: nucleolar RNA helicase 2                194   1e-51    Macaca fascicularis [crab eating macaque]
gb|ERE87186.1|  nucleolar RNA helicase 2-like protein                   193   1e-51    Cricetulus griseus [Chinese hamsters]
ref|XP_003903905.1|  PREDICTED: nucleolar RNA helicase 2                194   1e-51    Papio anubis [baboon]
ref|XP_011586207.1|  PREDICTED: nucleolar RNA helicase 2-like           194   1e-51    Aquila chrysaetos canadensis
ref|XP_002718616.1|  PREDICTED: nucleolar RNA helicase 2                194   1e-51    Oryctolagus cuniculus [domestic rabbit]
ref|XP_008576695.1|  PREDICTED: nucleolar RNA helicase 2                194   1e-51    Galeopterus variegatus [Malayan flying lemur]
ref|XP_010578315.1|  PREDICTED: nucleolar RNA helicase 2-like           194   1e-51    Haliaeetus leucocephalus
ref|XP_003258244.1|  PREDICTED: nucleolar RNA helicase 2 isoform 2      194   1e-51    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_005429045.1|  PREDICTED: nucleolar RNA helicase 2-like           193   1e-51    
ref|XP_009324263.1|  PREDICTED: nucleolar RNA helicase 2-like           194   1e-51    Pygoscelis adeliae
ref|XP_005838835.1|  hypothetical protein GUITHDRAFT_102470             192   1e-51    Guillardia theta CCMP2712
ref|XP_007961426.1|  PREDICTED: nucleolar RNA helicase 2                194   1e-51    Chlorocebus sabaeus
ref|XP_009962090.1|  PREDICTED: nucleolar RNA helicase 2-like           192   1e-51    Tyto alba [Schleiereule]
emb|CEF97957.1|  Helicase, C-terminal                                   194   1e-51    Ostreococcus tauri
ref|XP_006835901.1|  PREDICTED: nucleolar RNA helicase 2                194   1e-51    Chrysochloris asiatica
ref|XP_006676381.1|  hypothetical protein BATDEDRAFT_84954              194   1e-51    Batrachochytrium dendrobatidis JAM81
ref|XP_003258243.1|  PREDICTED: nucleolar RNA helicase 2 isoform 1      194   2e-51    Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_008641092.1|  PREDICTED: nucleolar RNA helicase 2-like           193   2e-51    Corvus brachyrhynchos
ref|XP_003079318.1|  ATP-dependent RNA helicase (ISS)                   193   2e-51    
ref|XP_010361113.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2     194   2e-51    Rhinopithecus roxellana
ref|XP_009695874.1|  PREDICTED: nucleolar RNA helicase 2-like           193   2e-51    Cariama cristata
ref|XP_009949129.1|  PREDICTED: nucleolar RNA helicase 2-like           193   2e-51    Leptosomus discolor
ref|XP_011586143.1|  PREDICTED: nucleolar RNA helicase 2-like           193   2e-51    Aquila chrysaetos canadensis
gb|EPQ14283.1|  Nucleolar RNA helicase 2                                193   2e-51    Myotis brandtii
ref|XP_006406182.1|  hypothetical protein EUTSA_v10020290mg             192   2e-51    Eutrema salsugineum [saltwater cress]
ref|XP_008143728.1|  PREDICTED: nucleolar RNA helicase 2                194   2e-51    
ref|XP_010361112.1|  PREDICTED: nucleolar RNA helicase 2 isoform X1     194   2e-51    Rhinopithecus roxellana
ref|XP_005491115.1|  PREDICTED: nucleolar RNA helicase 2-like           193   2e-51    
ref|XP_010011653.1|  PREDICTED: nucleolar RNA helicase 2-like           193   2e-51    Nestor notabilis
ref|XP_007938866.1|  PREDICTED: nucleolar RNA helicase 2                193   2e-51    Orycteropus afer afer
ref|XP_004470594.1|  PREDICTED: nucleolar RNA helicase 2                192   2e-51    
ref|XP_009094281.1|  PREDICTED: nucleolar RNA helicase 2-like           193   2e-51    
ref|XP_009068016.1|  PREDICTED: nucleolar RNA helicase 2-like           191   2e-51    Acanthisitta chloris
ref|XP_002190981.2|  PREDICTED: nucleolar RNA helicase 2-like           193   2e-51    
ref|XP_008771332.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar RN...    193   2e-51    
ref|XP_006148996.1|  PREDICTED: nucleolar RNA helicase 2                193   2e-51    Tupaia chinensis
gb|EOB09008.1|  Nucleolar RNA helicase 2                                191   2e-51    Anas platyrhynchos [duck]
ref|XP_009865080.1|  PREDICTED: nucleolar RNA helicase 2-like           191   2e-51    Apaloderma vittatum
ref|XP_006297190.1|  hypothetical protein CARUB_v10013195mg             192   3e-51    Capsella rubella
ref|XP_005153742.1|  PREDICTED: nucleolar RNA helicase 2-like           192   3e-51    Melopsittacus undulatus
ref|XP_001917975.1|  PREDICTED: nucleolar RNA helicase 2                193   3e-51    Equus caballus [domestic horse]
ref|XP_007638831.1|  PREDICTED: nucleolar RNA helicase 2                193   3e-51    Cricetulus griseus [Chinese hamsters]
ref|XP_009082858.1|  PREDICTED: nucleolar RNA helicase 2-like           192   3e-51    Acanthisitta chloris
ref|XP_008495911.1|  PREDICTED: nucleolar RNA helicase 2-like           192   3e-51    Calypte anna
ref|XP_005048018.1|  PREDICTED: nucleolar RNA helicase 2-like           193   3e-51    
ref|XP_006105393.1|  PREDICTED: nucleolar RNA helicase 2 isoform X1     193   3e-51    
ref|XP_010578253.1|  PREDICTED: nucleolar RNA helicase 2-like iso...    192   3e-51    
ref|XP_010578254.1|  PREDICTED: nucleolar RNA helicase 2-like iso...    192   3e-51    
gb|EGV93789.1|  Nucleolar RNA helicase 2                                192   3e-51    
ref|XP_005876873.1|  PREDICTED: nucleolar RNA helicase 2 isoform X1     193   3e-51    
ref|XP_009324264.1|  PREDICTED: nucleolar RNA helicase 2-like           192   3e-51    
ref|XP_009987183.1|  PREDICTED: nucleolar RNA helicase 2-like           192   3e-51    
ref|NP_188872.2|  putative mitochondrial RNA helicase 2                 191   3e-51    
ref|XP_008694185.1|  PREDICTED: nucleolar RNA helicase 2                193   4e-51    
emb|CDP16079.1|  unnamed protein product                                192   4e-51    
ref|XP_010323935.1|  PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP...    191   4e-51    
ref|XP_005876874.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2     192   4e-51    
ref|XP_006105394.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2     192   4e-51    
dbj|GAN03042.1|  nucleolar RNA helicase 2-like isoform X2               192   4e-51    
ref|XP_004701442.1|  PREDICTED: nucleolar RNA helicase 2                192   4e-51    
ref|XP_006760985.1|  PREDICTED: nucleolar RNA helicase 2                192   4e-51    
ref|XP_010297376.1|  PREDICTED: nucleolar RNA helicase 2-like           190   4e-51    
ref|XP_011940649.1|  PREDICTED: nucleolar RNA helicase 2                192   4e-51    
ref|XP_010198067.1|  PREDICTED: nucleolar RNA helicase 2-like           192   4e-51    
ref|XP_009913610.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar RN...    192   4e-51    
ref|XP_010113956.1|  PREDICTED: nucleolar RNA helicase 2-like           192   5e-51    
ref|XP_002883355.1|  hypothetical protein ARALYDRAFT_479746             191   5e-51    
ref|XP_004617168.1|  PREDICTED: nucleolar RNA helicase 2                192   5e-51    
ref|XP_007253243.1|  PREDICTED: nucleolar RNA helicase 2-like iso...    192   5e-51    
ref|XP_007253242.1|  PREDICTED: nucleolar RNA helicase 2-like iso...    192   5e-51    
ref|XP_009520796.1|  hypothetical protein PHYSODRAFT_326516             194   5e-51    
ref|XP_010133283.1|  PREDICTED: nucleolar RNA helicase 2-like           192   5e-51    
ref|XP_010051259.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    179   5e-51    
ref|XP_004427105.1|  PREDICTED: nucleolar RNA helicase 2                192   5e-51    
ref|XP_005530587.1|  PREDICTED: nucleolar RNA helicase 2-like           192   5e-51    
ref|XP_009635263.1|  PREDICTED: nucleolar RNA helicase 2-like           191   6e-51    
ref|XP_001232052.1|  PREDICTED: nucleolar RNA helicase 2                192   6e-51    
ref|XP_009464338.1|  PREDICTED: nucleolar RNA helicase 2-like           192   6e-51    
ref|XP_005713628.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 21-li...    192   6e-51    
gb|EIE87311.1|  hypothetical protein RO3G_12022                         191   6e-51    
ref|XP_005005365.1|  PREDICTED: nucleolar RNA helicase 2                192   6e-51    
gb|EPB89647.1|  hypothetical protein HMPREF1544_03579                   192   6e-51    
ref|XP_005235246.1|  PREDICTED: nucleolar RNA helicase 2-like           191   6e-51    
ref|XP_010399212.1|  PREDICTED: nucleolar RNA helicase 2-like           191   6e-51    
ref|XP_010126598.1|  PREDICTED: nucleolar RNA helicase 2-like           190   6e-51    
gb|KFK39521.1|  hypothetical protein AALP_AA3G255300                    191   7e-51    
ref|XP_004769606.1|  PREDICTED: nucleolar RNA helicase 2 isoform X1     192   7e-51    
ref|XP_009806451.1|  PREDICTED: nucleolar RNA helicase 2-like           191   7e-51    
ref|XP_010168437.1|  PREDICTED: nucleolar RNA helicase 2-like           191   7e-51    
ref|XP_005433605.1|  PREDICTED: nucleolar RNA helicase 2-like           191   7e-51    
ref|XP_005235247.1|  PREDICTED: nucleolar RNA helicase 2-like           191   7e-51    
ref|XP_004344972.1|  nucleolar RNA helicase 2                           192   8e-51    
ref|XP_010293567.1|  PREDICTED: nucleolar RNA helicase 2-like           191   8e-51    
ref|XP_011538638.1|  PREDICTED: nucleolar RNA helicase 2 isoform X1     191   8e-51    
ref|XP_002610327.1|  hypothetical protein BRAFLDRAFT_144535             191   8e-51    
ref|XP_011449590.1|  PREDICTED: nucleolar RNA helicase 2-like           191   8e-51    
ref|XP_004769607.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2     192   8e-51    
ref|XP_002191015.1|  PREDICTED: nucleolar RNA helicase 2-like           190   8e-51    
ref|XP_005433606.1|  PREDICTED: nucleolar RNA helicase 2-like           191   9e-51    
ref|XP_007121104.1|  PREDICTED: nucleolar RNA helicase 2                192   9e-51    
ref|XP_004888573.1|  PREDICTED: nucleolar RNA helicase 2                191   9e-51    
ref|XP_007167837.1|  PREDICTED: nucleolar RNA helicase 2                191   9e-51    
ref|XP_004049558.1|  PREDICTED: nucleolar RNA helicase 2 isoform 2      191   9e-51    
ref|NP_001243839.1|  nucleolar RNA helicase 2 isoform 2                 191   9e-51    
ref|XP_009108947.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    190   9e-51    
ref|XP_009456870.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2     191   1e-50    
ref|XP_003815960.1|  PREDICTED: nucleolar RNA helicase 2                191   1e-50    
ref|XP_507825.2|  PREDICTED: nucleolar RNA helicase 2 isoform X1        191   1e-50    
ref|XP_004049557.1|  PREDICTED: nucleolar RNA helicase 2 isoform 1      191   1e-50    
ref|XP_009967651.1|  PREDICTED: nucleolar RNA helicase 2-like           191   1e-50    
ref|NP_004719.2|  nucleolar RNA helicase 2 isoform 1                    191   1e-50    
ref|XP_011370452.1|  PREDICTED: nucleolar RNA helicase 2                191   1e-50    
ref|XP_009591168.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    190   1e-50    
ref|XP_009464337.1|  PREDICTED: nucleolar RNA helicase 2-like           191   1e-50    
ref|XP_008495910.1|  PREDICTED: nucleolar RNA helicase 2-like           191   1e-50    
ref|XP_010488258.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    190   1e-50    
ref|XP_009288852.1|  PREDICTED: nucleolar RNA helicase 2-like           191   1e-50    
gb|ELR47909.1|  Nucleolar RNA helicase 2                                191   1e-50    
ref|XP_009955676.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar RN...    191   1e-50    
gb|AAB02546.1|  Gu protein                                              191   1e-50    
ref|XP_006915628.1|  PREDICTED: nucleolar RNA helicase 2                191   1e-50    
ref|XP_010488257.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    190   1e-50    
gb|ELW65741.1|  Nucleolar RNA helicase 2                                194   1e-50    
ref|XP_010074102.1|  PREDICTED: nucleolar RNA helicase 2-like           191   1e-50    
ref|XP_005009180.1|  PREDICTED: nucleolar RNA helicase 2                191   1e-50    
ref|XP_009575208.1|  PREDICTED: nucleolar RNA helicase 2-like           190   1e-50    
ref|XP_010511251.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    190   1e-50    
ref|XP_005390157.1|  PREDICTED: nucleolar RNA helicase 2 isoform X1     191   1e-50    
ref|XP_007505939.1|  PREDICTED: nucleolar RNA helicase 2                191   2e-50    
ref|XP_010712814.1|  PREDICTED: nucleolar RNA helicase 2                190   2e-50    
ref|XP_006212998.1|  PREDICTED: nucleolar RNA helicase 2                191   2e-50    
ref|XP_010302670.1|  PREDICTED: nucleolar RNA helicase 2-like           190   2e-50    
ref|XP_008071284.1|  PREDICTED: nucleolar RNA helicase 2                191   2e-50    
ref|XP_004624414.1|  PREDICTED: nucleolar RNA helicase 2                191   2e-50    
ref|XP_005390158.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2     191   2e-50    
ref|XP_005907396.1|  PREDICTED: nucleolar RNA helicase 2                190   2e-50    
ref|XP_010712591.1|  PREDICTED: nucleolar RNA helicase 2-like           190   2e-50    
ref|XP_006297246.1|  hypothetical protein CARUB_v10013251mg             189   2e-50    
ref|XP_005048019.1|  PREDICTED: nucleolar RNA helicase 2-like           190   2e-50    
ref|XP_009771005.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    189   2e-50    
emb|CDY10634.1|  BnaA05g17280D                                          189   2e-50    
ref|XP_010984125.1|  PREDICTED: nucleolar RNA helicase 2                191   2e-50    
ref|XP_006181277.1|  PREDICTED: nucleolar RNA helicase 2                190   2e-50    
ref|XP_009635265.1|  PREDICTED: nucleolar RNA helicase 2-like           190   2e-50    
ref|XP_004680883.1|  PREDICTED: nucleolar RNA helicase 2                190   2e-50    
ref|XP_010850502.1|  PREDICTED: nucleolar RNA helicase 2                190   2e-50    
ref|XP_010511255.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    189   2e-50    
ref|NP_001076996.1|  nucleolar RNA helicase 2                           190   2e-50    
emb|CEI86541.1|  hypothetical protein RMCBS344292_00980                 190   2e-50    
ref|XP_003755081.1|  PREDICTED: nucleolar RNA helicase 2                190   2e-50    
ref|XP_009145390.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    189   2e-50    
ref|NP_001263383.1|  nucleolar RNA helicase 2                           190   3e-50    
ref|XP_005978742.1|  PREDICTED: nucleolar RNA helicase 2                190   3e-50    
ref|XP_005535707.1|  nucleolar RNA helicase II/Gu                       190   3e-50    
ref|XP_006060385.1|  PREDICTED: nucleolar RNA helicase 2                190   3e-50    
ref|XP_005699183.1|  PREDICTED: nucleolar RNA helicase 2                190   3e-50    
ref|XP_009942747.1|  PREDICTED: nucleolar RNA helicase 2-like           188   3e-50    
gb|AAF78930.2|AAF78930  RNA helicase II/Gu protein                      189   3e-50    
ref|XP_007423216.1|  PREDICTED: nucleolar RNA helicase 2                189   4e-50    
ref|XP_007454639.1|  PREDICTED: nucleolar RNA helicase 2                190   4e-50    
ref|XP_009863017.1|  PREDICTED: nucleolar RNA helicase 2-like           189   4e-50    
ref|XP_009905459.1|  PREDICTED: nucleolar RNA helicase 2-like           189   4e-50    
ref|XP_010466510.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    188   4e-50    
ref|XP_006728966.1|  PREDICTED: nucleolar RNA helicase 2 isoform X2     189   4e-50    
emb|CEG65973.1|  hypothetical protein RMATCC62417_02639                 189   4e-50    
ref|XP_004326963.1|  PREDICTED: nucleolar RNA helicase 2                189   5e-50    
gb|KFK39522.1|  hypothetical protein AALP_AA3G255500                    188   5e-50    
ref|XP_010604184.1|  PREDICTED: nucleolar RNA helicase 2                189   5e-50    
ref|XP_005657444.1|  PREDICTED: nucleolar RNA helicase 2                189   5e-50    
ref|XP_009905419.1|  PREDICTED: nucleolar RNA helicase 2-like           189   5e-50    
ref|XP_004280850.1|  PREDICTED: nucleolar RNA helicase 2                189   5e-50    
ref|XP_010466515.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    188   5e-50    
ref|XP_010466514.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    188   6e-50    
ref|XP_006728965.1|  PREDICTED: nucleolar RNA helicase 2 isoform X1     189   6e-50    
ref|XP_010488255.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    188   6e-50    
ref|XP_007054739.1|  PREDICTED: nucleolar RNA helicase 2-like           189   6e-50    
ref|XP_010466512.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    188   6e-50    
ref|XP_009496395.1|  hypothetical protein H696_04240                    189   6e-50    
ref|XP_009593230.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    188   6e-50    
ref|XP_009942746.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar RN...    188   6e-50    
ref|XP_010488254.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    188   6e-50    
ref|XP_009787018.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    188   7e-50    
ref|XP_003994044.3|  PREDICTED: nucleolar RNA helicase 2                189   7e-50    
ref|NP_188870.1|  DEAD-box ATP-dependent RNA helicase                   187   7e-50    
ref|XP_004657939.1|  PREDICTED: nucleolar RNA helicase 2                189   7e-50    
gb|ELU03439.1|  hypothetical protein CAPTEDRAFT_52524                   189   7e-50    
ref|XP_010187643.1|  PREDICTED: nucleolar RNA helicase 2-like           188   7e-50    
ref|XP_009484668.1|  PREDICTED: LOW QUALITY PROTEIN: nucleolar RN...    188   9e-50    
ref|XP_006352957.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    187   9e-50    
ref|XP_002883354.1|  hypothetical protein ARALYDRAFT_479744             187   1e-49    
emb|CDY37406.1|  BnaC05g30240D                                          186   1e-49    
ref|XP_001519340.2|  PREDICTED: nucleolar RNA helicase 2                188   1e-49    
ref|XP_005297366.1|  PREDICTED: nucleolar RNA helicase 2-like           188   1e-49    
ref|XP_010511242.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    187   1e-49    
ref|XP_003056927.1|  DEAD/DEAH box RNA helicase                         188   1e-49    
gb|EPY83760.1|  hypothetical protein CB1_000533042                      191   1e-49    
ref|XP_004393744.1|  PREDICTED: nucleolar RNA helicase 2                188   1e-49    
ref|XP_007524245.1|  PREDICTED: nucleolar RNA helicase 2                188   1e-49    
ref|XP_001519332.1|  PREDICTED: ATP-dependent RNA helicase DDX50        188   2e-49    
ref|XP_006273541.1|  PREDICTED: nucleolar RNA helicase 2-like iso...    186   2e-49    
ref|XP_851746.2|  PREDICTED: nucleolar RNA helicase 2                   187   2e-49    
ref|XP_006380943.1|  hypothetical protein POPTR_0006s02500g             186   2e-49    
ref|XP_002308835.2|  hypothetical protein POPTR_0006s02500g             186   2e-49    
emb|CDY37408.1|  BnaC05g30220D                                          186   2e-49    
emb|CBJ26838.1|  DEAD box helicase                                      187   2e-49    
ref|XP_011040644.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    186   3e-49    
ref|XP_011004482.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    186   3e-49    
ref|XP_009563564.1|  PREDICTED: nucleolar RNA helicase 2-like           187   3e-49    
ref|XP_007095812.1|  PREDICTED: nucleolar RNA helicase 2                187   3e-49    
emb|CCA17723.1|  DEAD/DEAH box RNA helicase putative                    186   4e-49    
ref|XP_006023204.1|  PREDICTED: nucleolar RNA helicase 2-like           186   5e-49    
gb|KDO64256.1|  hypothetical protein CISIN_1g007084mg                   181   5e-49    
gb|ERE87826.1|  nucleolar RNA helicase 2-like protein                   183   6e-49    
ref|XP_007902730.1|  PREDICTED: nucleolar RNA helicase 2-like           186   6e-49    
ref|WP_034404761.1|  RNA helicase                                       185   7e-49    
ref|XP_006273542.1|  PREDICTED: nucleolar RNA helicase 2-like iso...    186   7e-49    
emb|CAH93507.1|  hypothetical protein                                   181   8e-49    
ref|XP_009674661.1|  PREDICTED: nucleolar RNA helicase 2-like           185   9e-49    
ref|XP_004491264.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    184   1e-48    
ref|XP_003783808.1|  PREDICTED: nucleolar RNA helicase 2                186   1e-48    
ref|XP_007217634.1|  hypothetical protein PRUPE_ppa002643mg             184   1e-48    
ref|XP_011085434.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    184   1e-48    
ref|XP_006406184.1|  hypothetical protein EUTSA_v10020296mg             184   1e-48    
ref|XP_010221060.1|  PREDICTED: uncharacterized protein LOC104575417    188   1e-48    
gb|EYU43163.1|  hypothetical protein MIMGU_mgv1a003141mg                184   1e-48    
ref|XP_008229751.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    184   1e-48    
ref|WP_027460038.1|  RNA helicase                                       184   1e-48    
emb|CBN74178.1|  DEAD box helicase                                      186   2e-48    
ref|XP_010532528.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    184   2e-48    
ref|XP_010688871.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    184   2e-48    
tpg|DAA59526.2|  TPA: putative DEAD-box ATP-dependent RNA helicas...    177   2e-48    
ref|XP_008113403.1|  PREDICTED: nucleolar RNA helicase 2                185   2e-48    
ref|XP_003755082.1|  PREDICTED: ATP-dependent RNA helicase DDX50        184   2e-48    
ref|XP_005718016.1|  DEAD (Asp-Glu-Ala-Asp) box polypeptide 21-li...    184   2e-48    
gb|EYU43162.1|  hypothetical protein MIMGU_mgv1a003141mg                184   2e-48    
gb|KDO64254.1|  hypothetical protein CISIN_1g007084mg                   181   2e-48    
ref|XP_010015522.1|  PREDICTED: nucleolar RNA helicase 2-like           182   3e-48    
ref|XP_004251555.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    183   3e-48    
ref|XP_005326062.1|  PREDICTED: ATP-dependent RNA helicase DDX50        184   3e-48    
ref|XP_002520585.1|  dead box ATP-dependent RNA helicase, putative      177   4e-48    
emb|CBI31778.3|  unnamed protein product                                182   4e-48    
gb|KJB75399.1|  hypothetical protein B456_012G039900                    181   4e-48    
gb|KDO64255.1|  hypothetical protein CISIN_1g007084mg                   181   4e-48    
ref|XP_006351994.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    183   5e-48    
dbj|BAD97017.1|  nucleolar protein GU2 variant                          178   5e-48    
ref|XP_006351993.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    183   5e-48    
ref|XP_006351991.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    183   5e-48    
ref|XP_004992590.1|  DEAD box polypeptide 47 isoform 1                  183   5e-48    
gb|EGV93790.1|  ATP-dependent RNA helicase DDX50                        183   6e-48    
ref|XP_004888572.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    183   6e-48    
gb|EPS73227.1|  hypothetical protein M569_01530                         182   7e-48    
emb|CCI44343.1|  unnamed protein product                                182   7e-48    
ref|XP_007048884.1|  DEAD-box ATP-dependent RNA helicase 53 isofo...    182   7e-48    
ref|XP_011467638.1|  PREDICTED: DEAD-box ATP-dependent RNA helica...    182   7e-48    
ref|XP_001773524.1|  predicted protein                                  182   7e-48    
gb|ETK72184.1|  hypothetical protein L915_20663                         174   8e-48    
ref|WP_012693774.1|  RNA helicase                                       182   9e-48    
ref|XP_006181242.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    182   9e-48    
ref|XP_006212960.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    182   9e-48    
ref|XP_004470593.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    181   9e-48    
ref|XP_004888571.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    182   9e-48    
ref|XP_004470591.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    181   9e-48    
ref|XP_007638832.1|  PREDICTED: LOW QUALITY PROTEIN: ATP-dependen...    182   1e-47    
ref|XP_010984124.1|  PREDICTED: ATP-dependent RNA helicase DDX50 ...    182   1e-47    
ref|XP_004701441.1|  PREDICTED: ATP-dependent RNA helicase DDX50        182   1e-47    



>ref|XP_009767597.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Nicotiana 
sylvestris]
Length=692

 Score =   381 bits (978),  Expect = 2e-122, Method: Compositional matrix adjust.
 Identities = 179/219 (82%), Positives = 198/219 (90%), Gaps = 0/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             DP  ++NFRISKPLREAL AKGIE+LF IQAMTF+ +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  118   DPNVLSNFRISKPLREALNAKGIEALFPIQAMTFDDILDGSDLVGRARTGQGKTLAFVLP  177

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             ILESLTNGP KA RKTGYG+ PSVLVLLPTRELALQVF DFE+YG A+GLTSCCLYGN+P
Sbjct  178   ILESLTNGPTKALRKTGYGKAPSVLVLLPTRELALQVFADFEVYGRAMGLTSCCLYGNSP  237

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
                Q+++LKRGVDIVVGTPGRIKDHI RGN+D  SLKFRVLDEVDEML+IGFV+DVE IL
Sbjct  238   MGAQQVQLKRGVDIVVGTPGRIKDHIERGNLDFRSLKFRVLDEVDEMLKIGFVDDVELIL  297

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             GKV D  QVQT+LFSATL DWVKHIASKFLKPDKKTVD+
Sbjct  298   GKVEDASQVQTILFSATLPDWVKHIASKFLKPDKKTVDL  336



>ref|XP_009587639.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Nicotiana 
tomentosiformis]
Length=692

 Score =   379 bits (973),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 197/219 (90%), Gaps = 0/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             DP  ++NFRISKPLREAL AKGIE+LF IQAMTF+ +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  118   DPNVLSNFRISKPLREALNAKGIEALFPIQAMTFDDILDGSDLVGRARTGQGKTLAFVLP  177

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             ILESLTNGP KA RKTGYG+ PSVLVLLPTRELALQVF DFE+YG A+GL SCCLYGN+P
Sbjct  178   ILESLTNGPTKALRKTGYGKAPSVLVLLPTRELALQVFADFEVYGRAMGLASCCLYGNSP  237

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
                Q+++LKRGVDIVVGTPGRIKDHI RGN+D  SLKFRVLDEVDEML+IGFV+DVE IL
Sbjct  238   MGAQQVQLKRGVDIVVGTPGRIKDHIERGNLDFRSLKFRVLDEVDEMLKIGFVDDVELIL  297

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             GKV D  QVQT+LFSATL DWVKHIASKFLKPDKKTVD+
Sbjct  298   GKVEDASQVQTILFSATLPDWVKHIASKFLKPDKKTVDL  336



>ref|XP_011101144.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Sesamum 
indicum]
Length=701

 Score =   379 bits (972),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 178/219 (81%), Positives = 197/219 (90%), Gaps = 0/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             +P A++NFRIS PLREALK+KGIESLF IQAMTF  +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  120   NPNALSNFRISVPLREALKSKGIESLFPIQAMTFGMILDGSDLVGRARTGQGKTLAFVLP  179

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             ILESLTNGPAKA+RKTGYGR PSVLVLLPTRELA QVF DFE+YGGALGL SCCLYG +P
Sbjct  180   ILESLTNGPAKASRKTGYGRAPSVLVLLPTRELATQVFADFEVYGGALGLNSCCLYGGSP  239

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
             Y  Q+++LKRGVDIVVGTPGRIKDHI RGN+D  SLKFRVLDE DEMLR+GFVEDVE IL
Sbjct  240   YQPQQIQLKRGVDIVVGTPGRIKDHIERGNLDFRSLKFRVLDEADEMLRMGFVEDVELIL  299

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             GKV D  +VQTLLFSATL DWVKHI++KFLKPDKKT D+
Sbjct  300   GKVEDASKVQTLLFSATLPDWVKHISAKFLKPDKKTADL  338



>ref|XP_009628542.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Nicotiana tomentosiformis]
Length=655

 Score =   377 bits (968),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 178/218 (82%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +1

Query  487   PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPI  666
             P A++NFRIS PLREAL AKGI++LF IQAMTF+ V DG D+VGRARTGQGKTLAFVLPI
Sbjct  120   PNALSNFRISVPLREALIAKGIQALFPIQAMTFDTVFDGNDLVGRARTGQGKTLAFVLPI  179

Query  667   LESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPY  846
             LESLTNGP KA+RKTGYGR PSVLVLLPTRELALQVF DFE+YG A+GLTSCCLYGN+P 
Sbjct  180   LESLTNGPTKASRKTGYGRAPSVLVLLPTRELALQVFADFEVYGRAVGLTSCCLYGNSPM  239

Query  847   AQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILG  1026
              QQ+++LKRGVDIVVGTPGR+KDHI RGNID  SLKFRVLDEVDEML+IGFV+DVEFILG
Sbjct  240   GQQQVQLKRGVDIVVGTPGRVKDHIERGNIDFRSLKFRVLDEVDEMLKIGFVDDVEFILG  299

Query  1027  KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             KV D  QVQTLLFSATL  WVKHI+SKFLKPDKKT D+
Sbjct  300   KVEDASQVQTLLFSATLPSWVKHISSKFLKPDKKTADL  337



>ref|XP_004234150.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Solanum 
lycopersicum]
Length=682

 Score =   377 bits (968),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 195/218 (89%), Gaps = 0/218 (0%)
 Frame = +1

Query  487   PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPI  666
             P A++NFRIS PL+E L AKGI +LF IQAMTF+ +LDG+D+VGRARTGQGKTLAFVLPI
Sbjct  112   PNALSNFRISVPLKEVLNAKGINALFPIQAMTFDTILDGSDLVGRARTGQGKTLAFVLPI  171

Query  667   LESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPY  846
             LESL NGP K +RKTGYGR PSVLVLLPTRELALQVF DFE+YGGA+GLTSCCLYGN+P 
Sbjct  172   LESLINGPTKVSRKTGYGRAPSVLVLLPTRELALQVFADFEVYGGAVGLTSCCLYGNSPM  231

Query  847   AQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILG  1026
              QQ+++LKRGVDIVVGTPGRIKDHI RGNID  SLKFRVLDEVDEML+IGFV+DVEFILG
Sbjct  232   GQQQVQLKRGVDIVVGTPGRIKDHIERGNIDFRSLKFRVLDEVDEMLKIGFVDDVEFILG  291

Query  1027  KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             KV D  QVQTLLFSATL  WVKHI+SKFLKPDKKT D+
Sbjct  292   KVEDASQVQTLLFSATLPSWVKHISSKFLKPDKKTADL  329



>ref|XP_009628541.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Nicotiana tomentosiformis]
Length=691

 Score =   377 bits (968),  Expect = 7e-121, Method: Compositional matrix adjust.
 Identities = 178/218 (82%), Positives = 196/218 (90%), Gaps = 0/218 (0%)
 Frame = +1

Query  487   PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPI  666
             P A++NFRIS PLREAL AKGI++LF IQAMTF+ V DG D+VGRARTGQGKTLAFVLPI
Sbjct  120   PNALSNFRISVPLREALIAKGIQALFPIQAMTFDTVFDGNDLVGRARTGQGKTLAFVLPI  179

Query  667   LESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPY  846
             LESLTNGP KA+RKTGYGR PSVLVLLPTRELALQVF DFE+YG A+GLTSCCLYGN+P 
Sbjct  180   LESLTNGPTKASRKTGYGRAPSVLVLLPTRELALQVFADFEVYGRAVGLTSCCLYGNSPM  239

Query  847   AQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILG  1026
              QQ+++LKRGVDIVVGTPGR+KDHI RGNID  SLKFRVLDEVDEML+IGFV+DVEFILG
Sbjct  240   GQQQVQLKRGVDIVVGTPGRVKDHIERGNIDFRSLKFRVLDEVDEMLKIGFVDDVEFILG  299

Query  1027  KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             KV D  QVQTLLFSATL  WVKHI+SKFLKPDKKT D+
Sbjct  300   KVEDASQVQTLLFSATLPSWVKHISSKFLKPDKKTADL  337



>ref|XP_006348047.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Solanum 
tuberosum]
Length=683

 Score =   376 bits (966),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 176/218 (81%), Positives = 194/218 (89%), Gaps = 0/218 (0%)
 Frame = +1

Query  487   PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPI  666
             P A++NFRIS PLREAL  KGI +LF IQAMTF+ +LDG+D++GRARTGQGKTLAFVLPI
Sbjct  106   PNALSNFRISVPLREALITKGIHALFPIQAMTFDTILDGSDLIGRARTGQGKTLAFVLPI  165

Query  667   LESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPY  846
             LESL NGP K +RKTGYGR PSVLVLLPTRELALQVF DFE YGGA+GLTSCCLYGN+P 
Sbjct  166   LESLINGPTKVSRKTGYGRAPSVLVLLPTRELALQVFADFEFYGGAVGLTSCCLYGNSPM  225

Query  847   AQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILG  1026
              QQ+++LKRGVDIVVGTPGRIKDHI RGNID  SLKFRVLDEVDEML+IGFV+DVEFILG
Sbjct  226   GQQQVQLKRGVDIVVGTPGRIKDHIERGNIDFRSLKFRVLDEVDEMLKIGFVDDVEFILG  285

Query  1027  KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             KV D  QVQTLLFSATL  WVKHI+SKFLKPDKKT D+
Sbjct  286   KVEDASQVQTLLFSATLPSWVKHISSKFLKPDKKTADL  323



>ref|XP_006357902.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Solanum 
tuberosum]
Length=679

 Score =   375 bits (963),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 181/231 (78%), Positives = 200/231 (87%), Gaps = 7/231 (3%)
 Frame = +1

Query  469   DEEE-------EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRAR  627
             DEEE       EDP A++NFRISKPL+EAL +KGIE+LF IQAMTF+ +LDG D+VGRAR
Sbjct  96    DEEEVMVEKKVEDPNALSNFRISKPLKEALNSKGIEALFPIQAMTFDDILDGCDLVGRAR  155

Query  628   TGQGKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGAL  807
             TGQGKTLAFVLPILESLTNGP KA RKTGYG+ PSVLVLLPTRELALQVF DFE+YG A+
Sbjct  156   TGQGKTLAFVLPILESLTNGPTKALRKTGYGKAPSVLVLLPTRELALQVFADFEVYGRAV  215

Query  808   GLTSCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEML  987
             GLTSCCLYGN+P   Q+ +LKRGVDIVVGTPGR+KDHI RGNID  SLKFRVLDEVDEML
Sbjct  216   GLTSCCLYGNSPMGAQQAQLKRGVDIVVGTPGRVKDHIERGNIDFGSLKFRVLDEVDEML  275

Query  988   RIGFVEDVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             +IGFV+DVEFILGKV D   VQT+LFSATL  WVKHIASKFLKPDKKT D+
Sbjct  276   KIGFVDDVEFILGKVEDASLVQTVLFSATLPVWVKHIASKFLKPDKKTADL  326



>gb|KHN02770.1| DEAD-box ATP-dependent RNA helicase 7 [Glycine soja]
Length=701

 Score =   375 bits (963),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 199/224 (89%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             +E+++DP AI+NFRIS+PLRE LK KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTL
Sbjct  111   EEKKDDPNAISNFRISEPLREKLKEKGIESLFPIQAMTFDTVLDGSDLVGRARTGQGKTL  170

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NGPAK+ RKTGYGR PSVLVLLPTRELA QV  DFE+YGGA+GL+SCCL
Sbjct  171   AFVLPILESLINGPAKSARKTGYGRTPSVLVLLPTRELACQVHADFEVYGGAMGLSSCCL  230

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG  PY  QE+KL+RGVDIV+GTPGR+KDHI +GNIDL+ LKFRVLDE DEMLR+GFVED
Sbjct  231   YGGAPYQGQELKLRRGVDIVIGTPGRVKDHIEKGNIDLSQLKFRVLDEADEMLRMGFVED  290

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILGKV +V +VQTLLFSATL DWVK IA KFLKPDKKT D+
Sbjct  291   VEMILGKVENVNKVQTLLFSATLPDWVKQIALKFLKPDKKTADL  334



>ref|XP_003536498.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Glycine 
max]
Length=697

 Score =   375 bits (963),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 176/224 (79%), Positives = 199/224 (89%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             +E+++DP AI+NFRIS+PLRE LK KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTL
Sbjct  111   EEKKDDPNAISNFRISEPLREKLKEKGIESLFPIQAMTFDTVLDGSDLVGRARTGQGKTL  170

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NGPAK+ RKTGYGR PSVLVLLPTRELA QV  DFE+YGGA+GL+SCCL
Sbjct  171   AFVLPILESLINGPAKSARKTGYGRTPSVLVLLPTRELACQVHADFEVYGGAMGLSSCCL  230

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG  PY  QE+KL+RGVDIV+GTPGR+KDHI +GNIDL+ LKFRVLDE DEMLR+GFVED
Sbjct  231   YGGAPYQGQELKLRRGVDIVIGTPGRVKDHIEKGNIDLSQLKFRVLDEADEMLRMGFVED  290

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILGKV +V +VQTLLFSATL DWVK IA KFLKPDKKT D+
Sbjct  291   VEMILGKVENVNKVQTLLFSATLPDWVKQIALKFLKPDKKTADL  334



>ref|XP_010275981.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Nelumbo nucifera]
Length=745

 Score =   375 bits (964),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 175/219 (80%), Positives = 194/219 (89%), Gaps = 0/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             +P A++NFRISK LRE LK+KGIESLF IQAMTF+ ++DG+DMVGRARTGQGKTLAFVLP
Sbjct  154   NPNAVSNFRISKALREQLKSKGIESLFPIQAMTFDTIVDGSDMVGRARTGQGKTLAFVLP  213

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             ILESLTNGP KA+RKTGYGR PSVLVLLPTRELA QV  DFE+YGGA+GLTSCCLYG  P
Sbjct  214   ILESLTNGPTKASRKTGYGRAPSVLVLLPTRELAKQVHEDFEVYGGAVGLTSCCLYGGAP  273

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
             Y  QE+KL+RGVDIV+GTPGR+KDHI RGNIDLT LKFRVLDE DEMLR+GFVEDVE IL
Sbjct  274   YQSQEIKLRRGVDIVIGTPGRVKDHIERGNIDLTELKFRVLDEADEMLRMGFVEDVELIL  333

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             G V D  +VQTLLFSATL DWVK IAS+FLKPDKKT D+
Sbjct  334   GNVKDASKVQTLLFSATLPDWVKQIASRFLKPDKKTADL  372



>gb|KDO65345.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=546

 Score =   369 bits (948),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 173/222 (78%), Positives = 195/222 (88%), Gaps = 0/222 (0%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             E E P A++ FRIS PLRE LK+KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAF
Sbjct  104   ESEHPNAVSRFRISVPLREKLKSKGIESLFPIQAMTFDMVLDGSDLVGRARTGQGKTLAF  163

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
             VLPILESLTNGP KA++KTGYGR PSVLVLLPTRELA QV  DF++YGGA+GLTSCCLYG
Sbjct  164   VLPILESLTNGPTKASKKTGYGRAPSVLVLLPTRELAKQVHEDFDVYGGAVGLTSCCLYG  223

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
               PY  QE KLK+G+D+V+GTPGRIKDHI RGNIDL+SLKFRVLDE DEMLR+GFVEDVE
Sbjct  224   GAPYHAQEFKLKKGIDVVIGTPGRIKDHIERGNIDLSSLKFRVLDEADEMLRMGFVEDVE  283

Query  1015  FILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILGKV D  +VQTLLFSATL  WVKHI++KFLK DKKT+D+
Sbjct  284   LILGKVEDANKVQTLLFSATLPSWVKHISTKFLKSDKKTIDL  325



>ref|XP_004240751.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Solanum lycopersicum]
Length=683

 Score =   374 bits (959),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 177/220 (80%), Positives = 196/220 (89%), Gaps = 0/220 (0%)
 Frame = +1

Query  481   EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
             EDP A++NFRISKPL+EAL +KGIE+LF IQAMTF+ +LDG D+VGRARTGQGKTLAFVL
Sbjct  107   EDPNALSNFRISKPLKEALNSKGIEALFPIQAMTFDDILDGCDLVGRARTGQGKTLAFVL  166

