BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2289

Length=762
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|O04916.1|ACOC_SOLTU  RecName: Full=Aconitate hydratase, cytopl...    498   6e-171   Solanum tuberosum [potatoes]
gb|KCW88792.1|  hypothetical protein EUGRSUZ_A01129                     499   4e-170   Eucalyptus grandis [rose gum]
sp|P49608.1|ACOC_CUCMA  RecName: Full=Aconitate hydratase, cytopl...    505   4e-170   Cucurbita maxima [Boston marrow]
ref|XP_008455442.1|  PREDICTED: aconitate hydratase, cytoplasmic        507   7e-170   Cucumis melo [Oriental melon]
gb|KDO54658.1|  hypothetical protein CISIN_1g001917mg                   501   1e-169   Citrus sinensis [apfelsine]
ref|XP_004144496.1|  PREDICTED: aconitate hydratase, cytoplasmic        505   3e-169   Cucumis sativus [cucumbers]
ref|XP_006447556.1|  hypothetical protein CICLE_v10014140mg             502   3e-169   
gb|KCW88791.1|  hypothetical protein EUGRSUZ_A01129                     499   6e-169   Eucalyptus grandis [rose gum]
gb|ADZ57218.1|  aconitase protein                                       501   7e-169   Litchi chinensis [litchi]
gb|KDO54661.1|  hypothetical protein CISIN_1g001917mg                   501   9e-169   Citrus sinensis [apfelsine]
gb|KDO54659.1|  hypothetical protein CISIN_1g001917mg                   501   1e-168   Citrus sinensis [apfelsine]
gb|KDO54660.1|  hypothetical protein CISIN_1g001917mg                   501   1e-168   Citrus sinensis [apfelsine]
gb|AAO62410.1|  aconitase                                               501   2e-168   Solanum pennellii
emb|CBE71058.1|  aconitate hydratase 2                                  500   2e-168   Citrus clementina [clementine]
ref|XP_012089852.1|  PREDICTED: aconitate hydratase, cytoplasmic        503   3e-168   Jatropha curcas
ref|XP_006447555.1|  hypothetical protein CICLE_v10014140mg             503   5e-168   Citrus clementina [clementine]
gb|AAP30039.1|  aconitase                                               499   7e-168   Solanum pennellii
ref|XP_009599619.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    502   7e-168   Nicotiana tomentosiformis
ref|XP_004243472.1|  PREDICTED: aconitate hydratase, cytoplasmic        502   1e-167   Solanum lycopersicum
gb|KDO54657.1|  hypothetical protein CISIN_1g001917mg                   502   1e-167   Citrus sinensis [apfelsine]
gb|KDO54656.1|  hypothetical protein CISIN_1g001917mg                   501   1e-167   Citrus sinensis [apfelsine]
ref|XP_006366590.1|  PREDICTED: aconitate hydratase 2, mitochondr...    501   2e-167   Solanum tuberosum [potatoes]
dbj|BAG16527.1|  putative aconitase                                     501   2e-167   Capsicum chinense [bonnet pepper]
ref|XP_009770911.1|  PREDICTED: aconitate hydratase, cytoplasmic        501   2e-167   Nicotiana sylvestris
ref|XP_011095404.1|  PREDICTED: putative aconitate hydratase, cyt...    501   2e-167   Sesamum indicum [beniseed]
ref|XP_009601350.1|  PREDICTED: aconitate hydratase, cytoplasmic        501   2e-167   Nicotiana tomentosiformis
ref|XP_009399225.1|  PREDICTED: putative aconitate hydratase, cyt...    500   3e-167   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002524184.1|  aconitase, putative                                500   4e-167   Ricinus communis
ref|XP_006351962.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    499   7e-167   Solanum tuberosum [potatoes]
ref|XP_010278679.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    499   1e-166   Nelumbo nucifera [Indian lotus]
gb|AAG28426.1|AF194945_1  cytosolic aconitase                           496   1e-166   Nicotiana tabacum [American tobacco]
ref|XP_010046497.1|  PREDICTED: aconitate hydratase, cytoplasmic        498   3e-166   Eucalyptus grandis [rose gum]
ref|XP_011048785.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    498   3e-166   Populus euphratica
ref|XP_011097878.1|  PREDICTED: putative aconitate hydratase, cyt...    495   4e-166   
ref|XP_010276105.1|  PREDICTED: aconitate hydratase, cytoplasmic        497   7e-166   Nelumbo nucifera [Indian lotus]
ref|XP_010533008.1|  PREDICTED: aconitate hydratase 2, mitochondr...    486   9e-166   
ref|XP_009769027.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    496   1e-165   Nicotiana sylvestris
ref|XP_004517086.1|  PREDICTED: aconitate hydratase 2, mitochondr...    496   1e-165   Cicer arietinum [garbanzo]
ref|XP_004251517.2|  PREDICTED: aconitate hydratase, cytoplasmic        496   2e-165   Solanum lycopersicum
ref|XP_012070836.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    489   3e-165   Jatropha curcas
gb|KDO62732.1|  hypothetical protein CISIN_1g001863mg                   489   3e-165   Citrus sinensis [apfelsine]
ref|XP_002278138.1|  PREDICTED: aconitate hydratase, cytoplasmic        496   3e-165   Vitis vinifera
gb|KJB60837.1|  hypothetical protein B456_009G327800                    491   7e-165   Gossypium raimondii
sp|Q6YZX6.1|ACOC_ORYSJ  RecName: Full=Putative aconitate hydratas...    491   7e-165   Oryza sativa Japonica Group [Japonica rice]
gb|KJB60836.1|  hypothetical protein B456_009G327800                    490   8e-165   Gossypium raimondii
ref|XP_002279260.1|  PREDICTED: aconitate hydratase, cytoplasmic        494   9e-165   Vitis vinifera
ref|XP_003605929.1|  Aconitate hydratase                                493   1e-164   Medicago truncatula
gb|ERM97865.1|  hypothetical protein AMTR_s00115p00015570               489   1e-164   Amborella trichopoda
gb|EEE68177.1|  hypothetical protein OsJ_26310                          492   2e-164   Oryza sativa Japonica Group [Japonica rice]
gb|KDO62733.1|  hypothetical protein CISIN_1g001863mg                   489   2e-164   Citrus sinensis [apfelsine]
ref|XP_010675721.1|  PREDICTED: putative aconitate hydratase, cyt...    494   2e-164   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009419582.1|  PREDICTED: putative aconitate hydratase, cyt...    493   4e-164   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU27339.1|  hypothetical protein MIMGU_mgv1a000710mg                493   5e-164   Erythranthe guttata [common monkey flower]
emb|CDP10817.1|  unnamed protein product                                493   5e-164   Coffea canephora [robusta coffee]
gb|AFW61054.1|  hypothetical protein ZEAMMB73_482448                    486   5e-164   
ref|XP_010929878.1|  PREDICTED: putative aconitate hydratase, cyt...    493   5e-164   Elaeis guineensis
ref|XP_004974379.1|  PREDICTED: putative aconitate hydratase, cyt...    489   7e-164   
gb|KJB50479.1|  hypothetical protein B456_008G173400                    492   7e-164   Gossypium raimondii
ref|XP_002321126.2|  hypothetical protein POPTR_0014s15170g             492   8e-164   Populus trichocarpa [western balsam poplar]
gb|KJB62848.1|  hypothetical protein B456_009G440000                    488   1e-163   Gossypium raimondii
gb|KJB60835.1|  hypothetical protein B456_009G327800                    491   2e-163   Gossypium raimondii
ref|XP_010450391.1|  PREDICTED: aconitate hydratase 2, mitochondr...    490   2e-163   Camelina sativa [gold-of-pleasure]
ref|XP_008804304.1|  PREDICTED: putative aconitate hydratase, cyt...    491   2e-163   Phoenix dactylifera
ref|XP_010412716.1|  PREDICTED: aconitate hydratase 2, mitochondr...    490   2e-163   
ref|XP_007132546.1|  hypothetical protein PHAVU_011G1037001g            486   2e-163   Phaseolus vulgaris [French bean]
ref|XP_011620315.1|  PREDICTED: aconitate hydratase, cytoplasmic        490   3e-163   Amborella trichopoda
gb|KHN41224.1|  Aconitate hydratase, cytoplasmic                        487   3e-163   Glycine soja [wild soybean]
emb|CBE71057.1|  aconitate hydratase 3                                  487   4e-163   Citrus clementina [clementine]
ref|XP_006376779.1|  aconitate hydratase family protein                 490   4e-163   Populus trichocarpa [western balsam poplar]
gb|AAC26045.1|  aconitase-iron regulated protein 1                      487   5e-163   Citrus limon [lemon]
ref|XP_003596988.1|  Aconitate hydratase                                489   7e-163   Medicago truncatula
ref|XP_006452377.1|  hypothetical protein CICLE_v10007338mg             489   7e-163   Citrus clementina [clementine]
ref|XP_003573387.2|  PREDICTED: putative aconitate hydratase, cyt...    489   9e-163   Brachypodium distachyon [annual false brome]
ref|XP_006828850.1|  PREDICTED: aconitate hydratase, cytoplasmic        488   9e-163   Amborella trichopoda
ref|XP_007045642.1|  Aconitase 3                                        489   1e-162   
ref|XP_003527493.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    488   1e-162   Glycine max [soybeans]
ref|XP_012070835.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    488   2e-162   Jatropha curcas
dbj|BAJ85661.1|  predicted protein                                      488   2e-162   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011047264.1|  PREDICTED: aconitate hydratase, cytoplasmic        488   2e-162   Populus euphratica
gb|KHG02134.1|  hypothetical protein F383_25649                         488   3e-162   Gossypium arboreum [tree cotton]
ref|XP_002445174.1|  hypothetical protein SORBIDRAFT_07g005390          487   4e-162   Sorghum bicolor [broomcorn]
gb|KJB62847.1|  hypothetical protein B456_009G440000                    487   4e-162   Gossypium raimondii
ref|XP_007217144.1|  hypothetical protein PRUPE_ppa000812mg             487   4e-162   Prunus persica
ref|XP_010440740.1|  PREDICTED: aconitate hydratase 2, mitochondr...    486   6e-162   Camelina sativa [gold-of-pleasure]
ref|XP_008676648.1|  PREDICTED: uncharacterized protein LOC100216...    486   6e-162   
ref|XP_002870438.1|  predicted protein                                  486   1e-161   Arabidopsis lyrata subsp. lyrata
ref|XP_010533007.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    486   2e-161   Tarenaya hassleriana [spider flower]
gb|KJB30565.1|  hypothetical protein B456_005G149700                    483   2e-161   Gossypium raimondii
ref|XP_006396145.1|  hypothetical protein EUTSA_v10002387mg             485   2e-161   Eutrema salsugineum [saltwater cress]
gb|AAD25640.1|  cytoplasmic aconitate hydratase                         482   3e-161   Arabidopsis thaliana [mouse-ear cress]
gb|KFK39331.1|  hypothetical protein AALP_AA3G230700                    484   3e-161   Arabis alpina [alpine rockcress]
ref|XP_002532564.1|  aconitase, putative                                485   3e-161   
gb|KHG25175.1|  Aconitate hydratase, cytoplasmic                        482   3e-161   Gossypium arboreum [tree cotton]
gb|ADD62592.1|  cytosolic aconitase                                     467   5e-161   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010488774.1|  PREDICTED: aconitate hydratase 2, mitochondrial    484   5e-161   Camelina sativa [gold-of-pleasure]
ref|XP_006592372.1|  PREDICTED: aconitate hydratase 2, mitochondr...    481   1e-160   Glycine max [soybeans]
gb|KJB30569.1|  hypothetical protein B456_005G149700                    483   1e-160   Gossypium raimondii
gb|KJB30566.1|  hypothetical protein B456_005G149700                    483   1e-160   Gossypium raimondii
gb|KHN21232.1|  Aconitate hydratase, cytoplasmic                        481   1e-160   Glycine soja [wild soybean]
ref|NP_178634.2|  aconitate hydratase 3                                 483   3e-160   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004287944.1|  PREDICTED: aconitate hydratase, cytoplasmic        481   6e-160   Fragaria vesca subsp. vesca
ref|XP_010467089.1|  PREDICTED: aconitate hydratase 2, mitochondr...    481   6e-160   Camelina sativa [gold-of-pleasure]
ref|XP_002883704.1|  hypothetical protein ARALYDRAFT_480186             481   7e-160   
ref|XP_003539865.1|  PREDICTED: aconitate hydratase 2, mitochondr...    481   7e-160   Glycine max [soybeans]
emb|CDP05740.1|  unnamed protein product                                482   8e-160   Coffea canephora [robusta coffee]
ref|XP_008379632.1|  PREDICTED: aconitate hydratase, cytoplasmic        481   1e-159   
ref|XP_004487412.1|  PREDICTED: aconitate hydratase 2, mitochondr...    480   2e-159   Cicer arietinum [garbanzo]
gb|EMT33022.1|  Putative aconitate hydratase, cytoplasmic               478   3e-159   
gb|EPS60517.1|  hypothetical protein M569_14286                         476   4e-159   Genlisea aurea
ref|XP_003543388.1|  PREDICTED: aconitate hydratase 2, mitochondr...    478   7e-159   Glycine max [soybeans]
gb|ADM34980.1|  cytosolic aconitase                                     476   8e-159   Pyrus pyrifolia [sha li]