Query  661   PILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNT  840
             PILESLTNGP KA RKTGYG+ PSVLVLLPTRELALQVF DFE+YG A+GLTSCCLYGN+
Sbjct  167   PILESLTNGPTKALRKTGYGKAPSVLVLLPTRELALQVFADFEVYGRAVGLTSCCLYGNS  226

Query  841   PYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFI  1020
             P   Q+ +LKRGVDIVVGTPGR+KDHI RGNID  SLKFRVLDEVDEML+IGFV+DVEFI
Sbjct  227   PMGAQQAQLKRGVDIVVGTPGRVKDHIERGNIDFGSLKFRVLDEVDEMLKIGFVDDVEFI  286

Query  1021  LGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             LGKV D   VQT+LFSATL  WVKHIASKFLKPDKKT D+
Sbjct  287   LGKVEDASLVQTVLFSATLPVWVKHIASKFLKPDKKTADL  326



>gb|KDO65346.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
 gb|KDO65347.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=574

 Score =   369 bits (947),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 173/222 (78%), Positives = 195/222 (88%), Gaps = 0/222 (0%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             E E P A++ FRIS PLRE LK+KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAF
Sbjct  104   ESEHPNAVSRFRISVPLREKLKSKGIESLFPIQAMTFDMVLDGSDLVGRARTGQGKTLAF  163

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
             VLPILESLTNGP KA++KTGYGR PSVLVLLPTRELA QV  DF++YGGA+GLTSCCLYG
Sbjct  164   VLPILESLTNGPTKASKKTGYGRAPSVLVLLPTRELAKQVHEDFDVYGGAVGLTSCCLYG  223

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
               PY  QE KLK+G+D+V+GTPGRIKDHI RGNIDL+SLKFRVLDE DEMLR+GFVEDVE
Sbjct  224   GAPYHAQEFKLKKGIDVVIGTPGRIKDHIERGNIDLSSLKFRVLDEADEMLRMGFVEDVE  283

Query  1015  FILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILGKV D  +VQTLLFSATL  WVKHI++KFLK DKKT+D+
Sbjct  284   LILGKVEDANKVQTLLFSATLPSWVKHISTKFLKSDKKTIDL  325



>gb|KHN15708.1| DEAD-box ATP-dependent RNA helicase 7 [Glycine soja]
Length=694

 Score =   372 bits (954),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 199/223 (89%), Gaps = 0/223 (0%)
 Frame = +1

Query  472   EEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLA  651
             E++EDP A++NFRIS+PLR+ LK KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLA
Sbjct  108   EKKEDPNALSNFRISEPLRQKLKEKGIESLFPIQAMTFDTVLDGSDLVGRARTGQGKTLA  167

Query  652   FVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLY  831
             FVLPILESL NGP KA+RKTG+GR PSVLVLLPTRELA QV  DF++YGGA+GL+SCCLY
Sbjct  168   FVLPILESLINGPTKASRKTGFGRTPSVLVLLPTRELACQVHADFDVYGGAMGLSSCCLY  227

Query  832   GNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDV  1011
             G  PY  QE+KL+RGVDIV+GTPGR+KDHI +GNIDL+ LKFRVLDE DEMLR+GFVEDV
Sbjct  228   GGAPYQGQEIKLRRGVDIVIGTPGRVKDHIEKGNIDLSQLKFRVLDEADEMLRMGFVEDV  287

Query  1012  EFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             E ILGKV +V +VQTLLFSATL DWVK IA++FLKPDKKT D+
Sbjct  288   EMILGKVENVNKVQTLLFSATLPDWVKQIAARFLKPDKKTADL  330



>ref|XP_003556075.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Glycine 
max]
Length=693

 Score =   372 bits (954),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 172/223 (77%), Positives = 199/223 (89%), Gaps = 0/223 (0%)
 Frame = +1

Query  472   EEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLA  651
             E++EDP A++NFRIS+PLR+ LK KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLA
Sbjct  107   EKKEDPNALSNFRISEPLRQKLKEKGIESLFPIQAMTFDTVLDGSDLVGRARTGQGKTLA  166

Query  652   FVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLY  831
             FVLPILESL NGP KA+RKTG+GR PSVLVLLPTRELA QV  DF++YGGA+GL+SCCLY
Sbjct  167   FVLPILESLINGPTKASRKTGFGRTPSVLVLLPTRELACQVHADFDVYGGAMGLSSCCLY  226

Query  832   GNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDV  1011
             G  PY  QE+KL+RGVDIV+GTPGR+KDHI +GNIDL+ LKFRVLDE DEMLR+GFVEDV
Sbjct  227   GGAPYQGQEIKLRRGVDIVIGTPGRVKDHIEKGNIDLSQLKFRVLDEADEMLRMGFVEDV  286

Query  1012  EFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             E ILGKV +V +VQTLLFSATL DWVK IA++FLKPDKKT D+
Sbjct  287   EMILGKVENVNKVQTLLFSATLPDWVKQIAARFLKPDKKTADL  329



>gb|EPS64456.1| hypothetical protein M569_10323 [Genlisea aurea]
Length=693

 Score =   371 bits (953),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 176/219 (80%), Positives = 193/219 (88%), Gaps = 0/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             DP AI NFRISKPLREALKAKGIE+LF IQA TF  +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  100   DPNAIVNFRISKPLREALKAKGIEALFPIQAKTFTMILDGSDLVGRARTGQGKTLAFVLP  159

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             ILESLTNG AK TRKTGYGR PSVLVLLPTRELA QVF +FE+YGGALGL SCCLYG  P
Sbjct  160   ILESLTNGLAKTTRKTGYGRAPSVLVLLPTRELATQVFAEFEVYGGALGLNSCCLYGGAP  219

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
             Y  Q+++LKRGVDIV+GTPGRIKDHI RGNID  SLKFRVLDE DEMLR+GFVEDVEFIL
Sbjct  220   YQPQQIQLKRGVDIVIGTPGRIKDHIERGNIDFRSLKFRVLDEADEMLRMGFVEDVEFIL  279

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             GKV D + VQTLLFSATL +WVK I++KFL+ DKKTVD+
Sbjct  280   GKVEDARNVQTLLFSATLPEWVKQISAKFLRSDKKTVDL  318



>gb|KDO65344.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=620

 Score =   369 bits (947),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 173/222 (78%), Positives = 195/222 (88%), Gaps = 0/222 (0%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             E E P A++ FRIS PLRE LK+KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAF
Sbjct  104   ESEHPNAVSRFRISVPLREKLKSKGIESLFPIQAMTFDMVLDGSDLVGRARTGQGKTLAF  163

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
             VLPILESLTNGP KA++KTGYGR PSVLVLLPTRELA QV  DF++YGGA+GLTSCCLYG
Sbjct  164   VLPILESLTNGPTKASKKTGYGRAPSVLVLLPTRELAKQVHEDFDVYGGAVGLTSCCLYG  223

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
               PY  QE KLK+G+D+V+GTPGRIKDHI RGNIDL+SLKFRVLDE DEMLR+GFVEDVE
Sbjct  224   GAPYHAQEFKLKKGIDVVIGTPGRIKDHIERGNIDLSSLKFRVLDEADEMLRMGFVEDVE  283

Query  1015  FILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILGKV D  +VQTLLFSATL  WVKHI++KFLK DKKT+D+
Sbjct  284   LILGKVEDANKVQTLLFSATLPSWVKHISTKFLKSDKKTIDL  325



>emb|CDP05280.1| unnamed protein product [Coffea canephora]
Length=720

 Score =   372 bits (954),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 185/251 (74%), Positives = 209/251 (83%), Gaps = 7/251 (3%)
 Frame = +1

Query  400   LVEPVNFkaekkkkakLMEAVGGDEE----EEDPYAITNFRISKPLREALKAKGIESLFK  567
             L EP+N   +K K   L E    DEE    EE P A+T FRIS+ LREALK KGIE LF 
Sbjct  97    LGEPMNLMKKKAK---LTEVDEDDEEKSVKEEHPNALTKFRISERLREALKVKGIEYLFP  153

Query  568   IQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLL  747
             IQAMTF+ +LDG+D+VGRARTGQGKTLAFVLPILESLTNGPAKA RKTGYGR PSVLVLL
Sbjct  154   IQAMTFDTILDGSDLVGRARTGQGKTLAFVLPILESLTNGPAKAARKTGYGRAPSVLVLL  213

Query  748   PTRELALQVFTDFEMYGGALGLTSCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMR  927
             PTRELA QVFTDFE+YGGALGLTSCC+YG +PY QQE++LKRGVDIV+GT GR+KDHI R
Sbjct  214   PTRELACQVFTDFEVYGGALGLTSCCIYGQSPYRQQEIQLKRGVDIVIGTTGRVKDHIER  273

Query  928   GNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILGKVADVKQVQTLLFSATLQDWVKHIASK  1107
              NI+ +SL+FRVLDE DEML++GFV+DVEFILGKV    +VQTLLFSATL DWVK IA+K
Sbjct  274   ENINFSSLRFRVLDEADEMLKMGFVDDVEFILGKVESASEVQTLLFSATLPDWVKQIAAK  333

Query  1108  FLKPDKKTVDI  1140
             FLKPDKKT D+
Sbjct  334   FLKPDKKTADL  344



>ref|XP_009781160.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Nicotiana 
sylvestris]
Length=682

 Score =   370 bits (951),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 174/218 (80%), Positives = 193/218 (89%), Gaps = 0/218 (0%)
 Frame = +1

Query  487   PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPI  666
             P A++NFRIS PLREAL AKGI++LF IQAMTF+ + DG D+VGRARTGQGKTLAFVLPI
Sbjct  111   PNALSNFRISVPLREALIAKGIQALFPIQAMTFDTIFDGNDLVGRARTGQGKTLAFVLPI  170

Query  667   LESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPY  846
             LESLTNGP KA+RKTGYGR P VLVLLPTRELALQVF DFE+YG  +GLTSCCLYGN+P 
Sbjct  171   LESLTNGPTKASRKTGYGRAPCVLVLLPTRELALQVFADFEVYGRTVGLTSCCLYGNSPM  230

Query  847   AQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILG  1026
              QQ+++LKRGVDIVVGTPGR+KDHI RGNID  SLKFRVLDEVDEML+IGFV+DVEFILG
Sbjct  231   GQQQVQLKRGVDIVVGTPGRVKDHIERGNIDFRSLKFRVLDEVDEMLKIGFVDDVEFILG  290

Query  1027  KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             KV D  QVQTLLFSATL  WVKHI+ KFLKPDKKT D+
Sbjct  291   KVEDASQVQTLLFSATLPSWVKHISYKFLKPDKKTADL  328



>ref|XP_012090373.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 isoform X2 [Jatropha 
curcas]
Length=634

 Score =   369 bits (946),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 173/220 (79%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  481   EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
             EDP A + FRIS PLRE LK++GIE+LF IQAMTF  +LDG D+VGRARTGQGKTLAFVL
Sbjct  120   EDPNATSKFRISLPLREKLKSRGIEALFPIQAMTFNDILDGCDLVGRARTGQGKTLAFVL  179

Query  661   PILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNT  840
             PILESLTNGPAKA+RKTGYGRPPSVLVLLPTRELA QV+ DF++YG ALGLT+CCLYG  
Sbjct  180   PILESLTNGPAKASRKTGYGRPPSVLVLLPTRELACQVYDDFKVYGEALGLTTCCLYGGA  239

Query  841   PYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFI  1020
              Y  QE  LKRGVD+VVGTPGRIKDHI RGNIDL+ LKFRVLDE DEMLR+GFVEDVE I
Sbjct  240   SYHPQETSLKRGVDVVVGTPGRIKDHIERGNIDLSLLKFRVLDEADEMLRMGFVEDVELI  299

Query  1021  LGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             LGKV DV +VQTLLFSATL DWVKHI+++FLKP KKT+D+
Sbjct  300   LGKVEDVSKVQTLLFSATLPDWVKHISTRFLKPSKKTIDL  339



>gb|KDO65342.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=652

 Score =   368 bits (945),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 173/222 (78%), Positives = 195/222 (88%), Gaps = 0/222 (0%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             E E P A++ FRIS PLRE LK+KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAF
Sbjct  104   ESEHPNAVSRFRISVPLREKLKSKGIESLFPIQAMTFDMVLDGSDLVGRARTGQGKTLAF  163

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
             VLPILESLTNGP KA++KTGYGR PSVLVLLPTRELA QV  DF++YGGA+GLTSCCLYG
Sbjct  164   VLPILESLTNGPTKASKKTGYGRAPSVLVLLPTRELAKQVHEDFDVYGGAVGLTSCCLYG  223

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
               PY  QE KLK+G+D+V+GTPGRIKDHI RGNIDL+SLKFRVLDE DEMLR+GFVEDVE
Sbjct  224   GAPYHAQEFKLKKGIDVVIGTPGRIKDHIERGNIDLSSLKFRVLDEADEMLRMGFVEDVE  283

Query  1015  FILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILGKV D  +VQTLLFSATL  WVKHI++KFLK DKKT+D+
Sbjct  284   LILGKVEDANKVQTLLFSATLPSWVKHISTKFLKSDKKTIDL  325



>gb|EYU19497.1| hypothetical protein MIMGU_mgv1a002250mg [Erythranthe guttata]
Length=695

 Score =   369 bits (948),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 178/229 (78%), Positives = 197/229 (86%), Gaps = 0/229 (0%)
 Frame = +1

Query  454   EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  633
             E V  ++  EDP A++NFRISKPL++ALKAKGIESLF IQAMTF  VLDG+D+VGRARTG
Sbjct  107   EKVAEEKVIEDPNAVSNFRISKPLKDALKAKGIESLFPIQAMTFNLVLDGSDLVGRARTG  166

Query  634   QGKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGL  813
             QGKTLAFVLPILESLTNGPAKA RKTGYG+ PSVLVLLPTRELA QVF DFE YG +LGL
Sbjct  167   QGKTLAFVLPILESLTNGPAKAARKTGYGKAPSVLVLLPTRELATQVFADFESYGASLGL  226

Query  814   TSCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRI  993
             TSCCLYG +PY  Q+  LKRGVDIVVGTPGRIKDH+ RG ++L SLKFRVLDE DEMLR+
Sbjct  227   TSCCLYGGSPYQPQQNALKRGVDIVVGTPGRIKDHLERGTLNLGSLKFRVLDEADEMLRM  286

Query  994   GFVEDVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             GFVEDVE ILGKV DV QVQTLLFSATL  WVK I++KFLK DKKT D+
Sbjct  287   GFVEDVELILGKVQDVTQVQTLLFSATLPSWVKQISTKFLKADKKTADL  335



>ref|XP_012090372.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 isoform X1 [Jatropha 
curcas]
 gb|KDP22369.1| hypothetical protein JCGZ_26200 [Jatropha curcas]
Length=709

 Score =   369 bits (947),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 173/220 (79%), Positives = 193/220 (88%), Gaps = 0/220 (0%)
 Frame = +1

Query  481   EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
             EDP A + FRIS PLRE LK++GIE+LF IQAMTF  +LDG D+VGRARTGQGKTLAFVL
Sbjct  120   EDPNATSKFRISLPLREKLKSRGIEALFPIQAMTFNDILDGCDLVGRARTGQGKTLAFVL  179

Query  661   PILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNT  840
             PILESLTNGPAKA+RKTGYGRPPSVLVLLPTRELA QV+ DF++YG ALGLT+CCLYG  
Sbjct  180   PILESLTNGPAKASRKTGYGRPPSVLVLLPTRELACQVYDDFKVYGEALGLTTCCLYGGA  239

Query  841   PYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFI  1020
              Y  QE  LKRGVD+VVGTPGRIKDHI RGNIDL+ LKFRVLDE DEMLR+GFVEDVE I
Sbjct  240   SYHPQETSLKRGVDVVVGTPGRIKDHIERGNIDLSLLKFRVLDEADEMLRMGFVEDVELI  299

Query  1021  LGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             LGKV DV +VQTLLFSATL DWVKHI+++FLKP KKT+D+
Sbjct  300   LGKVEDVSKVQTLLFSATLPDWVKHISTRFLKPSKKTIDL  339



>ref|XP_006421777.1| hypothetical protein CICLE_v10004459mg [Citrus clementina]
 ref|XP_006490269.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Citrus 
sinensis]
 gb|ESR35017.1| hypothetical protein CICLE_v10004459mg [Citrus clementina]
 gb|KDO65343.1| hypothetical protein CISIN_1g005470mg [Citrus sinensis]
Length=695

 Score =   369 bits (946),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 173/222 (78%), Positives = 195/222 (88%), Gaps = 0/222 (0%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             E E P A++ FRIS PLRE LK+KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAF
Sbjct  104   ESEHPNAVSRFRISVPLREKLKSKGIESLFPIQAMTFDMVLDGSDLVGRARTGQGKTLAF  163

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
             VLPILESLTNGP KA++KTGYGR PSVLVLLPTRELA QV  DF++YGGA+GLTSCCLYG
Sbjct  164   VLPILESLTNGPTKASKKTGYGRAPSVLVLLPTRELAKQVHEDFDVYGGAVGLTSCCLYG  223

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
               PY  QE KLK+G+D+V+GTPGRIKDHI RGNIDL+SLKFRVLDE DEMLR+GFVEDVE
Sbjct  224   GAPYHAQEFKLKKGIDVVIGTPGRIKDHIERGNIDLSSLKFRVLDEADEMLRMGFVEDVE  283

Query  1015  FILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILGKV D  +VQTLLFSATL  WVKHI++KFLK DKKT+D+
Sbjct  284   LILGKVEDANKVQTLLFSATLPSWVKHISTKFLKSDKKTIDL  325



>gb|KJB39373.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=544

 Score =   364 bits (934),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/222 (78%), Positives = 194/222 (87%), Gaps = 0/222 (0%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  108   KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTGQGKTLAF  167

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
             VLPILESLTNGP K++R +GYGR PSVLVLLPTRELA QVF DFE+YG A+GLTSCCLYG
Sbjct  168   VLPILESLTNGPGKSSRTSGYGRAPSVLVLLPTRELAKQVFEDFEVYGEAVGLTSCCLYG  227

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
               PY  QEMKLKRGVDIVVGTPGR+KDHI RGNI L SL FRVLDE DEMLR+GFV+DVE
Sbjct  228   GAPYHTQEMKLKRGVDIVVGTPGRVKDHIERGNIHLGSLTFRVLDEADEMLRMGFVDDVE  287

Query  1015  FILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILGKVAD  +VQT+LFSATL DWVK IAS+FLKP KKTVD+
Sbjct  288   LILGKVADASKVQTVLFSATLPDWVKGIASRFLKPSKKTVDL  329



>ref|XP_011030003.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Populus 
euphratica]
Length=685

 Score =   368 bits (945),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 174/220 (79%), Positives = 195/220 (89%), Gaps = 0/220 (0%)
 Frame = +1

Query  481   EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
             EDP A+T FRIS+PLREALK +GIE+LF IQA TFE +L+G D+VGRARTGQGKTLAFVL
Sbjct  95    EDPNAVTRFRISEPLREALKKRGIEALFPIQARTFEDILNGCDLVGRARTGQGKTLAFVL  154

Query  661   PILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNT  840
             PILESL NGPAKA+RKTGYGRPPSVLVLLPTRELA QVF DF +YGGA+GL SCC+YG  
Sbjct  155   PILESLVNGPAKASRKTGYGRPPSVLVLLPTRELATQVFDDFRVYGGAVGLNSCCVYGGA  214

Query  841   PYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFI  1020
              Y  QE+ LKRGVDIVVGTPGRIKDHI +GNIDL+ LKFRVLDE DEMLR+GFVEDVE I
Sbjct  215   SYQPQELALKRGVDIVVGTPGRIKDHIEKGNIDLSLLKFRVLDESDEMLRMGFVEDVELI  274

Query  1021  LGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             LGKV DVK+VQTLLFSATL DWVK+I+S+FLKP KKT+D+
Sbjct  275   LGKVEDVKKVQTLLFSATLPDWVKNISSRFLKPTKKTIDL  314



>gb|KJB39371.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=571

 Score =   364 bits (935),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 174/222 (78%), Positives = 194/222 (87%), Gaps = 0/222 (0%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  108   KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTGQGKTLAF  167

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
             VLPILESLTNGP K++R +GYGR PSVLVLLPTRELA QVF DFE+YG A+GLTSCCLYG
Sbjct  168   VLPILESLTNGPGKSSRTSGYGRAPSVLVLLPTRELAKQVFEDFEVYGEAVGLTSCCLYG  227

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
               PY  QEMKLKRGVDIVVGTPGR+KDHI RGNI L SL FRVLDE DEMLR+GFV+DVE
Sbjct  228   GAPYHTQEMKLKRGVDIVVGTPGRVKDHIERGNIHLGSLTFRVLDEADEMLRMGFVDDVE  287

Query  1015  FILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILGKVAD  +VQT+LFSATL DWVK IAS+FLKP KKTVD+
Sbjct  288   LILGKVADASKVQTVLFSATLPDWVKGIASRFLKPSKKTVDL  329



>ref|XP_010109082.1| DEAD-box ATP-dependent RNA helicase 7 [Morus notabilis]
 gb|EXC20882.1| DEAD-box ATP-dependent RNA helicase 7 [Morus notabilis]
Length=703

 Score =   368 bits (944),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 175/227 (77%), Positives = 199/227 (88%), Gaps = 1/227 (0%)
 Frame = +1

Query  463   GGDEE-EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
             GG+E+ EE P AI+ FRIS PL+  LK KGIESLF IQAMT + +LDG+D+VGRARTGQG
Sbjct  104   GGEEKSEEHPNAISKFRISAPLKAKLKEKGIESLFPIQAMTLDTILDGSDLVGRARTGQG  163

Query  640   KTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTS  819
             KTLAFVLPILESLTNGPAKA+RKTGYGR PSVLVLLPTRELA QVF +FE+YG ALGLTS
Sbjct  164   KTLAFVLPILESLTNGPAKASRKTGYGRSPSVLVLLPTRELATQVFAEFEVYGAALGLTS  223

Query  820   CCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGF  999
             CCLYG +PY  QE KLKRGVDI+VGTPGR+KDHI R N+DLTSLKFRVLDE DEMLR+GF
Sbjct  224   CCLYGGSPYHSQEAKLKRGVDIIVGTPGRVKDHIERNNLDLTSLKFRVLDEADEMLRMGF  283

Query  1000  VEDVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VEDVE ILG+V D+ +VQTLLFSATL +WVK IA++FLK +KKTVD+
Sbjct  284   VEDVELILGQVEDLSKVQTLLFSATLPNWVKDIATRFLKQNKKTVDL  330



>ref|XP_002318863.2| DEAD box RNA helicase family protein [Populus trichocarpa]
 gb|EEE97083.2| DEAD box RNA helicase family protein [Populus trichocarpa]
Length=687

 Score =   367 bits (942),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 173/220 (79%), Positives = 195/220 (89%), Gaps = 0/220 (0%)
 Frame = +1

Query  481   EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
             EDP A+T FRIS+PLREALK +GIE+LF IQA TFE +L+G D+VGRARTGQGKTLAFVL
Sbjct  95    EDPNAVTRFRISEPLREALKKRGIEALFPIQARTFEDILNGCDLVGRARTGQGKTLAFVL  154

Query  661   PILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNT  840
             PILESL NGPAKA+RKTGYGRPPSVLVLLPTRELA QVF DF++YGGA+GL SCC+YG  
Sbjct  155   PILESLVNGPAKASRKTGYGRPPSVLVLLPTRELATQVFEDFKVYGGAVGLNSCCVYGGA  214

Query  841   PYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFI  1020
              Y  QE  LKRGVDIVVGTPGRIKDHI +GNIDL+ LKFRVLDE DEMLR+GFVEDVE I
Sbjct  215   SYQPQEFALKRGVDIVVGTPGRIKDHIEKGNIDLSLLKFRVLDESDEMLRMGFVEDVELI  274

Query  1021  LGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             LGKV DV++VQTLLFSATL DWVK+I+S+FLKP KKT+D+
Sbjct  275   LGKVEDVRKVQTLLFSATLPDWVKNISSRFLKPTKKTIDL  314



>ref|XP_002269873.2| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Vitis vinifera]
Length=711

 Score =   368 bits (944),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 193/219 (88%), Gaps = 0/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             +P A++NFRIS+PLRE LK+KGIE+LF IQAMTF+ +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  117   NPNALSNFRISEPLREKLKSKGIEALFPIQAMTFDTILDGSDLVGRARTGQGKTLAFVLP  176

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             ILESL NGP + +RKTGYGRPP VLVLLPTRELA QV+ DF++YGGA+GLTSCCLYG  P
Sbjct  177   ILESLINGPNRGSRKTGYGRPPCVLVLLPTRELATQVYADFDVYGGAIGLTSCCLYGGAP  236

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
             Y  QE+KLKRGVDIVVGTPGRIKDHI RGNID +SLKFRVLDE DEMLR+GFVEDVE IL
Sbjct  237   YQAQEIKLKRGVDIVVGTPGRIKDHIERGNIDFSSLKFRVLDEADEMLRMGFVEDVELIL  296

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             GKV DV +VQTLLFSATL  WVK I+S+FLKP  KT D+
Sbjct  297   GKVEDVSKVQTLLFSATLPGWVKEISSRFLKPTLKTADL  335



>gb|AAF40306.1|AF156667_1 RNA helicase [Vigna radiata]
Length=713

 Score =   366 bits (940),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 193/219 (88%), Gaps = 0/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             DP A++  RIS+PLR  LK KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAFVLP
Sbjct  127   DPNAVSKLRISEPLRLKLKEKGIESLFPIQAMTFDLVLDGSDLVGRARTGQGKTLAFVLP  186

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             ILESL NGP K++RKTGYGR PSVLVLLPTRELA +V  DFE+YGGA+GL+SCCLYG  P
Sbjct  187   ILESLINGPTKSSRKTGYGRTPSVLVLLPTRELACRVHADFEVYGGAMGLSSCCLYGGAP  246

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
             Y  QE+KL+RGVDIV+GTPGR+KDHI RGNIDL+ LKFRVLDE DEMLR+GFVEDVE IL
Sbjct  247   YNTQEIKLRRGVDIVIGTPGRVKDHIERGNIDLSQLKFRVLDEADEMLRMGFVEDVELIL  306

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             GKV +V +VQTLLFSATL DWVKHIA++FLKPDKKT D+
Sbjct  307   GKVENVNKVQTLLFSATLPDWVKHIAAQFLKPDKKTADL  345



>gb|EYU25021.1| hypothetical protein MIMGU_mgv1a027128mg [Erythranthe guttata]
Length=591

 Score =   362 bits (929),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 175/223 (78%), Positives = 193/223 (87%), Gaps = 5/223 (2%)
 Frame = +1

Query  472   EEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLA  651
             EE+E P A++NFRISKPLREALK KGIESLF IQA TF+ +L G+D+VGRARTGQGKTLA
Sbjct  7     EEDETPNAVSNFRISKPLREALKEKGIESLFPIQATTFDTILHGSDLVGRARTGQGKTLA  66

Query  652   FVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLY  831
             FVLPILESL NGP K +RKTGYGR PSVLVLLPTRELA QV +DFEMYGGALGL SCCLY
Sbjct  67    FVLPILESLINGPTKTSRKTGYGRAPSVLVLLPTRELATQVCSDFEMYGGALGLKSCCLY  126

Query  832   GNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDV  1011
             G +PY  Q+++LKRGVDIV+GTPGRIKDHI RGNID T+LKFRVLDE DEMLR+GFVEDV
Sbjct  127   GGSPYQPQQIQLKRGVDIVIGTPGRIKDHIERGNIDFTALKFRVLDESDEMLRMGFVEDV  186

Query  1012  EFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             E ILG      QVQTLLFSATL DWVKHIA+KFLK DKKT D+
Sbjct  187   ELILG-----FQVQTLLFSATLPDWVKHIAAKFLKRDKKTADL  224



>gb|KHG06829.1| DEAD-box ATP-dependent RNA helicase 7 [Gossypium arboreum]
Length=695

 Score =   365 bits (936),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 174/222 (78%), Positives = 194/222 (87%), Gaps = 0/222 (0%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  106   KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTGQGKTLAF  165

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
             VLPILESLTNGP K++R +GYGR PSVLVLLPTRELA QVF DFE+YG A+GLTSCCLYG
Sbjct  166   VLPILESLTNGPGKSSRTSGYGRAPSVLVLLPTRELAKQVFEDFEVYGEAVGLTSCCLYG  225

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
               PY  QEMKLKRGVDIVVGTPGR+KDHI RGNI L SL FRVLDE DEMLR+GFV+DVE
Sbjct  226   GAPYHTQEMKLKRGVDIVVGTPGRVKDHIERGNIHLGSLTFRVLDEADEMLRMGFVDDVE  285

Query  1015  FILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILGKVAD  +VQT+LFSATL DWVK IAS+FLKP KKTVD+
Sbjct  286   LILGKVADASKVQTVLFSATLPDWVKGIASRFLKPSKKTVDL  327



>gb|KJB39369.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=697

 Score =   365 bits (936),  Expect = 5e-116, Method: Compositional matrix adjust.
 Identities = 174/222 (78%), Positives = 194/222 (87%), Gaps = 0/222 (0%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  108   KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTGQGKTLAF  167

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
             VLPILESLTNGP K++R +GYGR PSVLVLLPTRELA QVF DFE+YG A+GLTSCCLYG
Sbjct  168   VLPILESLTNGPGKSSRTSGYGRAPSVLVLLPTRELAKQVFEDFEVYGEAVGLTSCCLYG  227

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
               PY  QEMKLKRGVDIVVGTPGR+KDHI RGNI L SL FRVLDE DEMLR+GFV+DVE
Sbjct  228   GAPYHTQEMKLKRGVDIVVGTPGRVKDHIERGNIHLGSLTFRVLDEADEMLRMGFVDDVE  287

Query  1015  FILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILGKVAD  +VQT+LFSATL DWVK IAS+FLKP KKTVD+
Sbjct  288   LILGKVADASKVQTVLFSATLPDWVKGIASRFLKPSKKTVDL  329



>gb|KJB39370.1| hypothetical protein B456_007G009400 [Gossypium raimondii]
Length=687

 Score =   364 bits (935),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 174/222 (78%), Positives = 194/222 (87%), Gaps = 0/222 (0%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  108   KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTGQGKTLAF  167

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
             VLPILESLTNGP K++R +GYGR PSVLVLLPTRELA QVF DFE+YG A+GLTSCCLYG
Sbjct  168   VLPILESLTNGPGKSSRTSGYGRAPSVLVLLPTRELAKQVFEDFEVYGEAVGLTSCCLYG  227

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
               PY  QEMKLKRGVDIVVGTPGR+KDHI RGNI L SL FRVLDE DEMLR+GFV+DVE
Sbjct  228   GAPYHTQEMKLKRGVDIVVGTPGRVKDHIERGNIHLGSLTFRVLDEADEMLRMGFVDDVE  287

Query  1015  FILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILGKVAD  +VQT+LFSATL DWVK IAS+FLKP KKTVD+
Sbjct  288   LILGKVADASKVQTVLFSATLPDWVKGIASRFLKPSKKTVDL  329



>ref|XP_010034995.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Eucalyptus 
grandis]
 gb|KCW46257.1| hypothetical protein EUGRSUZ_K00136 [Eucalyptus grandis]
Length=703

 Score =   364 bits (935),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 173/228 (76%), Positives = 197/228 (86%), Gaps = 3/228 (1%)
 Frame = +1

Query  466   GDEE---EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQ  636
             GD+E   EE+P A++NFRIS  LR  LK   IE+LF IQAMTF+ VLDGTD+VGRARTGQ
Sbjct  115   GDDEVAQEENPNAVSNFRISDSLRLKLKDNKIEALFPIQAMTFDIVLDGTDLVGRARTGQ  174

Query  637   GKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLT  816
             GKTLAFVLP+LESLTNGPAK +RKTGYGRPPSVLVLLPTRELA QVF+DFE+YGGA+GLT
Sbjct  175   GKTLAFVLPLLESLTNGPAKTSRKTGYGRPPSVLVLLPTRELAKQVFSDFEVYGGAVGLT  234

Query  817   SCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIG  996
             SCCLYG  PY  QE  L+RGVDIV+GTPGR+KDHI RGNIDL+SL FRVLDE DEMLR+G
Sbjct  235   SCCLYGGAPYHAQESHLRRGVDIVIGTPGRVKDHIERGNIDLSSLTFRVLDEADEMLRMG  294

Query  997   FVEDVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             FVEDVE ILGKV D  +VQTLLFSATL DWVK I+S+FLK +K+T+D+
Sbjct  295   FVEDVELILGKVKDTSKVQTLLFSATLPDWVKGISSRFLKQNKRTIDL  342



>ref|XP_008234340.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Prunus mume]
Length=690

 Score =   363 bits (931),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/219 (77%), Positives = 193/219 (88%), Gaps = 0/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             DP A++ FRIS+PL+  LK KGIESLF IQAMTF+ +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  109   DPNAVSRFRISEPLKAKLKEKGIESLFSIQAMTFDTILDGSDLVGRARTGQGKTLAFVLP  168

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             ILESL NGPAKA RKTGYGR P+V+VLLPTRELA QVF DFE YGGA+GL +CC+YG +P
Sbjct  169   ILESLINGPAKAFRKTGYGRAPTVIVLLPTRELAKQVFADFEFYGGAMGLAACCVYGGSP  228

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
             Y  QE KLKRGVDIV+GTPGRIKDHI +GNIDL++LKFRVLDE DEMLR+GFV+DVE IL
Sbjct  229   YQPQEYKLKRGVDIVIGTPGRIKDHIEKGNIDLSTLKFRVLDEADEMLRMGFVDDVELIL  288

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             GKV DV +VQTLLFSATL DWVK I+S+FLKP+KKT D+
Sbjct  289   GKVGDVSKVQTLLFSATLPDWVKGISSRFLKPNKKTADL  327



>ref|XP_007220217.1| hypothetical protein PRUPE_ppa002304mg [Prunus persica]
 gb|EMJ21416.1| hypothetical protein PRUPE_ppa002304mg [Prunus persica]
Length=690

 Score =   362 bits (930),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 168/219 (77%), Positives = 193/219 (88%), Gaps = 0/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             DP A++ FRIS+PL+  LK KGIESLF IQAMTF+ +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  109   DPNAVSRFRISEPLKAKLKEKGIESLFSIQAMTFDTILDGSDLVGRARTGQGKTLAFVLP  168

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             ILESL NGPAKA RKTGYGR P+V+VLLPTRELA QVF DFE YGGA+GL +CC+YG +P
Sbjct  169   ILESLINGPAKAFRKTGYGRAPTVIVLLPTRELAKQVFADFEFYGGAMGLAACCVYGGSP  228

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
             Y  QE KLKRGVDIV+GTPGRIKDHI +GNIDL++LKFRVLDE DEMLR+GFV+DVE IL
Sbjct  229   YQPQEYKLKRGVDIVIGTPGRIKDHIEKGNIDLSTLKFRVLDEADEMLRMGFVDDVELIL  288

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             GKV DV +VQTLLFSATL DWVK I+S+FLKP+KKT D+
Sbjct  289   GKVGDVSKVQTLLFSATLPDWVKGISSRFLKPNKKTADL  327



>gb|KHG06828.1| DEAD-box ATP-dependent RNA helicase 7 [Gossypium arboreum]
Length=722

 Score =   363 bits (932),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 174/222 (78%), Positives = 194/222 (87%), Gaps = 0/222 (0%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             + EDP AI+ FRIS+ LRE LK+KGIE+LF IQAMTF+ +LDGTD+VGRARTGQGKTLAF
Sbjct  106   KSEDPNAISRFRISEALREKLKSKGIEALFPIQAMTFDMILDGTDLVGRARTGQGKTLAF  165

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
             VLPILESLTNGP K++R +GYGR PSVLVLLPTRELA QVF DFE+YG A+GLTSCCLYG
Sbjct  166   VLPILESLTNGPGKSSRTSGYGRAPSVLVLLPTRELAKQVFEDFEVYGEAVGLTSCCLYG  225

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
               PY  QEMKLKRGVDIVVGTPGR+KDHI RGNI L SL FRVLDE DEMLR+GFV+DVE
Sbjct  226   GAPYHTQEMKLKRGVDIVVGTPGRVKDHIERGNIHLGSLTFRVLDEADEMLRMGFVDDVE  285

Query  1015  FILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILGKVAD  +VQT+LFSATL DWVK IAS+FLKP KKTVD+
Sbjct  286   LILGKVADASKVQTVLFSATLPDWVKGIASRFLKPSKKTVDL  327



>ref|XP_007143335.1| hypothetical protein PHAVU_007G063700g [Phaseolus vulgaris]
 gb|ESW15329.1| hypothetical protein PHAVU_007G063700g [Phaseolus vulgaris]
Length=713

 Score =   362 bits (929),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 169/219 (77%), Positives = 194/219 (89%), Gaps = 0/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             DP A++ FRIS+PLR  LK KGIESLF IQAMTF+ VLDG+D+VGRARTGQGKTLAFVLP
Sbjct  127   DPNAVSKFRISEPLRLKLKEKGIESLFPIQAMTFDLVLDGSDLVGRARTGQGKTLAFVLP  186

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             ILESLTNGPAK+TRKTGYGR PSVLVLLPTRELA QV +DFE+YGGA+GL++CCLYG  P
Sbjct  187   ILESLTNGPAKSTRKTGYGRTPSVLVLLPTRELACQVHSDFEVYGGAMGLSACCLYGGAP  246

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
             Y  QE+KL+RGVDIV+GTPGR+KDHI RGNIDL+ LKFRVLDE DEMLR+GF+EDVE IL
Sbjct  247   YNTQEIKLRRGVDIVIGTPGRVKDHIERGNIDLSQLKFRVLDEADEMLRMGFIEDVELIL  306

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             GKV +V +VQTLLFSATL   +K IA++FLKPDKKT D+
Sbjct  307   GKVENVNKVQTLLFSATLPYSIKQIAAQFLKPDKKTADL  345



>ref|XP_009343503.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=683

 Score =   361 bits (926),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 192/221 (87%), Gaps = 0/221 (0%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             +EDP A++ FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTGQGKTLAFV
Sbjct  105   KEDPNAVSKFRISAPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTGQGKTLAFV  164

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             LP+LESLTNGPA+  RKTGYGRPP+V+VLLPTRELA QVF DFE YGGA+GL +CC+YG 
Sbjct  165   LPVLESLTNGPAREFRKTGYGRPPTVIVLLPTRELAKQVFADFEAYGGAVGLAACCVYGG  224

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             +PY  QE KL+RGVD+V+GTPGRIKDHI RGNIDL++LK R+LDE DEMLR+GFV+DVE 
Sbjct  225   SPYGAQESKLRRGVDVVIGTPGRIKDHIERGNIDLSTLKVRILDEADEMLRMGFVDDVEL  284

Query  1018  ILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             ILGKV DV +VQTLLFSATL  WVK I+S+FLKPDKKTVD+
Sbjct  285   ILGKVKDVSKVQTLLFSATLPSWVKGISSRFLKPDKKTVDL  325



>ref|XP_009349718.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=683

 Score =   360 bits (925),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 192/221 (87%), Gaps = 0/221 (0%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             +EDP A++ FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTGQGKTLAFV
Sbjct  105   KEDPNAVSKFRISAPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTGQGKTLAFV  164

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             LP+LESLTNGPA+  RKTGYGRPP+V+VLLPTRELA QVF DFE YGGA+GL +CC+YG 
Sbjct  165   LPVLESLTNGPAREFRKTGYGRPPTVIVLLPTRELAKQVFADFEAYGGAVGLAACCVYGG  224

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             +PY  QE KL+RGVD+V+GTPGRIKDHI RGNIDL++LK R+LDE DEMLR+GFV+DVE 
Sbjct  225   SPYGAQESKLRRGVDVVIGTPGRIKDHIERGNIDLSTLKVRILDEADEMLRMGFVDDVEL  284

Query  1018  ILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             ILGKV DV +VQTLLFSATL  WVK I+S+FLKPDKKTVD+
Sbjct  285   ILGKVKDVSKVQTLLFSATLPSWVKGISSRFLKPDKKTVDL  325



>ref|XP_008364874.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Malus 
domestica]
Length=683

 Score =   360 bits (924),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 167/219 (76%), Positives = 190/219 (87%), Gaps = 0/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             DP A++ FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTGQGKTLAFVLP
Sbjct  104   DPNAVSKFRISAPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTGQGKTLAFVLP  163

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             +LESLTNGPAKA RKTGYGRPP+V+VLLPTRELA QVF DFE YGGA+GL +CC+YG +P
Sbjct  164   VLESLTNGPAKAFRKTGYGRPPTVIVLLPTRELAKQVFADFEAYGGAVGLAACCVYGGSP  223

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
             Y  QE KL+RGVDIV+GTPGRIKDHI RGNIDL++LK R+LDE DEMLR+GFV+DVE IL
Sbjct  224   YGAQESKLRRGVDIVIGTPGRIKDHIERGNIDLSTLKVRILDEADEMLRMGFVDDVELIL  283

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             GKV DV +VQTLLFSATL  WVK I+ +FLKPDKKTVD+
Sbjct  284   GKVKDVSKVQTLLFSATLPSWVKGISXRFLKPDKKTVDL  322



>ref|XP_008376504.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Malus domestica]
Length=686