gb|KHN36531.1|  Aconitate hydratase, cytoplasmic                        478   8e-159   Glycine soja [wild soybean]
ref|XP_008342002.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    478   1e-158   
emb|CDX93088.1|  BnaA03g38100D                                          478   1e-158   
emb|CDX97969.1|  BnaA06g07200D                                          478   1e-158   
ref|XP_009136177.1|  PREDICTED: aconitate hydratase 2, mitochondrial    478   1e-158   Brassica rapa
emb|CDY18054.1|  BnaC07g04160D                                          478   2e-158   Brassica napus [oilseed rape]
ref|XP_007149973.1|  hypothetical protein PHAVU_005G115100g             477   2e-158   Phaseolus vulgaris [French bean]
ref|XP_006296904.1|  hypothetical protein CARUB_v10012896mg             478   2e-158   Capsella rubella
ref|XP_009353280.1|  PREDICTED: aconitate hydratase, cytoplasmic        477   4e-158   Pyrus x bretschneideri [bai li]
ref|XP_002530635.1|  aconitase, putative                                474   4e-158   Ricinus communis
ref|XP_007046597.1|  Aconitase 1                                        474   4e-158   
gb|KCW56578.1|  hypothetical protein EUGRSUZ_I02307                     471   4e-158   Eucalyptus grandis [rose gum]
emb|CDY50945.1|  BnaC03g74450D                                          476   6e-158   Brassica napus [oilseed rape]
dbj|BAE98476.1|  aconitase like protein                                 454   7e-158   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010943467.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    476   8e-158   Elaeis guineensis
ref|XP_003540302.1|  PREDICTED: aconitate hydratase 2, mitochondr...    476   9e-158   Glycine max [soybeans]
ref|XP_002263337.1|  PREDICTED: aconitate hydratase 1                   473   2e-157   Vitis vinifera
ref|XP_004134842.1|  PREDICTED: aconitate hydratase                     472   2e-157   Cucumis sativus [cucumbers]
ref|XP_008440877.1|  PREDICTED: aconitate hydratase                     472   3e-157   Cucumis melo [Oriental melon]
emb|CBI24446.3|  unnamed protein product                                472   4e-157   Vitis vinifera
gb|KCW56576.1|  hypothetical protein EUGRSUZ_I02307                     471   8e-157   Eucalyptus grandis [rose gum]
ref|XP_010029634.1|  PREDICTED: aconitate hydratase 1                   471   8e-157   Eucalyptus grandis [rose gum]
gb|KJB48278.1|  hypothetical protein B456_008G061900                    471   1e-156   Gossypium raimondii
ref|XP_008800034.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    473   1e-156   Phoenix dactylifera
ref|XP_010918136.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    473   1e-156   Elaeis guineensis
ref|XP_009148490.1|  PREDICTED: aconitate hydratase 2, mitochondrial    473   2e-156   Brassica rapa
ref|XP_009787326.1|  PREDICTED: aconitate hydratase 2, mitochondr...    468   2e-156   Nicotiana sylvestris
ref|XP_011022256.1|  PREDICTED: aconitate hydratase 1                   468   6e-156   Populus euphratica
ref|XP_010266897.1|  PREDICTED: aconitate hydratase 1                   468   7e-156   Nelumbo nucifera [Indian lotus]
ref|XP_008785050.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    471   7e-156   Phoenix dactylifera
gb|KDO71348.1|  hypothetical protein CISIN_1g002610mg                   461   1e-155   Citrus sinensis [apfelsine]
ref|XP_008393748.1|  PREDICTED: aconitate hydratase 1-like              464   2e-155   
ref|XP_010526818.1|  PREDICTED: aconitate hydratase 1                   467   2e-155   Tarenaya hassleriana [spider flower]
ref|XP_009598331.1|  PREDICTED: aconitate hydratase 2, mitochondr...    466   2e-155   Nicotiana tomentosiformis
ref|XP_008363078.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    463   5e-155   
gb|KHG25176.1|  Aconitate hydratase, cytoplasmic                        467   5e-155   Gossypium arboreum [tree cotton]
ref|XP_006346211.1|  PREDICTED: aconitate hydratase 2, mitochondr...    468   6e-155   Solanum tuberosum [potatoes]
ref|XP_006380559.1|  hypothetical protein POPTR_0007s09260g             466   8e-155   Populus trichocarpa [western balsam poplar]
ref|XP_012088458.1|  PREDICTED: aconitate hydratase 1                   466   8e-155   Jatropha curcas
ref|XP_009384004.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    468   1e-154   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDO71347.1|  hypothetical protein CISIN_1g002610mg                   462   2e-154   Citrus sinensis [apfelsine]
gb|KEH27599.1|  cytoplasmic-like aconitate hydratase                    461   2e-154   Medicago truncatula
gb|KDO71346.1|  hypothetical protein CISIN_1g002610mg                   461   4e-154   Citrus sinensis [apfelsine]
ref|XP_006412054.1|  hypothetical protein EUTSA_v10024358mg             459   5e-154   
ref|XP_009382046.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    466   5e-154   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008242011.1|  PREDICTED: aconitate hydratase 1                   463   7e-154   Prunus mume [ume]
ref|XP_009363442.1|  PREDICTED: aconitate hydratase 1-like              463   7e-154   Pyrus x bretschneideri [bai li]
ref|XP_007203240.1|  hypothetical protein PRUPE_ppa001138mg             463   7e-154   Prunus persica
ref|XP_009787319.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    466   7e-154   Nicotiana sylvestris
gb|EYU24785.1|  hypothetical protein MIMGU_mgv1a000742mg                466   8e-154   Erythranthe guttata [common monkey flower]
ref|XP_003537655.1|  PREDICTED: aconitate hydratase, cytoplasmic-...    463   9e-154   Glycine max [soybeans]
gb|KHN41868.1|  Aconitate hydratase 1                                   463   1e-153   Glycine soja [wild soybean]
ref|XP_010113288.1|  Aconitate hydratase 1                              465   1e-153   
ref|XP_006383042.1|  aconitate hydratase family protein                 462   1e-153   Populus trichocarpa [western balsam poplar]
ref|XP_009344825.1|  PREDICTED: aconitate hydratase 1                   462   2e-153   Pyrus x bretschneideri [bai li]
ref|XP_010437416.1|  PREDICTED: aconitate hydratase 1-like              462   2e-153   Camelina sativa [gold-of-pleasure]
ref|XP_004287770.1|  PREDICTED: aconitate hydratase 1                   462   2e-153   Fragaria vesca subsp. vesca
ref|XP_009337075.1|  PREDICTED: aconitate hydratase 1-like              462   2e-153   Pyrus x bretschneideri [bai li]
gb|KFK30197.1|  hypothetical protein AALP_AA7G230700                    462   2e-153   Arabis alpina [alpine rockcress]
ref|XP_011100304.1|  PREDICTED: aconitate hydratase, cytoplasmic        464   3e-153   Sesamum indicum [beniseed]
gb|KDO71345.1|  hypothetical protein CISIN_1g002610mg                   461   3e-153   Citrus sinensis [apfelsine]
ref|XP_009598330.1|  PREDICTED: aconitate hydratase, cytoplasmic ...    466   4e-153   Nicotiana tomentosiformis
ref|XP_003612247.1|  Aconitate hydratase                                461   4e-153   Medicago truncatula
ref|XP_006425366.1|  hypothetical protein CICLE_v10024840mg             461   5e-153   Citrus clementina [clementine]
gb|KDO71342.1|  hypothetical protein CISIN_1g002610mg                   461   5e-153   Citrus sinensis [apfelsine]
emb|CBE71056.1|  aconitate hydratase 1                                  461   5e-153   Citrus clementina [clementine]
ref|XP_006467022.1|  PREDICTED: aconitate hydratase 1                   461   5e-153   Citrus sinensis [apfelsine]
ref|XP_007157870.1|  hypothetical protein PHAVU_002G105000g             461   5e-153   Phaseolus vulgaris [French bean]
emb|CDY41626.1|  BnaC03g62580D                                          461   9e-153   Brassica napus [oilseed rape]
ref|XP_006412056.1|  hypothetical protein EUTSA_v10024358mg             460   1e-152   Eutrema salsugineum [saltwater cress]
emb|CDY24823.1|  BnaA08g14870D                                          461   1e-152   Brassica napus [oilseed rape]
ref|XP_003517155.1|  PREDICTED: aconitate hydratase 1                   460   1e-152   Glycine max [soybeans]
ref|XP_010446873.1|  PREDICTED: aconitate hydratase 1                   460   1e-152   Camelina sativa [gold-of-pleasure]
gb|KHN36000.1|  Aconitate hydratase, cytoplasmic                        460   2e-152   Glycine soja [wild soybean]
ref|XP_006285963.1|  hypothetical protein CARUB_v10007484mg             459   2e-152   Capsella rubella
ref|XP_010432222.1|  PREDICTED: aconitate hydratase 1-like              459   3e-152   Camelina sativa [gold-of-pleasure]
ref|XP_009150005.1|  PREDICTED: aconitate hydratase 1                   459   4e-152   Brassica rapa
ref|XP_008337967.1|  PREDICTED: aconitate hydratase 1                   459   4e-152   
emb|CDX75532.1|  BnaA01g01700D                                          459   5e-152   
ref|XP_004512178.1|  PREDICTED: aconitate hydratase 1-like              458   7e-152   Cicer arietinum [garbanzo]
emb|CDX69174.1|  BnaC01g02790D                                          458   8e-152   
ref|XP_009109264.1|  PREDICTED: aconitate hydratase 1-like              457   1e-151   Brassica rapa
ref|NP_001119125.1|  aconitate hydratase 1                              454   1e-151   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002869584.1|  hypothetical protein ARALYDRAFT_492099             458   5e-151   
ref|XP_010438674.1|  PREDICTED: aconitate hydratase 3, mitochondr...    451   2e-150   Camelina sativa [gold-of-pleasure]
ref|NP_195308.1|  aconitate hydratase 1                                 454   2e-150   Arabidopsis thaliana [mouse-ear cress]
emb|CAA58046.1|  aconitase                                              454   3e-150   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448188.1|  PREDICTED: aconitate hydratase 3, mitochondr...    455   9e-150   Camelina sativa [gold-of-pleasure]
ref|XP_010433420.1|  PREDICTED: aconitate hydratase 3, mitochondrial    455   1e-149   Camelina sativa [gold-of-pleasure]
gb|AFW61053.1|  hypothetical protein ZEAMMB73_482448                    444   1e-149   
gb|EEE58288.1|  hypothetical protein OsJ_09326                          452   2e-149   Oryza sativa Japonica Group [Japonica rice]
ref|NP_567763.2|  aconitase 2                                           454   2e-149   Arabidopsis thaliana [mouse-ear cress]
emb|CDY66424.1|  BnaAnng22230D                                          454   2e-149   Brassica napus [oilseed rape]
gb|KDO71343.1|  hypothetical protein CISIN_1g002610mg                   451   3e-149   Citrus sinensis [apfelsine]
sp|Q42669.1|ACOC_CUCMC  RecName: Full=Aconitate hydratase; Short=...    447   4e-149   Cucumis melo var. conomon [snake cucumber]
emb|CDY14291.1|  BnaA08g14220D                                          453   5e-149   Brassica napus [oilseed rape]
ref|XP_004985790.1|  PREDICTED: putative aconitate hydratase, cyt...    453   5e-149   Setaria italica
gb|EEC74472.1|  hypothetical protein OsI_09921                          453   5e-149   Oryza sativa Indica Group [Indian rice]
ref|NP_001048898.1|  Os03g0136900                                       453   6e-149   
ref|XP_006651017.1|  PREDICTED: putative aconitate hydratase, cyt...    450   8e-149   
gb|AAK91447.1|  AT4g26970/F10M23_310                                    452   1e-148   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109156.1|  PREDICTED: aconitate hydratase 3, mitochondrial    452   2e-148   Brassica rapa
ref|XP_006413121.1|  hypothetical protein EUTSA_v10024309mg             452   2e-148   Eutrema salsugineum [saltwater cress]
tpg|DAA43248.1|  TPA: hypothetical protein ZEAMMB73_889153              441   3e-148   
gb|KFK29204.1|  hypothetical protein AALP_AA7G102800                    451   5e-148   Arabis alpina [alpine rockcress]
tpg|DAA43249.1|  TPA: hypothetical protein ZEAMMB73_889153              441   6e-148   
ref|XP_006283068.1|  hypothetical protein CARUB_v10004061mg             450   1e-147   Capsella rubella
ref|XP_008230066.1|  PREDICTED: aconitate hydratase, cytoplasmic        449   2e-147   Prunus mume [ume]
ref|XP_003558862.1|  PREDICTED: putative aconitate hydratase, cyt...    448   4e-147   Brachypodium distachyon [annual false brome]
ref|XP_008670445.1|  PREDICTED: putative aconitate hydratase, cyt...    447   9e-147   Zea mays [maize]
dbj|BAJ92965.1|  predicted protein                                      446   3e-146   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002460765.1|  hypothetical protein SORBIDRAFT_02g034590          445   6e-146   Sorghum bicolor [broomcorn]
ref|XP_010033531.1|  PREDICTED: aconitate hydratase 1-like              442   1e-145   Eucalyptus grandis [rose gum]