 Score =   360 bits (924),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 166/221 (75%), Positives = 192/221 (87%), Gaps = 0/221 (0%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             +EDP A++ FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTGQGKTLAFV
Sbjct  108   KEDPNAVSKFRISVPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTGQGKTLAFV  167

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             LP+LESLTNGPA+  RKTGYGRPP+V+VLLPTRELA QVF DFE YGGA+GL +CC+YG 
Sbjct  168   LPVLESLTNGPAREFRKTGYGRPPTVIVLLPTRELAKQVFADFEAYGGAVGLAACCVYGG  227

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             +PY  QE KL+RGVD+V+GTPGRIKDHI RGNIDL++LK R+LDE DEMLR+GFV+DVE 
Sbjct  228   SPYGAQESKLRRGVDVVIGTPGRIKDHIERGNIDLSTLKVRILDEADEMLRMGFVDDVEL  287

Query  1018  ILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             ILGKV DV +VQTLLFSATL  WVK I+S+FLKPDKKTVD+
Sbjct  288   ILGKVKDVSKVQTLLFSATLPSWVKGISSRFLKPDKKTVDL  328



>ref|XP_010555319.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Tarenaya hassleriana]
Length=687

 Score =   360 bits (923),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 170/219 (78%), Positives = 192/219 (88%), Gaps = 0/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             +P A+T FRIS P+   LK KGI +LF IQAMTF+ VLDG+D+VGRARTGQGKTLAFVLP
Sbjct  107   NPNAVTKFRISTPVVNKLKEKGIAALFPIQAMTFDMVLDGSDLVGRARTGQGKTLAFVLP  166

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             ILESLTNGP+ A+RKTGYGRPPSVLVLLPTRELA QVF DF++YGGA+GL+SCCLYG   
Sbjct  167   ILESLTNGPSNASRKTGYGRPPSVLVLLPTRELAKQVFADFDVYGGAVGLSSCCLYGGDS  226

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
             Y  QE KLKRGVDIVVGTPGRIKDHI RGNIDL+ LKFRVLDE DEMLR+GFVEDVE IL
Sbjct  227   YQPQEYKLKRGVDIVVGTPGRIKDHIERGNIDLSFLKFRVLDEADEMLRMGFVEDVELIL  286

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             GKV D  +VQTLLFSATL DWVK+I+S+FLKP+KKT+D+
Sbjct  287   GKVQDATKVQTLLFSATLPDWVKNISSRFLKPNKKTIDL  325



>ref|XP_006394423.1| hypothetical protein EUTSA_v10003756mg [Eutrema salsugineum]
 gb|ESQ31709.1| hypothetical protein EUTSA_v10003756mg [Eutrema salsugineum]
Length=679

 Score =   359 bits (922),  Expect = 4e-114, Method: Compositional matrix adjust.
 Identities = 170/224 (76%), Positives = 193/224 (86%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             D E ++P A++ FRIS PLRE LK KGIE+LF IQAMTF+ VLDG D+VGRARTGQGKTL
Sbjct  102   DVEVDNPNAVSRFRISAPLREKLKQKGIEALFPIQAMTFDMVLDGADLVGRARTGQGKTL  161

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NGPA++ RK GYGRPPSVLVLLPTRELA QVF DFE YGGA+GLTSCC+
Sbjct  162   AFVLPILESLINGPAQSKRKNGYGRPPSVLVLLPTRELAKQVFADFEAYGGAVGLTSCCV  221

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG  PY  QE KLKRGVDIVVGTPGRIKDHI R N+DL+ L+FRVLDE DEMLR+GFV+D
Sbjct  222   YGGDPYQPQEYKLKRGVDIVVGTPGRIKDHIERQNLDLSYLQFRVLDEADEMLRMGFVDD  281

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILGKV D K+VQTLLFSATL  WV+ IA++FLKP+KKT+D+
Sbjct  282   VELILGKVEDPKKVQTLLFSATLPSWVQKIAARFLKPEKKTIDL  325



>ref|XP_002510890.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
 gb|EEF51492.1| dead box ATP-dependent RNA helicase, putative [Ricinus communis]
Length=690

 Score =   358 bits (920),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 180/252 (71%), Positives = 207/252 (82%), Gaps = 5/252 (2%)
 Frame = +1

Query  400   LVEPVNFkaekkkkakLMEAVGGD-----EEEEDPYAITNFRISKPLREALKAKGIESLF  564
             LVEPVN K +KK K   +     D      EE+ P AI+ +RIS+ LRE LK+KGI+SLF
Sbjct  70    LVEPVNLKTKKKNKKAKIADENEDGEVETAEEDHPNAISKYRISESLREKLKSKGIQSLF  129

Query  565   KIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVL  744
              IQAMTF+ +LDG+D+VGRARTGQGKTLAFVLPILES+TNG AK +RKTGYGRPPSVLVL
Sbjct  130   PIQAMTFDDILDGSDLVGRARTGQGKTLAFVLPILESITNGHAKESRKTGYGRPPSVLVL  189

Query  745   LPTRELALQVFTDFEMYGGALGLTSCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIM  924
             LPTRELA QVF DF++YG +LGLTSCCLYG   Y  QEM LKRGVDIVVGTPGR+KDHI 
Sbjct  190   LPTRELASQVFDDFKVYGESLGLTSCCLYGGASYHPQEMSLKRGVDIVVGTPGRVKDHIE  249

Query  925   RGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILGKVADVKQVQTLLFSATLQDWVKHIAS  1104
             RGNI+L+ LKFRVLDE DEMLR+GFVEDVE ILGKV DV +VQTLLFSATL +WVK I+S
Sbjct  250   RGNINLSYLKFRVLDEADEMLRMGFVEDVELILGKVEDVSKVQTLLFSATLPEWVKQISS  309

Query  1105  KFLKPDKKTVDI  1140
             +FLK  KKT+D+
Sbjct  310   RFLKASKKTIDL  321



>ref|XP_004496646.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Cicer arietinum]
Length=631

 Score =   357 bits (915),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 171/220 (78%), Positives = 194/220 (88%), Gaps = 2/220 (1%)
 Frame = +1

Query  481   EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
             +DP A++ FRIS+PLRE LK KGIESLF IQAMTF+ VL+G+D+VGRARTGQGKTLAFVL
Sbjct  44    DDPNAVSKFRISEPLREKLKEKGIESLFPIQAMTFDLVLNGSDLVGRARTGQGKTLAFVL  103

Query  661   PILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNT  840
             PILES+ NGPAKA+RK GYGRPPSVLVLLPTRELA QV  DFE+YGGA+GLTSCCL G +
Sbjct  104   PILESVANGPAKASRKIGYGRPPSVLVLLPTRELASQVNADFEVYGGAMGLTSCCLIGGS  163

Query  841   PYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFI  1020
              Y  QE  LKRGVDIV+GTPGRIKD+IMRGNIDL+ LKFRVLDE DEMLR+GFV+DVE I
Sbjct  164   SYQVQE--LKRGVDIVIGTPGRIKDNIMRGNIDLSQLKFRVLDEADEMLRMGFVQDVELI  221

Query  1021  LGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             LGKV +V+ VQTLLFSATL DWVK+IA +FLKPDKKT D+
Sbjct  222   LGKVKNVENVQTLLFSATLPDWVKNIAVRFLKPDKKTADL  261



>ref|XP_004496645.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Cicer arietinum]
Length=666

 Score =   357 bits (916),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/220 (78%), Positives = 194/220 (88%), Gaps = 2/220 (1%)
 Frame = +1

Query  481   EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
             +DP A++ FRIS+PLRE LK KGIESLF IQAMTF+ VL+G+D+VGRARTGQGKTLAFVL
Sbjct  44    DDPNAVSKFRISEPLREKLKEKGIESLFPIQAMTFDLVLNGSDLVGRARTGQGKTLAFVL  103

Query  661   PILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNT  840
             PILES+ NGPAKA+RK GYGRPPSVLVLLPTRELA QV  DFE+YGGA+GLTSCCL G +
Sbjct  104   PILESVANGPAKASRKIGYGRPPSVLVLLPTRELASQVNADFEVYGGAMGLTSCCLIGGS  163

Query  841   PYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFI  1020
              Y  QE  LKRGVDIV+GTPGRIKD+IMRGNIDL+ LKFRVLDE DEMLR+GFV+DVE I
Sbjct  164   SYQVQE--LKRGVDIVIGTPGRIKDNIMRGNIDLSQLKFRVLDEADEMLRMGFVQDVELI  221

Query  1021  LGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             LGKV +V+ VQTLLFSATL DWVK+IA +FLKPDKKT D+
Sbjct  222   LGKVKNVENVQTLLFSATLPDWVKNIAVRFLKPDKKTADL  261



>ref|XP_011076505.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Sesamum indicum]
Length=1167

 Score =   369 bits (946),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 176/226 (78%), Positives = 198/226 (88%), Gaps = 0/226 (0%)
 Frame = +1

Query  463   GGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGK  642
             G   E++ P A+++FRIS PL+EALK KGIESLF IQAMTF AVLDG+D+VGRARTGQGK
Sbjct  548   GVKPEDDTPNAVSSFRISNPLKEALKEKGIESLFPIQAMTFNAVLDGSDLVGRARTGQGK  607

Query  643   TLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSC  822
             TLAFVLPILESLTNGP +A+RKTGYGR PSVLVLLPTRELA QVF+DFE+YGGALGL SC
Sbjct  608   TLAFVLPILESLTNGPTRASRKTGYGRAPSVLVLLPTRELATQVFSDFEVYGGALGLKSC  667

Query  823   CLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFV  1002
             CLYG +PY  Q ++LKRGVDIVVGTPGRIKDHI RGNIDL+++ FRVLDE DEMLR+GFV
Sbjct  668   CLYGGSPYQPQHVQLKRGVDIVVGTPGRIKDHIERGNIDLSAIIFRVLDEADEMLRMGFV  727

Query  1003  EDVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             EDVE IL KV D  +VQTLLFSATL DWVKHIA+KFLK DKKT D+
Sbjct  728   EDVELILSKVRDASKVQTLLFSATLPDWVKHIAAKFLKQDKKTADL  773



>ref|XP_011041667.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Populus 
euphratica]
Length=684

 Score =   357 bits (917),  Expect = 3e-113, Method: Compositional matrix adjust.
 Identities = 169/219 (77%), Positives = 189/219 (86%), Gaps = 0/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             DP A+T FRIS+PLRE LK +GIE+LF IQA TFE +L+G D+VGRARTGQGKTLAFVLP
Sbjct  98    DPNAVTRFRISEPLRETLKKRGIEALFPIQARTFEDILNGGDLVGRARTGQGKTLAFVLP  157

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             ILESL NGPAKA+RKTGYGRPPSVLVLLPTRELA QVF DF++YGGA+GL SCC+YG   
Sbjct  158   ILESLVNGPAKASRKTGYGRPPSVLVLLPTRELATQVFDDFKVYGGAMGLNSCCVYGGAS  217

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
             Y  QE  LKRGVD+VVGTPGR KDHI +GNIDL+ LKFRVLDE DEMLR+GFVEDVE IL
Sbjct  218   YQPQEFALKRGVDVVVGTPGRTKDHIEKGNIDLSLLKFRVLDEADEMLRMGFVEDVELIL  277

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             GKV DV +VQTLLFSATL  WVK I+SKFLKP KKT+D+
Sbjct  278   GKVKDVNKVQTLLFSATLPGWVKQISSKFLKPTKKTIDL  316



>ref|XP_004308148.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Fragaria vesca 
subsp. vesca]
Length=680

 Score =   355 bits (912),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 165/220 (75%), Positives = 192/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  481   EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
             +DP A+T FRIS PLR  LK KGIE+LF IQAMTF+ +LDG+D+VGRARTGQGKTLAFVL
Sbjct  105   DDPNAVTKFRISAPLRAKLKEKGIEALFSIQAMTFDTILDGSDLVGRARTGQGKTLAFVL  164

Query  661   PILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNT  840
             PILESL NG AK  RKTGYGR P+V+VLLPTRELA QVF DFE YGGA+G+T+CC+YG +
Sbjct  165   PILESLINGSAKEFRKTGYGRAPTVIVLLPTRELAKQVFADFEFYGGAVGITACCVYGGS  224

Query  841   PYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFI  1020
             PYA QE KLKRGVD++VGTPGRIKDHI RGNIDL++LKFR+LDE DEMLR+GFV+DVE I
Sbjct  225   PYATQEYKLKRGVDVIVGTPGRIKDHIERGNIDLSTLKFRILDEADEMLRMGFVDDVEQI  284

Query  1021  LGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             LGKV DV +VQTLLFSATL  WV++I+ +FLK DKKTVD+
Sbjct  285   LGKVKDVTKVQTLLFSATLPSWVQNISKRFLKSDKKTVDL  324



>ref|XP_002322430.2| DEAD box RNA helicase family protein [Populus trichocarpa]
 gb|EEF06557.2| DEAD box RNA helicase family protein [Populus trichocarpa]
Length=680

 Score =   355 bits (911),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 169/219 (77%), Positives = 189/219 (86%), Gaps = 0/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             DP A+T FRIS+PLRE LK +GIE+LF IQA TFE +L+G D+VGRARTGQGKTLAFVLP
Sbjct  100   DPNAVTRFRISEPLREVLKKRGIEALFPIQARTFEDILNGGDLVGRARTGQGKTLAFVLP  159

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             ILESL NG AKA+RKTGYGRPPSVLVLLPTRELA QVF DF++YGGA+GL SCC+YG   
Sbjct  160   ILESLVNGLAKASRKTGYGRPPSVLVLLPTRELATQVFDDFKVYGGAMGLDSCCVYGGAS  219

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
             Y  QE  LKRGVD+VVGTPGRIKDHI +GNIDL+ LKFRVLDE DEMLR+GFVEDVE IL
Sbjct  220   YQPQEFALKRGVDVVVGTPGRIKDHIEKGNIDLSLLKFRVLDEADEMLRMGFVEDVELIL  279

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             GKV DV +VQTLLFSATL  WVK I+SKFLKP KKT+D+
Sbjct  280   GKVKDVNKVQTLLFSATLPGWVKQISSKFLKPTKKTIDL  318



>gb|KFK27951.1| hypothetical protein AALP_AA8G452500 [Arabis alpina]
Length=683

 Score =   355 bits (911),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 165/219 (75%), Positives = 193/219 (88%), Gaps = 0/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             +P A++ FRIS PLRE LK KGIE+LF IQAMTF+ VLDG D+VGRARTGQGKTLAFVLP
Sbjct  108   NPNAVSKFRISDPLREQLKKKGIEALFPIQAMTFDMVLDGADLVGRARTGQGKTLAFVLP  167

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             ILESL NGPAK+ RK GYGRPPSVLVLLPTRELA QV++DFE YGG++GL+SCC+YG  P
Sbjct  168   ILESLINGPAKSKRKNGYGRPPSVLVLLPTRELAKQVYSDFESYGGSVGLSSCCIYGGDP  227

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
             YA QE KLKRGVDI+VGTPGRIKDH+ +G++DLT L+FRVLDE DEMLR+GFVE+VE IL
Sbjct  228   YAPQEHKLKRGVDIIVGTPGRIKDHLEKGHLDLTYLQFRVLDEADEMLRMGFVEEVELIL  287

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             GKV D K+VQTLLFSATL  WVK+IA+KFLKPD++ +D+
Sbjct  288   GKVEDPKKVQTLLFSATLPTWVKNIAAKFLKPDRELIDL  326



>ref|XP_004506292.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Cicer 
arietinum]
Length=680

 Score =   355 bits (911),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 166/222 (75%), Positives = 192/222 (86%), Gaps = 0/222 (0%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             +++DP A+TNFRIS+PL+  LK KGIE+LF IQAMTF  +LDG+D+VGRARTGQGKTLAF
Sbjct  100   KKDDPNAVTNFRISEPLKMKLKEKGIEALFPIQAMTFNTILDGSDLVGRARTGQGKTLAF  159

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
             VLPILESLTNGPAK+ RKTGYGR PSVLVLLPTRELA QV+ DFE+YG +LGL +C +YG
Sbjct  160   VLPILESLTNGPAKSVRKTGYGRVPSVLVLLPTRELANQVYADFEVYGSSLGLVACAVYG  219

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
               PY  QE KL+RGVDIV+GTPGR+KDHI RGNIDL+ LKFRVLDE DEMLR+GFV+DVE
Sbjct  220   GAPYGAQESKLRRGVDIVIGTPGRVKDHIERGNIDLSHLKFRVLDEADEMLRMGFVDDVE  279

Query  1015  FILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILGKV DV +VQTLLFSATL  WVK I+SKFLK DK+T D+
Sbjct  280   LILGKVQDVTKVQTLLFSATLPSWVKQISSKFLKADKQTADL  321



>ref|XP_009345013.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=858

 Score =   360 bits (923),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 167/219 (76%), Positives = 191/219 (87%), Gaps = 0/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             DP A+  FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTGQGKTLAFVLP
Sbjct  280   DPNAVLKFRISAPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTGQGKTLAFVLP  339

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             +LESLTNGPAKA RKTGYGRPP+V+VLLPTRELA QVF+DFE YGGA+GL +CC+YG +P
Sbjct  340   VLESLTNGPAKAFRKTGYGRPPTVIVLLPTRELAKQVFSDFEAYGGAVGLAACCVYGGSP  399

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
             Y  QE KL+RGVD+V+GTPGRIKDHI RGNIDL++LK R+LDE DEMLR+GFV+DVE IL
Sbjct  400   YGAQESKLRRGVDVVIGTPGRIKDHIERGNIDLSTLKVRILDEADEMLRMGFVDDVELIL  459

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             GKV DV +VQTLLFSATL  WVK I+S+FLKPDKKTVD+
Sbjct  460   GKVKDVSKVQTLLFSATLPSWVKGISSRFLKPDKKTVDL  498



>ref|XP_008812489.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Phoenix 
dactylifera]
Length=718

 Score =   355 bits (912),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 168/219 (77%), Positives = 191/219 (87%), Gaps = 0/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             +P A++ FRISK LRE LK+KGIESLF IQAMTF  +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  134   NPNAVSKFRISKVLREKLKSKGIESLFPIQAMTFNLILDGSDLVGRARTGQGKTLAFVLP  193

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             ILESLTNG  KA+RKTGYGRPPSVLVLLPTRELA QV  DFE+YGGA+GL+SCCLYG +P
Sbjct  194   ILESLTNGQHKASRKTGYGRPPSVLVLLPTRELANQVSADFEVYGGAVGLSSCCLYGGSP  253

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
             Y  QE+ LKRGVDIVVGTPGRIKDH+ RG +DL  LKFRVLDE DEML +GFV+DVE IL
Sbjct  254   YRGQELALKRGVDIVVGTPGRIKDHLERGTLDLKFLKFRVLDEADEMLNMGFVDDVELIL  313

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             GKV DV +VQTLLFSATL DWVK I+++FLKP+KKT D+
Sbjct  314   GKVEDVSKVQTLLFSATLPDWVKKISARFLKPNKKTADL  352



>ref|XP_009407947.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Musa acuminata 
subsp. malaccensis]
Length=712

 Score =   355 bits (911),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 194/224 (87%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             D   +DP A++NFRISK LRE L +KGI++LF IQAMTF+ +LDG D+VGRARTGQGKTL
Sbjct  114   DNAADDPNALSNFRISKVLRETLNSKGIKALFPIQAMTFDLILDGFDLVGRARTGQGKTL  173

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESLTNG  KA+RK+GYGRPPSVLVLLPTRELA QV++DFE+YGG +GL+SCCL
Sbjct  174   AFVLPILESLTNGVHKASRKSGYGRPPSVLVLLPTRELANQVYSDFEVYGGTVGLSSCCL  233

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG +PY  QE+ L+RGVDI+VGTPGRIKDHI RGN+DL +LKFRVLDE DEML +GFV+D
Sbjct  234   YGGSPYRTQEISLRRGVDIIVGTPGRIKDHIERGNLDLKALKFRVLDEADEMLNMGFVDD  293

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILGKV D  +VQTLLFSATL DWVK I+++FLK DKKT D+
Sbjct  294   VELILGKVEDTSKVQTLLFSATLPDWVKKISTRFLKQDKKTADL  337



>ref|XP_009112011.1| PREDICTED: LOW QUALITY PROTEIN: DEAD-box ATP-dependent RNA helicase 
7-like [Brassica rapa]
Length=655

 Score =   352 bits (904),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 191/224 (85%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             D + ++P A++NFRIS PL+  LK KGIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  80    DVKVDNPNAVSNFRISDPLKAKLKEKGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  139

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NGPAK+ RK GYGRPPSVLVLLPTRELA QVF DFE YGGA+GL +CC+
Sbjct  140   AFVLPILESLINGPAKSKRKNGYGRPPSVLVLLPTRELAKQVFADFEAYGGAVGLAACCV  199

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG  PYA QE KLKRGVDIVVGTPGRIKDHI R N+DLT L+FRVLDE DEMLR+GFV+D
Sbjct  200   YGGDPYAPQEHKLKRGVDIVVGTPGRIKDHIERRNLDLTYLQFRVLDEADEMLRMGFVDD  259

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILGKV D K+VQTLLFSATL  WV+ IA++FLK DKKT+D+
Sbjct  260   VELILGKVEDPKKVQTLLFSATLPSWVQTIAARFLKQDKKTIDL  303



>ref|XP_009130201.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Brassica rapa]
Length=667

 Score =   352 bits (904),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 189/220 (86%), Gaps = 0/220 (0%)
 Frame = +1

Query  481   EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
             E+P A++ FRIS PLRE LK KGIE+LF IQA TF+ VLDG D+VGRARTGQGKTLAFVL
Sbjct  99    ENPNAVSKFRISDPLREKLKEKGIEALFPIQATTFDMVLDGADLVGRARTGQGKTLAFVL  158

Query  661   PILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNT  840
             PILESL NGPAK  RK GYGRPPSVLVLLPTRELA QVF DF+ YGG++GLTSCC+YG  
Sbjct  159   PILESLINGPAKNKRKNGYGRPPSVLVLLPTRELAKQVFADFDAYGGSVGLTSCCVYGGD  218

Query  841   PYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFI  1020
             PY  Q+ KLK+GVDIVVGTPGRIKDHI R N+DLT L+FRVLDE DEMLR+GFV+DVE I
Sbjct  219   PYPPQQQKLKKGVDIVVGTPGRIKDHIERQNLDLTYLQFRVLDEADEMLRMGFVDDVELI  278

Query  1021  LGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             LGKV D K+VQTLLFSATL  WV++IAS+FLK DKKT+D+
Sbjct  279   LGKVEDPKKVQTLLFSATLPSWVQNIASRFLKQDKKTIDL  318



>ref|XP_010934579.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Elaeis 
guineensis]
Length=720

 Score =   353 bits (907),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 165/219 (75%), Positives = 192/219 (88%), Gaps = 0/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             +P A++ FRIS+ LRE LK+KGIESLF IQAMTF+ +LDG+D+VGRARTGQGKTLAFVLP
Sbjct  134   NPNAVSKFRISEVLREKLKSKGIESLFPIQAMTFDLILDGSDLVGRARTGQGKTLAFVLP  193

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             ILESLTNG  KA+RKTGYGRPPSVLVLLPTRELA QV+ DFE+YGGA+GL+SCCLYG +P
Sbjct  194   ILESLTNGQHKASRKTGYGRPPSVLVLLPTRELANQVYADFEVYGGAVGLSSCCLYGGSP  253

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
             Y  QE+ LKRGVDIVVGTPGR+KDH+ RG +DL  LKFRVLDE DEML +GFV+DVE IL
Sbjct  254   YRAQELSLKRGVDIVVGTPGRVKDHLERGTLDLKFLKFRVLDEADEMLNMGFVDDVELIL  313

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              KV +V +VQTLLFSATL DWVK I+++FLKPDKKT D+
Sbjct  314   SKVENVSKVQTLLFSATLPDWVKKISARFLKPDKKTADL  352



>gb|KEH26427.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=681

 Score =   352 bits (904),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 164/222 (74%), Positives = 191/222 (86%), Gaps = 0/222 (0%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             +++DP A++NFRIS+PLR  LK   IE+LF IQAMTF  +LDG+D+VGRARTGQGKTLAF
Sbjct  97    KKDDPNAVSNFRISEPLRMKLKENKIEALFPIQAMTFNTILDGSDLVGRARTGQGKTLAF  156

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
             VLPILESLTNGPAK+ RKTGYGR PSV+VLLPTRELA QV+ DFE+YG +LGL++C +YG
Sbjct  157   VLPILESLTNGPAKSVRKTGYGRVPSVIVLLPTRELANQVYADFELYGSSLGLSACAVYG  216

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
               PY  QE KL+RGVDIV+GTPGRIKDHI RGNIDL+ LKFRVLDE DEMLR+GFV+DVE
Sbjct  217   GAPYGAQETKLRRGVDIVIGTPGRIKDHIERGNIDLSHLKFRVLDEADEMLRMGFVDDVE  276

Query  1015  FILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILGKV DV +VQTLLFSATL  WVK I++KFLK DKKT D+
Sbjct  277   LILGKVQDVTKVQTLLFSATLPSWVKQISTKFLKSDKKTADL  318



>emb|CDX87236.1| BnaC09g05510D [Brassica napus]
Length=637

 Score =   351 bits (901),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 168/224 (75%), Positives = 190/224 (85%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             D + ++P A++NFRIS PL+  LK KGIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  80    DVKVDNPNAVSNFRISDPLKAKLKEKGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  139

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NGPAK+ RK GYGRPPSVLVLLPTRELA QVF DFE YGGA+GL SCC+
Sbjct  140   AFVLPILESLINGPAKSKRKNGYGRPPSVLVLLPTRELAKQVFADFEAYGGAVGLASCCV  199

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG  PYA QE KLK GVDIVVGTPGRIKDHI R N+DLT L+FRVLDE DEMLR+GFV+D
Sbjct  200   YGGDPYAPQERKLKSGVDIVVGTPGRIKDHIERRNLDLTYLQFRVLDEADEMLRMGFVDD  259

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILGKV D K+VQTLLFSATL  WV+ IA++FLK DKKT+D+
Sbjct  260   VELILGKVEDPKKVQTLLFSATLPSWVQTIAARFLKQDKKTIDL  303



>emb|CDY16789.1| BnaA09g05930D [Brassica napus]
Length=635

 Score =   350 bits (899),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 190/224 (85%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             D + ++P A++NFRIS PL+  LK KGIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  79    DVKVDNPNAVSNFRISDPLKAKLKEKGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  138

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NGPAK+ RK GYGRPPSVLVLLPTRELA QVF DFE YGGA+GL +CC+
Sbjct  139   AFVLPILESLINGPAKSKRKNGYGRPPSVLVLLPTRELAKQVFADFEAYGGAVGLAACCV  198

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG  PYA QE KLKRGVDIVVGTPGRIKDHI R N+DLT L+FRVLDE DEMLR+GFV+D
Sbjct  199   YGGDPYAPQEHKLKRGVDIVVGTPGRIKDHIERRNLDLTYLQFRVLDEADEMLRMGFVDD  258

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILG V D K+VQTLLFSATL  WV+ IA++FLK DKKT+D+
Sbjct  259   VELILGNVEDPKKVQTLLFSATLPSWVQTIAARFLKQDKKTIDL  302



>ref|XP_010940916.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Elaeis 
guineensis]
Length=711

 Score =   352 bits (903),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 167/228 (73%), Positives = 193/228 (85%), Gaps = 0/228 (0%)
 Frame = +1

Query  457   AVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQ  636
             A G +E   +P A++ FRISK LRE LK+KGIESLF IQAMTF+++LDG+D+VGRARTGQ
Sbjct  117   ARGENEGAANPNAVSKFRISKVLREKLKSKGIESLFPIQAMTFDSILDGSDLVGRARTGQ  176

Query  637   GKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLT  816
             GKTLAFVLPILESLTNG  K  RKTG GRPPSVLVLLPTRELA QV+ DF+ YGGA+GL+
Sbjct  177   GKTLAFVLPILESLTNGQYKTARKTGCGRPPSVLVLLPTRELANQVYADFQAYGGAVGLS  236

Query  817   SCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIG  996
             SCCLYG +PY  Q + LKRG+DIVVGTPGRIKDHI RG +DL  LKFR+LDE DEML +G
Sbjct  237   SCCLYGGSPYRAQVLALKRGIDIVVGTPGRIKDHIERGTLDLKFLKFRILDEADEMLNMG  296

Query  997   FVEDVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             FV+DVE ILGKV DV +VQTLLFSATL DWVK I+++FLKPDKKT D+
Sbjct  297   FVDDVELILGKVEDVNKVQTLLFSATLPDWVKKISARFLKPDKKTADL  344



>ref|XP_009346936.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Pyrus 
x bretschneideri]
Length=860

 Score =   356 bits (913),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 165/216 (76%), Positives = 188/216 (87%), Gaps = 0/216 (0%)
 Frame = +1

Query  493   AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILE  672
             A+  FRIS PLR  LK  GIESLF IQAMTF+ +LDG D+VGRARTGQGKTLAFVLP+LE
Sbjct  285   AVLKFRISAPLRAKLKENGIESLFPIQAMTFDTILDGLDLVGRARTGQGKTLAFVLPVLE  344

Query  673   SLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPYAQ  852
             SLTNGPAKA RKTGYGRPP+V+VLLPTRELA QVF DFE YGGA+GL +CC+YG +PY  
Sbjct  345   SLTNGPAKACRKTGYGRPPTVIVLLPTRELAKQVFADFEAYGGAVGLAACCVYGGSPYGA  404

Query  853   QEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILGKV  1032
             QE KL+RGVD+V+GTPGRIKDHI RGNIDL++LK R+LDE DEMLR+GFV+DVE ILGKV
Sbjct  405   QESKLRRGVDVVIGTPGRIKDHIERGNIDLSTLKVRILDEADEMLRMGFVDDVELILGKV  464

Query  1033  ADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              DV +VQTLLFSATL  WVK I+S+FLKPDKKTVD+
Sbjct  465   KDVSKVQTLLFSATLPSWVKGISSRFLKPDKKTVDL  500



>gb|KJB52898.1| hypothetical protein B456_008G282800 [Gossypium raimondii]
Length=704

 Score =   352 bits (902),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 189/220 (86%), Gaps = 0/220 (0%)
 Frame = +1

Query  481   EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
             EDP  ++ FRIS+ +R+ LK+KGIESLF IQA+TF+ +LDGTD+VGRARTGQGKTLAFVL
Sbjct  113   EDPNLVSRFRISEAVRKKLKSKGIESLFPIQALTFDVILDGTDLVGRARTGQGKTLAFVL  172

Query  661   PILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNT  840
             PILESLTNG  KA+RK GYGR PSVLVLLPTRELA QVF DFE+YG  +GLTSCCLYG  
Sbjct  173   PILESLTNGTVKASRKNGYGRAPSVLVLLPTRELAKQVFEDFEVYGEVVGLTSCCLYGGA  232

Query  841   PYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFI  1020
             PY  QEMK+K+GVDIV+GTPGRIKDHI RGNI L SLKFRVLDE DEMLR+GFV+DVE I
Sbjct  233   PYHTQEMKMKKGVDIVIGTPGRIKDHIERGNIHLGSLKFRVLDEADEMLRMGFVDDVELI  292

Query  1021  LGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             LGKV D  +VQTLLFSATL DWVK IA++FLK  KKTVD+
Sbjct  293   LGKVKDASKVQTLLFSATLPDWVKGIAARFLKTSKKTVDL  332



>gb|KJB52899.1| hypothetical protein B456_008G282800 [Gossypium raimondii]
Length=705

 Score =   352 bits (902),  Expect = 8e-111, Method: Compositional matrix adjust.
 Identities = 167/220 (76%), Positives = 189/220 (86%), Gaps = 0/220 (0%)
 Frame = +1

Query  481   EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
             EDP  ++ FRIS+ +R+ LK+KGIESLF IQA+TF+ +LDGTD+VGRARTGQGKTLAFVL
Sbjct  113   EDPNLVSRFRISEAVRKKLKSKGIESLFPIQALTFDVILDGTDLVGRARTGQGKTLAFVL  172

Query  661   PILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNT  840
             PILESLTNG  KA+RK GYGR PSVLVLLPTRELA QVF DFE+YG  +GLTSCCLYG  
Sbjct  173   PILESLTNGTVKASRKNGYGRAPSVLVLLPTRELAKQVFEDFEVYGEVVGLTSCCLYGGA  232

Query  841   PYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFI  1020
             PY  QEMK+K+GVDIV+GTPGRIKDHI RGNI L SLKFRVLDE DEMLR+GFV+DVE I
Sbjct  233   PYHTQEMKMKKGVDIVIGTPGRIKDHIERGNIHLGSLKFRVLDEADEMLRMGFVDDVELI  292

Query  1021  LGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             LGKV D  +VQTLLFSATL DWVK IA++FLK  KKTVD+
Sbjct  293   LGKVKDASKVQTLLFSATLPDWVKGIAARFLKTSKKTVDL  332



>ref|XP_007038495.1| DEAD-box ATP-dependent RNA helicase 7 [Theobroma cacao]
 gb|EOY22996.1| DEAD-box ATP-dependent RNA helicase 7 [Theobroma cacao]
Length=1077

 Score =   359 bits (921),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 174/219 (79%), Positives = 191/219 (87%), Gaps = 0/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             DP AI+ FRIS+ +RE LK+KGIESLF IQAMTF+ VLDGTD+VGRARTGQGKTLAFVLP
Sbjct  481   DPNAISRFRISEAVREKLKSKGIESLFPIQAMTFDIVLDGTDLVGRARTGQGKTLAFVLP  540

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             ILESLTNGPAK +RKTGYGR PSVLVLLPTRELA QVF DFE+YG  LGLTSCCLYG  P
Sbjct  541   ILESLTNGPAKTSRKTGYGRAPSVLVLLPTRELAKQVFDDFEVYGEVLGLTSCCLYGGAP  600

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
             Y  QEMKLKRGVDIVVGTPGR+KDHI R NIDL SL+FR+LDE DEMLR+GFV+DVE IL
Sbjct  601   YHSQEMKLKRGVDIVVGTPGRVKDHIERRNIDLGSLQFRILDEADEMLRMGFVDDVELIL  660

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             GKV D  +VQTLLFSATL DWVK IA++FLK  KKTVD+
Sbjct  661   GKVEDASKVQTLLFSATLPDWVKGIAARFLKASKKTVDL  699



>ref|XP_009398738.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Musa acuminata 
subsp. malaccensis]
Length=716

 Score =   350 bits (899),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 166/220 (75%), Positives = 192/220 (87%), Gaps = 0/220 (0%)
 Frame = +1

Query  481   EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
             +DP A++NFRISK LRE L +KGI++LF IQAMTF+ +LDG D+VGRARTGQGKTLAFVL
Sbjct  122   DDPNALSNFRISKVLRETLNSKGIKALFPIQAMTFDLILDGFDLVGRARTGQGKTLAFVL  181

Query  661   PILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNT  840
             PILESLTNG  KA+RKTGYGR P+VLVLLPTRELA QV +DFE+YGGA+GL+SCCLYG +
Sbjct  182   PILESLTNGVHKASRKTGYGRSPTVLVLLPTRELANQVHSDFEVYGGAVGLSSCCLYGGS  241

Query  841   PYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFI  1020
             PY  QE+ LKRGVDIVVGTPGRIKDHI RG +DL +LKFRVLDE DEML +GFV+DVE I
Sbjct  242   PYRAQEISLKRGVDIVVGTPGRIKDHIERGTLDLKTLKFRVLDEADEMLNMGFVDDVELI  301

Query  1021  LGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             LGKV DV +VQTLLFSATL DWVK I+++FLK DKKT D+
Sbjct  302   LGKVEDVSKVQTLLFSATLPDWVKKISTRFLKKDKKTADL  341



>ref|XP_008467258.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Cucumis melo]
Length=698

 Score =   347 bits (890),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 167/224 (75%), Positives = 188/224 (84%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             ++E E+P A+T FRIS+PL+  LK KGI SLF IQAMTF+ V DG+D+VGRARTGQGKTL
Sbjct  98    EKEAENPNAVTRFRISEPLKAKLKEKGISSLFPIQAMTFDTVYDGSDLVGRARTGQGKTL  157

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NGP K++R TGYGR PSV+VLLPTRELA QVF DF+ YG ALGL SCCL
Sbjct  158   AFVLPILESLVNGPFKSSRVTGYGRSPSVIVLLPTRELADQVFEDFKFYGRALGLDSCCL  217

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
              G   Y  QE+ LKRGVDIVVGTPGR+KDHI R NIDL SLKFRVLDE DEML +GFV+D
Sbjct  218   CGGMQYGPQEIALKRGVDIVVGTPGRVKDHINRNNIDLRSLKFRVLDEADEMLNMGFVDD  277

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VEFILGKVADV +VQTLLFSATL DWVK+I S+FLK  KKTVD+
Sbjct  278   VEFILGKVADVNKVQTLLFSATLPDWVKNITSRFLKASKKTVDL  321



>ref|XP_002866477.1| hypothetical protein ARALYDRAFT_496396 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42736.1| hypothetical protein ARALYDRAFT_496396 [Arabidopsis lyrata subsp. 
lyrata]
Length=669

 Score =   346 bits (887),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 165/224 (74%), Positives = 188/224 (84%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             D E ++P A++NFRIS PLRE LKAKGIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  89    DVEVDNPNAVSNFRISAPLREKLKAKGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  148

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NGPAK  RK GY R PSVLVLLPTRELA QV  DF+ YGG+LGL+SCC+
Sbjct  149   AFVLPILESLVNGPAKNKRKMGYARAPSVLVLLPTRELAKQVAADFDAYGGSLGLSSCCI  208

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG   Y  QE KL+RGVDIVVGTPGRIKDHI R NIDL+ L+FRVLDE DEMLR+GFVED
Sbjct  209   YGGDSYTAQENKLRRGVDIVVGTPGRIKDHIERQNIDLSHLQFRVLDEADEMLRMGFVED  268

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILGKV D  +VQTLLFSATL  WVK+I+++FLK D+KT+D+
Sbjct  269   VELILGKVEDPTKVQTLLFSATLPSWVKNISNRFLKRDQKTIDL  312



>ref|XP_006279587.1| hypothetical protein CARUB_v10026032mg [Capsella rubella]
 gb|EOA12485.1| hypothetical protein CARUB_v10026032mg [Capsella rubella]
Length=668

 Score =   342 bits (878),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 164/224 (73%), Positives = 188/224 (84%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             D E ++P AI+ FRIS  LRE LK +GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  89    DVEVDNPNAISKFRISPSLREKLKERGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  148

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NGPAK+ +K GYGRPPSVLVLLPTRELA QV  DF++YG ++GLTSCCL
Sbjct  149   AFVLPILESLINGPAKSKKKNGYGRPPSVLVLLPTRELAKQVAADFDVYGASVGLTSCCL  208

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG   Y  QE KLKRGVDIVVGTPGRIKDHI R NIDL+ L+FRVLDE DEMLR+GFVED
Sbjct  209   YGGDSYTGQEYKLKRGVDIVVGTPGRIKDHIERQNIDLSHLQFRVLDEADEMLRMGFVED  268

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILGKV D  +VQTLLFSATL  WVK+I+++FLK D+KT+D+
Sbjct  269   VELILGKVEDATKVQTLLFSATLPSWVKNISTRFLKRDQKTIDL  312



>ref|XP_003592391.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
 gb|AES62642.1| DEAD-box ATP-dependent RNA helicase [Medicago truncatula]
Length=641

 Score =   341 bits (874),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 169/236 (72%), Positives = 191/236 (81%), Gaps = 16/236 (7%)
 Frame = +1

Query  481   EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
             EDP  I+ F+IS+PLRE LK KGIESLF IQAMTF+ +L G D+VGRARTGQGKTLAFVL
Sbjct  40    EDPNGISKFKISEPLREKLKEKGIESLFPIQAMTFDIILQGCDLVGRARTGQGKTLAFVL  99

Query  661   PILESLTNGPAKAT--------------RKTGYGRPP--SVLVLLPTRELALQVFTDFEM  792
             PILES+TNG AK T              RK GYG PP  SVLVLLPTRELA QV  DFE+
Sbjct  100   PILESVTNGKAKETNAKTKETNGNARESRKGGYGGPPKPSVLVLLPTRELACQVNADFEV  159

Query  793   YGGALGLTSCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDE  972
             YGGA+GLTSCCLYG  PY  QE+KL+RGVDIV+GTPGRIKDHI+RG+IDL+ LKFRVLDE
Sbjct  160   YGGAMGLTSCCLYGGAPYKAQEIKLERGVDIVIGTPGRIKDHIVRGSIDLSQLKFRVLDE  219

Query  973   VDEMLRIGFVEDVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              DEMLR+GFVEDVE ILGKV +V QVQTLLFSATL +WVK+IA +FLK DK+T D+
Sbjct  220   ADEMLRMGFVEDVELILGKVKNVDQVQTLLFSATLPEWVKNIAKRFLKEDKQTADL  275



>ref|NP_201025.1| DEAD/DEAH box RNA helicase PRH75 [Arabidopsis thaliana]
 sp|Q39189.2|RH7_ARATH RecName: Full=DEAD-box ATP-dependent RNA helicase 7 [Arabidopsis 
thaliana]
 dbj|BAA97183.1| RNA helicase [Arabidopsis thaliana]
 gb|AAL07216.1| putative RNA helicase [Arabidopsis thaliana]
 gb|AAP40408.1| putative DEAD/DEAH box RNA helicase PRH75 [Arabidopsis thaliana]
 gb|AED97579.1| DEAD/DEAH box RNA helicase PRH75 [Arabidopsis thaliana]
Length=671

 Score =   341 bits (875),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 164/224 (73%), Positives = 187/224 (83%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             D E ++P A++ FRIS PLRE LKA GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  89    DVEVDNPNAVSKFRISAPLREKLKANGIEALFPIQASTFDMVLDGADLVGRARTGQGKTL  148

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NGPAK+ RK GYGR PSVLVLLPTRELA QV  DF+ YGG+LGL+SCCL
Sbjct  149   AFVLPILESLVNGPAKSKRKMGYGRSPSVLVLLPTRELAKQVAADFDAYGGSLGLSSCCL  208

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG   Y  QE KLKRGVDIVVGTPGRIKDHI R N+D + L+FRVLDE DEMLR+GFVED
Sbjct  209   YGGDSYPVQEGKLKRGVDIVVGTPGRIKDHIERQNLDFSYLQFRVLDEADEMLRMGFVED  268

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILGKV D  +VQTLLFSATL  WVK+I+++FLK D+KT+D+
Sbjct  269   VELILGKVEDSTKVQTLLFSATLPSWVKNISNRFLKRDQKTIDL  312



>ref|XP_011654884.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Cucumis sativus]
 gb|KGN50393.1| hypothetical protein Csa_5G171750 [Cucumis sativus]
Length=696

 Score =   341 bits (875),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 164/224 (73%), Positives = 186/224 (83%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             ++E E+P A+T FRIS+PL+  L+ KGI SLF IQA TF+ V DG+D+VGRARTGQGKTL
Sbjct  98    EKEAENPNAVTQFRISEPLKAKLREKGITSLFPIQATTFDTVYDGSDLVGRARTGQGKTL  157

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NGP K++R TGYGR PSV+VLLPTRELA QVF DF+ YG  LGL SCCL
Sbjct  158   AFVLPILESLVNGPYKSSRVTGYGRSPSVIVLLPTRELADQVFEDFKFYGRTLGLDSCCL  217

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
              G   Y  QE+ LKRGVDIVVGTPGR+KDHI R NIDL SLKFRVLDE DEML +GFV+D
Sbjct  218   CGGLQYGPQEIALKRGVDIVVGTPGRVKDHINRNNIDLRSLKFRVLDEADEMLNMGFVDD  277

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VEFILGKVADV +VQTLLFSATL DWVK+I S+FLK  KKTVD+
Sbjct  278   VEFILGKVADVNKVQTLLFSATLPDWVKNITSRFLKASKKTVDL  321



>gb|AAK62631.1| AT5g62190/mmi9_10 [Arabidopsis thaliana]
Length=671

 Score =   338 bits (868),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 163/224 (73%), Positives = 186/224 (83%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             D E ++P A++ FRI  PLRE LKA GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  89    DVEVDNPNAVSKFRIPAPLREKLKANGIEALFPIQASTFDMVLDGADLVGRARTGQGKTL  148

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NGPAK+ RK GYGR PSVLVLLPTRELA QV  DF+ YGG+LGL+SCCL
Sbjct  149   AFVLPILESLVNGPAKSKRKMGYGRSPSVLVLLPTRELAKQVAADFDEYGGSLGLSSCCL  208

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG   Y  QE KLKRGVDIVVGTPGRIKDHI R N+D + L+FRVLDE DEMLR+GFVED
Sbjct  209   YGGDSYPVQEGKLKRGVDIVVGTPGRIKDHIERQNLDFSYLQFRVLDEADEMLRMGFVED  268

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILGKV D  +VQTLLFSATL  WVK+I+++FLK D+KT+D+
Sbjct  269   VELILGKVEDSTKVQTLLFSATLPSWVKNISNRFLKRDQKTIDL  312



>ref|XP_003578458.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Brachypodium 
distachyon]
Length=694

 Score =   339 bits (869),  Expect = 4e-106, Method: Compositional matrix adjust.
 Identities = 161/230 (70%), Positives = 190/230 (83%), Gaps = 0/230 (0%)
 Frame = +1

Query  451   MEAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRART  630
             + A GGDE+  DP A+ NFRIS+PL++ LK+KGI +LF IQA TF  VLDG D+VGRART
Sbjct  105   LTASGGDEDPADPNALANFRISEPLKQKLKSKGINALFPIQATTFGLVLDGHDLVGRART  164

Query  631   GQGKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALG  810
             GQGKTLAFVLPILESL NGP KATR+T YGR PSVLVLLPTRELA QV  DFE YGGA G
Sbjct  165   GQGKTLAFVLPILESLVNGPHKATRRTDYGRLPSVLVLLPTRELANQVHADFEFYGGAFG  224

Query  811   LTSCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLR  990
             L++CC YG + Y  QEM +++GVDIVVGTPGR+KD I++G ++L SLKFRVLDE DEML 
Sbjct  225   LSTCCAYGGSHYRPQEMAMRKGVDIVVGTPGRVKDFIVKGTLNLKSLKFRVLDEADEMLN  284

Query  991   IGFVEDVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             +GFV+DVE ILGKV DV +VQTLLFSATL +WVK ++ +FLK DKKTVD+
Sbjct  285   MGFVDDVELILGKVEDVTKVQTLLFSATLPEWVKKLSMRFLKADKKTVDL  334



>emb|CAA68194.1| RNA helicase [Arabidopsis thaliana]
Length=671

 Score =   337 bits (865),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 163/224 (73%), Positives = 185/224 (83%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             D E ++P A++ FRIS PLRE LKA GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  89    DVEVDNPNAVSKFRISAPLREKLKANGIEALFPIQASTFDMVLDGADLVGRARTGQGKTL  148

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NGPAK+ RK GYGR PSVLVLLPTRELA QV  DF+ YGG+LGL+SCCL
Sbjct  149   AFVLPILESLVNGPAKSKRKMGYGRSPSVLVLLPTRELAKQVAADFDAYGGSLGLSSCCL  208

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG      QE KLKRGVDIVVGTPGRIKDHI R N+D +  KFRVLDE DEMLR+GFVED
Sbjct  209   YGGDSIPVQEGKLKRGVDIVVGTPGRIKDHIERQNLDFSYFKFRVLDEADEMLRMGFVED  268

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILGKV D  +VQTLLFSATL  WVK+I+++FLK D+KT+D+
Sbjct  269   VELILGKVEDSTKVQTLLFSATLPSWVKNISNRFLKRDQKTIDL  312



>ref|XP_006858006.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Amborella trichopoda]
 gb|ERN19473.1| hypothetical protein AMTR_s00069p00191130 [Amborella trichopoda]
Length=722

 Score =   336 bits (861),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/221 (72%), Positives = 181/221 (82%), Gaps = 0/221 (0%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E +P A+ NF ISK LRE LK+KGIESLF IQAMTF+ +  GTD+VGRARTGQGKTLAFV
Sbjct  132   EANPNAVVNFNISKVLREKLKSKGIESLFPIQAMTFDTIFGGTDLVGRARTGQGKTLAFV  191

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             LPILESLT      +RKTGYGR PSVLVL PTRELA QVF DFE YGG++GLTSCC+YG 
Sbjct  192   LPILESLTRPRDGESRKTGYGRSPSVLVLAPTRELAKQVFADFEFYGGSVGLTSCCVYGG  251

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
              PY  QE+ LKRGVDIVVGTPGRIKDHI R NIDL SL+FRVLDE DEML +GFV+DVE 
Sbjct  252   APYRPQEISLKRGVDIVVGTPGRIKDHIERNNIDLKSLRFRVLDEADEMLNMGFVDDVEN  311

Query  1018  ILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             ILG+V D  +VQTLLFSAT+ DWVK IA++F KPD+K  D+
Sbjct  312   ILGRVEDASKVQTLLFSATMPDWVKKIAARFFKPDRKVADL  352



>tpg|DAA40575.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=671

 Score =   334 bits (856),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 156/226 (69%), Positives = 188/226 (83%), Gaps = 0/226 (0%)
 Frame = +1

Query  463   GGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGK  642
             G DE+  DP A+TNFRIS+PLR++L++KGI++LF IQA TF+ VLDG+D+VGRARTGQGK
Sbjct  114   GSDEDPADPNALTNFRISEPLRQSLRSKGIKALFPIQATTFDLVLDGSDLVGRARTGQGK  173

Query  643   TLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSC  822
             TLAFVLPILESL NG  KA+R+T +GR PSVLVLLPTRELA QV  DFE YG   GL++C
Sbjct  174   TLAFVLPILESLVNGANKASRRTEHGRTPSVLVLLPTRELANQVHADFEFYGATFGLSAC  233

Query  823   CLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFV  1002
             C+YG +PY  QEM L+RGVDIVVGTPGRIKD I++G ++L  LKFRVLDE DEML +GFV
Sbjct  234   CVYGGSPYRPQEMALRRGVDIVVGTPGRIKDFIVKGTLNLKCLKFRVLDEADEMLNMGFV  293

Query  1003  EDVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             +DVE ILGKV D  +VQTLLFSATL DWV  ++ +FLK D+KTVD+
Sbjct  294   DDVELILGKVEDATKVQTLLFSATLPDWVNKLSMRFLKVDRKTVDL  339



>ref|XP_008670328.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Zea mays]
 tpg|DAA40576.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=704

 Score =   334 bits (857),  Expect = 4e-104, Method: Compositional matrix adjust.
 Identities = 156/226 (69%), Positives = 188/226 (83%), Gaps = 0/226 (0%)
 Frame = +1

Query  463   GGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGK  642
             G DE+  DP A+TNFRIS+PLR++L++KGI++LF IQA TF+ VLDG+D+VGRARTGQGK
Sbjct  114   GSDEDPADPNALTNFRISEPLRQSLRSKGIKALFPIQATTFDLVLDGSDLVGRARTGQGK  173

Query  643   TLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSC  822
             TLAFVLPILESL NG  KA+R+T +GR PSVLVLLPTRELA QV  DFE YG   GL++C
Sbjct  174   TLAFVLPILESLVNGANKASRRTEHGRTPSVLVLLPTRELANQVHADFEFYGATFGLSAC  233

Query  823   CLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFV  1002
             C+YG +PY  QEM L+RGVDIVVGTPGRIKD I++G ++L  LKFRVLDE DEML +GFV
Sbjct  234   CVYGGSPYRPQEMALRRGVDIVVGTPGRIKDFIVKGTLNLKCLKFRVLDEADEMLNMGFV  293

Query  1003  EDVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             +DVE ILGKV D  +VQTLLFSATL DWV  ++ +FLK D+KTVD+
Sbjct  294   DDVELILGKVEDATKVQTLLFSATLPDWVNKLSMRFLKVDRKTVDL  339



>gb|ACF80743.1| unknown [Zea mays]
Length=506

 Score =   326 bits (836),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 186/224 (83%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             DE+  DP A+TNFRIS+ LR++L++KGI+SLF IQA TF+ VLDG+D+VGRARTGQGKTL
Sbjct  114   DEDPADPNALTNFRISESLRQSLRSKGIKSLFPIQATTFDLVLDGSDLVGRARTGQGKTL  173

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NG  KA+R+T +GR PSVLVLLPTRELA QV  DFE YG   GL++CC+
Sbjct  174   AFVLPILESLVNGANKASRRTEHGRTPSVLVLLPTRELANQVHADFEFYGATFGLSACCV  233

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG +PY  QEM L+RGVDIVVGTPGR+KD I++G ++L  LKFRVLDE DEML +GFV+D
Sbjct  234   YGGSPYRPQEMALRRGVDIVVGTPGRVKDFIVKGTLNLKCLKFRVLDEADEMLNMGFVDD  293

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILGKV D  +VQTLLFSATL +WV  ++ +FLK D+KTVD+
Sbjct  294   VELILGKVEDATKVQTLLFSATLPEWVNKLSMRFLKVDRKTVDL  337



>ref|XP_004957391.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Setaria 
italica]
Length=708

 Score =   332 bits (850),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 156/224 (70%), Positives = 188/224 (84%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             DE+  DP A+TNFRIS+PLR+ LK+KGI++LF IQA TF+ VLDG+D+VGRARTGQGKTL
Sbjct  113   DEDPADPNALTNFRISEPLRQRLKSKGIKALFPIQATTFDLVLDGSDLVGRARTGQGKTL  172

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NG  KA+RKT YGR P+VLVLLPTRELA QV  DFE YG   GL++CC+
Sbjct  173   AFVLPILESLVNGTHKASRKTDYGRLPTVLVLLPTRELANQVHADFEFYGSTYGLSACCV  232

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG +PY  QEM L++GVDIVVGTPGR+KD +++G ++L SLKFRVLDE DEML +GFV+D
Sbjct  233   YGGSPYRPQEMALRKGVDIVVGTPGRVKDFVVKGTLNLKSLKFRVLDEADEMLNMGFVDD  292

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILGKV DV +VQTLLFSATL DWV  ++ +FLK D+KTVD+
Sbjct  293   VELILGKVEDVTRVQTLLFSATLPDWVNKLSMRFLKGDRKTVDL  336



>ref|XP_002460541.1| hypothetical protein SORBIDRAFT_02g030210 [Sorghum bicolor]
 gb|EER97062.1| hypothetical protein SORBIDRAFT_02g030210 [Sorghum bicolor]
Length=711

 Score =   330 bits (846),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 187/224 (83%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             DE+  DP A+TNFRIS+PLR++L++KGI++LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  115   DEDPADPNALTNFRISEPLRQSLRSKGIKALFPIQATTFDLVLDGNDLVGRARTGQGKTL  174

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NG  KA+R+T +GR PSV+VLLPTRELA QV  DFE YG   GL++CC+
Sbjct  175   AFVLPILESLVNGAHKASRRTEHGRTPSVIVLLPTRELANQVHADFEFYGATFGLSACCV  234

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG +PY  QEM L+RGVDIVVGTPGR+KD I++G ++L +LKFRVLDE DEML +GFV+D
Sbjct  235   YGGSPYRPQEMALRRGVDIVVGTPGRVKDFIVKGTLNLKNLKFRVLDEADEMLNMGFVDD  294

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILGKV D  +VQTLLFSATL DWV  ++ +FLK D+KTVD+
Sbjct  295   VELILGKVEDATKVQTLLFSATLPDWVNKLSMRFLKVDRKTVDL  338



>ref|XP_008652955.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X3 [Zea mays]
Length=634

 Score =   327 bits (839),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 186/224 (83%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             DE+  DP A+TNFRIS+ LR++L++KGI+SLF IQA TF+ VLDG+D+VGRARTGQGKTL
Sbjct  114   DEDPADPNALTNFRISESLRQSLRSKGIKSLFPIQATTFDLVLDGSDLVGRARTGQGKTL  173

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NG  KA+R+T +GR PSVLVLLPTRELA QV  DFE YG   GL++CC+
Sbjct  174   AFVLPILESLVNGANKASRRTEHGRTPSVLVLLPTRELANQVHADFEFYGATFGLSACCV  233

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG +PY  QEM L+RGVDIVVGTPGR+KD I++G ++L  LKFRVLDE DEML +GFV+D
Sbjct  234   YGGSPYRPQEMALRRGVDIVVGTPGRVKDFIVKGTLNLKCLKFRVLDEADEMLNMGFVDD  293

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILGKV D  +VQTLLFSATL +WV  ++ +FLK D+KTVD+
Sbjct  294   VELILGKVEDATKVQTLLFSATLPEWVNKLSMRFLKVDRKTVDL  337



>ref|XP_010483921.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Camelina 
sativa]
Length=681

 Score =   328 bits (842),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 183/224 (82%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             D E ++P A++ FRIS PLRE LK  GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  93    DVEVDNPNAVSKFRISAPLREMLKKNGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  152

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NGPAK+ +K GYGRPPSVLVLLPTRELA QV  DFE YG ALGLTSCC+
Sbjct  153   AFVLPILESLINGPAKSKKKNGYGRPPSVLVLLPTRELAKQVNADFETYGLALGLTSCCV  212

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG   Y+ Q+  L++GVDIVVGTPGR+KD I    IDL+ L+FRVLDE DEMLR+GFVED
Sbjct  213   YGGEGYSAQQNSLRKGVDIVVGTPGRVKDFINNEKIDLSYLQFRVLDEADEMLRMGFVED  272

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VEFILGKV D  +VQTLLFSATL  WV++I+ KFLK D KT+D+
Sbjct  273   VEFILGKVEDATKVQTLLFSATLPQWVQNISLKFLKKDLKTIDL  316



>gb|EAZ09787.1| hypothetical protein OsI_32075 [Oryza sativa Indica Group]
Length=685

 Score =   328 bits (840),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 153/225 (68%), Positives = 185/225 (82%), Gaps = 0/225 (0%)
 Frame = +1

Query  466   GDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKT  645
             GDE+  DP A+ NFRIS+PLRE LK+KGI++LF IQA TF+ VLDG D+VGRARTGQGKT
Sbjct  96    GDEDPADPNALANFRISEPLREKLKSKGIKALFPIQATTFDLVLDGHDLVGRARTGQGKT  155

Query  646   LAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCC  825
             LAFVLPILESL NG  KA+R+T YGRPP+VLVLLPTRELA QV TDF  YG   GL++CC
Sbjct  156   LAFVLPILESLVNGTHKASRRTDYGRPPTVLVLLPTRELAKQVHTDFAFYGATFGLSACC  215

Query  826   LYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVE  1005
             +YG + Y  QEM +++GVDIVVGTPGR+KD + +G ++  SLKFRVLDE DEML +GFV+
Sbjct  216   VYGGSDYRSQEMAIRKGVDIVVGTPGRVKDFVEKGTLNFRSLKFRVLDEADEMLNMGFVD  275

Query  1006  DVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             DVE ILGKV DV +VQTLLFSAT+ +WVK ++ +FLK  KKTVD+
Sbjct  276   DVELILGKVEDVTKVQTLLFSATIPEWVKKLSLRFLKSGKKTVDL  320



>ref|XP_008652954.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Zea mays]
Length=641

 Score =   326 bits (836),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 186/224 (83%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             DE+  DP A+TNFRIS+ LR++L++KGI+SLF IQA TF+ VLDG+D+VGRARTGQGKTL
Sbjct  114   DEDPADPNALTNFRISESLRQSLRSKGIKSLFPIQATTFDLVLDGSDLVGRARTGQGKTL  173

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NG  KA+R+T +GR PSVLVLLPTRELA QV  DFE YG   GL++CC+
Sbjct  174   AFVLPILESLVNGANKASRRTEHGRTPSVLVLLPTRELANQVHADFEFYGATFGLSACCV  233

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG +PY  QEM L+RGVDIVVGTPGR+KD I++G ++L  LKFRVLDE DEML +GFV+D
Sbjct  234   YGGSPYRPQEMALRRGVDIVVGTPGRVKDFIVKGTLNLKCLKFRVLDEADEMLNMGFVDD  293

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILGKV D  +VQTLLFSATL +WV  ++ +FLK D+KTVD+
Sbjct  294   VELILGKVEDATKVQTLLFSATLPEWVNKLSMRFLKVDRKTVDL  337



>ref|XP_010444062.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Camelina 
sativa]
Length=670

 Score =   327 bits (838),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 160/224 (71%), Positives = 182/224 (81%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             D E ++P A++ FRIS PLRE LK  GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  90    DVEVDNPNAVSKFRISAPLREMLKKNGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  149

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NGPAK+ +K GYGRPPSVLVLLPTRELA QV  DFE YG ALGLTSCC+
Sbjct  150   AFVLPILESLINGPAKSKKKNGYGRPPSVLVLLPTRELAKQVNADFETYGLALGLTSCCV  209

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG   Y+ Q+  L++GVDIVVGTPGR+KD I    IDL+ L+FRVLDE DEMLR+GFVED
Sbjct  210   YGGEGYSFQQNSLRKGVDIVVGTPGRVKDFINTEKIDLSYLQFRVLDEADEMLRMGFVED  269

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VEFILGKV D  +VQTLLFSATL  WVK I+ KFLK D KT+D+
Sbjct  270   VEFILGKVEDATKVQTLLFSATLPPWVKDISRKFLKKDLKTIDL  313



>ref|XP_010458375.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Camelina sativa]
 ref|XP_010458382.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X2 [Camelina sativa]
Length=679

 Score =   327 bits (838),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/224 (71%), Positives = 182/224 (81%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             D E ++P A++ FRIS PLRE LK  GIE+LF IQA TF+ VLDG D+VGRARTGQGKTL
Sbjct  95    DVEVDNPNAVSKFRISAPLREMLKKNGIEALFPIQATTFDMVLDGADLVGRARTGQGKTL  154

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NGPAK+ +K GYGRPPSVLVLLPTRELA QV  DFE YG ALGLTSCC+
Sbjct  155   AFVLPILESLINGPAKSKKKNGYGRPPSVLVLLPTRELAKQVNADFETYGLALGLTSCCV  214

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG   Y+ Q+  L++GVDIVVGTPGR+KD I    IDL+ L+FRVLDE DEMLR+GFVED
Sbjct  215   YGGEGYSFQQNSLRKGVDIVVGTPGRVKDFINTEKIDLSYLQFRVLDEADEMLRMGFVED  274

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VEFILGKV D  +VQTLLFSATL  WV+ I+ KFLK D KT+D+
Sbjct  275   VEFILGKVEDATKVQTLLFSATLPQWVQSISRKFLKKDLKTIDL  318



>ref|XP_006660856.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Oryza 
brachyantha]
 gb|ABG73436.1| DEAD/DEAH box helicase family protein [Oryza brachyantha]
Length=688

 Score =   327 bits (838),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/225 (70%), Positives = 184/225 (82%), Gaps = 1/225 (0%)
 Frame = +1

Query  466   GDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKT  645
             GDE+  DP A+ NFRIS+PLRE LK+KGI++LF IQA TF+ VLDG D+VGRARTGQGKT
Sbjct  98    GDEDPADPNALANFRISEPLREKLKSKGIKALFPIQATTFDLVLDGHDLVGRARTGQGKT  157

Query  646   LAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCC  825
             LAFVLPILESL NG  KA+    YGRPPSVLVLLPTRELA QV TDFE YG   GL+SCC
Sbjct  158   LAFVLPILESLVNGKHKAS-GADYGRPPSVLVLLPTRELAKQVHTDFEFYGATFGLSSCC  216

Query  826   LYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVE  1005
             +YG + Y  QEMK+++GVDIVVGTPGR+KD + +G ++  SLKFRVLDE DEML +GFV+
Sbjct  217   VYGGSEYRPQEMKIRKGVDIVVGTPGRVKDFVQKGTLNFKSLKFRVLDEADEMLNMGFVD  276

Query  1006  DVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             DVE ILGKV DV +VQTLLFSATL DWV  ++ +FLKP KKTVD+
Sbjct  277   DVELILGKVEDVTKVQTLLFSATLPDWVGKLSLRFLKPGKKTVDL  321



>ref|XP_008652953.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X1 [Zea mays]
 tpg|DAA62342.1| TPA: putative DEAD-box ATP-dependent RNA helicase family protein 
[Zea mays]
Length=707

 Score =   327 bits (838),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 153/224 (68%), Positives = 186/224 (83%), Gaps = 0/224 (0%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             DE+  DP A+TNFRIS+ LR++L++KGI+SLF IQA TF+ VLDG+D+VGRARTGQGKTL
Sbjct  114   DEDPADPNALTNFRISESLRQSLRSKGIKSLFPIQATTFDLVLDGSDLVGRARTGQGKTL  173

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPILESL NG  KA+R+T +GR PSVLVLLPTRELA QV  DFE YG   GL++CC+
Sbjct  174   AFVLPILESLVNGANKASRRTEHGRTPSVLVLLPTRELANQVHADFEFYGATFGLSACCV  233

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG +PY  QEM L+RGVDIVVGTPGR+KD I++G ++L  LKFRVLDE DEML +GFV+D
Sbjct  234   YGGSPYRPQEMALRRGVDIVVGTPGRVKDFIVKGTLNLKCLKFRVLDEADEMLNMGFVDD  293

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILGKV D  +VQTLLFSATL +WV  ++ +FLK D+KTVD+
Sbjct  294   VELILGKVEDATKVQTLLFSATLPEWVNKLSMRFLKVDRKTVDL  337



>gb|EMT03655.1| DEAD-box ATP-dependent RNA helicase 7 [Aegilops tauschii]
Length=687

 Score =   326 bits (836),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 183/230 (80%), Gaps = 0/230 (0%)
 Frame = +1

Query  451   MEAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRART  630
             + A G +EE  DP A+ NFRIS+ L++ LK+KGI +LF IQA TF  VLDG D+VGRART
Sbjct  95    LTASGEEEEPADPNALANFRISEKLKDKLKSKGINALFPIQATTFALVLDGNDLVGRART  154

Query  631   GQGKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALG  810
             GQGKTLAFVLPILESL NGP KATR+T YGRPPSVLVLLPTRELA QV  DFE YGG  G
Sbjct  155   GQGKTLAFVLPILESLVNGPHKATRRTDYGRPPSVLVLLPTRELANQVHADFEFYGGTFG  214

Query  811   LTSCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLR  990
             L++CC YG +PY  QE  L++GVDIVVGTPGR+KD I +  ++L  LKFRVLDE DEML 
Sbjct  215   LSTCCAYGGSPYRPQENALRQGVDIVVGTPGRVKDLIEKQKLNLRCLKFRVLDEADEMLN  274

Query  991   IGFVEDVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             +GF +DVE ILGKV DV +VQTLLFSATL +WVK ++  FLK D+KTVD+
Sbjct  275   MGFKDDVELILGKVEDVTKVQTLLFSATLPEWVKKLSMSFLKADRKTVDL  324



>gb|EAZ45398.1| hypothetical protein OsJ_30047 [Oryza sativa Japonica Group]
Length=685

 Score =   325 bits (833),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 184/225 (82%), Gaps = 0/225 (0%)
 Frame = +1

Query  466   GDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKT  645
             GDE+  DP A+ NFRIS+ LRE LK+KGI++LF IQA TF+ VLDG D+VGRARTGQGKT
Sbjct  96    GDEDPADPNALANFRISESLREKLKSKGIKALFPIQATTFDLVLDGHDLVGRARTGQGKT  155

Query  646   LAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCC  825
             LAFVLPILESL NG  KA+R+T YGRPP+VLVLLPTRELA QV TDF  YG   GL++CC
Sbjct  156   LAFVLPILESLVNGTHKASRRTDYGRPPTVLVLLPTRELAKQVHTDFAFYGATFGLSACC  215

Query  826   LYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVE  1005
             +YG + Y  QEM +++GVDIVVGTPGR+KD + +G ++  SLKFRVLDE DEML +GFV+
Sbjct  216   VYGGSDYRSQEMAIRKGVDIVVGTPGRVKDFVEKGTLNFRSLKFRVLDEADEMLNMGFVD  275

Query  1006  DVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             DVE ILGKV DV +VQTLLFSAT+ +WVK ++ +FLK  KKTVD+
Sbjct  276   DVELILGKVEDVTKVQTLLFSATIPEWVKKLSLRFLKSGKKTVDL  320



>ref|NP_001063702.1| Os09g0520700 [Oryza sativa Japonica Group]
 sp|Q650T9.1|RH7_ORYSJ RecName: Full=DEAD-box ATP-dependent RNA helicase 7 [Oryza sativa 
Japonica Group]
 dbj|BAD46678.1| putative RNA helicase [Oryza sativa Japonica Group]
 dbj|BAF25616.1| Os09g0520700 [Oryza sativa Japonica Group]
Length=696

 Score =   325 bits (833),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/225 (68%), Positives = 184/225 (82%), Gaps = 0/225 (0%)
 Frame = +1

Query  466   GDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKT  645
             GDE+  DP A+ NFRIS+ LRE LK+KGI++LF IQA TF+ VLDG D+VGRARTGQGKT
Sbjct  107   GDEDPADPNALANFRISESLREKLKSKGIKALFPIQATTFDLVLDGHDLVGRARTGQGKT  166

Query  646   LAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCC  825
             LAFVLPILESL NG  KA+R+T YGRPP+VLVLLPTRELA QV TDF  YG   GL++CC
Sbjct  167   LAFVLPILESLVNGTHKASRRTDYGRPPTVLVLLPTRELAKQVHTDFAFYGATFGLSACC  226

Query  826   LYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVE  1005
             +YG + Y  QEM +++GVDIVVGTPGR+KD + +G ++  SLKFRVLDE DEML +GFV+
Sbjct  227   VYGGSDYRSQEMAIRKGVDIVVGTPGRVKDFVEKGTLNFRSLKFRVLDEADEMLNMGFVD  286

Query  1006  DVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             DVE ILGKV DV +VQTLLFSAT+ +WVK ++ +FLK  KKTVD+
Sbjct  287   DVELILGKVEDVTKVQTLLFSATIPEWVKKLSLRFLKSGKKTVDL  331



>emb|CBI24488.3| unnamed protein product [Vitis vinifera]
Length=547

 Score =   320 bits (819),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +1

Query  577   MTFEAVLDGTDMVGRARTGQGKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTR  756
             MTF+ +LDG+D+VGRARTGQGKTLAFVLPILESL NGP + +RKTGYGRPP VLVLLPTR
Sbjct  1     MTFDTILDGSDLVGRARTGQGKTLAFVLPILESLINGPNRGSRKTGYGRPPCVLVLLPTR  60

Query  757   ELALQVFTDFEMYGGALGLTSCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNI  936
             ELA QV+ DF++YGGA+GLTSCCLYG  PY  QE+KLKRGVDIVVGTPGRIKDHI RGNI
Sbjct  61    ELATQVYADFDVYGGAIGLTSCCLYGGAPYQAQEIKLKRGVDIVVGTPGRIKDHIERGNI  120

Query  937   DLTSLKFRVLDEVDEMLRIGFVEDVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLK  1116
             D +SLKFRVLDE DEMLR+GFVEDVE ILGKV DV +VQTLLFSATL  WVK I+S+FLK
Sbjct  121   DFSSLKFRVLDEADEMLRMGFVEDVELILGKVEDVSKVQTLLFSATLPGWVKEISSRFLK  180

Query  1117  PDKKTVDI  1140
             P  KT D+
Sbjct  181   PTLKTADL  188



>ref|XP_010693660.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7 [Beta vulgaris 
subsp. vulgaris]
Length=684

 Score =   322 bits (824),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 152/219 (69%), Positives = 182/219 (83%), Gaps = 0/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             +P +++NFRISKPL++AL +KGI++LF IQAMTF+ V+DG D+V RARTGQGKTLAFVLP
Sbjct  99    NPNSLSNFRISKPLKDALISKGIQALFPIQAMTFDIVIDGCDLVARARTGQGKTLAFVLP  158

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             ILESL NG  K  RK+GYGR PSVLVLLPTRELA QV+ DF+ YG ++GL SCC+YG  P
Sbjct  159   ILESLVNGRTKTLRKSGYGRLPSVLVLLPTRELATQVYADFQSYGNSIGLASCCVYGGAP  218

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
             +  Q   LKRGVDIVVGTPGR+KD + +G ++L SL FRVLDE DEMLR+GFVEDVE IL
Sbjct  219   FQSQITSLKRGVDIVVGTPGRVKDLLEKGVLNLGSLLFRVLDEADEMLRMGFVEDVELIL  278

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             GKV DV +VQTLLFSATL DWVK I+++FLK  KKTVD+
Sbjct  279   GKVDDVTKVQTLLFSATLPDWVKQISTRFLKSAKKTVDL  317



>sp|Q41382.1|RH7_SPIOL RecName: Full=DEAD-box ATP-dependent RNA helicase 7 [Spinacia 
oleracea]
 emb|CAA68193.1| RNA helicase [Spinacia oleracea]
Length=685

 Score =   310 bits (794),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 148/222 (67%), Positives = 181/222 (82%), Gaps = 0/222 (0%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             E EDP +++NFRISKPL++ L +KGI++LF IQAMTF+ V+DG D+VGRARTGQGKTLAF
Sbjct  102   EAEDPNSLSNFRISKPLKDVLISKGIKALFPIQAMTFDNVIDGCDLVGRARTGQGKTLAF  161

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
             VLPI+ESL NG  K  R++G+GR PSVLVLLPTRELA QV  DF++YGGA+GLT+C +YG
Sbjct  162   VLPIVESLVNGRTKDLRRSGHGRLPSVLVLLPTRELATQVLADFQVYGGAVGLTACSVYG  221

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
               P+  Q   L RGVDIVVGTPGR+KD + +G + L SL FRVLDE DEML++GFV+DVE
Sbjct  222   GAPFHSQISSLTRGVDIVVGTPGRVKDLLEKGVLKLGSLLFRVLDEADEMLKMGFVDDVE  281

Query  1015  FILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILGKV  V +VQTLLFSATL  WVK I+++FLK  KKTVD+
Sbjct  282   LILGKVDHVSKVQTLLFSATLPSWVKQISTRFLKSAKKTVDL  323



>gb|EMS52016.1| DEAD-box ATP-dependent RNA helicase 7 [Triticum urartu]
Length=925

 Score =   311 bits (797),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 156/230 (68%), Positives = 182/230 (79%), Gaps = 0/230 (0%)
 Frame = +1

Query  451   MEAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRART  630
             + A G +EE  DP A+ NFRIS  L++ LK+KGI +LF IQA TF  VLDG D+VGRART
Sbjct  333   LTASGEEEEPADPNALANFRISDKLKDKLKSKGINALFPIQATTFALVLDGNDLVGRART  392

Query  631   GQGKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALG  810
             GQGKTLAFVLPILESL NGP KATR+T YGRPPSVLVLLPTRELA QV  DFE YGG  G
Sbjct  393   GQGKTLAFVLPILESLVNGPHKATRRTDYGRPPSVLVLLPTRELANQVHADFEFYGGTFG  452

Query  811   LTSCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLR  990
             L++CC YG +PY  QE  L++GVDIVVGTPGR+KD I +  ++L  LKFRVLDE DEML 
Sbjct  453   LSTCCAYGGSPYRPQENALRQGVDIVVGTPGRVKDLIEKQKLNLRCLKFRVLDEADEMLN  512

Query  991   IGFVEDVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             +GF +DVE ILGKV DV +VQTLLFSATL +WVK ++  FLK D+KTVD+
Sbjct  513   MGFKDDVELILGKVEDVTKVQTLLFSATLPEWVKKLSMSFLKADRKTVDL  562



>ref|XP_001764376.1| predicted protein [Physcomitrella patens]
 gb|EDQ70930.1| predicted protein [Physcomitrella patens]
Length=689

 Score =   296 bits (759),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 146/219 (67%), Positives = 169/219 (77%), Gaps = 2/219 (1%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             DP A++NF I K LR+ LKAKGIESLF IQA TFEAV DG DMVGRARTGQGKTLAFVLP
Sbjct  108   DPMAVSNFNIGKALRDKLKAKGIESLFPIQAQTFEAVFDGNDMVGRARTGQGKTLAFVLP  167

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             +LESL+   +  T+    GR  +V+VL PTRELA QV  DFE YG A+GL++ C+YG  P
Sbjct  168   VLESLSQ--SGYTKNLQRGRAAAVIVLAPTRELAKQVHADFETYGSAVGLSTVCVYGGAP  225

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
             Y  QE  L+RGVDIVVGTPGRIKDH  RG ++L SLKFR+LDE DEML +GFV+DVE IL
Sbjct  226   YGPQENALRRGVDIVVGTPGRIKDHFERGTLNLKSLKFRILDEADEMLNMGFVDDVETIL  285

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             G V D  +VQTLLFSATL  WV+ IA KFLK  +KTVD+
Sbjct  286   GGVDDPSKVQTLLFSATLPTWVQQIARKFLKATRKTVDL  324



>ref|XP_002975210.1| hypothetical protein SELMODRAFT_150370 [Selaginella moellendorffii]
 gb|EFJ23995.1| hypothetical protein SELMODRAFT_150370 [Selaginella moellendorffii]
Length=626

 Score =   293 bits (750),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/224 (63%), Positives = 176/224 (79%), Gaps = 3/224 (1%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             D + E+PYA+ NFRIS  ++  L+ KGI++LF+IQA +F+ VLDG D+VGRARTGQGKTL
Sbjct  36    DIDVENPYALENFRISDAVKGMLREKGIKALFQIQAQSFDIVLDGDDLVGRARTGQGKTL  95

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPI+ESL      ++ K GYGR P+VLVL PTRELA QV  DFE YGGA GL++ C+
Sbjct  96    AFVLPIIESLRK---SSSGKKGYGRAPTVLVLAPTRELAKQVHADFECYGGAAGLSTICV  152

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG + Y  Q+  ++RGVDIVVGTPGRIKD + RG+++L +LKFRVLDE DEML +GFVE 
Sbjct  153   YGGSQYGPQQNAMRRGVDIVVGTPGRIKDFLDRGDLNLKTLKFRVLDEADEMLNMGFVEA  212

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILG V D   VQTLLFSAT+  WVK IA++FLKP+KKTVD+
Sbjct  213   VEAILGAVEDTSSVQTLLFSATMPSWVKEIATRFLKPNKKTVDL  256



>ref|XP_002977618.1| hypothetical protein SELMODRAFT_107027 [Selaginella moellendorffii]
 gb|EFJ21622.1| hypothetical protein SELMODRAFT_107027 [Selaginella moellendorffii]
Length=663

 Score =   293 bits (751),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 142/224 (63%), Positives = 176/224 (79%), Gaps = 3/224 (1%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             D + E+PYA+ NFRIS  ++  L+ KGI++LF+IQA +F+ VLDG D+VGRARTGQGKTL
Sbjct  73    DIDVENPYALENFRISDAVKGMLREKGIKALFQIQAQSFDIVLDGDDLVGRARTGQGKTL  132

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             AFVLPI+ESL      ++ K GYGR P+VLVL PTRELA QV  DFE YGGA GL++ C+
Sbjct  133   AFVLPIIESLRKS---SSGKKGYGRAPTVLVLAPTRELAKQVHADFECYGGAAGLSTICV  189

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG + Y  Q+  ++RGVDIVVGTPGRIKD + RG+++L +LKFRVLDE DEML +GFVE 
Sbjct  190   YGGSQYGPQQNAMRRGVDIVVGTPGRIKDFLDRGDLNLKTLKFRVLDEADEMLNMGFVEA  249

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILG V D   VQTLLFSAT+  WVK IA++FLKP+KKTVD+
Sbjct  250   VEAILGAVEDTSSVQTLLFSATMPSWVKEIATRFLKPNKKTVDL  293



>ref|XP_010059508.1| PREDICTED: nucleolar RNA helicase 2-like [Eucalyptus grandis]
Length=584

 Score =   281 bits (719),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 134/194 (69%), Positives = 158/194 (81%), Gaps = 0/194 (0%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             +EE+P A++NFRI   LR  LK  GIE+LF IQAMTF+ ++DG D+VGRA T QGKTLAF
Sbjct  218   QEENPNALSNFRILNTLRLKLKDNGIEALFPIQAMTFDIIVDGADLVGRAHTSQGKTLAF  277

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
             VLPILESLTNGPAK +RKTGYGR  SVLVLLPTR LA QV++DFE+YGGA+GLTSCCLYG
Sbjct  278   VLPILESLTNGPAKTSRKTGYGRALSVLVLLPTRGLAKQVYSDFEVYGGAVGLTSCCLYG  337

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
               PY  QE +L+RGV IV+GT GR+KDHI R NIDL+SL F VLDE DEMLR+GFVEDVE
Sbjct  338   GAPYHAQESQLRRGVHIVIGTYGRVKDHIGRENIDLSSLTFLVLDEADEMLRMGFVEDVE  397

Query  1015  FILGKVADVKQVQT  1056
              ILG+    +Q+ +
Sbjct  398   LILGEATCQRQMTS  411



>ref|XP_004496647.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like isoform 
X3 [Cicer arietinum]
Length=582

 Score =   277 bits (709),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 133/168 (79%), Positives = 148/168 (88%), Gaps = 2/168 (1%)
 Frame = +1

Query  637   GKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLT  816
             GKTLAFVLPILES+ NGPAKA+RK GYGRPPSVLVLLPTRELA QV  DFE+YGGA+GLT
Sbjct  12    GKTLAFVLPILESVANGPAKASRKIGYGRPPSVLVLLPTRELASQVNADFEVYGGAMGLT  71

Query  817   SCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIG  996
             SCCL G + Y  QE  LKRGVDIV+GTPGRIKD+IMRGNIDL+ LKFRVLDE DEMLR+G
Sbjct  72    SCCLIGGSSYQVQE--LKRGVDIVIGTPGRIKDNIMRGNIDLSQLKFRVLDEADEMLRMG  129

Query  997   FVEDVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             FV+DVE ILGKV +V+ VQTLLFSATL DWVK+IA +FLKPDKKT D+
Sbjct  130   FVQDVELILGKVKNVENVQTLLFSATLPDWVKNIAVRFLKPDKKTADL  177



>ref|XP_004300425.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Fragaria 
vesca subsp. vesca]
Length=329

 Score =   260 bits (664),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 130/223 (58%), Positives = 170/223 (76%), Gaps = 3/223 (1%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             EE P A++ FRIS+PLR  LK +GI+SL  IQA TF+ +LDG D++ +A   Q KTLAFV
Sbjct  70    EETPNAVSKFRISEPLRAKLKERGIKSLSPIQARTFDTILDGFDLLAQAPADQDKTLAFV  129