ref|XP_006413195.1|  hypothetical protein EUTSA_v10024325mg             443   2e-145   
ref|XP_010529315.1|  PREDICTED: aconitate hydratase 1-like              441   2e-145   Tarenaya hassleriana [spider flower]
ref|NP_001159229.1|  uncharacterized protein LOC100304315               435   2e-145   
gb|KCW53221.1|  hypothetical protein EUGRSUZ_J02488                     442   4e-145   Eucalyptus grandis [rose gum]
gb|AAL13084.1|  putative aconitase                                      440   6e-145   Prunus avium [gean]
ref|XP_008670444.1|  PREDICTED: putative aconitate hydratase, cyt...    442   8e-145   Zea mays [maize]
gb|KHG08189.1|  hypothetical protein F383_11434                         439   2e-144   Gossypium arboreum [tree cotton]
ref|XP_002465901.1|  hypothetical protein SORBIDRAFT_01g047850          441   2e-144   Sorghum bicolor [broomcorn]
ref|XP_002991024.1|  hypothetical protein SELMODRAFT_132907             439   2e-144   
ref|XP_008344247.1|  PREDICTED: aconitate hydratase 1                   434   6e-144   
gb|KHG08190.1|  Aconitate hydratase 2, mitochondrial                    439   8e-144   Gossypium arboreum [tree cotton]
ref|XP_002991716.1|  hypothetical protein SELMODRAFT_133937             437   8e-144   
gb|KEH38306.1|  cytoplasmic-like aconitate hydratase                    436   1e-143   Medicago truncatula
dbj|BAD62409.1|  putative aconitate hydratase                           432   1e-143   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001136484.1|  uncharacterized protein LOC100216599               426   3e-143   
ref|XP_007020807.1|  Aconitase 3                                        435   3e-143   
ref|XP_008669747.1|  PREDICTED: putative aconitate hydratase, cyt...    435   7e-143   Zea mays [maize]
ref|NP_001147431.1|  aconitase2                                         434   1e-142   Zea mays [maize]
ref|XP_008661884.1|  PREDICTED: aconitase2 isoform X1                   434   3e-142   
ref|XP_008658754.1|  PREDICTED: uncharacterized protein LOC100304...    436   3e-142   
ref|XP_008669746.1|  PREDICTED: putative aconitate hydratase, cyt...    435   5e-142   Zea mays [maize]
gb|EMT03129.1|  Putative aconitate hydratase, cytoplasmic               449   5e-142   
gb|EEC83021.1|  hypothetical protein OsI_28098                          424   8e-142   Oryza sativa Indica Group [Indian rice]
emb|CDY56501.1|  BnaAnng14360D                                          434   1e-141   Brassica napus [oilseed rape]
ref|XP_010100637.1|  Aconitate hydratase                                432   2e-141   
gb|ACK56135.1|  putative aconitase                                      410   9e-141   Dimocarpus longan [longan]
gb|KGN48958.1|  Aconitase                                               428   1e-140   
gb|KHG24816.1|  Aconitate hydratase 1 -like protein                     426   2e-140   Gossypium arboreum [tree cotton]
ref|XP_001779205.1|  predicted protein                                  427   4e-140   
emb|CAN83844.1|  hypothetical protein VITISV_003004                     427   6e-140   Vitis vinifera
ref|NP_001057461.2|  Os06g0303400                                       421   4e-139   
ref|XP_002980554.1|  hypothetical protein SELMODRAFT_444572             424   2e-138   
ref|XP_002976825.1|  hypothetical protein SELMODRAFT_443331             424   3e-138   
ref|XP_001780674.1|  predicted protein                                  418   1e-136   
gb|KDO71344.1|  hypothetical protein CISIN_1g002610mg                   417   4e-136   Citrus sinensis [apfelsine]
gb|ABK25210.1|  unknown                                                 402   4e-134   Picea sitchensis
gb|KDO71349.1|  hypothetical protein CISIN_1g002610mg                   401   1e-133   Citrus sinensis [apfelsine]
gb|KJB17578.1|  hypothetical protein B456_003G006000                    409   5e-133   Gossypium raimondii
gb|EMT24311.1|  Putative aconitate hydratase, cytoplasmic               412   6e-133   
ref|XP_008355339.1|  PREDICTED: LOW QUALITY PROTEIN: aconitate hy...    395   8e-132   
gb|AES61065.2|  cytoplasmic-like aconitate hydratase                    405   1e-131   Medicago truncatula
ref|XP_003590814.1|  Aconitate hydratase                                405   3e-131   
gb|AFA36529.1|  aconitate hydratase 2                                   385   3e-131   Lolium perenne [perennial ryegrass]
gb|EMS62033.1|  Putative aconitate hydratase, cytoplasmic               405   7e-131   Triticum urartu
gb|EEE65577.1|  hypothetical protein OsJ_21080                          397   9e-131   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001770969.1|  predicted protein                                  403   1e-130   
emb|CAB36543.1|  putative aconitase                                     402   3e-130   Arabidopsis thaliana [mouse-ear cress]
gb|KJB62827.1|  hypothetical protein B456_009G438900                    389   2e-129   Gossypium raimondii
gb|ACR36825.1|  unknown                                                 380   1e-125   Zea mays [maize]
gb|AFW61052.1|  hypothetical protein ZEAMMB73_482448                    371   2e-124   
gb|KCW81855.1|  hypothetical protein EUGRSUZ_C03206                     371   4e-124   Eucalyptus grandis [rose gum]
ref|XP_002867051.1|  aconitate hydratase, cytoplasmic                   380   4e-122   
gb|ACP19662.1|  aconitase                                               357   1e-121   Glycine max [soybeans]
gb|KHG15607.1|  Aconitate hydratase 2, mitochondrial -like protein      354   3e-114   Gossypium arboreum [tree cotton]
ref|XP_001462506.1|  hypothetical protein                               346   5e-112   Paramecium tetraurelia strain d4-2
ref|XP_001637006.1|  predicted protein                                  347   2e-109   
gb|KHG18502.1|  Aconitate hydratase 2, mitochondrial -like protein      348   3e-109   
tpg|DAA49009.1|  TPA: hypothetical protein ZEAMMB73_412021              338   6e-109   
ref|XP_011411874.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    344   1e-108   
ref|XP_011411873.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    345   2e-108   
ref|XP_011411872.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    344   7e-108   
ref|XP_006823332.1|  PREDICTED: cytoplasmic aconitate hydratase         337   6e-107   
gb|ELU03714.1|  hypothetical protein CAPTEDRAFT_153788                  337   3e-106   
gb|EMT13756.1|  Aconitate hydratase 1                                   338   4e-106   
ref|XP_010482909.1|  PREDICTED: putative aconitate hydratase, cyt...    341   5e-106   
ref|XP_010443094.1|  PREDICTED: aconitate hydratase 3, mitochondr...    336   6e-106   
ref|XP_010443093.1|  PREDICTED: aconitate hydratase 3, mitochondr...    336   1e-105   
gb|AFI44047.1|  iron regulatory protein                                 337   3e-105   
ref|XP_010787893.1|  PREDICTED: cytoplasmic aconitate hydratase         329   4e-105   
ref|XP_009044065.1|  hypothetical protein LOTGIDRAFT_181349             335   1e-104   
ref|XP_010443085.1|  PREDICTED: aconitate hydratase 3, mitochondr...    336   2e-104   
ref|XP_011680420.1|  PREDICTED: cytoplasmic aconitate hydratase i...    334   3e-104   
gb|EJY70620.1|  Aconitate hydratase 1 family protein                    333   4e-104   
ref|XP_008433053.1|  PREDICTED: cytoplasmic aconitate hydratase         333   7e-104   
ref|XP_007543966.1|  PREDICTED: cytoplasmic aconitate hydratase i...    332   1e-103   
ref|XP_009495769.1|  cytoplasmic aconitate hydratase                    333   1e-103   
ref|XP_011680419.1|  PREDICTED: cytoplasmic aconitate hydratase i...    333   2e-103   
ref|XP_004575994.1|  PREDICTED: cytoplasmic aconitate hydratase-like    332   2e-103   
ref|XP_005754206.1|  PREDICTED: cytoplasmic aconitate hydratase-like    332   3e-103   
ref|XP_010746424.1|  PREDICTED: cytoplasmic aconitate hydratase         331   3e-103   
ref|XP_003459702.1|  PREDICTED: cytoplasmic aconitate hydratase         331   4e-103   
ref|XP_008666591.1|  PREDICTED: putative aconitate hydratase, cyt...    311   6e-103   
emb|CDW88502.1|  aconitate hydratase 1 family protein                   330   7e-103   
emb|CDW89012.1|  aconitate hydratase 1 family protein                   331   8e-103   
ref|XP_002111662.1|  hypothetical protein TRIADDRAFT_63287              329   2e-102   
ref|NP_001030155.1|  cytoplasmic aconitate hydratase                    328   4e-102   
ref|XP_005172430.1|  PREDICTED: cytoplasmic aconitate hydratase i...    328   4e-102   
ref|XP_008317436.1|  PREDICTED: cytoplasmic aconitate hydratase         328   5e-102   
ref|XP_004086812.1|  PREDICTED: cytoplasmic aconitate hydratase i...    328   6e-102   
ref|XP_007020811.1|  Aconitase 3                                        329   6e-102   
gb|EJY64435.1|  Aconitate hydratase 1 family protein                    328   9e-102   
ref|XP_001451848.1|  hypothetical protein                               327   2e-101   
ref|XP_011471732.1|  PREDICTED: cytoplasmic aconitate hydratase i...    324   1e-100   
ref|XP_007904798.1|  PREDICTED: cytoplasmic aconitate hydratase         323   3e-100   
ref|XP_011312352.1|  PREDICTED: cytoplasmic aconitate hydratase-like    322   6e-100   
ref|XP_008303429.1|  PREDICTED: cytoplasmic aconitate hydratase         322   6e-100   
ref|XP_006014028.1|  PREDICTED: cytoplasmic aconitate hydratase-like    314   7e-100   
ref|XP_010122172.1|  PREDICTED: cytoplasmic aconitate hydratase         317   8e-100   
gb|ACJ70654.1|  cytoplasmic aconitase/iron-regulatory protein           322   9e-100   
ref|NP_001135643.1|  cytoplasmic aconitate hydratase                    322   9e-100   
emb|CBY22746.1|  unnamed protein product                                322   1e-99    
gb|AFJ54573.1|  aconitase 1                                             315   2e-99    
gb|KFQ12070.1|  Cytoplasmic aconitate hydratase                         316   2e-99    
ref|XP_009927267.1|  PREDICTED: cytoplasmic aconitate hydratase         316   2e-99    
ref|XP_010013993.1|  PREDICTED: cytoplasmic aconitate hydratase         315   3e-99    
ref|XP_007255248.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    320   4e-99    
ref|XP_007440358.1|  PREDICTED: cytoplasmic aconitate hydratase-like    318   4e-99    
ref|XP_003966778.1|  PREDICTED: cytoplasmic aconitate hydratase         320   4e-99    
gb|KFQ42707.1|  Cytoplasmic aconitate hydratase                         315   4e-99    
ref|XP_008939123.1|  PREDICTED: cytoplasmic aconitate hydratase         319   9e-99    
gb|EAR86332.2|  cytoplasmic-like aconitate hydratase                    320   1e-98    
gb|AGC69746.1|  putative iron regulatory protein                        319   1e-98    
ref|XP_010965659.1|  PREDICTED: cytoplasmic aconitate hydratase i...    315   1e-98    
ref|XP_003747109.1|  PREDICTED: cytoplasmic aconitate hydratase         319   1e-98    
ref|XP_010974111.1|  PREDICTED: cytoplasmic aconitate hydratase i...    315   2e-98    
emb|CAF93695.1|  unnamed protein product                                319   2e-98    
gb|KFZ58431.1|  Cytoplasmic aconitate hydratase                         314   2e-98    
gb|KKA65835.1|  aco-1                                                   305   2e-98    
ref|XP_008545838.1|  PREDICTED: cytoplasmic aconitate hydratase-like    318   2e-98    
gb|KFQ08457.1|  Cytoplasmic aconitate hydratase                         315   3e-98    
ref|XP_009306687.1|  putative aconitase                                 318   3e-98    
ref|XP_009946591.1|  PREDICTED: cytoplasmic aconitate hydratase         315   3e-98    
ref|XP_006881316.1|  PREDICTED: cytoplasmic aconitate hydratase         318   3e-98    
ref|XP_003401470.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    317   4e-98    
ref|NP_001133702.1|  Iron-responsive element-binding protein 1          318   4e-98    
ref|XP_003487432.1|  PREDICTED: cytoplasmic aconitate hydratase-like    318   4e-98    
ref|XP_006629784.1|  PREDICTED: cytoplasmic aconitate hydratase-like    317   5e-98    
gb|AFJ54577.1|  aconitase 1                                             313   5e-98    
ref|XP_977148.1|  aconitate hydratase 1 family protein                  319   5e-98    
ref|XP_009818682.1|  PREDICTED: cytoplasmic aconitate hydratase         312   5e-98    
emb|CDQ69390.1|  unnamed protein product                                318   5e-98    
ref|XP_008166967.1|  PREDICTED: cytoplasmic aconitate hydratase         317   6e-98    
ref|XP_008882045.1|  aconitate hydratase ACN/IRP                        320   7e-98    