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             LPILESL NG A+ ++KTG+ + P V+VLLPTR+ A+QV  +F  YGG+LGL SCC+YG 
Sbjct  130   LPILESLVNGSAEQSKKTGH-KAPCVMVLLPTRDSAVQVLKEFGFYGGSLGLVSCCVYGG  188

Query  838   TPYAQQEMKLKRG-VDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
             + +  Q  KLKRG +DI+VGTPGR+KDHI +GNIDL+SLKFRVL + DE+ + G VEDVE
Sbjct  189   SSHKVQTKKLKRGRIDIIVGTPGRVKDHIEKGNIDLSSLKFRVLGDADELWKKGLVEDVE  248

Query  1015  FILGKVADVKQVQTLLFSATLQDWVKHIA-SKFLKPDKKTVDI  1140
             FILGKV DV + QTLLFS  +  +V+ IA S++LK + K V++
Sbjct  249   FILGKVNDVTKFQTLLFSTHMPRYVEKIACSRYLKSNYKEVEL  291



>gb|KCW45478.1| hypothetical protein EUGRSUZ_L00808 [Eucalyptus grandis]
Length=511

 Score =   264 bits (674),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 127/188 (68%), Positives = 147/188 (78%), Gaps = 19/188 (10%)
 Frame = +1

Query  577   MTFEAVLDGTDMVGRARTGQGKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTR  756
             M F+ +LDGTD+VGRA TGQGKT+AFVLPILESL NGP K +RKTGYG+PPSVLVLLPTR
Sbjct  29    MRFDIILDGTDLVGRAHTGQGKTMAFVLPILESLMNGPVKTSRKTGYGKPPSVLVLLPTR  88

Query  757   ELALQVFTDFEMYGGALGLTSCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNI  936
             EL  QVF+DFE+YGGA+GLTSCCL+G                   G PG +KDHI R NI
Sbjct  89    ELTKQVFSDFEVYGGAMGLTSCCLHG-------------------GAPGHVKDHIERENI  129

Query  937   DLTSLKFRVLDEVDEMLRIGFVEDVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLK  1116
             DL+SL FRVLDEVDEMLR+GFVEDVE ILGKV D  +VQTLLFS TL  WVK I+S+FLK
Sbjct  130   DLSSLTFRVLDEVDEMLRMGFVEDVELILGKVKDTSKVQTLLFSTTLPGWVKGISSRFLK  189

Query  1117  PDKKTVDI  1140
              +K+T+D+
Sbjct  190   QNKRTIDL  197



>ref|XP_011399479.1| DEAD-box ATP-dependent RNA helicase 7 [Auxenochlorella protothecoides]
 gb|KFM26541.1| DEAD-box ATP-dependent RNA helicase 7 [Auxenochlorella protothecoides]
Length=764

 Score =   266 bits (681),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 129/218 (59%), Positives = 159/218 (73%), Gaps = 5/218 (2%)
 Frame = +1

Query  487   PYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPI  666
             P+A+ NF +S PL+  L++KGIESLF IQA     +L+G D+VGRARTG GKTLAFVLPI
Sbjct  52    PHALDNFALSAPLKSMLRSKGIESLFDIQAACLTPLLEGRDLVGRARTGCGKTLAFVLPI  111

Query  667   LESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPY  846
             +E L+  P     +  +GR PSV+VL PTRELA QV  DFE YG + GLT  CLYG TP 
Sbjct  112   VERLSQRP-----RGAHGRAPSVIVLAPTRELAKQVGADFETYGRSAGLTCVCLYGGTPM  166

Query  847   AQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILG  1026
             + QE  L+RGVD+V+GTPGR+KDHI RG++   +L FRVLDE DEML +GFV+DVE IL 
Sbjct  167   SPQEGALRRGVDVVIGTPGRVKDHIERGSLSCANLAFRVLDECDEMLNMGFVDDVERILN  226

Query  1027  KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
                D   +QTLLFSATL  WVK I ++FLKP+  TVD+
Sbjct  227   TGVDTTDIQTLLFSATLPPWVKQITTRFLKPNHATVDL  264



>ref|XP_005849733.1| hypothetical protein CHLNCDRAFT_20835, partial [Chlorella variabilis]
 gb|EFN57631.1| hypothetical protein CHLNCDRAFT_20835, partial [Chlorella variabilis]
Length=608

 Score =   262 bits (670),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/219 (60%), Positives = 156/219 (71%), Gaps = 1/219 (0%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
              P A+ NF++S+P++  L+AKGIE+LF IQA     +L+G D+VGRARTG GKTLAFVLP
Sbjct  1     SPLALDNFKLSEPVKSLLRAKGIEALFDIQAQCLPPLLEGQDLVGRARTGCGKTLAFVLP  60

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             I+E L  G   A  K  +GR PSV+VL PTRELA QV  DFE Y  A  LT+ CLYG T 
Sbjct  61    IVERLAGGQG-AGGKRAFGRAPSVVVLAPTRELAKQVAADFEYYAKAFSLTTVCLYGGTQ  119

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
             Y  QE  L+RGVD+V+GTPGR+KDH+ RG + L  L+FRVLDE DEML +GFVEDVE IL
Sbjct  120   YGPQEGMLRRGVDVVIGTPGRVKDHLERGTLKLNQLRFRVLDECDEMLNMGFVEDVEKIL  179

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
                 D   VQTLLFSATL  WVK I  +FLKP   TVD+
Sbjct  180   NAGVDAATVQTLLFSATLPHWVKDITKRFLKPGFTTVDL  218



>ref|XP_005645158.1| DEAD-domain-containing protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20614.1| DEAD-domain-containing protein [Coccomyxa subellipsoidea C-169]
Length=698

 Score =   261 bits (668),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 132/219 (60%), Positives = 157/219 (72%), Gaps = 2/219 (1%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             DP A+ NFR+S  ++  L+ KGIE+LF IQA T   +LDG D+VGRARTGQGKTLAFVLP
Sbjct  102   DPLAVDNFRLSDKVKALLREKGIEALFSIQAHTLNHLLDGFDLVGRARTGQGKTLAFVLP  161

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             I+E L      ATR+   GR P V+VL PTRELA QV  DFE  G A  L++ CLYG  P
Sbjct  162   IVERLLAHNISATRRQ-QGRTPRVIVLAPTRELAKQVHADFENIGRAANLSTVCLYGGAP  220

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL  1023
              + QE  L+RG D+VVGTPGR+KDH+ RGN+ L  L FRVLDE DEML +GFVEDVE IL
Sbjct  221   MSPQEQILRRGCDVVVGTPGRVKDHLERGNLKLQDLMFRVLDECDEMLNMGFVEDVEKIL  280

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
                 D+K VQTLLFSATL  WVK I  +FL+P+ K VD+
Sbjct  281   NAGGDIK-VQTLLFSATLPSWVKDITRRFLQPNHKLVDL  318



>ref|XP_001417262.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO95555.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=654

 Score =   251 bits (641),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 126/223 (57%), Positives = 155/223 (70%), Gaps = 4/223 (2%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE +P A+ NF +S+P++  L+ KG ++LF IQA T E  L G D+VGRARTG GKTLAF
Sbjct  78    EEPNPLALDNFALSEPVKATLRKKGFDALFAIQAETLEIALSGKDVVGRARTGCGKTLAF  137

Query  655   VLPILESLTN-GPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLY  831
             VLPI+E +    P  A  +   GR P  +VL PTRELA QVF DF+  G + G  S C+Y
Sbjct  138   VLPIVEEMAKISPMPANGRRVQGRRPMCVVLAPTRELAKQVFADFDWIGNSFGFKSVCVY  197

Query  832   GNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDV  1011
             G TPY +QEM L+ G D+V+GTPGR+KDH+ R  + +  LKFRVLDE DEML +GFV+DV
Sbjct  198   GGTPYREQEMGLRGGCDVVIGTPGRMKDHLERKTLMMDKLKFRVLDEADEMLNMGFVDDV  257

Query  1012  EFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             E IL    D   VQTLLFSATL  WVK IA +FLKPD  TVD+
Sbjct  258   ELILKSSGD---VQTLLFSATLPPWVKDIAKRFLKPDYATVDL  297



>ref|XP_003078811.1| putative RNA helicase (ISS) [Ostreococcus tauri]
 emb|CAL51691.1| Helicase, C-terminal [Ostreococcus tauri]
Length=693

 Score =   245 bits (626),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 125/224 (56%), Positives = 157/224 (70%), Gaps = 5/224 (2%)
 Frame = +1

Query  475   EEEDPYAITNFR-ISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLA  651
             EE +P A+ NF+ ++ P++  L+ KG ++LF+IQA T E  L G D+VGRARTG GKTLA
Sbjct  75    EEPNPLALDNFKGLTDPVKTTLRKKGYDALFQIQAETLEIALGGRDVVGRARTGCGKTLA  134

Query  652   FVLPILESLTN-GPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             FVLPI+E +    P  A  +   GR P  +VL PTRELA QVF DF+  G + G  S C+
Sbjct  135   FVLPIIELMAKMSPMPANGRRVQGRRPMCVVLAPTRELAKQVFADFDWIGNSYGFKSLCV  194

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG  PY +QEM L+ GVDIV+GTPGR+KDH+ R  + +T LKFRVLDE DEML +GFV+D
Sbjct  195   YGGAPYREQEMGLRSGVDIVIGTPGRMKDHLERKTLMMTDLKFRVLDEADEMLNMGFVDD  254

Query  1009  VEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE IL    D   VQTLLFSATL  WVK I+ +FLKP+  TVD+
Sbjct  255   VETILKSSGD---VQTLLFSATLPSWVKDISKRFLKPNYSTVDL  295



>ref|XP_003058076.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58027.1| predicted protein [Micromonas pusilla CCMP1545]
Length=748

 Score =   246 bits (628),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 119/222 (54%), Positives = 153/222 (69%), Gaps = 1/222 (0%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+DP  ++NF IS+ +   L+ KGI SL+ IQA TF+ VLDG D+V RA+TG GKTLAFV
Sbjct  123   EDDPLRVSNFNISREVCARLETKGITSLYGIQAQTFQHVLDGKDIVARAKTGCGKTLAFV  182

Query  658   LPILESLTN-GPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
             LPI+E++    P  A  +   GR P V +L PTRELA QV  DF+  G A  LT+ C+YG
Sbjct  183   LPIVEAINREHPVPANGRRAQGRAPVVALLAPTRELAKQVHADFQHIGHAFKLTAICVYG  242

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
               PY  Q+  L+ G DIV+GTPGR+KDH+ R  +    L+FRVLDE DEML +GFVED+E
Sbjct  243   GAPYGDQQRLLRAGCDIVIGTPGRMKDHLERKTLSFDKLRFRVLDEADEMLNMGFVEDIE  302

Query  1015  FILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              IL    D +++QTLLFSATL  WV  I+ +FL+PD  TVD+
Sbjct  303   MILNHAKDNEKLQTLLFSATLPKWVADISRRFLQPDHVTVDL  344



>ref|XP_002507890.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69148.1| predicted protein [Micromonas sp. RCC299]
Length=631

 Score =   241 bits (615),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 120/230 (52%), Positives = 156/230 (68%), Gaps = 2/230 (1%)
 Frame = +1

Query  454   EAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTG  633
             EA  GD   ++ + ++NF +SK +   L+ KGI SL+ IQA  F+ +LDG D+VGRARTG
Sbjct  15    EASDGDASVDENH-VSNFNLSKEVCARLETKGITSLYSIQAQCFQPILDGKDLVGRARTG  73

Query  634   QGKTLAFVLPILESLTN-GPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALG  810
              GKTLAFVLPI+E +    P  A+ +   GR P V +L PTRELA QV +DF+  G A G
Sbjct  74    CGKTLAFVLPIVEVINRENPMPASGRRVQGRRPVVALLAPTRELAKQVHSDFQHIGQAFG  133

Query  811   LTSCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLR  990
             LTS C+YG  PY +QE  L++G DIV+GTPGR+KDH+ R  +    L+FRVLDE DEML 
Sbjct  134   LTSICVYGGAPYGEQERALRQGCDIVIGTPGRVKDHLDRKTLSFEKLRFRVLDEADEMLN  193

Query  991   IGFVEDVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             +GFVED+E IL    D   +QT+LFSATL  WV  I+ +FL P   T+D+
Sbjct  194   MGFVEDIETILNHAKDNANLQTVLFSATLPKWVADISKRFLVPGYTTIDL  243



>ref|XP_007512398.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16998.1| predicted protein [Bathycoccus prasinos]
Length=689

 Score =   238 bits (606),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 122/225 (54%), Positives = 150/225 (67%), Gaps = 4/225 (2%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             D    +P A+ NF +S  +  AL+ KGI++LF IQA T +  L G D+VGRARTG GKTL
Sbjct  75    DARTPNPLALENFSLSPEVVSALQKKGIDALFAIQAQTLDTALSGKDIVGRARTGCGKTL  134

Query  649   AFVLPILESLTNG-PAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCC  825
             AFVLPI+E +    P  A+ +   GR P V VL PTRELA QV  DF+  G A  L + C
Sbjct  135   AFVLPIVEQINKSDPTPASGRRLQGRRPVVCVLCPTRELAKQVGADFDWVGQAFNLKTVC  194

Query  826   LYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVE  1005
             +YG  PY  QE  L+ G DI+VGTPGR+KDH+ R N+   +LKFRVLDE DEML +GFV+
Sbjct  195   VYGGAPYRDQEQGLRSGCDIIVGTPGRVKDHLDRKNLKFDNLKFRVLDEADEMLNMGFVD  254

Query  1006  DVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             DVE IL    D   +QTLLFSATL  WVK IA +FLK D  T+D+
Sbjct  255   DVETILKVSGD---IQTLLFSATLPPWVKDIAKRFLKKDYATIDL  296



>ref|XP_001760070.1| predicted protein [Physcomitrella patens]
 gb|EDQ75195.1| predicted protein [Physcomitrella patens]
Length=657

 Score =   228 bits (582),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 133/169 (79%), Gaps = 2/169 (1%)
 Frame = +1

Query  634   QGKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGL  813
             QGKTLAFVLP+LESL+   +  T+  G GR P+V+VL PTRELA QV  DFE YG A+GL
Sbjct  129   QGKTLAFVLPVLESLSQ--SGYTKSLGRGRAPAVIVLAPTRELAKQVHADFETYGNAVGL  186

Query  814   TSCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRI  993
             ++ C+YG  PY  QE  L+RGVDIVVGTPGRIKDH+ RG ++L SLKFR+LDE DEML +
Sbjct  187   STVCVYGGAPYGPQENALRRGVDIVVGTPGRIKDHLERGGLNLKSLKFRILDEADEMLNM  246

Query  994   GFVEDVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             GFV+DVE ILG V D  +VQTLLFSATL  WV+ IA KFLKP+++TVD+
Sbjct  247   GFVDDVEKILGGVDDPSKVQTLLFSATLPTWVQQIARKFLKPERRTVDL  295



>gb|KIZ06880.1| cystathionine gamma-synthase [Monoraphidium neglectum]
Length=1211

 Score =   221 bits (562),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 114/208 (55%), Positives = 141/208 (68%), Gaps = 11/208 (5%)
 Frame = +1

Query  544   KGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILESLTNGPAKATRKTGYGR  723
             +GIESLF IQ    +  L+G D+VGRARTG GKTLAFVLPI+++L      A R   +GR
Sbjct  179   QGIESLFPIQTACLDHALNGFDVVGRARTGCGKTLAFVLPIVQTLLKAGGGAKR--AFGR  236

Query  724   PPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPYAQQEMKLKRGVDIVVGTPG  903
              P V+VL PTRELA QV  DFE  G A GL++ CLYG T Y  QE  L+RGVD+VVGTPG
Sbjct  237   KPLVVVLAPTRELAKQVHADFEYIGQAAGLSTLCLYGGTQYGPQESMLRRGVDVVVGTPG  296

Query  904   RIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILGK---------VADVKQVQT  1056
             R+KDH+ RG +DL+ L FRVLDE DEML +GFV+DVE IL               +++QT
Sbjct  297   RVKDHMERGTLDLSKLCFRVLDECDEMLNMGFVDDVEKILNAGLSKEGAAAAEGAEKLQT  356

Query  1057  LLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             +LFSAT+  WVK I  +FL+   K VD+
Sbjct  357   MLFSATMPAWVKDITRRFLRKGHKLVDL  384



>ref|XP_001702450.1| RNA helicase [Chlamydomonas reinhardtii]
 gb|EDO96945.1| RNA helicase [Chlamydomonas reinhardtii]
Length=737

 Score =   216 bits (549),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/217 (50%), Positives = 151/217 (70%), Gaps = 2/217 (1%)
 Frame = +1

Query  496   ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILES  675
             +  F++S+ ++  L+++ IESLF IQAMT E  ++G D+VGRARTG GKTLAF +P++E 
Sbjct  106   LDRFKLSEQVKSMLRSQNIESLFPIQAMTLEPAMEGLDVVGRARTGCGKTLAFTVPVVER  165

Query  676   L-TNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPYAQ  852
             +     + +    G GR P  +VL PTRELA QV   F   G A  L + C+YG TPY  
Sbjct  166   IIAEQKSGSGIGRGAGRLPVCIVLAPTRELAKQVQEVFANTGKAANLYTMCVYGGTPYDG  225

Query  853   QEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILGKV  1032
             QE  L RGVD+VVGTPGR+KD + RG + L++++FRVLDEVD+ML +GF+EDVE IL + 
Sbjct  226   QEQALSRGVDVVVGTPGRVKDLLERGTLKLSNIRFRVLDEVDQMLAMGFIEDVETILKQG  285

Query  1033  ADVK-QVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              + + Q+QTLLFSATL  WV+ +  +FL+P  K +D+
Sbjct  286   ENNRDQIQTLLFSATLPKWVQGLTQRFLRPGHKFLDL  322



>ref|XP_009064553.1| hypothetical protein LOTGIDRAFT_221850 [Lottia gigantea]
 gb|ESO84752.1| hypothetical protein LOTGIDRAFT_221850 [Lottia gigantea]
Length=719

 Score =   214 bits (546),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 116/238 (49%), Positives = 151/238 (63%), Gaps = 18/238 (8%)
 Frame = +1

Query  463   GGDEEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRART  630
             G  EEE  P     A +NFRIS    + L+  GI  LF +Q+ TF+ V  G+D++ +ART
Sbjct  108   GKQEEELSPQQKAGAFSNFRISPNTVKKLQKNGITYLFPVQSETFDIVYSGSDIITQART  167

Query  631   GQGKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALG  810
             G GKTLAF LPI+E L    +   R    GRPP VLV+ PTRELA QV  DFE Y  +L 
Sbjct  168   GTGKTLAFSLPIIEKLQLDKSPPQR----GRPPKVLVMAPTRELAKQVCEDFESYSSSLV  223

Query  811   LTSCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLR  990
             +   C+YG TPY  QE  L+ GVD++VGTPGRI DHI +GNI+L+ +K  +LDEVD ML 
Sbjct  224   V--LCIYGGTPYGPQERVLRSGVDVIVGTPGRINDHIEKGNINLSQIKHVILDEVDNMLD  281

Query  991   IGFVEDVEFILGKVADVKQV--------QTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             +GFVE VE IL     V  +        QT+LF+ATL  WV+  A+K+++ D KT+D+
Sbjct  282   MGFVEIVEQILAYAYKVHAIISERDEKPQTMLFTATLPPWVRKTANKYMREDVKTIDL  339



>ref|XP_005854803.1| dead deah box rna [Nannochloropsis gaditana CCMP526]
 gb|EKU21559.1| dead deah box rna [Nannochloropsis gaditana CCMP526]
Length=737

 Score =   214 bits (544),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 112/222 (50%), Positives = 149/222 (67%), Gaps = 17/222 (8%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             + DP A++NF+IS+  R  L+A+GI+SLF IQ+MT + +LDG D++GRARTG GKTLAF 
Sbjct  138   DADPNALSNFKISQATRTRLEARGIKSLFPIQSMTLQKILDGCDLIGRARTGCGKTLAFA  197

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             LP++E +  G  +  R    G PP VLVL PTRELA QV  +FE    A  L S C+YG 
Sbjct  198   LPVVELI--GDEREER----GAPPKVLVLAPTRELAKQVADEFEACAPAT-LRSVCIYGG  250

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
              PY  QE  L+RGV +VVGTPGRI DHI RG + L+ L+F +LDE D ML +GF +D++ 
Sbjct  251   APYRPQEEALRRGVQVVVGTPGRILDHIERGTLKLSGLRFLILDEADSMLDMGFKDDIQ-  309

Query  1018  ILGKVADV------KQVQTLLFSATLQDWVKHIASKFLKPDK  1125
                KV D       ++ Q LLFSATL  WV+ +A ++++ DK
Sbjct  310   ---KVCDAMGQDSHQRRQVLLFSATLPPWVQKVAQQYMRKDK  348



>ref|XP_002112077.1| hypothetical protein TRIADDRAFT_55752 [Trichoplax adhaerens]
 gb|EDV26044.1| hypothetical protein TRIADDRAFT_55752 [Trichoplax adhaerens]
Length=633

 Score =   212 bits (540),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 118/233 (51%), Positives = 150/233 (64%), Gaps = 11/233 (5%)
 Frame = +1

Query  448   LMEAVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRAR  627
             L E   G  EE+  +    FRIS  + ++LK +GI  LF IQA TF+ V DG D++G+AR
Sbjct  40    LPEHDSGSMEEKGDFK--KFRISSAIADSLKERGITYLFPIQAQTFDYVYDGQDVIGQAR  97

Query  628   TGQGKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGAL  807
             TG GKTL+F LPI E L     K  R     RPP VLVL PTRELA+Q+ ++F+   G+L
Sbjct  98    TGTGKTLSFALPITEKLI----KKKRSDDKIRPPKVLVLAPTRELAIQITSEFKALSGSL  153

Query  808   GLTSCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEML  987
              +   C+YG  PYA+QE  L+ G+DIV+GTPGRIKDHI R N+ L+ LK  VLDEVD ML
Sbjct  154   KVV--CIYGGVPYAEQENHLRNGIDIVIGTPGRIKDHIDRKNLVLSKLKHVVLDEVDRML  211

Query  988   RIGFVEDVEFILGK--VADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              +GF + VE IL    V D +  QTLLFSAT+  W      K++K DKK VD+
Sbjct  212   DMGFCDIVEEILSHAYVKD-RHPQTLLFSATMPKWALKTIDKYMKSDKKIVDL  263



>gb|EWM21167.1| dead deah box rna [Nannochloropsis gaditana]
Length=737

 Score =   211 bits (537),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/222 (50%), Positives = 148/222 (67%), Gaps = 17/222 (8%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             + DP A++NF+IS+     L+A+GI+SLF IQ+MT + +LDG D++GRARTG GKTLAF 
Sbjct  138   DADPNALSNFKISQATCTRLEARGIKSLFPIQSMTLQKILDGCDLIGRARTGCGKTLAFA  197

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             LP++E +  G  +  R    G PP VLVL PTRELA QV  +FE    A  L S C+YG 
Sbjct  198   LPVVELI--GDEREER----GAPPKVLVLAPTRELAKQVADEFEACAPAT-LRSVCIYGG  250

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
              PY  QE  L+RGV +VVGTPGRI DHI RG + L+ L+F +LDE D ML +GF +D++ 
Sbjct  251   APYRPQEEALRRGVQVVVGTPGRILDHIERGTLKLSGLRFLILDEADSMLDMGFKDDIQ-  309

Query  1018  ILGKVADV------KQVQTLLFSATLQDWVKHIASKFLKPDK  1125
                KV D       ++ Q LLFSATL  WV+ +A ++++ DK
Sbjct  310   ---KVCDAMGQDSHQRRQVLLFSATLPPWVQKVAQQYMRKDK  348



>ref|XP_002955657.1| hypothetical protein VOLCADRAFT_66087 [Volvox carteri f. nagariensis]
 gb|EFJ43297.1| hypothetical protein VOLCADRAFT_66087 [Volvox carteri f. nagariensis]
Length=727

 Score =   210 bits (534),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 114/223 (51%), Positives = 150/223 (67%), Gaps = 14/223 (6%)
 Frame = +1

Query  496   ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILES  675
             +  F +S+ ++  L+++ IESLF IQAMT E  L G D+VGRARTG GKTLAFVLPI+E 
Sbjct  104   LDRFPLSEQVKSMLRSQNIESLFPIQAMTLEPGLAGVDVVGRARTGCGKTLAFVLPIVER  163

Query  676   LTNGPAKATRKTGY------GRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +      A ++ G       GR P  +VL PTRELA QV   F   G A  L + C+YG 
Sbjct  164   IL-----AEQRKGVAAGRVAGRLPICIVLAPTRELAKQVQEVFANVGKAANLYTLCVYGG  218

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  QE  L +GVD+VVGTPGRIKD + RG + L++++FRVLDEVD+ML +GF+EDVE 
Sbjct  219   TPYDGQETALSKGVDVVVGTPGRIKDLLERGTLKLSNIRFRVLDEVDQMLAMGFIEDVET  278

Query  1018  ILGKVADVK--QVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL K  + +   +QTLLFSATL  WVK +  +FL+P  + +D+
Sbjct  279   IL-KAGEQQPDSIQTLLFSATLPKWVKGLTQRFLRPGHRFMDL  320



>ref|XP_008914911.1| hypothetical protein PPTG_18629 [Phytophthora parasitica INRA-310]
 gb|ETM99820.1| hypothetical protein PPTG_18629 [Phytophthora parasitica INRA-310]
Length=684

 Score =   208 bits (529),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 110/224 (49%), Positives = 149/224 (67%), Gaps = 15/224 (7%)
 Frame = +1

Query  460   VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
             VGG   EE+P ++ NFRI    ++ L+A+GI +LF IQAMTF+ +LDG D++GRARTG G
Sbjct  99    VGG---EENP-SLDNFRICDETKKNLQARGIHTLFPIQAMTFDKILDGKDLMGRARTGMG  154

Query  640   KTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTS  819
             KTLAFVLP++E L     K  R    GR P V+ + PTRELA QV ++FE+ G +  L++
Sbjct  155   KTLAFVLPVIELLL----KDKRPRSRGRAPRVVCMAPTRELAKQVASEFELTGPS--LST  208

Query  820   CCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGF  999
              C+YG   Y  Q    + GVDI+VGT GR+ DHI RGN+ L + +F +LDE D ML +GF
Sbjct  209   VCIYGGASYQSQNNAFRSGVDILVGTTGRVIDHIDRGNLRLHNCEFLILDEADTMLEMGF  268

Query  1000  VEDVEFILGKVADVK-----QVQTLLFSATLQDWVKHIASKFLK  1116
              EDV+ +   +  VK     + QTLLFSAT+  WVK +A K++K
Sbjct  269   REDVQKVFTAMDQVKNESTGKRQTLLFSATIPKWVKDVADKYMK  312



>ref|XP_002130533.1| PREDICTED: nucleolar RNA helicase 2 [Ciona intestinalis]
Length=672

 Score =   207 bits (526),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/223 (49%), Positives = 147/223 (66%), Gaps = 13/223 (6%)
 Frame = +1

Query  469   DEEEEDPYAI---TNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
             D +++ P A+    NFRI++  +  LK KG+  LF IQ  +F  V DG D+V +ARTG G
Sbjct  80    DIDDQSPEALGDFNNFRITEQTKVLLKKKGVAYLFPIQIQSFNHVYDGKDVVAQARTGTG  139

Query  640   KTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTS  819
             KTL+F +P++E L        R   YGRPP VLV+ PTRELA+QV  DF+    + GL+S
Sbjct  140   KTLSFAIPLVEKLI-----MNRCKDYGRPPKVLVMAPTRELAIQVRKDFQDI--SQGLSS  192

Query  820   CCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGF  999
              C+YG TPY QQE  ++ GVDIVVGTPGRI DH+ +GN+ L S++  VLDEVD+ML +GF
Sbjct  193   VCIYGGTPYFQQERSMRGGVDIVVGTPGRIMDHVQKGNLQLGSVEHVVLDEVDQMLDMGF  252

Query  1000  VEDVEFILGKVADVKQ---VQTLLFSATLQDWVKHIASKFLKP  1119
                VE ILG     ++    QTLLFSAT   WV++ + K+++P
Sbjct  253   APKVEEILGYAYTEEREGPPQTLLFSATCPPWVRNTSRKYMRP  295



>ref|XP_006630629.1| PREDICTED: nucleolar RNA helicase 2-like [Lepisosteus oculatus]
Length=777

 Score =   207 bits (528),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 108/224 (48%), Positives = 143/224 (64%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NFRISK   + L+A+G+  LF IQ  TF+ V DG D+VG+ARTG GKT +F 
Sbjct  179   EQKAGAFSNFRISKETIQLLQARGVTYLFDIQVKTFDFVFDGNDVVGQARTGTGKTFSFA  238

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L + P +  R    GRPP VLVL+PTRELALQV  DF+     L +   C YG 
Sbjct  239   IPLIEKLQSSPEERKR----GRPPKVLVLVPTRELALQVSRDFKDITKKLSVA--CFYGG  292

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             +PY  Q   ++ G+DI+VGTPGRIKDH+    +DL+ L   VLDEVD+ML +GF E VE 
Sbjct  293   SPYNPQLDNIRNGIDILVGTPGRIKDHLQNNKLDLSKLVHVVLDEVDQMLDMGFAEQVEE  352

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    +       QTLLFSAT   WV  +A K+++P+   VD+
Sbjct  353   ILSAAYRKDSENNPQTLLFSATCPHWVYAVAKKYMRPEYNHVDL  396



>gb|ETP29814.1| hypothetical protein F442_21078 [Phytophthora parasitica P10297]
Length=684

 Score =   206 bits (525),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/224 (49%), Positives = 148/224 (66%), Gaps = 15/224 (7%)
 Frame = +1

Query  460   VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
             VGG   EE+P ++ NFRI    ++ L+A+GI +LF IQAMTF+ +LDG D++GRARTG G
Sbjct  99    VGG---EENP-SLDNFRICDETKKNLQARGIHTLFPIQAMTFDKILDGKDLMGRARTGMG  154

Query  640   KTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTS  819
             KTLAF LP++E L     K  R    GR P V+ + PTRELA QV ++FE+ G +  L++
Sbjct  155   KTLAFALPVIELLL----KDKRPRSRGRAPRVVCMAPTRELAKQVASEFELTGPS--LST  208

Query  820   CCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGF  999
              C+YG   Y  Q    + GVDI+VGT GR+ DHI RGN+ L + +F +LDE D ML +GF
Sbjct  209   VCIYGGASYQSQNNAFRSGVDILVGTTGRVIDHIDRGNLRLHNCEFLILDEADTMLEMGF  268

Query  1000  VEDVEFILGKVADVK-----QVQTLLFSATLQDWVKHIASKFLK  1116
              EDV+ +   +  VK     + QTLLFSAT+  WVK +A K++K
Sbjct  269   REDVQKVFTAMDQVKNESTGKRQTLLFSATIPKWVKDVADKYMK  312



>gb|ETI31844.1| hypothetical protein F443_21248 [Phytophthora parasitica P1569]
 gb|ETL25637.1| hypothetical protein L916_20525 [Phytophthora parasitica]
 gb|ETL78851.1| hypothetical protein L917_20399 [Phytophthora parasitica]
 gb|ETM32130.1| hypothetical protein L914_20404 [Phytophthora parasitica]
 gb|ETO60560.1| hypothetical protein F444_21264 [Phytophthora parasitica P1976]
 gb|ETP01634.1| hypothetical protein F441_21133 [Phytophthora parasitica CJ01A1]
Length=684

 Score =   206 bits (525),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 109/224 (49%), Positives = 148/224 (66%), Gaps = 15/224 (7%)
 Frame = +1

Query  460   VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
             VGG   EE+P ++ NFRI    ++ L+A+GI +LF IQAMTF+ +LDG D++GRARTG G
Sbjct  99    VGG---EENP-SLDNFRICDETKKNLQARGIHTLFPIQAMTFDKILDGKDLMGRARTGMG  154

Query  640   KTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTS  819
             KTLAF LP++E L     K  R    GR P V+ + PTRELA QV ++FE+ G +  L++
Sbjct  155   KTLAFALPVIELLL----KDKRPRSRGRAPRVVCMAPTRELAKQVASEFELTGPS--LST  208

Query  820   CCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGF  999
              C+YG   Y  Q    + GVDI+VGT GR+ DHI RGN+ L + +F +LDE D ML +GF
Sbjct  209   VCIYGGASYQSQNNAFRSGVDILVGTTGRVIDHIDRGNLRLHNCEFLILDEADTMLEMGF  268

Query  1000  VEDVEFILGKVADVK-----QVQTLLFSATLQDWVKHIASKFLK  1116
              EDV+ +   +  VK     + QTLLFSAT+  WVK +A K++K
Sbjct  269   REDVQKVFTAMDQVKNESTGKRQTLLFSATIPKWVKDVADKYMK  312



>ref|XP_008290699.1| PREDICTED: nucleolar RNA helicase 2-like [Stegastes partitus]
Length=754

 Score =   206 bits (524),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 147/231 (64%), Gaps = 15/231 (6%)
 Frame = +1

Query  472   EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
             E+EE P     A +NFRIS+   + LKA+G+  LF IQ  TF+ V DG D++ +ARTG G
Sbjct  152   EKEETPEQREGAFSNFRISQVTIDKLKARGVSYLFDIQVKTFDPVYDGEDVIAQARTGTG  211

Query  640   KTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTS  819
             KT +F +P++E L    A+ TR    GRPP VLVL PTRELA+QV  DF+     L +  
Sbjct  212   KTFSFAIPLVEKLQRDSAEMTR----GRPPKVLVLAPTRELAIQVAKDFKDVSKRLSIA-  266

Query  820   CCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGF  999
              C YG + Y  Q   ++ G+DI+VGTPGRIKDH+    ++LT LK  VLDEVD+ML +GF
Sbjct  267   -CFYGGSSYNPQIDAIRNGIDILVGTPGRIKDHLQNNKLNLTKLKHVVLDEVDQMLDMGF  325

Query  1000  VEDVEFILG----KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              E VE ILG    K +D    QTLLFSAT   WV  +A K+++P  K VD+
Sbjct  326   AEQVEEILGSSYKKDSDANP-QTLLFSATCPPWVYDVAKKYMRPACKHVDL  375



>ref|XP_009837773.1| hypothetical protein H257_12310 [Aphanomyces astaci]
 gb|ETV72987.1| hypothetical protein H257_12310 [Aphanomyces astaci]
Length=683

 Score =   205 bits (521),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/225 (46%), Positives = 143/225 (64%), Gaps = 11/225 (5%)
 Frame = +1

Query  481   EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
             ED   ++NFRIS    + L+ +GI +LF IQAMTF+++ D  D++GRARTG GKTLAFVL
Sbjct  87    EDNPPLSNFRISAATIDNLEKRGIPTLFPIQAMTFDSIYDKKDLIGRARTGMGKTLAFVL  146

Query  661   PILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNT  840
             P++E L     +  R    GRPP V+ + PTRELA QV  +FE+ G  L  T  C+YG  
Sbjct  147   PVVELLLKDGLRKNR----GRPPKVICMAPTRELAKQVAQEFELTGPTLSTT--CIYGGA  200

Query  841   PYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFI  1020
              Y  Q     +GVDIVVGT GRI DH+ RG + L    F +LDE D ML +GF ED++ +
Sbjct  201   SYQSQNSDFSKGVDIVVGTTGRICDHLERGTLKLHQCSFLILDEADTMLEMGFREDIQKV  260

Query  1021  -----LGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
                    K A+   +QTLLFSAT+  WV+ +A++++ P ++ V++
Sbjct  261   FEAMQFAKAAEDHHIQTLLFSATIPSWVETVANQYMSPTREYVNM  305



>ref|XP_006023203.1| PREDICTED: nucleolar RNA helicase 2-like [Alligator sinensis]
Length=689

 Score =   205 bits (521),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 141/219 (64%), Gaps = 9/219 (4%)
 Frame = +1

Query  493   AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILE  672
             A +NF ISK   E LKA+G++ LF IQA TF+ + DG DM+ +ARTG GKT +F LP++E
Sbjct  127   AFSNFSISKETAELLKARGVKYLFSIQAKTFQPIYDGKDMIAQARTGTGKTFSFALPLIE  186

Query  673   SLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPYAQ  852
              L      A ++   GRPP VL+L PTRELA QV  DF+       LT  C YG TPY +
Sbjct  187   KLQG----AIKERKRGRPPKVLILTPTRELANQVARDFKDI--TKKLTVACFYGGTPYGE  240

Query  853   QEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILG--  1026
             Q + ++ G+DI+VGTPGRIKDH+  G + L+++K  VLDEVD+ML +GF E VE IL   
Sbjct  241   QILHIQNGIDILVGTPGRIKDHLQNGKLSLSNVKHVVLDEVDQMLDMGFAEQVEEILTFA  300

Query  1027  -KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              K       QTLLFSAT   WV ++  K++K   + +D+
Sbjct  301   YKKDSEDNPQTLLFSATCPHWVYNVGKKYMKSSYEQIDL  339



>ref|XP_005815128.1| PREDICTED: nucleolar RNA helicase 2-like [Xiphophorus maculatus]
Length=745

 Score =   205 bits (522),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 113/237 (48%), Positives = 146/237 (62%), Gaps = 15/237 (6%)
 Frame = +1

Query  454   EAVGGDEEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGR  621
             E     E E+ P     A +NFRISK   + LKA+G+  LF IQ  +F AV DG D++ +
Sbjct  143   ELASDSENEQTPEQREGAFSNFRISKVTIDKLKARGVTYLFDIQVKSFNAVYDGEDVIAQ  202

Query  622   ARTGQGKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGG  801
             ARTG GKT +F LP++E L N   +  R    GRPP VLVL PTRELA+QV  DF+    
Sbjct  203   ARTGTGKTFSFALPLVEKLQNDSVEMMR----GRPPKVLVLTPTRELAIQVSKDFKDIAK  258

Query  802   ALGLTSCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDE  981
              L +   C YG + Y  Q   ++ G+DI+VGTPGRIKDH+    ++LT LK  VLDEVD+
Sbjct  259   RLSIA--CFYGGSSYNPQIDAIRNGIDILVGTPGRIKDHLENNKLNLTKLKHVVLDEVDQ  316

Query  982   MLRIGFVEDVEFILG----KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             ML +GF E VE ILG    K +D    QTLLFSAT   WV  +A K+++P  K +D+
Sbjct  317   MLDMGFAEQVEEILGTSYKKDSDTNP-QTLLFSATCPPWVYDVAKKYMRPGCKHIDL  372



>ref|XP_007549868.1| PREDICTED: nucleolar RNA helicase 2-like [Poecilia formosa]
Length=743

 Score =   205 bits (521),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 112/237 (47%), Positives = 147/237 (62%), Gaps = 15/237 (6%)
 Frame = +1

Query  454   EAVGGDEEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGR  621
             E     E E+ P     A +NFRISK   + LKA+G+  LF IQ  +F AV DG D++ +
Sbjct  143   ELASDSENEQTPEQREGAFSNFRISKVTIDKLKARGVTYLFDIQVKSFNAVYDGEDVIAQ  202

Query  622   ARTGQGKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGG  801
             ARTG GKT +F +P++E L N   + TR    GRPP VLVL PTRELA+QV  DF+    
Sbjct  203   ARTGTGKTFSFAIPLVEKLQNDSVEMTR----GRPPKVLVLAPTRELAIQVSKDFKDIAK  258

Query  802   ALGLTSCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDE  981
              L +   C YG + Y  Q   ++ G+DI+VGTPGRIKDH+    ++LT LK  VLDEVD+
Sbjct  259   RLSIV--CFYGGSSYNPQIDAIRNGIDILVGTPGRIKDHLENNKLNLTKLKHVVLDEVDQ  316

Query  982   MLRIGFVEDVEFILG----KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             ML +GF + VE ILG    K +D    QTLLFSAT   WV  +A K+++P  K +D+
Sbjct  317   MLDMGFADQVEEILGSSYKKDSDTNP-QTLLFSATCPPWVYDVAKKYMRPGCKHIDL  372



>ref|XP_006273547.1| PREDICTED: nucleolar RNA helicase 2-like [Alligator mississippiensis]
Length=692

 Score =   203 bits (517),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 143/219 (65%), Gaps = 9/219 (4%)
 Frame = +1

Query  493   AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILE  672
             A +NF ISK   E LKA+G++ LF IQA TF+ + DG DM+ +ARTG GKT +F LP++E
Sbjct  128   AFSNFSISKETAELLKARGVKYLFSIQAKTFQPIYDGKDMIVQARTGTGKTFSFALPLIE  187

Query  673   SLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPYAQ  852
              L     +A ++   GRPP VL+L PTRELA QV  DF+       LT  C YG TPY +
Sbjct  188   KLQ----EAIKEEKRGRPPKVLILTPTRELANQVARDFKDI--TKKLTVACFYGGTPYGE  241

Query  853   QEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILG--  1026
             Q + ++ G+DI+VGTPGRIKDH+  G + L+++K  VLDEVD+ML +GF E VE IL   
Sbjct  242   QILHIQNGIDILVGTPGRIKDHLQNGKLSLSNVKHVVLDEVDQMLDMGFAEQVEEILTFA  301

Query  1027  -KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              K       QTLLFSAT   W+ +++ K++K   + +D+
Sbjct  302   YKKDSEDNPQTLLFSATCPHWLYNVSKKYMKSSYEQIDL  340



>ref|XP_001417991.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96284.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=346

 Score =   196 bits (497),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 108/216 (50%), Positives = 140/216 (65%), Gaps = 11/216 (5%)
 Frame = +1

Query  496   ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILES  675
             + NF +S     AL+ +G+++LF IQ    +  L G D+VGRARTG GKTLAF LP++E 
Sbjct  3     VGNFGMSAITVAALRKRGVDTLFPIQQAVLKPALSGEDVVGRARTGTGKTLAFALPVIER  62

Query  676   L-TNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPYAQ  852
             L T+G       +G  R P  +VL PTRELA QV  + E+   A  L + C+YG TP  Q
Sbjct  63    LLTDG------TSGRSRNPKCIVLAPTRELAKQV--ENEICITAPSLETVCVYGGTPIGQ  114

Query  853   QEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILGKV  1032
             QE KL+RGVDIVVGTPGR++D + R ++DL  ++F VLDE D+ML +GF EDVE IL   
Sbjct  115   QEGKLRRGVDIVVGTPGRVQDLMNRRSLDLGEIEFVVLDEADQMLNVGFEEDVEAILQDC  174

Query  1033  ADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              + +  QT LFSAT+  WVK I  KFLKP    VD+
Sbjct  175   PESR--QTFLFSATMPSWVKQITKKFLKPGHVVVDL  208



>ref|XP_005733301.1| PREDICTED: nucleolar RNA helicase 2-like [Pundamilia nyererei]
Length=754

 Score =   203 bits (516),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 143/231 (62%), Gaps = 15/231 (6%)
 Frame = +1

Query  472   EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
             E EE P     A +NFRISK   + LKA+G+  LF IQ  TF  V DG D++ +ARTG G
Sbjct  149   ETEETPEQKEGAFSNFRISKVTIDKLKARGVSYLFDIQVKTFNHVYDGEDVIAQARTGTG  208

Query  640   KTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTS  819
             KT +F +P++E L        R    GRPP VLVL PTRELA+QV  DF+     + +  
Sbjct  209   KTFSFAIPLVEKLQKDSVDMAR----GRPPKVLVLTPTRELAIQVAKDFKDIAKRVSIA-  263

Query  820   CCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGF  999
              C YG + Y  Q   ++ G+DI+VGTPGRIKDHI    ++LT +K  VLDEVD+ML +GF
Sbjct  264   -CFYGGSSYNPQIDAIRNGIDILVGTPGRIKDHIQNNKLNLTKVKHVVLDEVDQMLDMGF  322

Query  1000  VEDVEFILG----KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              E VE ILG    K AD    QTLLFSAT   WV  +A K+++P+ K +D+
Sbjct  323   AEQVEEILGSSYKKDADTNP-QTLLFSATCPPWVYEVAKKYMRPNCKHIDL  372



>ref|XP_005467227.1| PREDICTED: nucleolar RNA helicase 2-like [Oreochromis niloticus]
Length=757

 Score =   202 bits (515),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 144/231 (62%), Gaps = 15/231 (6%)
 Frame = +1

Query  472   EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
             E EE P     A +NFRISK   + LKA+G+  LF IQ  TF  V DG D++ +ARTG G
Sbjct  150   ETEETPEQKEGAFSNFRISKVTIDKLKARGVSYLFDIQVKTFNHVYDGEDVIAQARTGTG  209

Query  640   KTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTS  819
             KT +F +P++E L     +  R    GRPP VLVL PTRELA+QV  DF+     + +  
Sbjct  210   KTFSFAIPLVEKLQKDSVEMAR----GRPPKVLVLTPTRELAIQVAKDFKDIAKRVSIA-  264

Query  820   CCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGF  999
              C YG + Y  Q   ++ G+DI+VGTPGRIKDHI    ++LT +K  VLDEVD+ML +GF
Sbjct  265   -CFYGGSSYNPQIDAIRNGIDILVGTPGRIKDHIQNNKLNLTKVKHVVLDEVDQMLDMGF  323

Query  1000  VEDVEFILG----KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              E VE ILG    K +D    QTLLFSAT   WV  +A K+++P+ K +D+
Sbjct  324   AEQVEEILGSSYKKDSDTNP-QTLLFSATCPPWVYEVAKKYMRPNCKHIDL  373



>ref|XP_004334405.1| DEAD/DEAH box helicase domain containing protein [Acanthamoeba 
castellanii str. Neff]
 gb|ELR12392.1| DEAD/DEAH box helicase domain containing protein [Acanthamoeba 
castellanii str. Neff]
Length=723

 Score =   202 bits (514),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 105/215 (49%), Positives = 142/215 (66%), Gaps = 4/215 (2%)
 Frame = +1

Query  499   TNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILESL  678
             ++FRIS    + L+ +G + LF IQA T++ + DG D++GRARTG GKTL+FVLP++E +
Sbjct  119   SDFRISPTTVKLLQDRGFKCLFAIQAQTYDHIYDGKDIIGRARTGSGKTLSFVLPVVEKI  178

Query  679   TNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPYAQQE  858
                 A   R T YGRPP V+ L PTRELA Q+  +F++   A  L + C+YG  PY  QE
Sbjct  179   FIDMAGKPRST-YGRPPKVVCLSPTRELARQIAKEFDLV--APSLKAVCVYGGAPYTPQE  235

Query  859   MKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILGKVAD  1038
               LKRGVDIV+GTPGR+ D + R  + LT +K+ +LDE DEML IGF + V+ IL     
Sbjct  236   NALKRGVDIVIGTPGRVIDMLDRNCLKLTDVKYVILDEADEMLNIGFADAVDKILASAPK  295

Query  1039  VKQVQTLLFSATLQDWVKHIASKFLKPDK-KTVDI  1140
               + QTLLFSAT+  WV+ IA K ++P    TVD+
Sbjct  296   PDERQTLLFSATIPPWVQGIAQKHMRPSNLITVDL  330



>ref|XP_005297367.1| PREDICTED: nucleolar RNA helicase 2 [Chrysemys picta bellii]
Length=813

 Score =   203 bits (516),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 142/225 (63%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EEE   A +NF ISK   E LKA+G++ LF +QA TF+ + DG D++ +ARTG GKT +F
Sbjct  237   EEEREGAFSNFSISKETTELLKARGVKYLFSVQAKTFQPIYDGKDVIAQARTGTGKTFSF  296

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              +P++E L     +  R    GR P VLVL PTRELA+QV  DF+       LT  C YG
Sbjct  297   AVPLIEKLQGDTLERKR----GRTPKVLVLAPTRELAIQVARDFKDV--TKKLTVACFYG  350

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY  Q   ++ G+DI+VGTPGRIKDH+  G +DL+++K  VLDEVD+ML +GF E VE
Sbjct  351   GTPYNGQIEHIRNGIDILVGTPGRIKDHLQNGKLDLSNVKHVVLDEVDQMLDMGFAEQVE  410

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              IL    K       QTLLFSAT   WV  +A K++K   + VD+
Sbjct  411   EILAFAYKKDSEDNPQTLLFSATCPHWVYDVAKKYMKSGYEQVDL  455



>ref|XP_005915179.1| PREDICTED: nucleolar RNA helicase 2-like [Haplochromis burtoni]
Length=796

 Score =   202 bits (515),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 143/231 (62%), Gaps = 15/231 (6%)
 Frame = +1

Query  472   EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
             E EE P     A +NFRISK   + LKA+G+  LF IQ  TF  V DG D++ +ARTG G
Sbjct  190   ETEETPEQKEGAFSNFRISKVTIDKLKARGVSYLFDIQVKTFNHVYDGEDVIAQARTGTG  249

Query  640   KTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTS  819
             KT +F +P++E L        R    GRPP VLVL PTRELA+QV  DF+     + +  
Sbjct  250   KTFSFAIPLVEKLQKDSVDMAR----GRPPKVLVLTPTRELAIQVAKDFKDIAKRVSIA-  304

Query  820   CCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGF  999
              C YG + Y  Q   ++ G+DI+VGTPGRIKDHI    ++LT +K  VLDEVD+ML +GF
Sbjct  305   -CFYGGSSYNPQIDAIRNGIDILVGTPGRIKDHIQNNKLNLTKVKHVVLDEVDQMLDMGF  363

Query  1000  VEDVEFILG----KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              E VE ILG    K AD    QTLLFSAT   WV  +A K+++P+ K +D+
Sbjct  364   AEQVEEILGSSYKKDADTNP-QTLLFSATCPPWVYEVAKKYMRPNCKHIDL  413



>ref|XP_004539930.1| PREDICTED: nucleolar RNA helicase 2-like [Maylandia zebra]
Length=797

 Score =   202 bits (515),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 143/231 (62%), Gaps = 15/231 (6%)
 Frame = +1

Query  472   EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
             E EE P     A +NFRISK   + LKA+G+  LF IQ  TF  V DG D++ +ARTG G
Sbjct  191   ETEETPEQKEGAFSNFRISKVTIDKLKARGVSYLFDIQVKTFNHVYDGEDVIAQARTGTG  250

Query  640   KTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTS  819
             KT +F +P++E L        R    GRPP VLVL PTRELA+QV  DF+     + +  
Sbjct  251   KTFSFAIPLVEKLQKDSVDMAR----GRPPKVLVLTPTRELAIQVAKDFKDIAKRVSIA-  305

Query  820   CCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGF  999
              C YG + Y  Q   ++ G+DI+VGTPGRIKDHI    ++LT +K  VLDEVD+ML +GF
Sbjct  306   -CFYGGSSYNPQIDAIRNGIDILVGTPGRIKDHIQNNKLNLTKVKHVVLDEVDQMLDMGF  364

Query  1000  VEDVEFILG----KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              E VE ILG    K AD    QTLLFSAT   WV  +A K+++P+ K +D+
Sbjct  365   AEQVEEILGSSYKKDADTNP-QTLLFSATCPPWVYEVAKKYMRPNCKHIDL  414



>ref|XP_006780037.1| PREDICTED: nucleolar RNA helicase 2-like [Neolamprologus brichardi]
Length=794

 Score =   202 bits (515),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 111/231 (48%), Positives = 143/231 (62%), Gaps = 15/231 (6%)
 Frame = +1

Query  472   EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
             E EE P     A +NFRISK   + LKA+G+  LF IQ  TF  V DG D++ +ARTG G
Sbjct  189   ETEETPEQKEGAFSNFRISKVTIDKLKARGVAYLFDIQVKTFNHVYDGEDVIAQARTGTG  248

Query  640   KTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTS  819
             KT +F +P++E L        R    GRPP VLVL PTRELA+QV  DF+     + +  
Sbjct  249   KTFSFAIPLVEKLQKDSVDMAR----GRPPKVLVLTPTRELAIQVAKDFKDIAKRVSIA-  303

Query  820   CCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGF  999
              C YG + Y  Q   ++ G+DI+VGTPGRIKDHI    ++LT +K  VLDEVD+ML +GF
Sbjct  304   -CFYGGSSYNPQIDAIRNGIDILVGTPGRIKDHIQNNKLNLTKVKHVVLDEVDQMLDMGF  362

Query  1000  VEDVEFILG----KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              E VE ILG    K AD    QTLLFSAT   WV  +A K+++P+ K +D+
Sbjct  363   AEQVEEILGSSYKKDADTNP-QTLLFSATCPPWVYEVAKKYMRPNCKHIDL  412



>ref|XP_006820781.1| PREDICTED: nucleolar RNA helicase 2-like isoform X2 [Saccoglossus 
kowalevskii]
Length=707

 Score =   202 bits (513),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 145/226 (64%), Gaps = 12/226 (5%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             +EE   A +NFR+S     +LKA+ I  LF IQA TF+ V DG D++ +ARTG GKTLAF
Sbjct  120   KEEKAGAFSNFRLSPQTIASLKARSITHLFPIQAKTFDYVYDGHDVIAQARTGTGKTLAF  179

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LP++E L N   KA      GRPP VLV+ PTRELA QV  DF+     L  ++ C+YG
Sbjct  180   ALPLVEKLKNTEFKA------GRPPQVLVMAPTRELAKQVSEDFQASNPRL--STLCVYG  231

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              T Y  QE  ++RGVD++VGTPGRI D++ +  ++L+ LK  +LDEVD ML +GF + VE
Sbjct  232   GTAYWPQESAIRRGVDVLVGTPGRILDYVQKNTLNLSQLKHVILDEVDRMLDMGFADTVE  291

Query  1015  FILGKVADV----KQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              IL     +    +  QTLLFSATL +WV   A K++K + K VD+
Sbjct  292   EILSASYKMDNPGENPQTLLFSATLPEWVYRTAKKYMKSEIKRVDL  337



>ref|XP_002738237.2| PREDICTED: nucleolar RNA helicase 2-like isoform X1 [Saccoglossus 
kowalevskii]
Length=708

 Score =   202 bits (513),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 145/226 (64%), Gaps = 12/226 (5%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             +EE   A +NFR+S     +LKA+ I  LF IQA TF+ V DG D++ +ARTG GKTLAF
Sbjct  121   KEEKAGAFSNFRLSPQTIASLKARSITHLFPIQAKTFDYVYDGHDVIAQARTGTGKTLAF  180

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LP++E L N   KA      GRPP VLV+ PTRELA QV  DF+     L  ++ C+YG
Sbjct  181   ALPLVEKLKNTEFKA------GRPPQVLVMAPTRELAKQVSEDFQASNPRL--STLCVYG  232

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              T Y  QE  ++RGVD++VGTPGRI D++ +  ++L+ LK  +LDEVD ML +GF + VE
Sbjct  233   GTAYWPQESAIRRGVDVLVGTPGRILDYVQKNTLNLSQLKHVILDEVDRMLDMGFADTVE  292

Query  1015  FILGKVADV----KQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              IL     +    +  QTLLFSATL +WV   A K++K + K VD+
Sbjct  293   EILSASYKMDNPGENPQTLLFSATLPEWVYRTAKKYMKSEIKRVDL  338



>ref|XP_008873274.1| hypothetical protein H310_09087 [Aphanomyces invadans]
 gb|ETV98399.1| hypothetical protein H310_09087 [Aphanomyces invadans]
Length=675

 Score =   201 bits (512),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 101/225 (45%), Positives = 143/225 (64%), Gaps = 11/225 (5%)
 Frame = +1

Query  481   EDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVL  660
             +D   ++NFR+S    + L+ +GI +LF IQAMTF+++ D  D++GRARTG GKTLAFVL
Sbjct  82    DDNPPLSNFRVSAVTIKNLEKRGIATLFPIQAMTFDSIYDKKDLIGRARTGMGKTLAFVL  141

Query  661   PILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNT  840
             P++E L     +  R    GRPP V+ + PTRELA QV  +FE+ G +  LT+ C+YG  
Sbjct  142   PVVELLLKDGLRKNR----GRPPKVICMAPTRELAKQVAQEFELTGPS--LTTTCIYGGA  195

Query  841   PYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFI  1020
              Y  Q     +GVDIVVGT GRI DH+ RG + L    F +LDE D ML +GF EDV+ +
Sbjct  196   SYQSQNNDFSKGVDIVVGTTGRICDHLDRGTLRLHQCSFLILDEADTMLEMGFREDVQKV  255

Query  1021  L-----GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
                    K      +QTLLFSAT+  WV+ +A +++ P+++ V++
Sbjct  256   FEAMQAAKATSDHHIQTLLFSATIPSWVESVAKQYMSPNREYVNM  300



>ref|XP_007054740.1| PREDICTED: nucleolar RNA helicase 2-like [Chelonia mydas]
Length=681

 Score =   201 bits (511),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 141/225 (63%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EEE   A +NF ISK   E LKA+G++ LF +QA TF+ + DG D++ +ARTG GKT +F
Sbjct  105   EEEKEGAFSNFSISKETTELLKARGVKYLFSVQAKTFQPIYDGKDVIAQARTGTGKTFSF  164

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              +P++E L     +  R    GR P VLVL PTRELA+QV  DF+       LT  C YG
Sbjct  165   AVPLIEKLQGDTLERKR----GRIPKVLVLAPTRELAIQVARDFKDV--TKKLTVACFYG  218

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY  Q   +K G+DI+VGTPGRIKDH+  G +D++++K  VLDEVD+ML +GF E VE
Sbjct  219   GTPYNGQIEHIKNGIDILVGTPGRIKDHLQNGKLDVSNVKHVVLDEVDQMLDMGFAEQVE  278

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              IL    K       QTLLFSAT   WV  +A K++K   +  D+
Sbjct  279   EILAFAYKKDSEDNPQTLLFSATCPHWVYDVAKKYMKSRYEQFDL  323



>ref|XP_006125341.1| PREDICTED: nucleolar RNA helicase 2 [Pelodiscus sinensis]
Length=728

 Score =   201 bits (512),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 140/225 (62%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EEE   A +NF ISK   E LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  154   EEEKEGAFSNFSISKETIELLKARGVKYLFSVQVKTFQPIYDGKDVIAQARTGTGKTFSF  213

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              +P++E L  G  +  R    GR P VL L PTRELA+QV  DF+       LT  C YG
Sbjct  214   AVPLIEKLQGGTMERKR----GRTPKVLALAPTRELAIQVARDFKDI--TKKLTVACFYG  267

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY  Q   +K G+DI+VGTPGRIKDH+    +DL+++K  VLDEVD+ML +GF E VE
Sbjct  268   GTPYNGQIEHIKNGIDILVGTPGRIKDHLQNNKLDLSNVKHVVLDEVDQMLDMGFAEQVE  327

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              IL    K       QTLLFSAT   WV  +A K++K   + +D+
Sbjct  328   EILAFAYKKDSEDNPQTLLFSATCPHWVYDVAKKYMKSKYEQIDL  372



>ref|XP_009674650.1| PREDICTED: nucleolar RNA helicase 2-like [Struthio camelus australis]
Length=597

 Score =   199 bits (507),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 109/234 (47%), Positives = 144/234 (62%), Gaps = 12/234 (5%)
 Frame = +1

Query  457   AVGGDEE---EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRAR  627
               GG EE   E    A +NF +SK     LKA+G++ LF +Q  TF+ + DG D++ +AR
Sbjct  11    CAGGPEELTEEAREGAFSNFPLSKNTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQAR  70

Query  628   TGQGKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGAL  807
             TG GKT +F +P++E L + P    R    GR P VLVL+PTRELA+QV  DF+     L
Sbjct  71    TGTGKTFSFAIPLVEKLQSVPQDGKR----GRAPKVLVLVPTRELAIQVARDFQNLTRKL  126

Query  808   GLTSCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEML  987
              +   C YG TPY  Q   LK G+D++VGTPGRIKDHI    +DL+++K  VLDEVD ML
Sbjct  127   SVA--CFYGGTPYKAQFDLLKSGIDVLVGTPGRIKDHIQNSKLDLSTVKHVVLDEVDHML  184

Query  988   RIGFVEDVEFILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              +GF E VE ILG   K       QTLLFSAT   WV  +A K++K + + +D+
Sbjct  185   DMGFAEQVEEILGFAYKKGSEDNPQTLLFSATCPRWVYDVAKKYMKDEYEQIDL  238



>ref|XP_010753600.1| PREDICTED: nucleolar RNA helicase 2-like isoform X1 [Larimichthys 
crocea]
 ref|XP_010753601.1| PREDICTED: nucleolar RNA helicase 2-like isoform X2 [Larimichthys 
crocea]
Length=754

 Score =   201 bits (511),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 112/231 (48%), Positives = 145/231 (63%), Gaps = 15/231 (6%)
 Frame = +1

Query  472   EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
             E EE P     A +NFRIS+   + LKA+G+  LF IQ  TF  V DG D++ +ARTG G
Sbjct  146   ETEETPEQKEGAFSNFRISQVTIDKLKARGVSYLFDIQVKTFNPVYDGEDVIAQARTGTG  205

Query  640   KTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTS  819
             KT +F +P++E L     + +R    GR P VLVL PTRELA+QV  DF+     L ++ 
Sbjct  206   KTFSFAIPLVEKLQKDSVQLSR----GRAPKVLVLTPTRELAIQVAKDFKDIIKKLAIS-  260

Query  820   CCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGF  999
              C YG + Y  Q   ++ G+DI+VGTPGRIKDHI    +DL+ LK  VLDEVD+ML +GF
Sbjct  261   -CFYGGSSYNPQLDAIRNGIDILVGTPGRIKDHIQNNKLDLSKLKHVVLDEVDQMLDMGF  319

Query  1000  VEDVEFIL----GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              E VE IL    GK +D    QTLLFSAT   WV  +A K++KP+ K VD+
Sbjct  320   AEQVEEILASSYGKDSD-PNPQTLLFSATCPPWVYEVAKKYMKPECKHVDL  369



>ref|XP_010887236.1| PREDICTED: nucleolar RNA helicase 2-like [Esox lucius]
Length=766

 Score =   201 bits (511),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 140/224 (63%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NFRIS    + L+A+GI  LF IQ  TF +V DG D++G+ARTG GKTLAF 
Sbjct  160   EQKSGAFSNFRISPNTIKLLEARGISFLFDIQTQTFNSVYDGKDVIGQARTGTGKTLAFA  219

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L N P    R    GR P VL L PTRELA+QV  DF+     L +T  C YG 
Sbjct  220   IPLIEKLQNDPEDKKR----GRAPKVLCLAPTRELAIQVAKDFKDMTKKLSVT--CFYGG  273

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             + Y  Q   ++ G+D++VGTPGRIKDH+    +DL+ LK  VLDEVD+ML +GF E VE 
Sbjct  274   SSYNPQLDAIRGGIDVLVGTPGRIKDHLQNNKLDLSQLKHVVLDEVDQMLDMGFAEQVEE  333

Query  1018  ILGKVADV---KQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL            QTLLFSAT   WV  +A K+++P+ + VD+
Sbjct  334   ILSASYQKGLESNPQTLLFSATCPPWVYEVAKKYMRPNFEHVDL  377



>ref|XP_010073942.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Pterocles 
gutturalis]
Length=575

 Score =   198 bits (504),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 142/225 (63%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE +  A +NF +SK     LKA+ ++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  4     EEAEEGAFSNFPLSKNTINLLKARCVKYLFPVQVKTFQPIYDGKDVIAQARTGTGKTFSF  63

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
             VLP++E L +   +  R    GR P VLVL+PTRELA QV  DF+     L +   C YG
Sbjct  64    VLPLIEKLQSVSQEGRR----GRSPKVLVLVPTRELATQVAKDFKNLTRKLSVA--CFYG  117

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY +Q   LK G+DI+VGTPGRIKDHI    ++L+S+K  VLDEVD ML +GF E VE
Sbjct  118   GTPYREQLDLLKSGIDILVGTPGRIKDHIQNSKLELSSVKHVVLDEVDHMLDMGFAEQVE  177

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K++K D + +D+
Sbjct  178   EILGFAYKKGSENNPQTLLFSATCPRWVYDVAKKYMKDDYEQIDL  222



>gb|ACH85363.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 21 [Salmo salar]
Length=611

 Score =   199 bits (505),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 105/224 (47%), Positives = 140/224 (63%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NFRIS    + L+A+GI  LF IQ  TF +V +G D++G+ARTG GKTLAF 
Sbjct  29    EQKEGAFSNFRISPNTIKLLQARGISYLFDIQTQTFNSVYEGKDVIGQARTGTGKTLAFA  88

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L N P    R    GR P +L L PTRELA+QV  DF+     L +T  C YG 
Sbjct  89    IPLIEKLQNDPDDKRR----GRAPKILCLAPTRELAIQVSKDFKDMTKKLSVT--CFYGG  142

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             + Y  Q   ++ G+DI+VGTPGRIKDH+    +DL+ LK  VLDEVD+ML +GF E VE 
Sbjct  143   SSYNPQLDAIRSGIDILVGTPGRIKDHLQNNKLDLSQLKHVVLDEVDQMLDMGFAEQVEE  202

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    +       QTLLFSAT   WV  +A ++++P  + VD+
Sbjct  203   ILSASYQKDSETNPQTLLFSATCPSWVYDVAKRYMRPTYEHVDL  246



>dbj|BAE87690.1| unnamed protein product [Macaca fascicularis]
Length=353

 Score =   193 bits (490),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 140/224 (63%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LK +G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  31    EQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  90

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L +G  +  ++   GRPP VLVL PTRELA QV  DF      L +   C YG 
Sbjct  91    IPLIEKL-HGELQDRKR---GRPPQVLVLAPTRELANQVSKDFSDITKKLSVA--CFYGG  144

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDHI  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  145   TPYGGQFERMRNGIDILVGTPGRIKDHIQSGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  204

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  205   ILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTCEQVDL  248



>emb|CDQ75565.1| unnamed protein product [Oncorhynchus mykiss]
Length=749

 Score =   199 bits (507),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/224 (47%), Positives = 140/224 (63%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NFRIS    + L+A+GI  LF IQ  TF +V +G D++G+ARTG GKTLAF 
Sbjct  167   EQKEGAFSNFRISPNTIKLLQARGISYLFDIQTQTFNSVYEGKDVIGQARTGTGKTLAFA  226

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L N P    R    GR P +L L PTRELA+QV  DF+     L +T  C YG 
Sbjct  227   IPLIEKLQNDPDDKKR----GRAPKILCLAPTRELAIQVSKDFKDMTKKLSVT--CFYGG  280

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             + Y  Q   ++ G+DI+VGTPGRIKDH+    +DL+ LK  VLDEVD+ML +GF E VE 
Sbjct  281   SSYNPQLDAIRSGIDILVGTPGRIKDHLQNNKLDLSQLKHVVLDEVDQMLDMGFAEQVEE  340

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    +       QTLLFSAT   WV  +A ++++P  + VD+
Sbjct  341   ILSASYQKDSETNPQTLLFSATCPSWVYDVAKRYMRPTYEHVDL  384



>ref|XP_009703721.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Cariama cristata]
Length=511

 Score =   196 bits (497),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 138/225 (61%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE    A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  58    EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQVKTFQPIYDGKDVIAQARTGTGKTFSF  117

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LP+ E L +      R    GR P VLVL+PTRELA QV  DF+     L +   C YG
Sbjct  118   ALPLTEKLQSVSQDGRR----GRAPKVLVLVPTRELATQVARDFKNLTRKLSV--ACFYG  171

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY  Q   LK G+DI+VGTPGRIKDHI    ++L+S+K  VLDEVD ML +GF E VE
Sbjct  172   GTPYKAQLDLLKSGIDILVGTPGRIKDHIQNSKLELSSVKHVVLDEVDHMLDMGFAEQVE  231

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K++K + + +D+
Sbjct  232   EILGFAYKKGSENNPQTLLFSATCPRWVHDVAKKYMKDEYEQIDL  276



>ref|XP_010197456.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Colius striatus]
Length=350

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/220 (48%), Positives = 138/220 (63%), Gaps = 11/220 (5%)
 Frame = +1

Query  493   AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILE  672
             A++NF ISK   + L+A+G+  LF +Q  TF+ V  G D++ +ARTG GKT +F +P++E
Sbjct  99    ALSNFPISKATVQLLQARGVTYLFPVQVKTFDPVYSGKDVIAQARTGTGKTFSFAIPLIE  158

Query  673   SLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPYAQ  852
              L     +  R    GR P VLVL PTRELA QV  DF+       LT  C YG TPY  
Sbjct  159   KLQGDSQERKR----GRSPKVLVLCPTRELANQVAKDFKDI--TRKLTVACFYGGTPYNG  212

Query  853   QEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILGKV  1032
             Q   ++ G+DI+VGTPGRIKDH+  G +DLT +K  VLDEVD+ML +GF E VE IL +V
Sbjct  213   QVDLMRSGIDILVGTPGRIKDHLQNGKLDLTKVKHVVLDEVDQMLDMGFAEQVEDIL-RV  271

Query  1033  ADVKQV----QTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             A  K      QTLLFSAT   WV  +A K++K   + +D+
Sbjct  272   AYKKDSEDNPQTLLFSATCPHWVYDVAKKYMKSKYEQIDL  311



>emb|CDS09503.1| hypothetical protein LRAMOSA10863 [Absidia idahoensis var. thermophila]
Length=681

 Score =   198 bits (504),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/237 (48%), Positives = 150/237 (63%), Gaps = 10/237 (4%)
 Frame = +1

Query  448   LMEAVGGDEEEEDP--YAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGR  621
             ++E  G   EE+ P    ++ FRIS+   E L+A+GI+SLF IQA TF+++ DG D++ R
Sbjct  64    VVEETGKHNEEDVPEHLKLSKFRISQGTVENLEARGIKSLFDIQAATFDSIFDGNDVLAR  123

Query  622   ARTGQGKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGG  801
             ARTG GKTLAF LP++E L       TR+   GR P VLV+ PTR+LA QV  DFE   G
Sbjct  124   ARTGTGKTLAFALPVIEKLALDTEYNTRR---GRAPRVLVMCPTRDLAKQVCGDFETISG  180

Query  802   ALGLTSCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDE  981
                L +  +YG TPY +Q   LK GVD++VGTPGRI DHI  GN+ L +LK+ +LDE DE
Sbjct  181   NR-LQALAVYGGTPYQEQTSVLKAGVDVIVGTPGRILDHIKYGNLKLHALKYIILDEADE  239

Query  982   MLRI-GFVEDVEFILGKVADVKQ---VQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             ML   GF +D+   L  V + K     QTLLFSAT+ D V     +F+K D K +D+
Sbjct  240   MLDARGFEQDMFAALDFVKEQKSERDYQTLLFSATVPDSVMETIQRFMKSDYKRIDL  296



>ref|XP_006889064.1| PREDICTED: nucleolar RNA helicase 2 [Elephantulus edwardii]
Length=786

 Score =   199 bits (505),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 108/224 (48%), Positives = 138/224 (62%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  184   EQKEGAFSNFPISEVTIKLLKARGVNYLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  243

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L        R    GRPP VLVL PTRELA QV  DF      L +   C YG 
Sbjct  244   IPLIEKLQGDLQDRKR----GRPPQVLVLAPTRELANQVSKDFSDITKKLSV--ACFYGG  297

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  298   TPYGGQLDRMRNGIDILVGTPGRIKDHVQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  357

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++KP  + VD+
Sbjct  358   ILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKPTYEQVDL  401



>ref|XP_010938270.1| PREDICTED: DEAD-box ATP-dependent RNA helicase 7-like [Elaeis 
guineensis]
Length=318

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/179 (56%), Positives = 118/179 (66%), Gaps = 31/179 (17%)
 Frame = +1

Query  505   FRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILESLTN  684
              RISK LRE LK+KGIES+F IQ MTF+++ DG+++V + RTGQGKTLAFVLPILE LTN
Sbjct  84    MRISKVLREKLKSKGIESMFPIQTMTFDSIFDGSNLVCQERTGQGKTLAFVLPILEFLTN  143

Query  685   GPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPYAQQEMK  864
             G  K  +KTG GRPPSVLVLLPTREL  QV+ DF+ Y GA+G                  
Sbjct  144   GQYKEAKKTGCGRPPSVLVLLPTRELTNQVYADFQAYSGAVGW-----------------  186

Query  865   LKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILGKVADV  1041
                           IKDHI RG +DL  LKFR+LD+ DEML +GFV+DVE IL  V DV
Sbjct  187   --------------IKDHIERGTLDLKFLKFRILDQADEMLNMGFVDDVELILSMVEDV  231



>ref|XP_005429044.1| PREDICTED: nucleolar RNA helicase 2-like [Geospiza fortis]
Length=576

 Score =   196 bits (498),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 141/225 (63%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE    A +NF +S+     L A+GI+ LF +Q  TF+ + DG D++ +ARTG GKTL+F
Sbjct  8     EEAKEGAFSNFPLSQNTINLLTARGIKYLFPVQVKTFQPIYDGKDVIAQARTGTGKTLSF  67

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LP++E L +      R    GR P VLVL+PTRELA+QV  DF+ +   L +   C YG
Sbjct  68    ALPLIEKLQSVSQDGRR----GRAPKVLVLVPTRELAIQVAKDFKNFTKKLSIA--CFYG  121

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
               PY +Q   LK G+DI+VGTPGRIKDH+    ++L+S+K  VLDEVD ML +GF E VE
Sbjct  122   GAPYKEQLDVLKSGIDILVGTPGRIKDHVQNSKLELSSVKHVVLDEVDHMLDMGFAEQVE  181

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K+++ + + +D+
Sbjct  182   EILGSSYKKGSENNPQTLLFSATCPRWVYDVAKKYMRAEYEQIDL  226



>ref|XP_009990339.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Tauraco erythrolophus]
Length=581

 Score =   196 bits (498),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 141/225 (63%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE    A +NF +S+     LKA+G++ LF +QA TF+ + DG D++ +ARTG GKT +F
Sbjct  4     EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQAKTFQPIYDGKDLIAQARTGTGKTFSF  63

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              +P++E L +      R    GR P VLVL+PTRELA QV  DF+       L+  C YG
Sbjct  64    AVPLIEKLQSVSQDGRR----GRAPKVLVLVPTRELATQVAKDFKNL--TRKLSVACFYG  117

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY +Q   LK G+DI+VGTPGRIKDH+    ++L+S+K  VLDEVD ML +GF E VE
Sbjct  118   GTPYKEQLDLLKSGIDILVGTPGRIKDHVQNSKLELSSVKHVVLDEVDHMLDMGFAEQVE  177

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K++K + + +D+
Sbjct  178   EILGFAYKKGSENNPQTLLFSATCPRWVYDVAKKYMKDEYEQIDL  222



>ref|XP_005990005.1| PREDICTED: nucleolar RNA helicase 2 [Latimeria chalumnae]
Length=567

 Score =   196 bits (497),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 104/224 (46%), Positives = 138/224 (62%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NFRIS    + LKA+G+  LF +Q   F  V +G D++ +ARTG GKT +F 
Sbjct  4     EQKEGAFSNFRISNETIQLLKARGVAYLFPVQVKAFNYVYNGKDLIAQARTGTGKTFSFA  63

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L        R    GR P VLVL PTRELA+QV  DF+     L L+  C YG 
Sbjct  64    IPLVEKLQADLQDRKR----GRAPKVLVLTPTRELAIQVHRDFKDITRKLSLS--CFYGG  117

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q   ++ G+DI+VGTPGRI+DH+    +DL+ LK  VLDEVD+ML +GF E VE 
Sbjct  118   TPYNSQLDNIRNGIDILVGTPGRIRDHLQNNKLDLSKLKHVVLDEVDQMLDMGFAEQVEE  177

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             ILG   K    +  QTLLFSAT   WV  +A K++K + K +D+
Sbjct  178   ILGTAYKKGCEENPQTLLFSATCPHWVYDVAKKYMKSNFKQIDL  221



>gb|EMP40574.1| Nucleolar RNA helicase 2, partial [Chelonia mydas]
Length=1143

 Score =   201 bits (510),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 141/225 (63%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EEE   A +NF ISK   E LKA+G++ LF +QA TF+ + DG D++ +ARTG GKT +F
Sbjct  574   EEEKEGAFSNFSISKETTELLKARGVKYLFSVQAKTFQPIYDGKDVIAQARTGTGKTFSF  633

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              +P++E L     +  R    GR P VLVL PTRELA+QV  DF+     L  T  C YG
Sbjct  634   AVPLIEKLQGDTLERKR----GRIPKVLVLAPTRELAIQVARDFKDVTKKL--TVACFYG  687

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY  Q   +K G+DI+VGTPGRIKDH+  G +D++++K  VLDEVD+ML +GF E VE
Sbjct  688   GTPYNGQIEHIKNGIDILVGTPGRIKDHLQNGKLDVSNVKHVVLDEVDQMLDMGFAEQVE  747

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              IL    K       QTLLFSAT   WV  +A K++K   +  D+
Sbjct  748   EILAFAYKKDSEDNPQTLLFSATCPHWVYDVAKKYMKSRYEQFDL  792


 Score =   189 bits (479),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 139/225 (62%), Gaps = 11/225 (5%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF ISK   E L+A+G+  LF +Q  TF+ + DG D+V +ARTG GKT +F 
Sbjct  6     EQKEGAFSNFCISKETIELLRARGVTYLFPVQVKTFKHIYDGKDVVAQARTGTGKTFSFA  65

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L     +  R    GR P VLVL PTRELA QV  DF+     L +   C YG 
Sbjct  66    IPLIEKLQGEMQERKR----GRTPKVLVLTPTRELANQVAKDFKDITKTLSVA--CFYGG  119

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             T Y  Q   ++ G+DI+VGTPGRIKDH+  G +DL+ LK  VLDEVD+ML +GF E VE 
Sbjct  120   TAYNGQIDLIRSGIDILVGTPGRIKDHLQNGKLDLSKLKHVVLDEVDQMLDMGFAEQVED  179

Query  1018  ILGKVADVKQV----QTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL +VA  K      QTLLFSAT   WV  +A K++K   + VD+
Sbjct  180   IL-RVAYKKDSEDNPQTLLFSATCPHWVYDVAKKYMKSRYEQVDL  223



>ref|XP_004067286.1| PREDICTED: nucleolar RNA helicase 2-like isoform X1 [Oryzias 
latipes]
Length=775

 Score =   198 bits (503),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 142/231 (61%), Gaps = 15/231 (6%)
 Frame = +1

Query  472   EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
             E EE P     A +NFRIS+     LKA+G+  LF IQ  TF  V DG D++ +ARTG G
Sbjct  172   ETEETPEQKEGAFSNFRISQVTINKLKARGVSYLFDIQVKTFNPVYDGEDVLAQARTGTG  231

Query  640   KTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTS  819
             KT +F +P++E L     + TR    GRPP VLVL PTRELA+QV  DF+     L +  
Sbjct  232   KTFSFAIPLVERLQKEGGETTR----GRPPKVLVLTPTRELAIQVAKDFKDVSKKLAI--  285

Query  820   CCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGF  999
              C YG + Y  Q   ++ G+DI+VGTPGRIKDH+    ++L+ LK  VLDEVD+ML +GF
Sbjct  286   ACFYGGSSYNPQLDAIRNGIDILVGTPGRIKDHLQNHKLNLSDLKHVVLDEVDQMLDMGF  345

Query  1000  VEDVEFILG----KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              E VE IL     K +D    QTLLFSAT   WV  +A K+++P  K VD+
Sbjct  346   AEQVEEILSLSYKKDSDTNP-QTLLFSATCPPWVYEVAKKYMRPGCKHVDL  395



>ref|XP_011490446.1| PREDICTED: nucleolar RNA helicase 2-like isoform X2 [Oryzias 
latipes]
Length=740

 Score =   197 bits (502),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 110/231 (48%), Positives = 142/231 (61%), Gaps = 15/231 (6%)
 Frame = +1

Query  472   EEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
             E EE P     A +NFRIS+     LKA+G+  LF IQ  TF  V DG D++ +ARTG G
Sbjct  137   ETEETPEQKEGAFSNFRISQVTINKLKARGVSYLFDIQVKTFNPVYDGEDVLAQARTGTG  196

Query  640   KTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTS  819
             KT +F +P++E L     + TR    GRPP VLVL PTRELA+QV  DF+     L +  
Sbjct  197   KTFSFAIPLVERLQKEGGETTR----GRPPKVLVLTPTRELAIQVAKDFKDVSKKLAI--  250

Query  820   CCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGF  999
              C YG + Y  Q   ++ G+DI+VGTPGRIKDH+    ++L+ LK  VLDEVD+ML +GF
Sbjct  251   ACFYGGSSYNPQLDAIRNGIDILVGTPGRIKDHLQNHKLNLSDLKHVVLDEVDQMLDMGF  310

Query  1000  VEDVEFILG----KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              E VE IL     K +D    QTLLFSAT   WV  +A K+++P  K VD+
Sbjct  311   AEQVEEILSLSYKKDSDTNP-QTLLFSATCPPWVYEVAKKYMRPGCKHVDL  360



>ref|XP_003976441.2| PREDICTED: nucleolar RNA helicase 2-like isoform X1 [Takifugu 
rubripes]
Length=747

 Score =   197 bits (502),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 137/220 (62%), Gaps = 11/220 (5%)
 Frame = +1

Query  493   AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILE  672
             A +NFRIS      LKA+G+  LF IQ  TF++V DG D++ +ARTG GKT +F +P++E
Sbjct  165   AFSNFRISPVTINKLKARGVSYLFDIQVKTFDSVYDGEDVIAQARTGTGKTFSFAIPLVE  224

Query  673   SLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPYAQ  852
              L    A   R    GR P VLVL PTRELA+QV  DF+     L +   C YG T Y  
Sbjct  225   KLQRDSAGPAR----GRAPKVLVLTPTRELAIQVAKDFKDIIKKLSIV--CFYGGTSYMP  278

Query  853   QEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILG--  1026
             Q   ++ G+DI+VGTPGRIKDH+    +DL+ LK  VLDEVD+ML +GF E VE IL   
Sbjct  279   QIDAIRNGIDILVGTPGRIKDHLQNNKLDLSKLKHVVLDEVDQMLDMGFAEQVEEILASS  338

Query  1027  --KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
               K AD    QTLLFSAT   WV  +A K+++P  K VD+
Sbjct  339   YKKDADTNP-QTLLFSATCPPWVYDVAKKYMRPKCKHVDL  377



>ref|XP_011615621.1| PREDICTED: nucleolar RNA helicase 2-like isoform X2 [Takifugu 
rubripes]
Length=746