emb|CEF64620.1|  Cytoplasmic aconitate hydratase                        317   8e-98    
ref|XP_008849314.1|  PREDICTED: cytoplasmic aconitate hydratase         317   8e-98    
ref|XP_003283928.1|  hypothetical protein DICPUDRAFT_45137              317   8e-98    
ref|XP_005433002.1|  PREDICTED: cytoplasmic aconitate hydratase         317   9e-98    
gb|EPY75099.1|  cytoplasmic aconitate hydratase                         315   1e-97    
ref|XP_010288384.1|  PREDICTED: cytoplasmic aconitate hydratase         312   1e-97    
ref|XP_009898602.1|  PREDICTED: cytoplasmic aconitate hydratase         317   1e-97    
gb|EFA77648.1|  putative iron regulatory protein                        316   1e-97    
ref|XP_005234855.1|  PREDICTED: cytoplasmic aconitate hydratase         316   1e-97    
gb|KFG60936.1|  aconitate hydratase ACN/IRP                             319   1e-97    
ref|XP_011924721.1|  PREDICTED: cytoplasmic aconitate hydratase i...    314   1e-97    
ref|XP_011924722.1|  PREDICTED: cytoplasmic aconitate hydratase i...    314   1e-97    
gb|AFJ54570.1|  aconitase 1                                             314   1e-97    
gb|ESS32610.1|  aconitate hydratase ACN/IRP                             319   2e-97    
ref|XP_002366326.1|  aconitate hydratase, putative                      319   2e-97    
gb|KFG42597.1|  aconitate hydratase ACN/IRP                             319   2e-97    
gb|EPR62226.1|  aconitate hydratase ACN/IRP                             319   2e-97    
ref|XP_011835374.1|  PREDICTED: cytoplasmic aconitate hydratase i...    313   2e-97    
ref|XP_006975385.1|  PREDICTED: cytoplasmic aconitate hydratase         316   2e-97    
gb|KFH13093.1|  aconitate hydratase ACN/IRP                             319   2e-97    
ref|XP_003263352.1|  PREDICTED: cytoplasmic aconitate hydratase         316   2e-97    
ref|XP_001659032.1|  AAEL008216-PA                                      316   2e-97    
gb|AAR15297.1|  iron regulatory protein                                 316   2e-97    
ref|XP_009094283.1|  PREDICTED: cytoplasmic aconitate hydratase         316   2e-97    
ref|NP_509898.1|  Protein ACO-1                                         316   2e-97    
gb|AJQ30117.1|  aconitate hydratase 1                                   316   2e-97    
ref|XP_005530013.1|  PREDICTED: cytoplasmic aconitate hydratase         316   2e-97    
gb|EMP30789.1|  Cytoplasmic aconitate hydratase                         315   3e-97    
ref|XP_011871579.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    315   3e-97    
ref|XP_010576405.1|  PREDICTED: cytoplasmic aconitate hydratase         315   3e-97    
gb|KFQ88200.1|  Cytoplasmic aconitate hydratase                         313   3e-97    
ref|XP_007065257.1|  PREDICTED: cytoplasmic aconitate hydratase         315   3e-97    
gb|AAF99681.1|AF261088_1  iron regulatory protein 1                     313   3e-97    
ref|XP_011924719.1|  PREDICTED: cytoplasmic aconitate hydratase i...    313   3e-97    
ref|XP_003800343.1|  PREDICTED: cytoplasmic aconitate hydratase         315   3e-97    
ref|XP_011871581.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    315   3e-97    
ref|XP_008953722.1|  PREDICTED: cytoplasmic aconitate hydratase i...    312   3e-97    
ref|XP_011871580.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    316   3e-97    
ref|XP_010352748.1|  PREDICTED: cytoplasmic aconitate hydratase         315   4e-97    
gb|AAA69900.1|  iron-responsive regulatory protein/iron regulator...    313   4e-97    
ref|XP_011804047.1|  PREDICTED: cytoplasmic aconitate hydratase i...    315   4e-97    
ref|XP_003109738.1|  CRE-ACO-1 protein                                  315   4e-97    
gb|AAH05454.1|  Aconitase 1                                             315   5e-97    
ref|XP_010974110.1|  PREDICTED: cytoplasmic aconitate hydratase i...    315   5e-97    
ref|XP_010965658.1|  PREDICTED: cytoplasmic aconitate hydratase i...    315   5e-97    
ref|XP_005362039.1|  PREDICTED: cytoplasmic aconitate hydratase         315   5e-97    
gb|AFJ54576.1|  aconitase 1                                             311   5e-97    
gb|EFX65502.1|  putative aconitate hydratase 1                          315   6e-97    
gb|KFP65041.1|  Cytoplasmic aconitate hydratase                         314   6e-97    
gb|EFZ14973.1|  hypothetical protein SINV_01110                         315   6e-97    
ref|XP_006216897.1|  PREDICTED: cytoplasmic aconitate hydratase         315   6e-97    
ref|XP_004581280.1|  PREDICTED: cytoplasmic aconitate hydratase         313   6e-97    
ref|XP_009698540.1|  PREDICTED: cytoplasmic aconitate hydratase         314   6e-97    
ref|XP_005061122.1|  PREDICTED: cytoplasmic aconitate hydratase         314   6e-97    
ref|XP_007464993.1|  PREDICTED: cytoplasmic aconitate hydratase i...    314   7e-97    
ref|XP_001365420.1|  PREDICTED: cytoplasmic aconitate hydratase         314   7e-97    
ref|XP_011164631.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    314   7e-97    
ref|XP_011164630.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    314   7e-97    
ref|XP_005492744.1|  PREDICTED: cytoplasmic aconitate hydratase         314   7e-97    
ref|XP_005141537.1|  PREDICTED: cytoplasmic aconitate hydratase         314   7e-97    
ref|NP_001080577.1|  aconitase 1, soluble                               314   7e-97    
gb|KFM82338.1|  hypothetical protein X975_14216                         317   8e-97    
dbj|BAD92717.1|  aconitase 1 variant                                    312   8e-97    
ref|XP_010151037.1|  PREDICTED: cytoplasmic aconitate hydratase         314   8e-97    
ref|XP_009559475.1|  PREDICTED: cytoplasmic aconitate hydratase         314   8e-97    
ref|XP_004712473.1|  PREDICTED: cytoplasmic aconitate hydratase         313   8e-97    
ref|XP_011804046.1|  PREDICTED: cytoplasmic aconitate hydratase i...    315   8e-97    
ref|XP_007464992.1|  PREDICTED: cytoplasmic aconitate hydratase i...    314   8e-97    
ref|XP_005425054.1|  PREDICTED: cytoplasmic aconitate hydratase         314   9e-97    
gb|EGT30572.1|  CBN-ACO-1 protein                                       314   9e-97    
ref|XP_008517260.1|  PREDICTED: cytoplasmic aconitate hydratase         314   1e-96    
ref|XP_009485700.1|  PREDICTED: cytoplasmic aconitate hydratase         314   1e-96    
ref|XP_003911667.1|  PREDICTED: cytoplasmic aconitate hydratase         314   1e-96    
ref|XP_011746263.1|  PREDICTED: cytoplasmic aconitate hydratase         314   1e-96    
ref|XP_006913749.1|  PREDICTED: cytoplasmic aconitate hydratase-like    314   1e-96    
ref|XP_009646981.1|  PREDICTED: cytoplasmic aconitate hydratase         314   1e-96    
ref|NP_001244794.1|  cytoplasmic aconitate hydratase                    314   1e-96    
ref|XP_009883571.1|  PREDICTED: cytoplasmic aconitate hydratase         314   1e-96    
gb|EGV97063.1|  Cytoplasmic aconitate hydratase                         312   1e-96    
ref|XP_005581618.1|  PREDICTED: cytoplasmic aconitate hydratase i...    314   1e-96    
gb|AFJ54578.1|  aconitase 1                                             311   1e-96    
ref|NP_031412.2|  cytoplasmic aconitate hydratase                       314   1e-96    
ref|XP_011380734.1|  PREDICTED: cytoplasmic aconitate hydratase         314   1e-96    
ref|XP_001843386.1|  iron-responsive element-binding protein 1          314   1e-96    
ref|XP_009573519.1|  PREDICTED: cytoplasmic aconitate hydratase         313   1e-96    
ref|XP_008632753.1|  PREDICTED: cytoplasmic aconitate hydratase         313   1e-96    
gb|AFJ54571.1|  aconitase 1                                             311   1e-96    
ref|XP_010398395.1|  PREDICTED: cytoplasmic aconitate hydratase         313   1e-96    
gb|EZA62627.1|  Cytoplasmic aconitate hydratase                         311   1e-96    
ref|XP_011924723.1|  PREDICTED: cytoplasmic aconitate hydratase i...    313   1e-96    
gb|KFP56261.1|  Cytoplasmic aconitate hydratase                         313   1e-96    
ref|NP_001075784.1|  cytoplasmic aconitate hydratase                    313   2e-96    
ref|XP_007116533.1|  PREDICTED: cytoplasmic aconitate hydratase i...    313   2e-96    
ref|XP_009499933.1|  PREDICTED: cytoplasmic aconitate hydratase         313   2e-96    
ref|XP_005605105.1|  PREDICTED: cytoplasmic aconitate hydratase         313   2e-96    
ref|XP_005510592.1|  PREDICTED: cytoplasmic aconitate hydratase         313   2e-96    
gb|KFW89360.1|  Cytoplasmic aconitate hydratase                         313   2e-96    
gb|EHH24050.1|  hypothetical protein EGK_07631                          314   2e-96    
ref|XP_009075233.1|  PREDICTED: cytoplasmic aconitate hydratase         313   2e-96    
ref|XP_008246563.1|  PREDICTED: cytoplasmic aconitate hydratase i...    313   2e-96    
ref|XP_009283305.1|  PREDICTED: cytoplasmic aconitate hydratase         313   2e-96    
ref|XP_005184263.1|  PREDICTED: cytoplasmic aconitate hydratase         313   2e-96    
emb|CAD20353.1|  cytoplasmic aconitase                                  313   2e-96    
ref|XP_009942226.1|  PREDICTED: cytoplasmic aconitate hydratase         313   2e-96    
ref|XP_009327206.1|  PREDICTED: cytoplasmic aconitate hydratase         313   2e-96    
ref|XP_003830146.1|  PREDICTED: cytoplasmic aconitate hydratase i...    313   2e-96    
ref|XP_002194651.1|  PREDICTED: cytoplasmic aconitate hydratase         313   2e-96    
ref|NP_002188.1|  cytoplasmic aconitate hydratase                       313   2e-96    
pdb|2B3X|A  Chain A, Structure Of An Orthorhombic Crystal Form Of...    313   2e-96    
gb|AFJ54572.1|  aconitase 1                                             311   2e-96    
gb|AAA03251.1|  chimeric iron-responsive element-binding protein,...    313   2e-96    
ref|XP_009462533.1|  PREDICTED: cytoplasmic aconitate hydratase         313   2e-96    
emb|CAA43455.1|  iron response element binding protein                  313   2e-96    
ref|XP_007116532.1|  PREDICTED: cytoplasmic aconitate hydratase i...    313   3e-96    
ref|XP_011644750.1|  PREDICTED: cytoplasmic aconitate hydratase-like    313   3e-96    
ref|XP_009675962.1|  PREDICTED: cytoplasmic aconitate hydratase i...    312   3e-96    
ref|XP_006192563.1|  PREDICTED: cytoplasmic aconitate hydratase         313   3e-96    
gb|AFJ54574.1|  aconitase 1                                             310   3e-96    
gb|KFB40343.1|  AGAP007258-PA-like protein                              313   3e-96    
ref|NP_001126764.1|  cytoplasmic aconitate hydratase                    313   3e-96    
gb|EHH57327.1|  hypothetical protein EGM_06925                          313   3e-96    
ref|XP_006265526.1|  PREDICTED: cytoplasmic aconitate hydratase         312   4e-96    
ref|XP_011584460.1|  PREDICTED: cytoplasmic aconitate hydratase         312   4e-96    
gb|KDR18766.1|  Cytoplasmic aconitate hydratase                         312   4e-96    
ref|XP_005031316.1|  PREDICTED: cytoplasmic aconitate hydratase         312   4e-96    
ref|XP_009997773.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    312   4e-96    
gb|AFJ54569.1|  aconitase 1                                             310   4e-96    
ref|XP_009675961.1|  PREDICTED: cytoplasmic aconitate hydratase i...    312   4e-96    
ref|NP_001025707.1|  cytoplasmic aconitate hydratase                    312   4e-96    
ref|XP_003225327.2|  PREDICTED: cytoplasmic aconitate hydratase         312   5e-96    
ref|XP_001952191.1|  PREDICTED: cytoplasmic aconitate hydratase-like    312   5e-96    
ref|XP_007531304.1|  PREDICTED: cytoplasmic aconitate hydratase         312   5e-96    
ref|XP_006143153.1|  PREDICTED: cytoplasmic aconitate hydratase         312   5e-96    
ref|XP_006102185.1|  PREDICTED: LOW QUALITY PROTEIN: cytoplasmic ...    311   5e-96    
ref|XP_010611189.1|  PREDICTED: cytoplasmic aconitate hydratase         312   6e-96    
ref|XP_009986012.1|  PREDICTED: cytoplasmic aconitate hydratase         312   6e-96    
ref|XP_006609084.1|  PREDICTED: cytoplasmic aconitate hydratase-l...    312   6e-96    
ref|XP_010136118.1|  PREDICTED: cytoplasmic aconitate hydratase i...    312   6e-96    
ref|XP_005401176.1|  PREDICTED: cytoplasmic aconitate hydratase         312   6e-96    
ref|XP_008200453.1|  PREDICTED: cytoplasmic aconitate hydratase-like    312   6e-96    
ref|XP_010136119.1|  PREDICTED: cytoplasmic aconitate hydratase i...    312   6e-96    
ref|XP_002071941.1|  GK22582                                            312   7e-96    
ref|XP_004329499.1|  PREDICTED: cytoplasmic aconitate hydratase-like    311   7e-96    



>sp|O04916.1|ACOC_SOLTU RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase, partial [Solanum tuberosum]
 emb|CAA65735.1| aconitate hydratase [Solanum tuberosum]
Length=616

 Score =   498 bits (1282),  Expect = 6e-171, Method: Compositional matrix adjust.
 Identities = 236/254 (93%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL+YLKLTGRSDE V M+EAYLRANNMFVDYNEPQQE+VYSS L L
Sbjct  24   EYGATMGFFPVDHVTLEYLKLTGRSDEIVGMVEAYLRANNMFVDYNEPQQEKVYSSYLNL  83

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPCLSGPKRPHDRVPLKEMKSDWH+ LDNKVGFKGFAVPKE Q+KVAKFSFHGQP
Sbjct  84   DLADVEPCLSGPKRPHDRVPLKEMKSDWHALLDNKVGFKGFAVPKEVQDKVAKFSFHGQP  143

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY
Sbjct  144  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  203

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  204  LLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISENDIVAAAVLSGNRNFEGR  263

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  264  VHALTRANYLASPP  277



>gb|KCW88792.1| hypothetical protein EUGRSUZ_A01129 [Eucalyptus grandis]
Length=708

 Score =   499 bits (1284),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 234/254 (92%), Positives = 248/254 (98%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRAN +F+DY+EPQQERVYSS L+L
Sbjct  203  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANKLFIDYDEPQQERVYSSYLEL  262

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE+Q+KVAKFSFHGQP
Sbjct  263  NLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKESQDKVAKFSFHGQP  322

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  323  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWIKTSLAPGSGVVTKY  382

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV SAIS+NDI+AAAVLSGNRNFEGR
Sbjct  383  LLQSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVGSAISENDIIAAAVLSGNRNFEGR  442

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  443  VHPLTRANYLASPP  456



>sp|P49608.1|ACOC_CUCMA RecName: Full=Aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Cucurbita maxima]
 pir||T10101 aconitate hydratase (EC 4.2.1.3) - cucurbit
 dbj|BAA06108.1| aconitase [Cucurbita cv. Kurokawa Amakuri]
Length=898

 Score =   505 bits (1300),  Expect = 4e-170, Method: Compositional matrix adjust.
 Identities = 239/254 (94%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIEAYLRAN MFVDY EPQQE+VYSS LQL
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANKMFVDYKEPQQEKVYSSYLQL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA+PKEAQE VAKFSFHGQP
Sbjct  366  DLTDVEPCISGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAIPKEAQENVAKFSFHGQP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  426  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWVKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ YLNQQGFHIVGYGCTTCIGNSGDLDESVS+AISDNDIVAAAVLSGNRNFEGR
Sbjct  486  LLKSGLQPYLNQQGFHIVGYGCTTCIGNSGDLDESVSAAISDNDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_008455442.1| PREDICTED: aconitate hydratase, cytoplasmic [Cucumis melo]
Length=989

 Score =   507 bits (1306),  Expect = 7e-170, Method: Compositional matrix adjust.
 Identities = 239/254 (94%), Positives = 248/254 (98%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIEAYLRAN MFVDYNEPQQERVYSS LQL
Sbjct  397  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANKMFVDYNEPQQERVYSSYLQL  456

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA+PKEAQ+KVAKFSFHGQP
Sbjct  457  DLADVEPCISGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAIPKEAQDKVAKFSFHGQP  516

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAK+A ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  517  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKRACELGLQVKPWVKTSLAPGSGVVTKY  576

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ YLNQQGFHIVGYGCTTCIGNSGDLDESVS+AIS+NDIVAAAVLSGNRNFEGR
Sbjct  577  LLKSGLQPYLNQQGFHIVGYGCTTCIGNSGDLDESVSAAISENDIVAAAVLSGNRNFEGR  636

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  637  VHPLTRANYLASPP  650



>gb|KDO54658.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=795

 Score =   501 bits (1289),  Expect = 1e-169, Method: Compositional matrix adjust.
 Identities = 235/254 (93%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAM+E YLRAN MFVDYNEPQQERVYSS L+L
Sbjct  203  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMVEGYLRANKMFVDYNEPQQERVYSSYLEL  262

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE QEKV KFSFHGQP
Sbjct  263  NLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQEKVVKFSFHGQP  322

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  323  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWVKTSLAPGSGVVTKY  382

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+S I+DNDIVAAAVLSGNRNFEGR
Sbjct  383  LLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASTITDNDIVAAAVLSGNRNFEGR  442

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  443  VHPLTRANYLASPP  456



>ref|XP_004144496.1| PREDICTED: aconitate hydratase, cytoplasmic [Cucumis sativus]
 gb|KGN43521.1| hypothetical protein Csa_7G043630 [Cucumis sativus]
Length=989

 Score =   505 bits (1301),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 239/254 (94%), Positives = 248/254 (98%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIEAYLRAN MFVDYNEPQQERVYSS LQL
Sbjct  397  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANKMFVDYNEPQQERVYSSYLQL  456

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFA+PKEAQ+KVAKFSFHGQP
Sbjct  457  DLADVEPCISGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAIPKEAQDKVAKFSFHGQP  516

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  517  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWVKTSLAPGSGVVTKY  576

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ YLNQQGF+IVGYGCTTCIGNSGDLDESVS+AIS+NDIVAAAVLSGNRNFEGR
Sbjct  577  LLKSGLQPYLNQQGFNIVGYGCTTCIGNSGDLDESVSAAISENDIVAAAVLSGNRNFEGR  636

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  637  VHPLTRANYLASPP  650



>ref|XP_006447556.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 gb|ESR60796.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=888

 Score =   502 bits (1293),  Expect = 3e-169, Method: Compositional matrix adjust.
 Identities = 236/254 (93%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAM+E YLRAN MFVDYNEPQQERVYSS L+L
Sbjct  408  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMVEGYLRANKMFVDYNEPQQERVYSSYLEL  467

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE QEKV KFSFHGQP
Sbjct  468  NLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQEKVVKFSFHGQP  527

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  528  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWVKTSLAPGSGVVTKY  587

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+SAI+DNDIVAAAVLSGNRNFEGR
Sbjct  588  LLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASAITDNDIVAAAVLSGNRNFEGR  647

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  648  VHPLTRANYLASPP  661



>gb|KCW88791.1| hypothetical protein EUGRSUZ_A01129 [Eucalyptus grandis]
Length=795

 Score =   499 bits (1284),  Expect = 6e-169, Method: Compositional matrix adjust.
 Identities = 234/254 (92%), Positives = 248/254 (98%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRAN +F+DY+EPQQERVYSS L+L
Sbjct  203  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANKLFIDYDEPQQERVYSSYLEL  262

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE+Q+KVAKFSFHGQP
Sbjct  263  NLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKESQDKVAKFSFHGQP  322

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  323  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWIKTSLAPGSGVVTKY  382

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV SAIS+NDI+AAAVLSGNRNFEGR
Sbjct  383  LLQSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVGSAISENDIIAAAVLSGNRNFEGR  442

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  443  VHPLTRANYLASPP  456



>gb|ADZ57218.1| aconitase protein [Litchi chinensis]
Length=883

 Score =   501 bits (1291),  Expect = 7e-169, Method: Compositional matrix adjust.
 Identities = 236/254 (93%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIE YLRAN MFVDYNEPQQERVYSS L+L
Sbjct  291  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEGYLRANKMFVDYNEPQQERVYSSYLEL  350

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP
Sbjct  351  NLAEVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  410

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  411  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKTSLAPGSGVVTKY  470

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQEYLNQQGFHIVGYGCTTCIGNSG+LDESV+SAIS+ND+VAAAVLSGNRNFEGR
Sbjct  471  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGELDESVASAISENDVVAAAVLSGNRNFEGR  530

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  531  VHPLTRANYLASPP  544



>gb|KDO54661.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=876

 Score =   501 bits (1289),  Expect = 9e-169, Method: Compositional matrix adjust.
 Identities = 235/254 (93%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAM+E YLRAN MFVDYNEPQQERVYSS L+L
Sbjct  404  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMVEGYLRANKMFVDYNEPQQERVYSSYLEL  463

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE QEKV KFSFHGQP
Sbjct  464  NLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQEKVVKFSFHGQP  523

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  524  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWVKTSLAPGSGVVTKY  583

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+S I+DNDIVAAAVLSGNRNFEGR
Sbjct  584  LLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASTITDNDIVAAAVLSGNRNFEGR  643

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  644  VHPLTRANYLASPP  657



>gb|KDO54659.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=896

 Score =   501 bits (1291),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 235/254 (93%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAM+E YLRAN MFVDYNEPQQERVYSS L+L
Sbjct  404  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMVEGYLRANKMFVDYNEPQQERVYSSYLEL  463

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE QEKV KFSFHGQP
Sbjct  464  NLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQEKVVKFSFHGQP  523

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  524  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWVKTSLAPGSGVVTKY  583

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+S I+DNDIVAAAVLSGNRNFEGR
Sbjct  584  LLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASTITDNDIVAAAVLSGNRNFEGR  643

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  644  VHPLTRANYLASPP  657



>gb|KDO54660.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=902

 Score =   501 bits (1290),  Expect = 1e-168, Method: Compositional matrix adjust.
 Identities = 235/254 (93%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAM+E YLRAN MFVDYNEPQQERVYSS L+L
Sbjct  404  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMVEGYLRANKMFVDYNEPQQERVYSSYLEL  463

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE QEKV KFSFHGQP
Sbjct  464  NLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQEKVVKFSFHGQP  523

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  524  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWVKTSLAPGSGVVTKY  583

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+S I+DNDIVAAAVLSGNRNFEGR
Sbjct  584  LLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASTITDNDIVAAAVLSGNRNFEGR  643

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  644  VHPLTRANYLASPP  657



>gb|AAO62410.1| aconitase [Solanum pennellii]
Length=898

 Score =   501 bits (1289),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 237/254 (93%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV M+E+YLRANNMFVDY EPQQE+VYSS L L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDETVGMVESYLRANNMFVDYKEPQQEKVYSSYLNL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPCLSGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q+KVAKFSFHGQP
Sbjct  366  DLADVEPCLSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEVQDKVAKFSFHGQP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY
Sbjct  426  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  486  LLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISENDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  546  VHALTRANYLASPP  559



>emb|CBE71058.1| aconitate hydratase 2 [Citrus clementina]
Length=898

 Score =   500 bits (1288),  Expect = 2e-168, Method: Compositional matrix adjust.
 Identities = 235/254 (93%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDET+AM+E YLRAN MFVDYNEPQQERVYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDETLAMVEGYLRANKMFVDYNEPQQERVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE QEKV KFSFHGQP
Sbjct  366  NLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQEKVVKFSFHGQP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  426  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWVKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+SAI+DNDIVAAAVLSGNRNFEGR
Sbjct  486  LLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASAITDNDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_012089852.1| PREDICTED: aconitate hydratase, cytoplasmic [Jatropha curcas]
 gb|KDP22711.1| hypothetical protein JCGZ_01813 [Jatropha curcas]
Length=998

 Score =   503 bits (1295),  Expect = 3e-168, Method: Compositional matrix adjust.
 Identities = 236/254 (93%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRAN MFVDYNEPQQERVYSS LQL
Sbjct  406  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANKMFVDYNEPQQERVYSSYLQL  465

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCL+NKVGFKGFAVP E+Q+KVAKFSFHGQP
Sbjct  466  NLADVEPCISGPKRPHDRVPLKEMKADWHSCLNNKVGFKGFAVPNESQDKVAKFSFHGQP  525

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  526  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKTSLAPGSGVVTKY  585

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQEYLNQQGFHIVGYGCTTCIGNSG+LDE+V+SAISDNDI+AAAVLSGNRNFEGR
Sbjct  586  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGELDETVASAISDNDIIAAAVLSGNRNFEGR  645

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  646  VHPLTRANYLASPP  659



>ref|XP_006447555.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
 ref|XP_006469685.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469686.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Citrus sinensis]
 gb|ESR60795.1| hypothetical protein CICLE_v10014140mg [Citrus clementina]
Length=1000