 Score =   197 bits (502),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 108/220 (49%), Positives = 137/220 (62%), Gaps = 11/220 (5%)
 Frame = +1

Query  493   AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILE  672
             A +NFRIS      LKA+G+  LF IQ  TF++V DG D++ +ARTG GKT +F +P++E
Sbjct  164   AFSNFRISPVTINKLKARGVSYLFDIQVKTFDSVYDGEDVIAQARTGTGKTFSFAIPLVE  223

Query  673   SLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPYAQ  852
              L    A   R    GR P VLVL PTRELA+QV  DF+     L +   C YG T Y  
Sbjct  224   KLQRDSAGPAR----GRAPKVLVLTPTRELAIQVAKDFKDIIKKLSIV--CFYGGTSYMP  277

Query  853   QEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILG--  1026
             Q   ++ G+DI+VGTPGRIKDH+    +DL+ LK  VLDEVD+ML +GF E VE IL   
Sbjct  278   QIDAIRNGIDILVGTPGRIKDHLQNNKLDLSKLKHVVLDEVDQMLDMGFAEQVEEILASS  337

Query  1027  --KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
               K AD    QTLLFSAT   WV  +A K+++P  K VD+
Sbjct  338   YKKDADTNP-QTLLFSATCPPWVYDVAKKYMRPKCKHVDL  376



>ref|XP_009993187.1| PREDICTED: nucleolar RNA helicase 2-like [Chaetura pelagica]
Length=681

 Score =   197 bits (500),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 107/239 (45%), Positives = 146/239 (61%), Gaps = 18/239 (8%)
 Frame = +1

Query  460   VGGDEEEEDPY---------AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDM  612
              G +E+E D           A +NF +S+   + LKA+G++ LF +QA TF+ + DG D+
Sbjct  90    AGAEEQESDAEELTEEEKEGAFSNFPLSQNTIDLLKARGVKYLFPVQAKTFQPIYDGKDL  149

Query  613   VGRARTGQGKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEM  792
             + +ARTG GKT +F +P++E L +      R    GR P VLVL+PTRELA QV  DF+ 
Sbjct  150   IAQARTGTGKTFSFAIPLIEKLQSVSQDGRR----GRAPKVLVLVPTRELATQVAKDFKN  205

Query  793   YGGALGLTSCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDE  972
                   L+  C YG TPY +Q   LK G+DI+VGTPGRIKDH+    ++L+S+K  VLDE
Sbjct  206   L--TRKLSVACFYGGTPYKEQIDLLKSGIDILVGTPGRIKDHVQNSKLELSSVKHVVLDE  263

Query  973   VDEMLRIGFVEDVEFILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VD ML +GF E VE ILG   K       QTLLFSAT   WV  +A K++K + + +D+
Sbjct  264   VDHMLDMGFAEQVEEILGFAYKKDSENNPQTLLFSATCPRWVYDVAKKYMKDEYEQIDL  322



>ref|XP_008943828.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Merops nubicus]
Length=599

 Score =   196 bits (497),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 140/225 (62%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EEE   A +NF +S+     L+A+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  21    EEEKEGAFSNFPLSQNTISLLRARGVKYLFPVQVKTFQPIYDGKDVIAQARTGTGKTFSF  80

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LP+ E L +      R    GR P VLVL+PTRELA QV  DF+     L +   C YG
Sbjct  81    ALPLTEKLQSVSQDGKR----GRAPKVLVLVPTRELATQVAKDFKNLTRKLSVA--CFYG  134

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY +Q   LK G+DI+VGTPGRIKDH+    ++L+S+K  VLDEVD ML +GF E VE
Sbjct  135   GTPYKEQLDLLKSGIDILVGTPGRIKDHVQNSKLELSSVKHVVLDEVDHMLDMGFAEQVE  194

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K++K + + +D+
Sbjct  195   EILGFAYKKGSENNPQTLLFSATCPRWVYDVAKKYMKDEYEQIDL  239



>emb|CBK20101.2| unnamed protein product [Blastocystis hominis]
Length=553

 Score =   195 bits (495),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 105/233 (45%), Positives = 143/233 (61%), Gaps = 16/233 (7%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             E E  YA+  +RIS      L +KGI  LF IQA++F+A+ DG D++GRA TGQGKTLAF
Sbjct  10    ESESLYAMHRYRISPETIGILHSKGITELFPIQALSFDAIYDGKDLIGRAPTGQGKTLAF  69

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LPI+E +     +  R++   R P  LVL PTRELA Q+     M   A  L + CL+G
Sbjct  70    ALPIVEKIYKLNLRPPRRS---RAPLCLVLSPTRELAQQIDEQIRMI--APSLRTVCLFG  124

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
               P+  QE  L+RGV+ VVGTPGR+ DH+ RG + L  L++ +LDE D ML +GF EDVE
Sbjct  125   GAPFDPQEFALRRGVEFVVGTPGRVLDHLERGTLQLGELQWFILDEADRMLDMGFSEDVE  184

Query  1015  FIL-----------GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ++           G      ++Q LLFSAT+  WV+ + +K++ PDK TVD+
Sbjct  185   KVVDYAIKSGGETKGPRIVPDRIQVLLFSATIPSWVREVMTKYMHPDKVTVDL  237



>ref|XP_009094282.1| PREDICTED: nucleolar RNA helicase 2-like [Serinus canaria]
Length=695

 Score =   197 bits (500),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 104/225 (46%), Positives = 142/225 (63%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE    A +NF +S+   + L A+GI+ LF +Q  TF+ + DG D++ +ARTG GKTL+F
Sbjct  127   EEAKEGAFSNFPLSQNTIKLLTARGIKYLFPVQVKTFQPIYDGKDVIAQARTGTGKTLSF  186

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LP++E L +      R    GR P VLVL+PTRELA+QV  DF+ +   L +   C YG
Sbjct  187   ALPLIEKLQSVSQDGRR----GRAPKVLVLVPTRELAIQVAKDFKNFTKKLSIA--CFYG  240

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
               PY +Q   LK G+DI+VGTPGRIKDH+    ++L+S+K  VLDEVD ML +GF E VE
Sbjct  241   GAPYKEQLDVLKSGIDILVGTPGRIKDHVQNSKLELSSVKHVVLDEVDHMLDMGFAEQVE  300

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K+++ + + +D+
Sbjct  301   EILGSSYKKGSENNPQTLLFSATCPRWVYDVAKKYMRDEYEQIDL  345



>ref|XP_009892318.1| PREDICTED: nucleolar RNA helicase 2-like [Charadrius vociferus]
Length=655

 Score =   196 bits (498),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 140/225 (62%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE    A +NF +S+     L A+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  78    EEAKEGAFSNFPLSESTINLLNARGVKYLFPVQVKTFQPIYDGKDLIAQARTGTGKTFSF  137

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
             VLP++E L +      R    GR P VLVL+PTRELA QV  DF+     L +   C YG
Sbjct  138   VLPLIEKLQSVSQDGRR----GRAPKVLVLVPTRELATQVAKDFKNLTRKLSVA--CFYG  191

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY +Q   LK G+DI+VGTPGRIKDHI    ++L+S+K  VLDEVD ML +GF E VE
Sbjct  192   GTPYKEQIDLLKSGIDILVGTPGRIKDHIQNSKLELSSVKHVVLDEVDHMLDMGFAEQVE  251

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K++K + + +D+
Sbjct  252   EILGFAYKKGSENNPQTLLFSATCPRWVYDVAKKYMKDEYEQIDL  296



>ref|XP_008756606.1| PREDICTED: LOW QUALITY PROTEIN: nucleolar RNA helicase 2-like 
isoform X1 [Rattus norvegicus]
Length=781

 Score =   197 bits (501),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/224 (48%), Positives = 138/224 (62%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  177   EQKEGAFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  236

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L  G  +  R    GR P VLVL PTRELA QV  DF      L +   C YG 
Sbjct  237   IPLIEKLQGGLQERKR----GRAPQVLVLAPTRELANQVSKDFSDITKKLSVA--CFYGG  290

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  291   TPYGGQIERMRSGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  350

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   K VD+
Sbjct  351   ILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYKQVDL  394



>ref|NP_001120807.1| nucleolar RNA helicase 2 [Danio rerio]
 gb|AAI60629.1| Ddx21 protein [Danio rerio]
Length=759

 Score =   197 bits (500),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 107/231 (46%), Positives = 146/231 (63%), Gaps = 13/231 (6%)
 Frame = +1

Query  469   DEEEEDPY----AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQ  636
             ++E+E P     A +NFRIS    + L+A+G+  LF IQ  TF AV DG D++G+ARTG 
Sbjct  155   EQEKETPEQREGAFSNFRISPNTIKLLQARGVSYLFDIQVKTFNAVYDGKDLIGQARTGT  214

Query  637   GKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLT  816
             GKT +F +P++E L +G  +  R    GRPP VLVL PTRELA+QV  DF+     L +T
Sbjct  215   GKTFSFAVPLVEKLQSGDQERRR----GRPPKVLVLAPTRELAIQVTKDFKDITRKLSVT  270

Query  817   SCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIG  996
               C YG + Y  Q   ++ G+D++VGTPGRI+DH+    +DL+ L+  VLDEVD+ML +G
Sbjct  271   --CFYGGSSYNPQIDAIRSGIDVLVGTPGRIRDHLQNNKLDLSQLQHVVLDEVDQMLDMG  328

Query  997   FVEDVEFILGKV--ADVKQV-QTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             F E VE IL      D +Q  QTLLFSAT   WV  +A K+++     VD+
Sbjct  329   FAEQVEEILSASYKKDAEQKPQTLLFSATCPSWVYDVAKKYMRSQFIHVDL  379



>ref|XP_010158185.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Eurypyga helias]
Length=582

 Score =   195 bits (495),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 142/226 (63%), Gaps = 11/226 (5%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE+   A +NF ISK   + L+A+G+  LF +Q  TF++V  G D++ +ARTG GKT +F
Sbjct  4     EEQKEGAFSNFPISKETVQLLQARGVTYLFPVQVKTFKSVFSGKDVIAQARTGTGKTFSF  63

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              +P++E L     +  R    GRPP VLVL PTRELA QV  DF+       LT  C YG
Sbjct  64    AIPLIEKLQKDSQERKR----GRPPKVLVLCPTRELANQVARDFKDI--TRQLTVACFYG  117

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY  Q   ++ G+DI+VGTPGRIKDH+  G +DLT +K  VLDEVD+ML +GF E VE
Sbjct  118   GTPYNGQIDLMRSGIDILVGTPGRIKDHLQSGKLDLTKVKHVVLDEVDQMLDMGFAEQVE  177

Query  1015  FILGKVADVKQV----QTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              IL +VA  K      QTLLFSAT   WV  +A K++K   + +D+
Sbjct  178   DIL-RVAYKKDSEDNPQTLLFSATCPHWVYDVAKKYMKSRYEQIDL  222



>ref|XP_010132216.1| PREDICTED: nucleolar RNA helicase 2-like [Buceros rhinoceros 
silvestris]
Length=578

 Score =   195 bits (495),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 140/225 (62%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EEE     +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  6     EEEKEGDFSNFPLSEATINLLKARGVKYLFPVQVKTFQPIYDGKDVIAQARTGTGKTFSF  65

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LP++E L +      R    GR P VLVL+PTRELA QV  DF+     L +   C YG
Sbjct  66    ALPLIEKLQSVSEDGRR----GRAPKVLVLVPTRELATQVAKDFKNLTRKLSVA--CFYG  119

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY +Q   LK G+DI+VGTPGRIKDHI    ++L+S+K  +LDEVD ML +GF E VE
Sbjct  120   GTPYKEQLDLLKSGIDILVGTPGRIKDHIQNSKLELSSVKHVILDEVDHMLDMGFAEQVE  179

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K++K + + +D+
Sbjct  180   EILGFAYKKGSENNPQTLLFSATCPRWVYDVAKKYMKDEYEQIDL  224



>ref|XP_011782358.1| PREDICTED: nucleolar RNA helicase 2 isoform X2 [Colobus angolensis 
palliatus]
Length=651

 Score =   196 bits (497),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/224 (48%), Positives = 140/224 (63%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF ISK   + LK +G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  50    EQKEGAFSNFPISKETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  109

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L +G  +  ++   GRPP VLVL PTRELA QV  DF      L +   C YG 
Sbjct  110   IPLIEKL-HGELQDRKR---GRPPQVLVLAPTRELANQVSKDFSDITKKLSVA--CFYGG  163

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDHI  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  164   TPYGGQFERMRNGIDILVGTPGRIKDHIQSGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  223

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  224   ILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  267



>emb|CDH59679.1| nucleolar rna helicase 2-like [Lichtheimia corymbifera JMRC:FSU:9682]
Length=684

 Score =   196 bits (498),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 113/237 (48%), Positives = 152/237 (64%), Gaps = 10/237 (4%)
 Frame = +1

Query  448   LMEAVGGDEEEEDP--YAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGR  621
             ++E  G  E+++ P    ++ FRIS+   E L+A+GI+SLF IQA TF+++ DG D++ R
Sbjct  64    VVEESGKHEDDQVPEHLQLSKFRISQGTVENLEARGIKSLFDIQAATFDSIFDGNDVLAR  123

Query  622   ARTGQGKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGG  801
             ARTG GKTLAF LP++E LT      TR+   GR P VLV+ PTR+LA QV  DFE   G
Sbjct  124   ARTGTGKTLAFALPVIEKLTLDTEYNTRR---GRAPRVLVMCPTRDLAKQVCGDFETISG  180

Query  802   ALGLTSCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDE  981
                L +  +YG TPY +Q   LK GVD++VGTPGRI DHI  GN+ L +LK+ +LDE DE
Sbjct  181   NR-LQALPVYGGTPYQEQTSVLKAGVDVIVGTPGRILDHIKYGNLKLHALKYIILDEADE  239

Query  982   MLRI-GFVEDVEFILGKVADVKQ---VQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             ML   GF +D+   L  V + K     QTLLFSAT+ + V     +F+K D K +D+
Sbjct  240   MLDARGFEQDMFAALDFVKEQKSERDYQTLLFSATVPESVMETIQRFMKSDYKRIDL  296



>ref|XP_002502509.1| DEAD/DEAH box RNA helicase [Micromonas sp. RCC299]
 gb|ACO63767.1| DEAD/DEAH box RNA helicase [Micromonas sp. RCC299]
Length=790

 Score =   196 bits (499),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/222 (48%), Positives = 143/222 (64%), Gaps = 8/222 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
              + DP  + NF +S   + AL+ +GIE+LF IQA   E  L G D+VGRARTG GKTL F
Sbjct  128   NKRDPMHVDNFPLSDITKAALRKRGIETLFPIQASVLEPALQGRDVVGRARTGTGKTLGF  187

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LPI+ESL + P+  T ++   R P  +VL PTRELA QV  + E+      L + C+YG
Sbjct  188   SLPIIESLLSNPSNRTDRS---RNPRCIVLAPTRELANQV--EKEIQATVPSLRTLCVYG  242

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
                 + QE  L+RGVDIVVGTPGR+ D I RG+++L  +++ VLDE D+ML +GF EDVE
Sbjct  243   GVAISNQERPLRRGVDIVVGTPGRLIDLIQRGSLNLHDIEYCVLDEADQMLAVGFEEDVE  302

Query  1015  FILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              I+ ++ +  Q QT LFSAT+  WV  I  K+L  D  T+D+
Sbjct  303   RIMEEIPE--QRQTFLFSATMPSWVTRITQKYLA-DHVTIDL  341



>emb|CEP17128.1| hypothetical protein [Parasitella parasitica]
Length=708

 Score =   196 bits (498),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 113/231 (49%), Positives = 146/231 (63%), Gaps = 9/231 (4%)
 Frame = +1

Query  460   VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
             +  DE  E+   ++NFRIS+   + LKAKGI+SLF+IQA TF+ + DG D++ RARTG G
Sbjct  84    INSDEVPEN-LRLSNFRISQGTVDNLKAKGIKSLFEIQAATFDTIFDGNDVLARARTGTG  142

Query  640   KTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTS  819
             KTLAF LP++E L        R+   GR P VLVL PTR+LA QV  DFE   G   L +
Sbjct  143   KTLAFALPVIERLALDKEYTVRR---GRSPRVLVLCPTRDLAKQVCGDFEQLSGNR-LKT  198

Query  820   CCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRI-G  996
               +YG  PY +Q    + GVD+VVGTPGRI DHI  GN+ L+ LKF VLDE DEML   G
Sbjct  199   LSVYGGVPYNEQTTVFRDGVDVVVGTPGRILDHIKFGNMKLSDLKFIVLDEADEMLDARG  258

Query  997   FVEDVEFILGKVADVK---QVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             F ED+  +L  + + K     QTLLFSAT+ + V     +FLK D + +D+
Sbjct  259   FEEDMFNLLSSIQEQKTSRDYQTLLFSATVPESVMETIKRFLKEDYERIDL  309



>ref|XP_010153144.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Eurypyga helias]
Length=592

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 138/225 (61%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE    A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  40    EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTGTGKTFSF  99

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LP+ E L +      R    GR P VLVL+PTRELA QV  DF+       L+  C YG
Sbjct  100   ALPLTEKLQSVSQDGRR----GRAPKVLVLVPTRELATQVAKDFKNI--TRKLSVACFYG  153

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY  Q   LK G+DI+VGTPGRIKDHI    ++L+S+K  VLDEVD ML +GF E VE
Sbjct  154   GTPYKAQLDLLKSGIDILVGTPGRIKDHIQNSKLELSSVKHVVLDEVDHMLDMGFAEQVE  213

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K++K + + +D+
Sbjct  214   EILGFAYKKGSENNPQTLLFSATCPRWVYDVAKKYMKDEYEQIDL  258



>ref|XP_010164383.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Caprimulgus 
carolinensis]
Length=630

 Score =   195 bits (496),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 138/225 (61%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE    A +NF IS+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  53    EEAKEGAFSNFPISEDTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTGTGKTFSF  112

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LP+ E L +      R    GR P VLVL+PTRELA QV  DF+       L+  C YG
Sbjct  113   ALPLTEKLQSVSQDGKR----GRAPKVLVLVPTRELATQVARDFKNL--TRKLSVACFYG  166

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY  Q   LK G+DI+VGTPGRIKDHI    ++L+S+K  VLDEVD ML +GF E VE
Sbjct  167   GTPYKAQLDLLKSGIDILVGTPGRIKDHIQNSKLELSSVKHVVLDEVDHMLDMGFAEQVE  226

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K++K + + +D+
Sbjct  227   EILGFAYKKGSENNPQTLLFSATCPRWVYDVAKKYMKDEYEQIDL  271



>ref|XP_010295282.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Phaethon lepturus]
Length=703

 Score =   196 bits (498),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 138/225 (61%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE    A TNF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  102   EEAKEGAFTNFPLSQDTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTGTGKTFSF  161

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LP+ E L +      R    GR P VLVL+PTRELA QV  DF+     L +   C YG
Sbjct  162   ALPLTERLQSVSQDGRR----GRAPKVLVLVPTRELATQVAKDFKHLTRKLSVA--CFYG  215

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY  Q   LK G+DI+VGTPGRIKDHI    ++L+S+K  VLDEVD ML +GF E VE
Sbjct  216   GTPYKAQLDILKSGIDILVGTPGRIKDHIQNSKLELSSVKHVVLDEVDHMLDMGFAEQVE  275

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K++K + + +D+
Sbjct  276   EILGFAYKKGSENNPQTLLFSATCPRWVYDVAKKYMKDEYEQIDL  320



>ref|XP_008924427.1| PREDICTED: nucleolar RNA helicase 2-like [Manacus vitellinus]
Length=696

 Score =   196 bits (497),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 141/225 (63%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE    A +NF +S+     L A+G++ LF +QA TF+ + DG D++ +ARTG GKTL+F
Sbjct  128   EEAKEGAFSNFPLSQNTINLLTARGVKYLFPVQAKTFQPIYDGKDVIAQARTGTGKTLSF  187

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LP++E L +      R    GR P VLVL+PTRELA QV  DF+       L+  C YG
Sbjct  188   ALPLIEKLQSVSQDGRR----GRAPKVLVLVPTRELATQVARDFKNL--TRKLSVACFYG  241

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY +Q   L+ G+DI+VGTPGRIKDH+    ++L+S+K  VLDEVD ML +GF E VE
Sbjct  242   GTPYKEQLDLLRSGIDILVGTPGRIKDHVQNSKLELSSVKHVVLDEVDHMLDMGFAEQVE  301

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K++K + + +D+
Sbjct  302   EILGFAYKKGSENNPQTLLFSATCPRWVYDVAKKYMKDEYEQIDL  346



>ref|XP_011782350.1| PREDICTED: nucleolar RNA helicase 2 isoform X1 [Colobus angolensis 
palliatus]
Length=781

 Score =   196 bits (499),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/224 (48%), Positives = 140/224 (63%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF ISK   + LK +G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  180   EQKEGAFSNFPISKETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  239

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L +G  +  ++   GRPP VLVL PTRELA QV  DF      L +   C YG 
Sbjct  240   IPLIEKL-HGELQDRKR---GRPPQVLVLAPTRELANQVSKDFSDITKKLSV--ACFYGG  293

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDHI  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  294   TPYGGQFERMRNGIDILVGTPGRIKDHIQSGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  353

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  354   ILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  397



>ref|XP_005491116.1| PREDICTED: nucleolar RNA helicase 2-like [Zonotrichia albicollis]
Length=718

 Score =   196 bits (498),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/225 (46%), Positives = 141/225 (63%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE    A +NF +S+     L A+GI+ LF +Q  TF+ + DG D++ +ARTG GKTL+F
Sbjct  150   EEAKEGAFSNFPLSQNTINLLTARGIKYLFPVQVKTFQPIYDGKDVIAQARTGTGKTLSF  209

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LP++E L +      R    GR P VLVL+PTRELA+QV  DF+ +   L +   C YG
Sbjct  210   ALPLIEKLQSVSQDGRR----GRAPKVLVLVPTRELAIQVAKDFKNFTKKLSIA--CFYG  263

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
               PY +Q   L+ G+DI+VGTPGRIKDH+    ++L+S+K  VLDEVD ML +GF E VE
Sbjct  264   GAPYKEQLDVLRSGIDILVGTPGRIKDHVQNSKLELSSVKHVVLDEVDHMLDMGFAEQVE  323

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K+++ + + +D+
Sbjct  324   EILGSSYKKGSESNPQTLLFSATCPRWVYDVAKKYMRAEYEQIDL  368



>ref|XP_009581978.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Fulmarus glacialis]
Length=610

 Score =   194 bits (494),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/225 (48%), Positives = 138/225 (61%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE    A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKTL+F
Sbjct  58    EEAKEGAFSNFPLSENTINLLKARGVKYLFPVQVETFQPIYDGKDLIAQARTGTGKTLSF  117

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LP+ E L +      R    GR P VLVL+PTRELA QV  DF+     L +   C YG
Sbjct  118   ALPLTEKLQSVSQDGRR----GRSPKVLVLVPTRELATQVAKDFKNLTRKLSVA--CFYG  171

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY  Q   LK G+DI+VGTPGRIKDHI    ++L+S+K  VLDEVD ML +GF E VE
Sbjct  172   GTPYKAQLDLLKSGIDILVGTPGRIKDHIQNSKLELSSVKHVVLDEVDHMLDMGFAEQVE  231

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K++K   + +D+
Sbjct  232   EILGFAYKKGSENNPQTLLFSATCPRWVYDVAKKYMKDGYEQIDL  276



>ref|XP_008611506.1| hypothetical protein SDRG_07451 [Saprolegnia diclina VS20]
 gb|EQC35222.1| hypothetical protein SDRG_07451 [Saprolegnia diclina VS20]
Length=662

 Score =   195 bits (496),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 137/216 (63%), Gaps = 7/216 (3%)
 Frame = +1

Query  496   ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILES  675
             +++FR+      AL+ +GI +LF IQ+MTF+ + D  D++GRARTG GKTLAFVLP++E 
Sbjct  82    VSDFRVGDITIAALEKRGISTLFPIQSMTFDKIYDEFDLIGRARTGMGKTLAFVLPVVER  141

Query  676   LTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPYAQQ  855
             L     K  ++T  GR   V+ + PTRELA QV T+FE    +L  T  C+YG   Y  Q
Sbjct  142   LF----KEGKRTNRGRAAKVICMAPTRELAKQVATEFEQTAPSLKTT--CIYGGASYQSQ  195

Query  856   EMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILGKVA  1035
                 + GVDIVVGT GRI DH+ RG + L   KF +LDE D ML +GF ED++ +   + 
Sbjct  196   NQDFRDGVDIVVGTTGRICDHLERGTLRLNECKFLILDEADTMLEMGFREDIQKVFEAME  255

Query  1036  DVKQV-QTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
               K   QTLLFSAT+  W+  +A K++KPD+  V++
Sbjct  256   AAKTAHQTLLFSATIPSWLDQVAKKYMKPDRVYVNM  291



>ref|XP_002913778.1| PREDICTED: nucleolar RNA helicase 2 [Ailuropoda melanoleuca]
Length=794

 Score =   196 bits (498),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 137/224 (61%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+P  + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  184   EQKEGAFSNFPISEPTIKLLKARGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  243

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L        R    GR P VLVL PTRELA QV  DF      L +   C YG 
Sbjct  244   IPLIEKLQGEMQDRKR----GRAPQVLVLAPTRELANQVSRDFSDITRKLAV--ACFYGG  297

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  298   TPYGGQIERMRNGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  357

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  358   ILSVAYKKDSEDNPQTLLFSATCPHWVYNVAKKYMKSTYEQVDL  401



>gb|EFB22545.1| hypothetical protein PANDA_001614, partial [Ailuropoda melanoleuca]
Length=765

 Score =   196 bits (498),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 137/224 (61%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+P  + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  155   EQKEGAFSNFPISEPTIKLLKARGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  214

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L        R    GR P VLVL PTRELA QV  DF      L +   C YG 
Sbjct  215   IPLIEKLQGEMQDRKR----GRAPQVLVLAPTRELANQVSRDFSDITRKLAV--ACFYGG  268

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  269   TPYGGQIERMRNGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  328

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  329   ILSVAYKKDSEDNPQTLLFSATCPHWVYNVAKKYMKSTYEQVDL  372



>ref|XP_009814524.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Gavia stellata]
Length=635

 Score =   194 bits (494),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 140/225 (62%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE    A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  58    EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTGTGKTFSF  117

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              +P++E L +      R    GR P VLVL+PTRELA QV  DF+       L+  C YG
Sbjct  118   AVPLIEKLQSVSQDGRR----GRSPKVLVLVPTRELATQVAKDFKNL--TRKLSVACFYG  171

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY +Q   LK G+DI+VGTPGRIKDHI    ++L+S+K  VLDEVD ML +GF E VE
Sbjct  172   GTPYKEQLDLLKSGIDILVGTPGRIKDHIQNSKLELSSVKHVVLDEVDHMLDMGFAEQVE  231

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K++K + + +D+
Sbjct  232   EILGFAYKKDSENNPQTLLFSATCPRWVYDVAKKYMKDEYEQIDL  276



>ref|XP_004386445.1| PREDICTED: nucleolar RNA helicase 2 [Trichechus manatus latirostris]
Length=787

 Score =   196 bits (498),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 108/224 (48%), Positives = 136/224 (61%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             EE   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  184   EEKEGAFSNFPISEVTVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  243

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L        R    GRPP VLVL PTRELA QV  DF      L +   C YG 
Sbjct  244   IPLIEKLQGELQDKKR----GRPPQVLVLAPTRELANQVSKDFRDITKKLAV--ACFYGG  297

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q   ++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  298   TPYGGQFDNMRNGIDILVGTPGRIKDHLQSGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  357

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  358   ILSVAYKKDSEDNPQTLLFSATCPHWVYNVAKKYMKSTYEQVDL  401



>ref|XP_005326022.1| PREDICTED: nucleolar RNA helicase 2 [Ictidomys tridecemlineatus]
Length=785

 Score =   196 bits (497),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 138/224 (62%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  185   EQKEGAFSNFPISEETIKLLKARGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  244

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L +      R    GRPP VLVL PTRELA QV  DF      L +   C YG 
Sbjct  245   IPLIEKLQSELQDRKR----GRPPQVLVLAPTRELASQVSRDFSNITKKLSV--ACFYGG  298

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  K++ G+DI+VGTPGRIKDH+  G +DL+ LK  VLDEVD+ML +GF + VE 
Sbjct  299   TPYGGQIEKMRNGIDILVGTPGRIKDHLQNGKLDLSKLKHVVLDEVDQMLDMGFADQVEE  358

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  359   ILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  402



>ref|XP_008308798.1| PREDICTED: nucleolar RNA helicase 2 [Cynoglossus semilaevis]
Length=765

 Score =   196 bits (497),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 106/218 (49%), Positives = 133/218 (61%), Gaps = 9/218 (4%)
 Frame = +1

Query  496   ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILES  675
              +NFRIS      LKA+G+  LF IQ   F  V DG D++G+ARTG GKT +F +P++E 
Sbjct  171   FSNFRISPFTITKLKARGVSYLFDIQVKAFNHVYDGEDVIGQARTGTGKTFSFAIPLVEK  230

Query  676   LTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPYAQQ  855
             L        R    GR P VLVL PTRELA+QV  DF+     L +T  C YG T Y  Q
Sbjct  231   LQKESVAPVR----GRAPKVLVLAPTRELAIQVAKDFKDIAKKLAIT--CFYGGTSYNPQ  284

Query  856   EMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILG---  1026
                ++ G+DI+VGTPGRIKDHI    +DLT LK  VLDEVD+ML +GF E VE IL    
Sbjct  285   VDFIRNGIDILVGTPGRIKDHIQNNKLDLTKLKHVVLDEVDQMLDMGFAEQVEEILALSY  344

Query  1027  KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             K       QTLLFSAT   WV  +A K+++P+ K +D+
Sbjct  345   KKDGESNPQTLLFSATCPPWVYDVAKKYMRPECKHIDL  382



>gb|KDO19871.1| hypothetical protein SPRG_14901 [Saprolegnia parasitica CBS 223.65]
Length=648

 Score =   194 bits (494),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 99/216 (46%), Positives = 137/216 (63%), Gaps = 7/216 (3%)
 Frame = +1

Query  496   ITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILES  675
             +++FR+      AL+ +GI +LF IQ+MTF+ + D  D++GRARTG GKTLAFVLP++E 
Sbjct  83    VSDFRVGDITIAALEKRGISTLFPIQSMTFDKIYDEFDLIGRARTGMGKTLAFVLPVVER  142

Query  676   LTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPYAQQ  855
             L     K  ++T  GR   V+ + PTRELA QV T+FE    +L  T  C+YG   Y  Q
Sbjct  143   LF----KEGKRTNRGRAAKVICMAPTRELAKQVATEFEQTAPSLKTT--CIYGGASYQSQ  196

Query  856   EMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILGKVA  1035
                 + GVDIVVGT GRI DH+ RG + L   KF +LDE D ML +GF ED++ +   + 
Sbjct  197   NQDFRDGVDIVVGTTGRICDHLERGTLRLNECKFLILDEADTMLEMGFREDIQKVFEAME  256

Query  1036  DVKQV-QTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
               K   QTLLFSAT+  W+  +A K++KPD+  V++
Sbjct  257   AAKTAHQTLLFSATIPSWLDQVAKKYMKPDRVYVNM  292



>ref|XP_005360167.1| PREDICTED: nucleolar RNA helicase 2 [Microtus ochrogaster]
Length=772

 Score =   196 bits (497),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 139/224 (62%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LKA+G+  LF +QA TF  V  G D++ +ARTG GKT +F 
Sbjct  175   EQKEGAFSNFPISEETIKLLKARGVNYLFPVQAKTFHHVYSGKDLIAQARTGTGKTFSFA  234

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L +G  +  R    GR P VLVL PTRELA QV  DF      L +   C YG 
Sbjct  235   IPLIEKLQSGLQERKR----GRAPQVLVLAPTRELANQVSKDFSDITKKLSVA--CFYGG  288

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  289   TPYGGQIERMRSGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  348

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  349   ILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  392



>gb|EDL92966.1| rCG22008, isoform CRA_c [Rattus norvegicus]
Length=638

 Score =   194 bits (494),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 138/224 (62%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  34    EQKEGAFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  93

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L  G  +  R    GR P VLVL PTRELA QV  DF      L +   C YG 
Sbjct  94    IPLIEKLQGGLQERKR----GRAPQVLVLAPTRELANQVSKDFSDITKKLSVA--CFYGG  147

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  148   TPYGGQIERMRSGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  207

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  208   ILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  251



>ref|XP_006972790.1| PREDICTED: nucleolar RNA helicase 2 [Peromyscus maniculatus bairdii]
Length=783

 Score =   195 bits (496),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 138/224 (62%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  178   EQKEGAFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVFSGKDLIAQARTGTGKTFSFA  237

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L +G     R    GR P VLVL PTRELA QV  DF      L +   C YG 
Sbjct  238   IPLIEKLQSGLQDRKR----GRAPQVLVLAPTRELANQVSKDFSDITKKLSVA--CFYGG  291

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  292   TPYGGQIERMRTGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  351

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  352   ILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  395



>ref|NP_001032278.1| nucleolar RNA helicase 2 [Rattus norvegicus]
 sp|Q3B8Q1.1|DDX21_RAT RecName: Full=Nucleolar RNA helicase 2; AltName: Full=DEAD box 
protein 21; AltName: Full=Gu-alpha; AltName: Full=Nucleolar 
RNA helicase Gu; AltName: Full=Nucleolar RNA helicase II; 
AltName: Full=RH II/Gu [Rattus norvegicus]
 gb|AAI05879.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 21 [Rattus norvegicus]
 gb|EDL92965.1| rCG22008, isoform CRA_b [Rattus norvegicus]
Length=782

 Score =   195 bits (496),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 138/224 (62%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  178   EQKEGAFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  237

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L  G  +  R    GR P VLVL PTRELA QV  DF      L +   C YG 
Sbjct  238   IPLIEKLQGGLQERKR----GRAPQVLVLAPTRELANQVSKDFSDITKKLSVA--CFYGG  291

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  292   TPYGGQIERMRSGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  351

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  352   ILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  395



>dbj|BAE26522.1| unnamed protein product [Mus musculus]
Length=851

 Score =   196 bits (497),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 138/224 (62%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  254   EQKEGAFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  313

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L  G  +  R    GR P VLVL PTRELA QV  DF      L +   C YG 
Sbjct  314   IPLIEKLQGGLQERKR----GRAPQVLVLAPTRELANQVSKDFSDITKKLSVA--CFYGG  367

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  368   TPYGGQIERMRSGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  427

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  428   ILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  471



>ref|XP_009505570.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Phalacrocorax 
carbo]
Length=588

 Score =   193 bits (491),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 139/225 (62%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE    A +NF +S+     L+A+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  11    EEAKEGAFSNFPLSENTINLLEARGVKYLFPVQVRTFQPIYDGKDLIAQARTGTGKTFSF  70

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LP++E L +      R    GR P VLVL+PTRELA QV  DF+       L+  C YG
Sbjct  71    ALPLIEKLQSVSQDGRR----GRSPKVLVLVPTRELATQVAKDFKNL--TRKLSVACFYG  124

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY  Q   LK G+DI+VGTPGRIKDHI    ++L+S+K  VLDEVD ML +GF E VE
Sbjct  125   GTPYKAQLDLLKSGIDILVGTPGRIKDHIQNSKLELSSVKHVVLDEVDHMLDMGFAEQVE  184

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K++K + + +D+
Sbjct  185   EILGFAYKKGSENNPQTLLFSATCPRWVYDVAKKYMKDEYEQIDL  229



>gb|AAF61690.1|AF220365_1 nucleolar RNA helicase II/Gu [Mus musculus]
 gb|EDL32085.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 21, isoform CRA_a [Mus 
musculus]
Length=805

 Score =   195 bits (496),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 138/224 (62%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  208   EQKEGAFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  267

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L  G  +  R    GR P VLVL PTRELA QV  DF      L +   C YG 
Sbjct  268   IPLIEKLQGGLQERKR----GRAPQVLVLAPTRELANQVSKDFSDITKKLSVA--CFYGG  321

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  322   TPYGGQIERMRSGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  381

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  382   ILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  425



>dbj|BAB26817.2| unnamed protein product [Mus musculus]
Length=832

 Score =   195 bits (496),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 138/224 (62%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  235   EQKEGAFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  294

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L  G  +  R    GR P VLVL PTRELA QV  DF      L +   C YG 
Sbjct  295   IPLIEKLQGGLQERKR----GRAPQVLVLAPTRELANQVSKDFSDITKKLSVA--CFYGG  348

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  349   TPYGGQIERMRSGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  408

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  409   ILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  452



>ref|XP_005154050.1| PREDICTED: nucleolar RNA helicase 2-like [Melopsittacus undulatus]
Length=695

 Score =   194 bits (494),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 140/225 (62%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE      +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT++F
Sbjct  121   EEAKEGDFSNFPLSQNTVNLLKAQGVKYLFPVQVRTFQPIYDGKDVIAQARTGTGKTISF  180

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LP++E L +      R    GR P VLVL+PTRELA QV  DF+     L +   C YG
Sbjct  181   ALPLIEKLQSVLLDGRR----GRAPKVLVLVPTRELATQVAKDFKNLTKKLSIA--CFYG  234

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY +Q   LK G+DI+VGTPGRIKDHI    ++L+S+K  VLDEVD ML +GF E VE
Sbjct  235   GTPYKEQIDLLKSGIDILVGTPGRIKDHIQNSKLELSSVKHVVLDEVDHMLDMGFAEQVE  294

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K++K D + +D+
Sbjct  295   EILGFAYKKGSENNPQTLLFSATCPRWVYDVAKKYMKDDCERIDL  339



>ref|XP_008641093.1| PREDICTED: nucleolar RNA helicase 2-like [Corvus brachyrhynchos]
Length=705

 Score =   194 bits (494),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 142/225 (63%), Gaps = 11/225 (5%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF ISK   + L+A+G+  LF +Q  TF  V  G D++ +ARTG GKT +F 
Sbjct  124   EQKEGAFSNFSISKETIQLLQARGVTYLFPVQVKTFNPVYSGKDVIAQARTGTGKTFSFA  183

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L  G ++  R+   GRPP VLVL PTRELA QV  DF+       LT  C YG 
Sbjct  184   IPLIEKL-QGESQERRR---GRPPKVLVLCPTRELANQVAKDFKDI--TRKLTVACFYGG  237

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q   ++ G+DI+VGTPGRIKDH+  G +DLT +K  VLDEVD+ML +GF E VE 
Sbjct  238   TPYNGQTDLMRSGIDILVGTPGRIKDHLQNGKLDLTKVKHVVLDEVDQMLDMGFAEQVED  297

Query  1018  ILGKVADVKQV----QTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL +VA  K      QTLLFSAT   WV  +A K++K   + +D+
Sbjct  298   IL-RVAYKKDSEDNPQTLLFSATCPHWVYDVAKKYMKSRYEQIDL  341



>gb|AAD43959.3|AF159131_1 nucleolar RNA helicase II/Gu [Mus musculus]
Length=851

 Score =   195 bits (496),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 138/224 (62%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  254   EQKEGAFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  313

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L  G  +  R    GR P VLVL PTRELA QV  DF      L +   C YG 
Sbjct  314   IPLIEKLQGGLQERKR----GRAPQVLVLAPTRELANQVSKDFSDITKKLSVA--CFYGG  367

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  368   TPYGGQIERMRSGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  427

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  428   ILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  471



>ref|XP_009563565.1| PREDICTED: nucleolar RNA helicase 2-like [Cuculus canorus]
Length=710

 Score =   194 bits (494),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 141/225 (63%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE    A +NF +S+   + LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  145   EEAKEGAFSNFPLSENTIKLLKARGVKYLFPVQVKTFQPIYDGKDVIAQARTGTGKTFSF  204

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              +P++E L +      R    GR P VLVL+PTRELA QV  DF+     L +   C YG
Sbjct  205   AVPLIEKLQDVSQDVRR----GRSPKVLVLVPTRELATQVAKDFKNLTRKLSVA--CFYG  258

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY +Q   LK G+DI+VGTPGRIKDHI    ++L+S+K  VLDEVD ML +GF E VE
Sbjct  259   GTPYKEQIDLLKSGIDILVGTPGRIKDHIQNSKLELSSVKHVVLDEVDHMLDMGFAEQVE  318

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K++K + + +D+
Sbjct  319   EILGFAYKKGSENNPQTLLFSATCPRWVYDVAKKYMKDEYEQIDL  363



>gb|AAH59237.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 21 [Mus musculus]
Length=851

 Score =   195 bits (496),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 138/224 (62%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  254   EQKEGAFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  313

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L  G  +  R    GR P VLVL PTRELA QV  DF      L +   C YG 
Sbjct  314   IPLIEKLQGGLQERKR----GRAPQVLVLAPTRELANQVSKDFSDITKKLSVA--CFYGG  367

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  368   TPYGGQIERMRSGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  427

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  428   ILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  471



>ref|XP_009288813.1| PREDICTED: nucleolar RNA helicase 2-like [Aptenodytes forsteri]
Length=615

 Score =   194 bits (492),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 138/225 (61%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE    A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  38    EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTGTGKTFSF  97