 Score =   503 bits (1294),  Expect = 5e-168, Method: Compositional matrix adjust.
 Identities = 236/254 (93%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAM+E YLRAN MFVDYNEPQQERVYSS L+L
Sbjct  408  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMVEGYLRANKMFVDYNEPQQERVYSSYLEL  467

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE QEKV KFSFHGQP
Sbjct  468  NLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQEKVVKFSFHGQP  527

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  528  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWVKTSLAPGSGVVTKY  587

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+SAI+DNDIVAAAVLSGNRNFEGR
Sbjct  588  LLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASAITDNDIVAAAVLSGNRNFEGR  647

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  648  VHPLTRANYLASPP  661



>gb|AAP30039.1| aconitase [Solanum pennellii]
Length=898

 Score =   499 bits (1285),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 236/254 (93%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV M+E+YLRANNMFVDY EPQQE+VYSS L L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDETVGMVESYLRANNMFVDYKEPQQEKVYSSYLNL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPCLSGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q+KVA+FSFHGQP
Sbjct  366  DLADVEPCLSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEVQDKVAEFSFHGQP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY
Sbjct  426  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  486  LLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISENDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  546  VHALTRANYLASPP  559



>ref|XP_009599619.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana tomentosiformis]
Length=985

 Score =   502 bits (1292),  Expect = 7e-168, Method: Compositional matrix adjust.
 Identities = 237/254 (93%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV MIEAYLRANNMFVDYNEPQ E+VYS+SL L
Sbjct  393  EYGATMGFFPVDHVTLQYLKLTGRSDETVEMIEAYLRANNMFVDYNEPQHEKVYSASLHL  452

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLKEMK DWHSCLDNKVGFKGFAVPK+AQEKV KFSFHGQ 
Sbjct  453  DLADVEPCVSGPKRPHDRVPLKEMKPDWHSCLDNKVGFKGFAVPKDAQEKVVKFSFHGQD  512

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGLH+KPWVKTSLAPGSGVVTKY
Sbjct  513  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLHIKPWVKTSLAPGSGVVTKY  572

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  573  LLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVASAISENDIVAAAVLSGNRNFEGR  632

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  633  VHPLTRANYLASPP  646



>ref|XP_004243472.1| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=995

 Score =   502 bits (1292),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 237/254 (93%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV M+E+YLRANNMFVDY EPQQE+VYSS L L
Sbjct  403  EYGATMGFFPVDHVTLQYLKLTGRSDETVGMVESYLRANNMFVDYKEPQQEKVYSSYLNL  462

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPCLSGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q+KVAKFSFHGQP
Sbjct  463  DLADVEPCLSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEVQDKVAKFSFHGQP  522

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY
Sbjct  523  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  582

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  583  LLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISENDIVAAAVLSGNRNFEGR  642

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  643  VHALTRANYLASPP  656



>gb|KDO54657.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   502 bits (1292),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 235/254 (93%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAM+E YLRAN MFVDYNEPQQERVYSS L+L
Sbjct  404  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMVEGYLRANKMFVDYNEPQQERVYSSYLEL  463

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE QEKV KFSFHGQP
Sbjct  464  NLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQEKVVKFSFHGQP  523

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  524  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWVKTSLAPGSGVVTKY  583

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+S I+DNDIVAAAVLSGNRNFEGR
Sbjct  584  LLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASTITDNDIVAAAVLSGNRNFEGR  643

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  644  VHPLTRANYLASPP  657



>gb|KDO54656.1| hypothetical protein CISIN_1g001917mg [Citrus sinensis]
Length=996

 Score =   501 bits (1291),  Expect = 1e-167, Method: Compositional matrix adjust.
 Identities = 235/254 (93%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAM+E YLRAN MFVDYNEPQQERVYSS L+L
Sbjct  404  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMVEGYLRANKMFVDYNEPQQERVYSSYLEL  463

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE QEKV KFSFHGQP
Sbjct  464  NLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQEKVVKFSFHGQP  523

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  524  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWVKTSLAPGSGVVTKY  583

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESV+S I+DNDIVAAAVLSGNRNFEGR
Sbjct  584  LLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVASTITDNDIVAAAVLSGNRNFEGR  643

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  644  VHPLTRANYLASPP  657



>ref|XP_006366590.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=997

 Score =   501 bits (1291),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 237/254 (93%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL+YLKLTGRSDE V M+EAYLRANNMFVDYNEPQQE+VYSS L L
Sbjct  405  EYGATMGFFPVDHVTLEYLKLTGRSDEIVGMVEAYLRANNMFVDYNEPQQEKVYSSYLNL  464

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPCLSGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q+KVAKFSFHGQP
Sbjct  465  DLADVEPCLSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEVQDKVAKFSFHGQP  524

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY
Sbjct  525  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  584

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  585  LLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISENDIVAAAVLSGNRNFEGR  644

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  645  VHALTRANYLASPP  658



>dbj|BAG16527.1| putative aconitase [Capsicum chinense]
Length=995

 Score =   501 bits (1290),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 237/254 (93%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV M+EAYLRANNMFVDYNEPQ E+VYSS L L
Sbjct  403  EYGATMGFFPVDHVTLQYLKLTGRSDETVGMVEAYLRANNMFVDYNEPQTEKVYSSYLNL  462

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q+KVAKFSFHGQP
Sbjct  463  DLADVEPCVSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEVQDKVAKFSFHGQP  522

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY
Sbjct  523  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  582

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  583  LLRSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISENDIVAAAVLSGNRNFEGR  642

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  643  VHALTRANYLASPP  656



>ref|XP_009770911.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana sylvestris]
Length=996

 Score =   501 bits (1290),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 237/254 (93%), Positives = 248/254 (98%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDET+AMIEAYLRAN MFVDYNEPQQE+VYSS L L
Sbjct  404  EYGATMGFFPVDHVTLQYLKLTGRSDETIAMIEAYLRANKMFVDYNEPQQEKVYSSYLDL  463

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DLV+VEPC+SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q+KVAKF FHGQP
Sbjct  464  DLVNVEPCVSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEVQDKVAKFDFHGQP  523

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY
Sbjct  524  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  583

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  584  LLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISENDIVAAAVLSGNRNFEGR  643

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  644  VHALTRANYLASPP  657



>ref|XP_011095404.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=1011

 Score =   501 bits (1290),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 236/254 (93%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRAN MFVDY+EPQQ+RVYSS L+L
Sbjct  419  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANKMFVDYSEPQQDRVYSSYLEL  478

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLK+MK+DWHSCLDNKVGFKGFAVPKE QEKV KFSFHGQP
Sbjct  479  DLADVEPCISGPKRPHDRVPLKDMKADWHSCLDNKVGFKGFAVPKEQQEKVVKFSFHGQP  538

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  539  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKTSLAPGSGVVTKY  598

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV+SAI+DND+VAAAVLSGNRNFEGR
Sbjct  599  LLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVASAIADNDLVAAAVLSGNRNFEGR  658

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  659  VHPLTRANYLASPP  672



>ref|XP_009601350.1| PREDICTED: aconitate hydratase, cytoplasmic [Nicotiana tomentosiformis]
Length=997

 Score =   501 bits (1289),  Expect = 2e-167, Method: Compositional matrix adjust.
 Identities = 237/254 (93%), Positives = 248/254 (98%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDET+AMIEAYLRAN MFVDYNEPQQE+VYSS L L
Sbjct  405  EYGATMGFFPVDHVTLQYLKLTGRSDETIAMIEAYLRANKMFVDYNEPQQEKVYSSYLDL  464

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DLV+VEPC+SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q+KVAKF FHGQP
Sbjct  465  DLVNVEPCVSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEVQDKVAKFDFHGQP  524

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY
Sbjct  525  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  584

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  585  LLKSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAISENDIVAAAVLSGNRNFEGR  644

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  645  VHALTRANYLASPP  658



>ref|XP_009399225.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=993

 Score =   500 bits (1288),  Expect = 3e-167, Method: Compositional matrix adjust.
 Identities = 235/254 (93%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV++IEAYLRAN MFVDYNEPQ+ERVYSS L+L
Sbjct  399  EYGATMGFFPVDHVTLQYLKLTGRSDETVSLIEAYLRANKMFVDYNEPQKERVYSSYLEL  458

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPK++QEKVAKF FHGQP
Sbjct  459  DLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKDSQEKVAKFDFHGQP  518

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPWVKTSLAPGSGVVTKY
Sbjct  519  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACQLGLQVKPWVKTSLAPGSGVVTKY  578

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESV++AISDNDIVAAAVLSGNRNFEGR
Sbjct  579  LLKSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVAAAISDNDIVAAAVLSGNRNFEGR  638

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  639  VHPLTRANYLASPP  652



>ref|XP_002524184.1| aconitase, putative [Ricinus communis]
 gb|EEF38199.1| aconitase, putative [Ricinus communis]
Length=997

 Score =   500 bits (1288),  Expect = 4e-167, Method: Compositional matrix adjust.
 Identities = 235/254 (93%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDET++MIE+YLRAN MFVDYNEPQQERVYSS LQL
Sbjct  404  EYGATMGFFPVDHVTLQYLKLTGRSDETISMIESYLRANKMFVDYNEPQQERVYSSYLQL  463

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL +VEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA+PKE QEKVAKFSFHGQP
Sbjct  464  DLGEVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAIPKEVQEKVAKFSFHGQP  523

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  524  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKTSLAPGSGVVTKY  583

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  584  LLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVASAISENDIVAAAVLSGNRNFEGR  643

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  644  VHALTRANYLASPP  657



>ref|XP_006351962.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Solanum tuberosum]
Length=981

 Score =   499 bits (1285),  Expect = 7e-167, Method: Compositional matrix adjust.
 Identities = 237/254 (93%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIEAYLRANNMFVDYNEPQ E+VYSS L L
Sbjct  389  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANNMFVDYNEPQHEKVYSSCLYL  448

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL +VEPC+SGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPK+AQEKV KFSFHGQ 
Sbjct  449  DLAEVEPCVSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKDAQEKVVKFSFHGQD  508

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGL+VKPWVKTSLAPGSGVVTKY
Sbjct  509  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLNVKPWVKTSLAPGSGVVTKY  568

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGFHIVGYGCTTCIGNSGDLDESVSSAIS+NDIVAAAVLSGNRNFEGR
Sbjct  569  LLQSGLQKYLNEQGFHIVGYGCTTCIGNSGDLDESVSSAISENDIVAAAVLSGNRNFEGR  628

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  629  VHPLTRANYLASPP  642



>ref|XP_010278679.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nelumbo nucifera]
Length=997

 Score =   499 bits (1285),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 234/254 (92%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRAN MFVDYNEPQQERVYSS L+L
Sbjct  405  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANKMFVDYNEPQQERVYSSYLEL  464

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLKEMK+DW SCLDNKVGFKGF+VPKE+Q KVAKFSFHGQP
Sbjct  465  DLADVEPCISGPKRPHDRVPLKEMKADWRSCLDNKVGFKGFSVPKESQNKVAKFSFHGQP  524

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  525  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAYELGLEVKPWIKTSLAPGSGVVTKY  584

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L QSGLQ+YLNQQGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDI+AAAVLSGNRNFEGR
Sbjct  585  LFQSGLQKYLNQQGFHIVGYGCTTCIGNSGELDESVASAISENDIIAAAVLSGNRNFEGR  644

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  645  VHPLTRANYLASPP  658



>gb|AAG28426.1|AF194945_1 cytosolic aconitase [Nicotiana tabacum]
Length=898

 Score =   496 bits (1277),  Expect = 1e-166, Method: Compositional matrix adjust.
 Identities = 235/254 (93%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV MIEAYLRAN MFVDY+EPQ E+VYSS L L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDETVEMIEAYLRANKMFVDYDEPQHEKVYSSCLHL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  VEPC+SGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPK+AQEKV KFSFHGQ 
Sbjct  366  DLAGVEPCVSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKDAQEKVVKFSFHGQD  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGLH+KPWVKTSLAPGSGVVTKY
Sbjct  426  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLHIKPWVKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  486  LLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVASAISENDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_010046497.1| PREDICTED: aconitate hydratase, cytoplasmic [Eucalyptus grandis]
Length=996

 Score =   498 bits (1282),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 234/254 (92%), Positives = 248/254 (98%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRAN +F+DY+EPQQERVYSS L+L
Sbjct  404  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANKLFIDYDEPQQERVYSSYLEL  463

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE+Q+KVAKFSFHGQP
Sbjct  464  NLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKESQDKVAKFSFHGQP  523

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  524  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWIKTSLAPGSGVVTKY  583

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV SAIS+NDI+AAAVLSGNRNFEGR
Sbjct  584  LLQSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVGSAISENDIIAAAVLSGNRNFEGR  643

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  644  VHPLTRANYLASPP  657



>ref|XP_011048785.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Populus euphratica]
Length=995

 Score =   498 bits (1281),  Expect = 3e-166, Method: Compositional matrix adjust.
 Identities = 235/254 (93%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRAN MFVDYNEPQ ERVYSS LQL
Sbjct  403  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANKMFVDYNEPQPERVYSSYLQL  462

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLKEMK+DWH+CL+NKVGFKGFAVPKEAQEKVAKFSFHGQP
Sbjct  463  DLADVEPCISGPKRPHDRVPLKEMKADWHACLNNKVGFKGFAVPKEAQEKVAKFSFHGQP  522

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  523  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLKVKPWIKTSLAPGSGVVTKY  582

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGF+IVGYGCTTCIGNSGDLDESV S IS+NDI+AAAVLSGNRNFEGR
Sbjct  583  LLQSGLQKYLNEQGFNIVGYGCTTCIGNSGDLDESVGSVISENDILAAAVLSGNRNFEGR  642

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  643  VHPLTRANYLASPP  656



>ref|XP_011097878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Sesamum 
indicum]
Length=898

 Score =   495 bits (1274),  Expect = 4e-166, Method: Compositional matrix adjust.
 Identities = 233/254 (92%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPL++MK+DWHS LD+KVGFKGFAVPKE Q+KV KFSFHGQP
Sbjct  366  DLGDVEPCVSGPKRPHDRVPLRDMKADWHSSLDSKVGFKGFAVPKEEQDKVVKFSFHGQP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  426  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDL+ESV+SAI+DND++AAAVLSGNRNFEGR
Sbjct  486  LLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLEESVASAIADNDLIAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_010276105.1| PREDICTED: aconitate hydratase, cytoplasmic [Nelumbo nucifera]
Length=992

 Score =   497 bits (1279),  Expect = 7e-166, Method: Compositional matrix adjust.
 Identities = 232/254 (91%), Positives = 248/254 (98%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRAN MFVDYNEPQQERVYSS L+L
Sbjct  400  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANKMFVDYNEPQQERVYSSYLEL  459

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFAVPK++Q+KVAKFSFHGQP
Sbjct  460  DLADVEPCISGPKRPHDRVPLKEMKADWHACLDNQVGFKGFAVPKDSQDKVAKFSFHGQP  519

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  520  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWIKTSLAPGSGVVTKY  579

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGL++YL+QQGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDI+AAAVLSGNRNFEGR
Sbjct  580  LLQSGLKKYLDQQGFHIVGYGCTTCIGNSGELDESVASAISENDIIAAAVLSGNRNFEGR  639

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  640  VHPLTRANYLASPP  653



>ref|XP_010533008.1| PREDICTED: aconitate hydratase 2, mitochondrial isoform X2 [Tarenaya 
hassleriana]
Length=658

 Score =   486 bits (1251),  Expect = 9e-166, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIE+YLRAN MFVDYNEPQQERVYSS L+L
Sbjct  66   EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIESYLRANKMFVDYNEPQQERVYSSYLEL  125

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  VEPC+SGPKRPHDRVPLKEMK+DWHSCLDN VGFKGFA+PKEAQ+KVAKFSF GQP
Sbjct  126  DLSGVEPCISGPKRPHDRVPLKEMKADWHSCLDNTVGFKGFAIPKEAQDKVAKFSFDGQP  185

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  186  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLKVKPWIKTSLAPGSGVVTKY  245

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQEYLN+QGFHIVGYGCTTCIGNSG+++ESV +AIS+NDIVAAAVLSGNRNFEGR
Sbjct  246  LAKSGLQEYLNEQGFHIVGYGCTTCIGNSGEINESVGAAISENDIVAAAVLSGNRNFEGR  305

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  306  VHPLTRANYLASPP  319



>ref|XP_009769027.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Nicotiana sylvestris]
Length=989

 Score =   496 bits (1278),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 235/254 (93%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV MIEAYLRAN MFVDY+EPQ E+VYSS L L
Sbjct  397  EYGATMGFFPVDHVTLQYLKLTGRSDETVEMIEAYLRANKMFVDYDEPQHEKVYSSCLHL  456

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  VEPC+SGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPK+AQEKV KFSFHGQ 
Sbjct  457  DLAGVEPCVSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKDAQEKVVKFSFHGQD  516

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGLH+KPWVKTSLAPGSGVVTKY
Sbjct  517  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLHIKPWVKTSLAPGSGVVTKY  576

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  577  LLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVASAISENDIVAAAVLSGNRNFEGR  636

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  637  VHPLTRANYLASPP  650



>ref|XP_004517086.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=979

 Score =   496 bits (1277),  Expect = 1e-165, Method: Compositional matrix adjust.
 Identities = 231/254 (91%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIE+YLRAN +FVDYNEPQQ+RVYSS L+L
Sbjct  387  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIESYLRANKLFVDYNEPQQDRVYSSYLEL  446

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA+PKEAQEKVAKF FHGQP
Sbjct  447  NLSEVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFAIPKEAQEKVAKFDFHGQP  506

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL +KPWVKTSLAPGSGVVTKY
Sbjct  507  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLRIKPWVKTSLAPGSGVVTKY  566

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGFHIVG+GCTTCIGNSGDLDESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  567  LLQSGLQKYLNEQGFHIVGFGCTTCIGNSGDLDESVASAISENDIVAAAVLSGNRNFEGR  626

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  627  VHPLTRANYLASPP  640



>ref|XP_004251517.2| PREDICTED: aconitate hydratase, cytoplasmic [Solanum lycopersicum]
Length=981

 Score =   496 bits (1276),  Expect = 2e-165, Method: Compositional matrix adjust.
 Identities = 236/254 (93%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIEAYLRANNMFVDYNEPQ E+VYSS L L
Sbjct  389  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANNMFVDYNEPQHEKVYSSCLYL  448

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL +VEPC+SGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPK+AQEKV KFSFHGQ 
Sbjct  449  DLAEVEPCVSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKDAQEKVVKFSFHGQH  508

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGL+VKPWVKTSLAPGSGVVTKY
Sbjct  509  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLNVKPWVKTSLAPGSGVVTKY  568

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGF+IVGYGCTTCIGNSGDLDESVSSAIS+NDIVAAAVLSGNRNFEGR
Sbjct  569  LLQSGLQKYLNEQGFNIVGYGCTTCIGNSGDLDESVSSAISENDIVAAAVLSGNRNFEGR  628

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  629  VHPLTRANYLASPP  642



>ref|XP_012070836.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X2 [Jatropha 
curcas]
Length=798

 Score =   489 bits (1260),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 227/254 (89%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDH TLQYLKLTGRSDETVAM+EAYLRAN MFVDYNEPQ+ER Y+S LQL
Sbjct  203  EYGATMGFFPVDHATLQYLKLTGRSDETVAMVEAYLRANKMFVDYNEPQEERAYTSYLQL  262

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLKEMK+DWHSCLD++VGFKGF VPKE Q+KVAKFSFHGQP
Sbjct  263  DLADVEPCVSGPKRPHDRVPLKEMKTDWHSCLDSRVGFKGFGVPKEEQDKVAKFSFHGQP  322

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGS+VIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  323  AELKHGSIVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWIKTSLAPGSGVVTKY  382

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L QSGLQ+YLNQQGFHIVGYGCTTCIGNSG+LD  V+SAISDNDI+AAAVLSGNRNFEGR
Sbjct  383  LEQSGLQKYLNQQGFHIVGYGCTTCIGNSGELDSEVASAISDNDIIAAAVLSGNRNFEGR  442

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  443  VHPLTRANYLASPP  456



>gb|KDO62732.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=795

 Score =   489 bits (1260),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 229/254 (90%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIE YLRAN MFVDYNEP+QER YSS LQL
Sbjct  203  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEEYLRANKMFVDYNEPEQERSYSSYLQL  262

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLK+MK+DWH+CL+N+VGFKGFAVPK+ Q+KVAKFSFHGQP
Sbjct  263  DLADVEPCISGPKRPHDRVPLKDMKADWHACLENQVGFKGFAVPKQEQDKVAKFSFHGQP  322

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  323  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKTSLAPGSGVVTKY  382

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L QSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV++AI++NDIVAAAVLSGNRNFEGR
Sbjct  383  LQQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVATAITENDIVAAAVLSGNRNFEGR  442

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  443  VHPLTRANYLASPP  456



>ref|XP_002278138.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI26642.3| unnamed protein product [Vitis vinifera]
Length=1009

 Score =   496 bits (1276),  Expect = 3e-165, Method: Compositional matrix adjust.
 Identities = 235/254 (93%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRAN MFVDYNEPQ ER YSS LQL
Sbjct  417  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANRMFVDYNEPQVERFYSSYLQL  476

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DW +CLDNKVGFKGFAVPKEAQ+KVAKFSFHGQP
Sbjct  477  NLEDVEPCMSGPKRPHDRVPLKEMKTDWKACLDNKVGFKGFAVPKEAQDKVAKFSFHGQP  536

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKASELGL VKPW+KTSLAPGSGVVTKY
Sbjct  537  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKASELGLEVKPWIKTSLAPGSGVVTKY  596

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV+SAIS+NDI+AAAVLSGNRNFEGR
Sbjct  597  LLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVASAISENDIIAAAVLSGNRNFEGR  656

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  657  VHALTRANYLASPP  670



>gb|KJB60837.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=865

 Score =   491 bits (1263),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 230/254 (91%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIE+YLRAN MFVDYNEPQQERVYSS L+L
Sbjct  398  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIESYLRANKMFVDYNEPQQERVYSSYLEL  457

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPL+EMKSDW+SCL+NK GFKGFAVPKEAQ+KVAKFSFHGQP
Sbjct  458  NLAEVEPCISGPKRPHDRVPLREMKSDWNSCLNNKAGFKGFAVPKEAQDKVAKFSFHGQP  517

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  518  AELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKTSLAPGSGVVTKY  577

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDIVA+AVLSGNRNFEGR
Sbjct  578  LLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISENDIVASAVLSGNRNFEGR  637

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  638  VHALTRANYLASPP  651



>sp|Q6YZX6.1|ACOC_ORYSJ RecName: Full=Putative aconitate hydratase, cytoplasmic; Short=Aconitase; 
AltName: Full=Citrate hydro-lyase [Oryza sativa 
Japonica Group]
 dbj|BAD05751.1| putative Aconitate hydratase [Oryza sativa Japonica Group]
Length=898

 Score =   491 bits (1265),  Expect = 7e-165, Method: Compositional matrix adjust.
 Identities = 233/254 (92%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL YLKLTGRSDETVAMIEAYLRAN MFVDYNEPQ ERVYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLDYLKLTGRSDETVAMIEAYLRANKMFVDYNEPQTERVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL +VEPC+SGPKRPHDRV LKEMKSDWHSCLDN+VGFKGFAVPKE Q+KV KF FHGQP
Sbjct  366  DLNEVEPCISGPKRPHDRVLLKEMKSDWHSCLDNRVGFKGFAVPKEQQDKVVKFDFHGQP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  426  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWVKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQEYLN+QGFH+VGYGCTTCIGNSGDLDESVS+AIS+ND+VAAAVLSGNRNFEGR
Sbjct  486  LLQSGLQEYLNKQGFHVVGYGCTTCIGNSGDLDESVSAAISENDVVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>gb|KJB60836.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=860

 Score =   490 bits (1262),  Expect = 8e-165, Method: Compositional matrix adjust.
 Identities = 230/254 (91%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIE+YLRAN MFVDYNEPQQERVYSS L+L
Sbjct  398  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIESYLRANKMFVDYNEPQQERVYSSYLEL  457

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPL+EMKSDW+SCL+NK GFKGFAVPKEAQ+KVAKFSFHGQP
Sbjct  458  NLAEVEPCISGPKRPHDRVPLREMKSDWNSCLNNKAGFKGFAVPKEAQDKVAKFSFHGQP  517

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  518  AELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKTSLAPGSGVVTKY  577

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDIVA+AVLSGNRNFEGR
Sbjct  578  LLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISENDIVASAVLSGNRNFEGR  637

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  638  VHALTRANYLASPP  651



>ref|XP_002279260.1| PREDICTED: aconitate hydratase, cytoplasmic [Vitis vinifera]
 emb|CBI28935.3| unnamed protein product [Vitis vinifera]
Length=987

 Score =   494 bits (1271),  Expect = 9e-165, Method: Compositional matrix adjust.
 Identities = 233/254 (92%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD VTLQYLKLTGRSDETVA+IEAYLRAN MFVD+NEPQQER YSS L+L
Sbjct  395  EYGATMGFFPVDRVTLQYLKLTGRSDETVALIEAYLRANKMFVDHNEPQQERAYSSYLEL  454

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DLV+VEPC+SGPKRPHDRV LKEMK DWHSCLDNKVGFKGFAVPKEAQ+KVAKFSFHGQP
Sbjct  455  DLVNVEPCVSGPKRPHDRVTLKEMKVDWHSCLDNKVGFKGFAVPKEAQDKVAKFSFHGQP  514

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  515  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  574

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLNQQGFHIVGYGCTTCIGNSG++DESV+SAI++NDIVAAAVLSGNRNFEGR
Sbjct  575  LLQSGLQKYLNQQGFHIVGYGCTTCIGNSGEIDESVASAITENDIVAAAVLSGNRNFEGR  634