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LP+ E L +      R    GR P VLVL+PTRELA QV  DF+       L+  C YG
Sbjct  98    ALPLTEQLQSVSQDGRR----GRSPKVLVLVPTRELATQVAKDFKNL--TRKLSVACFYG  151

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY  Q   LK G+DI+VGTPGRIKDHI    ++L+S+K  VLDEVD ML +GF E VE
Sbjct  152   GTPYKAQLDLLKSGIDILVGTPGRIKDHIQNSKLELSSVKHVVLDEVDHMLDMGFAEQVE  211

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K++K + + +D+
Sbjct  212   EILGFAYKKDSENNPQTLLFSATCPRWVYDVAKKYMKDEYEQIDL  256



>gb|AAH30895.1| Ddx21 protein, partial [Mus musculus]
Length=689

 Score =   194 bits (494),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 138/224 (62%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  92    EQKEGAFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  151

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L  G  +  R    GR P VLVL PTRELA QV  DF      L +   C YG 
Sbjct  152   IPLIEKLQGGLQERKR----GRAPQVLVLAPTRELANQVSKDFSDITKKLSVA--CFYGG  205

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  206   TPYGGQIERMRSGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  265

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  266   ILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  309



>ref|XP_005070877.1| PREDICTED: nucleolar RNA helicase 2 isoform X2 [Mesocricetus 
auratus]
Length=774

 Score =   195 bits (495),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 138/224 (62%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + L+A+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  179   EQKEGAFSNFPISEETVKLLRARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  238

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L +G     R    GR P VLVL PTRELA QV  DF      L +   C YG 
Sbjct  239   IPLIEKLQDGLQDRKR----GRAPQVLVLAPTRELANQVSKDFSDITKKLSVA--CFYGG  292

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  293   TPYGGQIERMRSGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  352

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  353   ILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  396



>ref|XP_002904811.1| DEAD/DEAH box RNA helicase, putative [Phytophthora infestans 
T30-4]
 gb|EEY53193.1| DEAD/DEAH box RNA helicase, putative [Phytophthora infestans 
T30-4]
Length=681

 Score =   194 bits (493),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 105/224 (47%), Positives = 144/224 (64%), Gaps = 15/224 (7%)
 Frame = +1

Query  460   VGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQG  639
             VGG   EE+P ++ NFRI    ++ L+A+GI +LF IQAMTF+ ++DG D++GRARTG G
Sbjct  100   VGG---EENP-SLDNFRICDETKKNLQARGIHTLFPIQAMTFDKIVDGKDLMGRARTGMG  155

Query  640   KTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTS  819
             KTLAF LP++E L        R         V+ + PTRELA QV T+FE+ G +  L++
Sbjct  156   KTLAFALPVIELLLQDKRPRARGRAP----RVVCMAPTRELAKQVATEFELTGPS--LST  209

Query  820   CCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGF  999
              C+YG   Y  Q    + GVDI+VGT GR+ DHI RGN+ L + +F +LDE D ML +GF
Sbjct  210   VCIYGGASYQSQNNAFRSGVDILVGTTGRVIDHIDRGNLRLHNCEFLILDEADTMLEMGF  269

Query  1000  VEDVEFILGKVADVK-----QVQTLLFSATLQDWVKHIASKFLK  1116
              EDV+ +   +  VK     + QTLLFSAT+  WVK +A K++K
Sbjct  270   REDVQKVFTAMDQVKNESTGKRQTLLFSATIPKWVKDVADKYMK  313



>ref|XP_005070876.1| PREDICTED: nucleolar RNA helicase 2 isoform X1 [Mesocricetus 
auratus]
Length=780

 Score =   195 bits (495),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 138/224 (62%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + L+A+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  185   EQKEGAFSNFPISEETVKLLRARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  244

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L +G     R    GR P VLVL PTRELA QV  DF      L +   C YG 
Sbjct  245   IPLIEKLQDGLQDRKR----GRAPQVLVLAPTRELANQVSKDFSDITKKLSVA--CFYGG  298

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  299   TPYGGQIERMRSGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  358

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  359   ILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  402



>ref|NP_062426.2| nucleolar RNA helicase 2 [Mus musculus]
 sp|Q9JIK5.3|DDX21_MOUSE RecName: Full=Nucleolar RNA helicase 2; AltName: Full=DEAD box 
protein 21; AltName: Full=Gu-alpha; AltName: Full=Nucleolar 
RNA helicase Gu; AltName: Full=Nucleolar RNA helicase II; 
AltName: Full=RH II/Gu [Mus musculus]
 dbj|BAE35625.1| unnamed protein product [Mus musculus]
 gb|AAH43655.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 21 [Mus musculus]
 gb|EDL32086.1| DEAD (Asp-Glu-Ala-Asp) box polypeptide 21, isoform CRA_b [Mus 
musculus]
Length=851

 Score =   195 bits (496),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 138/224 (62%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  254   EQKEGAFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  313

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L  G  +  R    GR P VLVL PTRELA QV  DF      L +   C YG 
Sbjct  314   IPLIEKLQGGLQERKR----GRAPQVLVLAPTRELANQVSKDFSDITKKLSVA--CFYGG  367

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  368   TPYGGQIERMRSGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  427

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  428   ILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  471



>emb|CEG79803.1| hypothetical protein RMATCC62417_14224 [Rhizopus microsporus]
Length=476

 Score =   191 bits (485),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 107/223 (48%), Positives = 140/223 (63%), Gaps = 8/223 (4%)
 Frame = +1

Query  484   DPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLP  663
             D   ++NFRIS+   + L+ KGI+SLF IQA TF+ + DG D++ RARTG GKTLAF +P
Sbjct  72    DHLLLSNFRISQSTIDNLEKKGIKSLFDIQAATFDTIFDGKDVLARARTGTGKTLAFAIP  131

Query  664   ILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTP  843
             ++E L        R+   GR P VLVL PTR+LA QV  DFE   G   L +  +YG  P
Sbjct  132   VVERLALDKDYKERR---GRAPRVLVLCPTRDLAKQVCGDFEQVSGNR-LKTLPVYGGVP  187

Query  844   YAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRI-GFVEDVEFI  1020
             Y +Q    + GVD+VVGTPGRI DHI  GN+ L  LKF +LDE DEML   GF ED+  +
Sbjct  188   YNEQTSVFREGVDVVVGTPGRILDHIKFGNMKLHDLKFIILDEADEMLDARGFEEDMFNL  247

Query  1021  LGKVADVKQV---QTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             L  + + K+    QTLLFSAT+ + V     +FLK D + +D+
Sbjct  248   LSNIQEQKETRDYQTLLFSATVPESVMQTIQRFLKEDYERIDL  290



>gb|KFH66922.1| hypothetical protein MVEG_07447 [Mortierella verticillata NRRL 
6337]
Length=687

 Score =   194 bits (493),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 109/235 (46%), Positives = 144/235 (61%), Gaps = 15/235 (6%)
 Frame = +1

Query  463   GGDEEEEDP--YAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQ  636
             G   E E P    +T+++IS    +AL  +GI+SLF IQA  F  + +G D++GRARTG 
Sbjct  104   GATVENEIPENLRLTSYKISLSTVDALAKRGIKSLFPIQAEVFNPIYNGNDVLGRARTGT  163

Query  637   GKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLT  816
             GKTLAF LP++ESL        R    GR P VLVL PTR+LA+QV  +F     +  L 
Sbjct  164   GKTLAFALPMVESLLKEKIVKER----GRVPRVLVLAPTRDLAIQVSNEFTSI--SPNLK  217

Query  817   SCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIG  996
             + C+YG TP  +Q   L++GVD+V+GTPGR  DHI RGN+ L  L+F  LDE D+ML IG
Sbjct  218   TLCVYGGTPMREQTAYLQQGVDVVIGTPGRCMDHINRGNLLLHDLRFVCLDEADQMLDIG  277

Query  997   FVEDVEFILGKV-------ADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             F ED+E IL +V        D  + QTLLFSAT  +W+K    K+L P    +D+
Sbjct  278   FAEDMEQILQEVHTHKETRGDAPKHQTLLFSATAPEWIKRTVEKYLDPQFVNIDL  332



>ref|XP_002820927.1| PREDICTED: nucleolar RNA helicase 2 [Pongo abelii]
Length=783

 Score =   195 bits (495),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 140/224 (63%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LK +G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  182   EQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  241

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L +G  +  ++   GRPP VLVL PTRELA QV  DF      L +   C YG 
Sbjct  242   IPLIEKL-HGELQDRKR---GRPPQVLVLAPTRELANQVSKDFSDITKKLSV--ACFYGG  295

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDHI  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  296   TPYGGQFERMRNGIDILVGTPGRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  355

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  356   ILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  399



>ref|XP_010399213.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Corvus cornix 
cornix]
Length=702

 Score =   194 bits (493),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 142/225 (63%), Gaps = 11/225 (5%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF ISK   + L+A+G+  LF +Q  TF  V  G D++ +ARTG GKT +F 
Sbjct  121   EQKEGAFSNFSISKETIQLLQARGVTYLFPVQVKTFNPVYSGKDVIAQARTGTGKTFSFA  180

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L  G ++  R+   GRPP VLVL PTRELA QV  DF+       LT  C YG 
Sbjct  181   IPLIEKL-QGESQERRR---GRPPKVLVLCPTRELANQVAKDFKDI--TRKLTVACFYGG  234

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q   ++ G+DI+VGTPGRIKDH+  G +DLT +K  VLDEVD+ML +GF E VE 
Sbjct  235   TPYNGQTDLMRSGIDILVGTPGRIKDHLQNGKLDLTKVKHVVLDEVDQMLDMGFAEQVED  294

Query  1018  ILGKVADVKQV----QTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL +VA  K      QTLLFSAT   WV  +A K++K   + +D+
Sbjct  295   IL-RVAYKKDSEDNPQTLLFSATCPHWVYDVAKKYMKSRYEQIDL  338



>ref|XP_009487807.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Pelecanus 
crispus]
Length=581

 Score =   192 bits (489),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 138/225 (61%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE    A +NF +S+     LKA+G++ LF +Q  TF+ V DG D++ +ARTG GKT +F
Sbjct  4     EEAKEGAFSNFPLSQDTLNLLKARGVKYLFPVQVKTFQPVYDGKDLIAQARTGTGKTFSF  63

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LP++E L +      R    GR P VLVL+PTRELA QV  DF+       L+  C YG
Sbjct  64    ALPLIEKLQSVSQDGRR----GRSPKVLVLVPTRELATQVAKDFKNL--TRKLSVACFYG  117

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY  Q   LK G+DI+VGTPGRIKDHI    ++L+S+K  VLDEVD ML +GF E VE
Sbjct  118   GTPYKVQLDLLKSGIDILVGTPGRIKDHIQNSKLELSSVKHVVLDEVDHMLDMGFAEQVE  177

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              IL    K       QTLLFSAT   WV  +A K++K + + +D+
Sbjct  178   EILAFAYKKGSENNPQTLLFSATCPRWVYDVAKKYMKDEYEQIDL  222



>ref|XP_009892319.1| PREDICTED: nucleolar RNA helicase 2-like [Charadrius vociferus]
Length=682

 Score =   194 bits (493),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 109/226 (48%), Positives = 144/226 (64%), Gaps = 11/226 (5%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE+   A +NF ISK   + L+A+G+  LF +Q  TF++V  G D++ +ARTG GKT +F
Sbjct  102   EEQKEGAFSNFPISKGTVQLLQARGVTYLFPVQVKTFDSVYSGKDVIAQARTGTGKTFSF  161

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              +P++E L  G ++  R+   GR P VLVL PTRELA QV  DF+       LT  C YG
Sbjct  162   AIPLIEKL-QGDSQERRR---GRSPKVLVLCPTRELANQVAKDFKDI--TRKLTVACFYG  215

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY  Q   ++ G+DI+VGTPGRIKDH+  G +DLT +K  VLDEVD+ML +GF E VE
Sbjct  216   GTPYNGQIDLMRSGIDILVGTPGRIKDHLQSGKLDLTKVKHVVLDEVDQMLDMGFAEQVE  275

Query  1015  FILGKVADVKQV----QTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              IL +VA  K      QTLLFSAT   WV  +A K++K   + VD+
Sbjct  276   DIL-RVAYKKDSEDNPQTLLFSATCPHWVYDVAKKYMKSKYEQVDL  320



>ref|XP_001110939.1| PREDICTED: nucleolar RNA helicase 2-like isoform 3 [Macaca mulatta]
Length=783

 Score =   194 bits (494),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 140/224 (63%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LK +G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  182   EQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  241

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L +G  +  ++   GRPP VLVL PTRELA QV  DF      L +   C YG 
Sbjct  242   IPLIEKL-HGELQDRKR---GRPPQVLVLAPTRELANQVSKDFSDITKKLSV--ACFYGG  295

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDHI  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  296   TPYGGQFERMRNGIDILVGTPGRIKDHIQSGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  355

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  356   ILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  399



>ref|XP_003409350.1| PREDICTED: nucleolar RNA helicase 2 [Loxodonta africana]
Length=787

 Score =   194 bits (494),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 140/224 (63%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  184   EQKEGAFSNFPISEATVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  243

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L +G  +  ++   GRPP VLVL PTRELA QV  DF      L +   C YG 
Sbjct  244   IPLIEKL-HGELQDKKR---GRPPQVLVLAPTRELASQVSRDFSDITKKLAV--ACFYGG  297

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+    +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  298   TPYGGQFERMRNGIDILVGTPGRIKDHLQNAKLDLTKLKHVVLDEVDQMLDMGFADQVEE  357

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  358   ILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  401



>ref|XP_421574.3| PREDICTED: nucleolar RNA helicase 2-like [Gallus gallus]
Length=760

 Score =   194 bits (494),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 139/225 (62%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE    A +NF +S      LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  190   EEAREGAFSNFPLSPSTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTGTGKTFSF  249

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              +P+ E L +     ++    GR P VLVL+PTRELA+QV  DF+       L+  C YG
Sbjct  250   AIPLTEKLQS----VSQDEKRGRSPKVLVLVPTRELAIQVAKDFKNL--TRKLSVACFYG  303

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY  Q   LK G+DI+VGTPGRIKDHI    +DL+++K  VLDEVD ML +GF E VE
Sbjct  304   GTPYKAQFDLLKNGIDILVGTPGRIKDHIQNSKLDLSNVKHVVLDEVDHMLDMGFAEQVE  363

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K++K + + VD+
Sbjct  364   EILGFAYKKGSENSPQTLLFSATCPRWVYDVAKKYMKGEYEQVDL  408



>gb|EHH64804.1| hypothetical protein EGM_18115 [Macaca fascicularis]
Length=783

 Score =   194 bits (494),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 140/224 (63%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LK +G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  182   EQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  241

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L +G  +  ++   GRPP VLVL PTRELA QV  DF      L +   C YG 
Sbjct  242   IPLIEKL-HGELQDRKR---GRPPQVLVLAPTRELANQVSKDFSDITKKLSV--ACFYGG  295

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDHI  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  296   TPYGGQFERMRNGIDILVGTPGRIKDHIQSGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  355

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  356   ILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  399



>ref|XP_011846565.1| PREDICTED: nucleolar RNA helicase 2 [Mandrillus leucophaeus]
Length=759

 Score =   194 bits (494),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 140/224 (63%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LK +G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  182   EQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  241

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L +G  +  ++   GRPP VLVL PTRELA QV  DF      L +   C YG 
Sbjct  242   IPLIEKL-HGELQDRKR---GRPPQVLVLAPTRELANQVSKDFSDITKKLSV--ACFYGG  295

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDHI  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  296   TPYGGQFERMRSGIDILVGTPGRIKDHIQSGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  355

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  356   ILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  399



>emb|CDY46329.1| BnaC01g31630D [Brassica napus]
Length=549

 Score =   192 bits (487),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 106/228 (46%), Positives = 142/228 (62%), Gaps = 9/228 (4%)
 Frame = +1

Query  457   AVGGDEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQ  636
             A+   E   D  AI    IS  + +AL AKGIE LF IQ    E  + G DM+GRARTG 
Sbjct  93    AIADSESSGDGLAIAELGISPEIVKALSAKGIEKLFPIQKAVLEPAMQGRDMIGRARTGT  152

Query  637   GKTLAFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLT  816
             GKTLAF +PI++ +     K   K G GR P  LVL PTRELA QV  +F     A  L 
Sbjct  153   GKTLAFGIPIIDKII----KFNAKHGRGRNPLCLVLAPTRELARQVEKEFRE--SAPSLD  206

Query  817   SCCLYGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIG  996
             + C+YG TP  QQ  +L  GVD+ VGTPGRI D I RG ++L+ ++F VLDE D+ML++G
Sbjct  207   TICVYGGTPIGQQMRQLDYGVDVAVGTPGRIIDLIKRGALNLSEVQFVVLDEADQMLQVG  266

Query  997   FVEDVEFILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             F EDVE IL ++ + +  Q+++FSAT+  W++ +  K+L  D  T+D+
Sbjct  267   FAEDVEIILERLPEKR--QSMMFSATMPSWIRSLTKKYLN-DPLTIDL  311



>ref|XP_004583494.1| PREDICTED: nucleolar RNA helicase 2 [Ochotona princeps]
Length=778

 Score =   194 bits (494),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 109/225 (48%), Positives = 140/225 (62%), Gaps = 11/225 (5%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  177   EQKEGAFSNFPISEETVKLLKARGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  236

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L        R    GRPP VLVL PTRELA QV  DF      L +   C YG 
Sbjct  237   IPLVEKLQGELQDRKR----GRPPQVLVLAPTRELANQVSRDFSDITKKLAV--ACFYGG  290

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DL+ LK  VLDEVD+ML +GF + VE 
Sbjct  291   TPYGNQIERIRNGIDILVGTPGRIKDHLESGKLDLSKLKHVVLDEVDQMLDMGFADQVED  350

Query  1018  ILGKVADVKQV----QTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL KVA  K      QTLLFSAT   WV ++A K++K   + VD+
Sbjct  351   IL-KVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  394



>ref|XP_009993186.1| PREDICTED: nucleolar RNA helicase 2-like [Chaetura pelagica]
Length=472

 Score =   190 bits (483),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 105/220 (48%), Positives = 137/220 (62%), Gaps = 11/220 (5%)
 Frame = +1

Query  493   AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILE  672
             A +NF ISK   + L+A+G+  LF +Q  TF+ V  G D++ +ARTG GKT +F +P++E
Sbjct  127   AFSNFSISKGTVQLLQARGVTYLFPVQVKTFDPVYSGKDVIAQARTGTGKTFSFAIPLIE  186

Query  673   SLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPYAQ  852
              L     +  R    GR P VLVL PTRELA QV  DF+       LT  C YG TPY  
Sbjct  187   KLQGDSQERKR----GRSPKVLVLCPTRELANQVAKDFKDI--TRKLTVACFYGGTPYNG  240

Query  853   QEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILGKV  1032
             Q   ++ G+DI+VGTPGRIKDH+  G +DLT +K  VLDEVD+ML +GF E VE IL +V
Sbjct  241   QIDLMRNGIDILVGTPGRIKDHLQNGKLDLTKVKHVVLDEVDQMLDMGFAEQVEDIL-RV  299

Query  1033  ADVKQV----QTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             A  K      QTLLFSAT   WV  +A K++K   + +D+
Sbjct  300   AYKKDSEDNPQTLLFSATCPHWVYDVAKKYMKSRYEQIDL  339



>gb|ETE62473.1| Nucleolar RNA helicase 2, partial [Ophiophagus hannah]
Length=1477

 Score =   197 bits (502),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/219 (48%), Positives = 137/219 (63%), Gaps = 9/219 (4%)
 Frame = +1

Query  493   AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILE  672
             A  NF ISK   + LKA+G+  LF +QA TF+ V +G D+V +ARTG GKT +F +P++E
Sbjct  907   AFANFDISKATLDLLKARGVTYLFPVQAKTFKPVFEGKDVVAQARTGTGKTFSFAIPLIE  966

Query  673   SLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPYAQ  852
              L   P +  R    GRPP VLVL PTRELA+QV  DF+       LT  C YG T Y  
Sbjct  967   KLDRDPQERKR----GRPPKVLVLTPTRELAMQVARDFKDI--TKKLTVACFYGGTAYNG  1020

Query  853   QEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFIL---  1023
             Q   ++ G+DI+VGTPGRIKDH+    +D++ LK  VLDEVD+ML +GF E VE IL   
Sbjct  1021  QLDLIRNGIDILVGTPGRIKDHLQNNKLDISKLKHVVLDEVDQMLDMGFAEQVEEILVNS  1080

Query  1024  GKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  1081  YKKDSEDNPQTLLFSATCPQWVYNVAKKYMKSKYEQVDL  1119



>ref|XP_011666060.1| PREDICTED: nucleolar RNA helicase 2 [Strongylocentrotus purpuratus]
Length=682

 Score =   194 bits (492),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 110/234 (47%), Positives = 141/234 (60%), Gaps = 18/234 (8%)
 Frame = +1

Query  469   DEEEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTL  648
             +E +E   A +NF I     E L AKG++ LF IQA TF+ + DG D++ +ARTG GKTL
Sbjct  109   EETQEKIGAFSNFGIRPKTIEKLHAKGVKYLFPIQAQTFKPIDDGFDVIAQARTGTGKTL  168

Query  649   AFVLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCL  828
             +FVLP++E     P K+      GR P +L L PTRELA Q+   FE  G  L  T  C+
Sbjct  169   SFVLPLVEKWQQFPQKS------GRQPIILALAPTRELAKQISEYFEAIGPHLSTT--CI  220

Query  829   YGNTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVED  1008
             YG T Y  QE  ++RG+D+VVGTPGRI D+I +  +DL+ LK  VLDEVD ML +GF E 
Sbjct  221   YGGTSYWPQESAIRRGLDVVVGTPGRILDYIRKNTLDLSKLKHVVLDEVDRMLDMGFAES  280

Query  1009  VEFILGKVADVKQ----------VQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             VE ILG      Q           QTLLFSAT+  WV   A K+++ D K VD+
Sbjct  281   VEEILGAAYKTGQPGDGEEAPNNPQTLLFSATVPPWVYQTAVKYMRKDLKKVDL  334



>ref|XP_005530565.1| PREDICTED: nucleolar RNA helicase 2-like [Pseudopodoces humilis]
Length=715

 Score =   194 bits (493),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 142/225 (63%), Gaps = 11/225 (5%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF ISK   + L+A+G+  LF +Q  TF  V  G D++ +ARTG GKT +F 
Sbjct  130   EQKEGAFSNFSISKETVQLLQARGVTYLFPVQVKTFNPVYSGKDVIAQARTGTGKTFSFA  189

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L  G ++  R+   GRPP VLVL PTRELA QV  DF+       LT  C YG 
Sbjct  190   IPLIEKL-QGESQERRR---GRPPKVLVLCPTRELANQVAKDFKDI--TRKLTVACFYGG  243

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q   ++ G+DI+VGTPGRIKDH+  G +DLT +K  VLDEVD+ML +GF E VE 
Sbjct  244   TPYNGQIDLMRSGIDILVGTPGRIKDHLQNGKLDLTKVKHVVLDEVDQMLDMGFAEQVED  303

Query  1018  ILGKVADVKQV----QTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL +VA  K      QTLLFSAT   WV  +A K++K   + +D+
Sbjct  304   IL-RVAYKKDSEDNPQTLLFSATCPHWVYDVAKKYMKSRYEQIDL  347



>ref|XP_009499705.1| PREDICTED: nucleolar RNA helicase 2-like [Phalacrocorax carbo]
Length=688

 Score =   194 bits (492),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/226 (48%), Positives = 143/226 (63%), Gaps = 11/226 (5%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE+   A +NF ISK   + L+A+G+  LF +Q  TF+ V  G D++ +ARTG GKT +F
Sbjct  109   EEQKEGAFSNFSISKGTVQLLQARGVTYLFPVQVKTFDPVFSGKDVIAQARTGTGKTFSF  168

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              +P++E L  G ++  R+   GR P VLVL PTRELA QV  DF+       LT  C YG
Sbjct  169   AIPLIEKL-QGDSQEKRR---GRSPKVLVLCPTRELANQVAKDFKDI--TKKLTVACFYG  222

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY  Q   ++ G+DI+VGTPGRIKDH+  G +DLT +K  VLDEVD+ML +GF E VE
Sbjct  223   GTPYNGQIDLMRSGIDILVGTPGRIKDHLQNGKLDLTKVKHVVLDEVDQMLDMGFAEQVE  282

Query  1015  FILGKVADVKQV----QTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              IL +VA  K      QTLLFSAT   WV  +A K++K   + +D+
Sbjct  283   DIL-RVAYKKDSEDNPQTLLFSATCPHWVYDVAKKYMKSKYEQIDL  327



>ref|XP_011713343.1| PREDICTED: nucleolar RNA helicase 2 [Macaca nemestrina]
Length=783

 Score =   194 bits (494),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 140/224 (63%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LK +G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  182   EQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  241

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L +G  +  ++   GRPP VLVL PTRELA QV  DF      L +   C YG 
Sbjct  242   IPLIEKL-HGELQDRKR---GRPPQVLVLAPTRELANQVSKDFSDITKKLSV--ACFYGG  295

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDHI  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  296   TPYGGQFERMRNGIDILVGTPGRIKDHIQSGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  355

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  356   ILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  399



>ref|XP_008830862.1| PREDICTED: nucleolar RNA helicase 2 [Nannospalax galili]
Length=789

 Score =   194 bits (493),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/224 (47%), Positives = 137/224 (61%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  183   EQKEGAFSNFPISEETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  242

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L  G     R    GR P VLVL PTRELA QV  DF      L +   C YG 
Sbjct  243   IPLIEKLQGGLQDRKR----GRAPQVLVLAPTRELANQVSRDFSDITKKLSVA--CFYGG  296

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DL+ LK  VLDEVD+ML +GF + VE 
Sbjct  297   TPYGGQIERMRNGIDILVGTPGRIKDHLQNGKLDLSKLKHVVLDEVDQMLDMGFADQVEE  356

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  357   ILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  400



>ref|XP_005565735.1| PREDICTED: nucleolar RNA helicase 2 [Macaca fascicularis]
Length=783

 Score =   194 bits (493),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 140/224 (63%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LK +G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  182   EQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  241

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L +G  +  ++   GRPP VLVL PTRELA QV  DF      L +   C YG 
Sbjct  242   IPLIEKL-HGELQDRKR---GRPPQVLVLAPTRELANQVSKDFSDITKKLSV--ACFYGG  295

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDHI  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  296   TPYGGQFERMRNGIDILVGTPGRIKDHIQSGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  355

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  356   ILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  399



>gb|ERE87186.1| nucleolar RNA helicase 2-like protein [Cricetulus griseus]
Length=648

 Score =   193 bits (491),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 136/224 (61%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  134   EQKEGAFSNFPISQETVKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  193

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L  G     R    GR P VLVL PTRELA QV  DF      L +   C YG 
Sbjct  194   IPLIEKLQGGLQDKKR----GRAPQVLVLAPTRELANQVSNDFSDITKKLSVA--CFYGG  247

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q   ++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  248   TPYGGQIDCIRSGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  307

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  308   ILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  351



>ref|XP_003903905.1| PREDICTED: nucleolar RNA helicase 2 [Papio anubis]
Length=783

 Score =   194 bits (493),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 140/224 (63%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LK +G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  182   EQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  241

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L +G  +  ++   GRPP VLVL PTRELA QV  DF      L +   C YG 
Sbjct  242   IPLIEKL-HGELQDRKR---GRPPQVLVLAPTRELANQVSKDFSDITKKLSV--ACFYGG  295

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDHI  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  296   TPYGGQFERMRNGIDILVGTPGRIKDHIQSGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  355

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  356   ILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  399



>ref|XP_011586207.1| PREDICTED: nucleolar RNA helicase 2-like [Aquila chrysaetos canadensis]
Length=682

 Score =   194 bits (492),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 138/225 (61%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE    A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  105   EEAKEGAFSNFPLSQNTINFLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTGTGKTFSF  164

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LP+ E L +      R    GR P VLVL+PTRELA QV  DF+       L+  C YG
Sbjct  165   ALPLTEKLQSVSQDGRR----GRAPKVLVLVPTRELATQVAKDFKSL--TRKLSVACFYG  218

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY +Q   LK G+DI+VGTPGRIKDHI    ++L+ +K  VLDEVD ML +GF E VE
Sbjct  219   GTPYKEQLDLLKSGIDILVGTPGRIKDHIQNSKLELSDVKHVVLDEVDHMLDMGFAEQVE  278

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K++K + + +D+
Sbjct  279   EILGFAYKKGSENNPQTLLFSATCPRWVYDVAKKYMKDEYEQIDL  323



>ref|XP_002718616.1| PREDICTED: nucleolar RNA helicase 2 [Oryctolagus cuniculus]
Length=780

 Score =   194 bits (493),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 140/225 (62%), Gaps = 11/225 (5%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LKA+G+  LF +QA TF  V  G D++ +ARTG GKT +F 
Sbjct  180   EQKEGAFSNFPISEETIKLLKARGVTFLFPVQAKTFHHVYSGRDLIAQARTGTGKTFSFA  239

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L        R    GRPP VLVL PTRELA QV  DF      L +   C YG 
Sbjct  240   IPLIEKLQGELQDRKR----GRPPQVLVLAPTRELANQVSKDFSDITKKLAV--ACFYGG  293

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DL+ LK  VLDEVD+ML +GF + VE 
Sbjct  294   TPYGNQIERMRNGIDILVGTPGRIKDHLENGKLDLSKLKHVVLDEVDQMLDMGFADQVED  353

Query  1018  ILGKVADVKQV----QTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL KVA  K      QTLLFSAT   WV ++A K++K   + VD+
Sbjct  354   IL-KVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKATYEQVDL  397



>ref|XP_008576695.1| PREDICTED: nucleolar RNA helicase 2 [Galeopterus variegatus]
Length=772

 Score =   194 bits (493),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 136/224 (61%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LK +G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  181   EQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFYHVYSGKDLIAQARTGTGKTFSFA  240

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L        R    GR P VLVL PTRELA QV  DF        LT  C YG 
Sbjct  241   IPLIEKLQG----ELRDRKRGRSPQVLVLAPTRELANQVSRDFSDI--TKKLTVACFYGG  294

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  295   TPYGGQIERMRNGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVED  354

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++KP  + VD+
Sbjct  355   ILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKPTYEQVDL  398



>ref|XP_010578315.1| PREDICTED: nucleolar RNA helicase 2-like [Haliaeetus leucocephalus]
Length=702

 Score =   194 bits (492),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/225 (47%), Positives = 138/225 (61%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE    A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  116   EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTGTGKTFSF  175

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LP+ E L +      R    GR P VLVL+PTRELA QV  DF+       L+  C YG
Sbjct  176   ALPLTEKLQSVSQDGRR----GRAPKVLVLVPTRELATQVARDFKSL--TRKLSVACFYG  229

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY +Q   LK G+DI+VGTPGRIKDHI    ++L+ +K  VLDEVD ML +GF E VE
Sbjct  230   GTPYKEQLDLLKSGIDILVGTPGRIKDHIQNSKLELSDVKHVVLDEVDHMLDMGFAEQVE  289

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K++K + + +D+
Sbjct  290   EILGFAYKKGSENNPQTLLFSATCPRWVYDVAKKYMKDEYEQIDL  334



>ref|XP_003258244.1| PREDICTED: nucleolar RNA helicase 2 isoform 2 [Nomascus leucogenys]
Length=715

 Score =   194 bits (492),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 136/224 (61%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LK +G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  114   EQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  173

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L        R    GRPP VLVL PTRELA QV  DF      L +   C YG 
Sbjct  174   IPLIEKLHEELQDRKR----GRPPQVLVLAPTRELANQVSKDFSDITKKLSV--ACFYGG  227

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDHI  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  228   TPYGGQFERMRNGIDILVGTPGRIKDHIQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  287

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  288   ILSVAYKKDSEDDPQTLLFSATCPHWVFNVAKKYMKSTYEQVDL  331



>ref|XP_005429045.1| PREDICTED: nucleolar RNA helicase 2-like [Geospiza fortis]
Length=683

 Score =   193 bits (491),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 108/225 (48%), Positives = 142/225 (63%), Gaps = 11/225 (5%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF ISK   + L+A+G+  LF +Q  TF  V  G D++ +ARTG GKT +F 
Sbjct  100   EQKEGAFSNFSISKETVQLLQARGVTYLFPVQVKTFNPVYSGKDVIAQARTGTGKTFSFA  159

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L  G ++  R+   GRPP VLVL PTRELA QV  DF+       LT  C YG 
Sbjct  160   IPLIEKL-QGDSQERRR---GRPPKVLVLCPTRELANQVAKDFKDI--TRKLTVGCFYGG  213

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q   ++ G+DI+VGTPGRIKDH+  G +DLT +K  VLDEVD+ML +GF E VE 
Sbjct  214   TPYNGQIDLMRSGIDILVGTPGRIKDHLQNGKLDLTKVKHVVLDEVDQMLDMGFAEQVED  273

Query  1018  ILGKVADVKQV----QTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL +VA  K      QTLLFSAT   WV  +A K++K   + +D+
Sbjct  274   IL-RVAYKKDSEDNPQTLLFSATCPHWVYDVAKKYMKSRYEQIDL  317



>ref|XP_009324263.1| PREDICTED: nucleolar RNA helicase 2-like [Pygoscelis adeliae]
Length=711

 Score =   194 bits (492),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/225 (47%), Positives = 138/225 (61%), Gaps = 9/225 (4%)
 Frame = +1

Query  475   EEEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAF  654
             EE    A +NF +S+     LKA+G++ LF +Q  TF+ + DG D++ +ARTG GKT +F
Sbjct  134   EEAKEGAFSNFPLSQNTINLLKARGVKYLFPVQVKTFQPIYDGKDLIAQARTGTGKTFSF  193

Query  655   VLPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYG  834
              LP+ E L +      R    GR P VLVL+PTRELA QV  DF+       L+  C YG
Sbjct  194   ALPLTEKLQSVSQDGRR----GRSPKVLVLVPTRELATQVAKDFKNL--TRKLSVACFYG  247

Query  835   NTPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVE  1014
              TPY  Q   LK G+DI+VGTPGRIKDHI    ++L+S+K  VLDEVD ML +GF E VE
Sbjct  248   GTPYKAQLDLLKSGIDILVGTPGRIKDHIQNSKLELSSVKHVVLDEVDHMLDMGFAEQVE  307

Query  1015  FILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              ILG   K       QTLLFSAT   WV  +A K++K + + +D+
Sbjct  308   EILGFAYKRDSENNPQTLLFSATCPRWVYDVAKKYMKDEYEQIDL  352



>ref|XP_005838835.1| hypothetical protein GUITHDRAFT_102470 [Guillardia theta CCMP2712]
 gb|EKX51855.1| hypothetical protein GUITHDRAFT_102470 [Guillardia theta CCMP2712]
Length=589

 Score =   192 bits (488),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/222 (47%), Positives = 143/222 (64%), Gaps = 11/222 (5%)
 Frame = +1

Query  493   AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILE  672
             +I NFRIS+   +AL  +GI++LF IQ  TF+ + +G D++ RARTG GKTLAFVLP+ E
Sbjct  138   SIRNFRISEKTIKALSEQGIQTLFPIQVATFDIIYEGYDLIARARTGTGKTLAFVLPVHE  197

Query  673   SLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPYAQ  852
              L     +   +   GR P  LV++PTREL LQV   ++  GG+L + S  +YG  P  Q
Sbjct  198   KLMRSRGQINSR---GRAPEALVMVPTRELCLQVTRVWKSLGGSLEIQS--VYGGAPIRQ  252

Query  853   QEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILGKV  1032
             Q++ L  G+D+V+GTPGRI D   RG++ L  +KF VLDE D+ML IGF +D+E I+  V
Sbjct  253   QQIALSDGIDVVIGTPGRILDLKSRGSLRLDRIKFLVLDEADQMLEIGFKDDMEEIIRSV  312

Query  1033  ADVKQV-----QTLLFSATLQDWVKHIASKFLKPD-KKTVDI  1140
                 Q      QTLLFSAT+  WV+ IA  +L+ D +K VD+
Sbjct  313   CGDAQASNLDHQTLLFSATVPSWVQEIARNYLRADRRKDVDL  354



>ref|XP_007961426.1| PREDICTED: nucleolar RNA helicase 2 [Chlorocebus sabaeus]
Length=783

 Score =   194 bits (493),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 140/224 (63%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LK +G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  182   EQKEGAFSNFPISEETIKLLKGRGVTFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  241

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L +G  +  ++   GRPP VLVL PTRELA QV  DF      L +   C YG 
Sbjct  242   IPLIEKL-HGELQDRKR---GRPPQVLVLAPTRELANQVSKDFSDITKKLSV--ACFYGG  295

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDHI  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  296   TPYGGQFERMRNGIDILVGTPGRIKDHIQSGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  355

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++K   + VD+
Sbjct  356   ILSVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKSAYEQVDL  399



>ref|XP_009962090.1| PREDICTED: nucleolar RNA helicase 2-like, partial [Tyto alba]
Length=601

 Score =   192 bits (488),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 105/219 (48%), Positives = 136/219 (62%), Gaps = 9/219 (4%)
 Frame = +1

Query  493   AITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFVLPILE  672
             A +NF +S+     LKA+GI+ LF +Q  TF+ + DG D++ +ARTG GKT +F LP+ E
Sbjct  35    AFSNFPLSQNTISLLKAQGIKYLFPVQVRTFQPIYDGKDVIAQARTGTGKTFSFALPLTE  94

Query  673   SLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGNTPYAQ  852
              L +      R    GR P VLVL+PTRELA QV  DF+       L+  C YG TPY  
Sbjct  95    KLQSVSQDGRR----GRAPKVLVLVPTRELATQVARDFKNL--TRKLSVACFYGGTPYKA  148

Query  853   QEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEFILG--  1026
             Q   LK G+DI+VGTPGRIKDHI    ++L+S+K  VLDEVD ML +GF E VE ILG  
Sbjct  149   QLDLLKSGIDILVGTPGRIKDHIQNSKLELSSVKHVVLDEVDHMLDMGFAEQVEEILGCA  208

Query  1027  -KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
              K       QTLLFSAT   WV  +A K++K + + +D+
Sbjct  209   YKKGSENNPQTLLFSATCPRWVYDVAKKYMKDEYEQIDL  247



>emb|CEF97957.1| Helicase, C-terminal [Ostreococcus tauri]
Length=765

 Score =   194 bits (492),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/221 (48%), Positives = 140/221 (63%), Gaps = 6/221 (3%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             + DP  + NF +S+   +AL+ +G+++LF IQ       +DG D+VGRARTG GKTLAF 
Sbjct  98    DADPADVDNFGMSETTVQALRKRGVDALFPIQQAVLRPAMDGQDVVGRARTGTGKTLAFS  157

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             LP++E L +    +  +      P  +VL PTRELA QV  + E++  A  L + C+YG 
Sbjct  158   LPVIEKLLSNGRGSGGRGYRN--PKCIVLAPTRELAKQV--ENEIFITAPTLDTACVYGG  213

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TP  QQE KL+RGVDIVVGTPGRI D + R  +DL+ ++F VLDE D+ML +GF EDVE 
Sbjct  214   TPIGQQESKLRRGVDIVVGTPGRIMDLMNRRALDLSEIEFVVLDEADQMLNVGFEEDVEA  273

Query  1018  ILGKVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL      +  QT LFSAT+  WVK I  KFLK     VD+
Sbjct  274   ILHDCPAGR--QTFLFSATMPQWVKQITKKFLKAQHVVVDL  312



>ref|XP_006835901.1| PREDICTED: nucleolar RNA helicase 2 [Chrysochloris asiatica]
Length=787

 Score =   194 bits (492),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 107/224 (48%), Positives = 137/224 (61%), Gaps = 9/224 (4%)
 Frame = +1

Query  478   EEDPYAITNFRISKPLREALKAKGIESLFKIQAMTFEAVLDGTDMVGRARTGQGKTLAFV  657
             E+   A +NF IS+   + LKA+G+  LF IQA TF  V  G D++ +ARTG GKT +F 
Sbjct  184   EQKEGAFSNFPISEVTIKLLKARGVNFLFPIQAKTFHHVYSGKDLIAQARTGTGKTFSFA  243

Query  658   LPILESLTNGPAKATRKTGYGRPPSVLVLLPTRELALQVFTDFEMYGGALGLTSCCLYGN  837
             +P++E L        R    GR P VLVL PTRELA QV  DF      L +   C YG 
Sbjct  244   IPLIEKLQGELQDRKR----GRAPQVLVLAPTRELANQVSRDFSDITKKLAV--ACFYGG  297

Query  838   TPYAQQEMKLKRGVDIVVGTPGRIKDHIMRGNIDLTSLKFRVLDEVDEMLRIGFVEDVEF  1017
             TPY  Q  +++ G+DI+VGTPGRIKDH+  G +DLT LK  VLDEVD+ML +GF + VE 
Sbjct  298   TPYGGQLDRMRNGIDILVGTPGRIKDHLQNGKLDLTKLKHVVLDEVDQMLDMGFADQVEE  357

Query  1018  ILG---KVADVKQVQTLLFSATLQDWVKHIASKFLKPDKKTVDI  1140
             IL    K       QTLLFSAT   WV ++A K++KP  + VD+
Sbjct  358   ILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKPTYEQVDL  401



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3099660946280