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  635  VHPLTRANYLASPP  648



>ref|XP_003605929.1| Aconitate hydratase [Medicago truncatula]
 gb|AES88126.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   493 bits (1270),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 231/254 (91%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIE+YLRANN+FVDYNEPQQ+RVYSS L+L
Sbjct  387  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIESYLRANNLFVDYNEPQQDRVYSSYLEL  446

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA+PKEAQ KVAKF F+GQP
Sbjct  447  NLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFAIPKEAQGKVAKFDFNGQP  506

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  507  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQVKPWVKTSLAPGSGVVTKY  566

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGFHIVG+GCTTCIGNSGDL+ESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  567  LLQSGLQKYLNEQGFHIVGFGCTTCIGNSGDLNESVASAISENDIVAAAVLSGNRNFEGR  626

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  627  VHPLTRANYLASPP  640



>gb|ERM97865.1| hypothetical protein AMTR_s00115p00015570, partial [Amborella 
trichopoda]
Length=854

 Score =   489 bits (1260),  Expect = 1e-164, Method: Compositional matrix adjust.
 Identities = 230/254 (91%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIEAYLRAN MFVDY EPQ ERVYSS LQL
Sbjct  284  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANKMFVDYKEPQTERVYSSYLQL  343

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVE CLSGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE+Q+KV KFSFHG+P
Sbjct  344  DLADVETCLSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKESQDKVVKFSFHGKP  403

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVMLGAAL AKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  404  AEIKHGSVVIAAITSCTNTSNPSVMLGAALSAKKACELGLEVKPWIKTSLAPGSGVVTKY  463

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YL+QQGFHIVGYGCTTCIGNSG+LDESV+SAI+DND+VA+AVLSGNRNFEGR
Sbjct  464  LLQSGLQKYLDQQGFHIVGYGCTTCIGNSGELDESVASAIADNDLVASAVLSGNRNFEGR  523

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  524  VHPLTRANYLASPP  537



>gb|EEE68177.1| hypothetical protein OsJ_26310 [Oryza sativa Japonica Group]
Length=956

 Score =   492 bits (1267),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 233/254 (92%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL YLKLTGRSDETVAMIEAYLRAN MFVDYNEPQ ERVYSS L+L
Sbjct  364  EYGATMGFFPVDHVTLDYLKLTGRSDETVAMIEAYLRANKMFVDYNEPQTERVYSSYLEL  423

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL +VEPC+SGPKRPHDRV LKEMKSDWHSCLDN+VGFKGFAVPKE Q+KV KF FHGQP
Sbjct  424  DLNEVEPCISGPKRPHDRVLLKEMKSDWHSCLDNRVGFKGFAVPKEQQDKVVKFDFHGQP  483

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  484  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWVKTSLAPGSGVVTKY  543

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQEYLN+QGFH+VGYGCTTCIGNSGDLDESVS+AIS+ND+VAAAVLSGNRNFEGR
Sbjct  544  LLQSGLQEYLNKQGFHVVGYGCTTCIGNSGDLDESVSAAISENDVVAAAVLSGNRNFEGR  603

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  604  VHPLTRANYLASPP  617



>gb|KDO62733.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=875

 Score =   489 bits (1260),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 229/254 (90%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIE YLRAN MFVDYNEP+QER YSS LQL
Sbjct  410  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEEYLRANKMFVDYNEPEQERSYSSYLQL  469

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLK+MK+DWH+CL+N+VGFKGFAVPK+ Q+KVAKFSFHGQP
Sbjct  470  DLADVEPCISGPKRPHDRVPLKDMKADWHACLENQVGFKGFAVPKQEQDKVAKFSFHGQP  529

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  530  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKTSLAPGSGVVTKY  589

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L QSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV++AI++NDIVAAAVLSGNRNFEGR
Sbjct  590  LQQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVATAITENDIVAAAVLSGNRNFEGR  649

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  650  VHPLTRANYLASPP  663



>ref|XP_010675721.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Beta vulgaris 
subsp. vulgaris]
Length=1015

 Score =   494 bits (1271),  Expect = 2e-164, Method: Compositional matrix adjust.
 Identities = 232/254 (91%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL+YLKLTGRSD+TV+MIE YLRAN MFVDYNEPQQERVYSS L+L
Sbjct  423  EYGATMGFFPVDHVTLEYLKLTGRSDDTVSMIEQYLRANKMFVDYNEPQQERVYSSYLEL  482

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLKEMK DWHSCL++KVGFKGFA+PKE QEKVAKFSFHGQP
Sbjct  483  DLADVEPCISGPKRPHDRVPLKEMKDDWHSCLNSKVGFKGFAIPKEEQEKVAKFSFHGQP  542

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL VKPWVKTSLAPGSGVVTKY
Sbjct  543  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLEVKPWVKTSLAPGSGVVTKY  602

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ+YL+QQGF+IVGYGCTTCIGNSGDLDESVS+AI++NDIVAAAVLSGNRNFEGR
Sbjct  603  LLKSGLQKYLDQQGFNIVGYGCTTCIGNSGDLDESVSAAITENDIVAAAVLSGNRNFEGR  662

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  663  VHPLTRANYLASPP  676



>ref|XP_009419582.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Musa acuminata 
subsp. malaccensis]
Length=1003

 Score =   493 bits (1268),  Expect = 4e-164, Method: Compositional matrix adjust.
 Identities = 230/254 (91%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIEAYLRAN MFVDY EPQ+ERVYSS L+L
Sbjct  409  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANKMFVDYTEPQKERVYSSYLEL  468

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLKEMK+DWHSCLD+KVGFKGFAVPKE+QEK+ KF FHGQP
Sbjct  469  DLADVEPCISGPKRPHDRVPLKEMKADWHSCLDSKVGFKGFAVPKESQEKIVKFDFHGQP  528

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGS+VIAAITSCTNTSNP+VMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  529  AELKHGSLVIAAITSCTNTSNPNVMLGAGLVAKKACELGLQVKPWIKTSLAPGSGVVTKY  588

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQEYLNQQGF+IVGYGCTTCIGNSGDLDESV++AISDNDIVAAAVLSGNRNFEGR
Sbjct  589  LLKSGLQEYLNQQGFNIVGYGCTTCIGNSGDLDESVAAAISDNDIVAAAVLSGNRNFEGR  648

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  649  VHPLTRANYLASPP  662



>gb|EYU27339.1| hypothetical protein MIMGU_mgv1a000710mg [Erythranthe guttata]
Length=1010

 Score =   493 bits (1268),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 230/254 (91%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRAN MF+DYNEPQ+E+VYSS L L
Sbjct  418  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANRMFIDYNEPQEEKVYSSYLDL  477

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLK+MK DWHSCLDNK+GFKGFA+PKE QEKV KFSF+GQP
Sbjct  478  ELSDVEPCISGPKRPHDRVPLKDMKDDWHSCLDNKIGFKGFAIPKEKQEKVVKFSFNGQP  537

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  538  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKTSLAPGSGVVTKY  597

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLNQQGF+IVGYGCTTCIGNSGDLDESV+SAI+DND+VAAAVLSGNRNFEGR
Sbjct  598  LLQSGLQKYLNQQGFNIVGYGCTTCIGNSGDLDESVASAIADNDLVAAAVLSGNRNFEGR  657

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  658  VHPLTRANYLASPP  671



>emb|CDP10817.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   493 bits (1268),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 230/254 (91%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIE YLRANNMFVDYNEPQQER YSS L L
Sbjct  418  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEGYLRANNMFVDYNEPQQERAYSSYLSL  477

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLK+MK+DWH+CLDNKVGFKGFA+PKE Q K AKFSFHG+P
Sbjct  478  DLADVEPCISGPKRPHDRVPLKDMKADWHACLDNKVGFKGFAIPKEEQGKAAKFSFHGEP  537

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKASELGL VKPWVKTSLAPGSGVVTKY
Sbjct  538  AELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKASELGLQVKPWVKTSLAPGSGVVTKY  597

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLNQQGFHIVGYGCTTCIGNSG+LD++V+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  598  LLQSGLQKYLNQQGFHIVGYGCTTCIGNSGELDDTVASAISENDIVAAAVLSGNRNFEGR  657

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  658  VHALTRANYLASPP  671



>gb|AFW61054.1| hypothetical protein ZEAMMB73_482448 [Zea mays]
Length=797

 Score =   486 bits (1251),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL YLKLTGRSDETV+MIEAYLRAN MFVDYNEP  ER+YSS L+L
Sbjct  203  EYGATMGFFPVDHVTLDYLKLTGRSDETVSMIEAYLRANKMFVDYNEPPTERIYSSYLEL  262

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEP +SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q+KV KF FHGQP
Sbjct  263  NLDEVEPSMSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEQQDKVVKFDFHGQP  322

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  323  AEMKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKTSLAPGSGVVTKY  382

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVS+AI++ND+VAAAVLSGNRNFEGR
Sbjct  383  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSTAITENDVVAAAVLSGNRNFEGR  442

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  443  VHPLTRANYLASPP  456



>ref|XP_010929878.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Elaeis 
guineensis]
Length=1009

 Score =   493 bits (1268),  Expect = 5e-164, Method: Compositional matrix adjust.
 Identities = 230/254 (91%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIE+YLRANNMFVDY+EPQ ERVYSS L+L
Sbjct  415  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIESYLRANNMFVDYSEPQVERVYSSYLEL  474

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPK++Q+KV KFSFHGQP
Sbjct  475  DLTDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKDSQDKVVKFSFHGQP  534

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  535  AELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWIKTSLAPGSGVVTKY  594

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGL+ YLNQQGFH+VGYGCTTCIGNSGDLDESV++AIS+NDIVAAAVLSGNRNFEGR
Sbjct  595  LLKSGLENYLNQQGFHLVGYGCTTCIGNSGDLDESVAAAISENDIVAAAVLSGNRNFEGR  654

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  655  VHPLTRANYLASPP  668



>ref|XP_004974379.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=892

 Score =   489 bits (1258),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 231/254 (91%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL YLKLTGRSDETV+MIEAYLRAN MFVDYNEPQ ER+YSS L+L
Sbjct  391  EYGATMGFFPVDHVTLDYLKLTGRSDETVSMIEAYLRANKMFVDYNEPQPERIYSSYLEL  450

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL +VEP +SGPKRPHDRVPLK+MKSDWH+CLDNKVGFKGFAVPKE Q KV KF FHGQP
Sbjct  451  DLDEVEPSISGPKRPHDRVPLKDMKSDWHACLDNKVGFKGFAVPKEQQGKVVKFDFHGQP  510

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  511  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKTSLAPGSGVVTKY  570

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVS+AIS+ND+VAAAVLSGNRNFEGR
Sbjct  571  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSAAISENDVVAAAVLSGNRNFEGR  630

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  631  VHPLTRANYLASPP  644



>gb|KJB50479.1| hypothetical protein B456_008G173400 [Gossypium raimondii]
Length=996

 Score =   492 bits (1266),  Expect = 7e-164, Method: Compositional matrix adjust.
 Identities = 231/254 (91%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIE+YLRANNMFVDY+EPQQ+RVYSS L+L
Sbjct  404  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIESYLRANNMFVDYDEPQQKRVYSSYLEL  463

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPL+EMK+DW+SCL+NKVGFKGFAVPKEAQ KVAKFSFHGQP
Sbjct  464  NLAEVEPCISGPKRPHDRVPLREMKADWNSCLNNKVGFKGFAVPKEAQGKVAKFSFHGQP  523

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  524  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKTSLAPGSGVVTKY  583

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQEYLN+QGFHIVGYGCTTCIGNSGDLDESV+SAIS+NDI+AAAVLSGNRNFEGR
Sbjct  584  LLQSGLQEYLNKQGFHIVGYGCTTCIGNSGDLDESVASAISENDIIAAAVLSGNRNFEGR  643

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  644  VHALTRANYLASPP  657



>ref|XP_002321126.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
 gb|EEE99441.2| hypothetical protein POPTR_0014s15170g [Populus trichocarpa]
Length=999

 Score =   492 bits (1266),  Expect = 8e-164, Method: Compositional matrix adjust.
 Identities = 232/254 (91%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVA IEAYLRAN MFVDY+EPQ ERVYSS LQL
Sbjct  407  EYGATMGFFPVDHVTLQYLKLTGRSDETVARIEAYLRANKMFVDYDEPQAERVYSSYLQL  466

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPL+EMK+DWHSCL NKVGFKGFAVPKEAQ+KVAKFSFHGQP
Sbjct  467  DLADVEPCVSGPKRPHDRVPLREMKADWHSCLSNKVGFKGFAVPKEAQDKVAKFSFHGQP  526

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  527  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLKVKPWIKTSLAPGSGVVTKY  586

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+Y N+QGFHIVGYGCTTCIGNSGDLDESV+SAIS+NDI+AAAVLSGNRNFEGR
Sbjct  587  LQKSGLQKYFNEQGFHIVGYGCTTCIGNSGDLDESVASAISENDILAAAVLSGNRNFEGR  646

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  647  VHPLTRANYLASPP  660



>gb|KJB62848.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=864

 Score =   488 bits (1255),  Expect = 1e-163, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIEAYLRAN MFVDY+EPQQER YSS LQL
Sbjct  401  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANKMFVDYDEPQQERAYSSYLQL  460

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN VGFKGFAVPKE Q KVAKF+FHG P
Sbjct  461  DLAEVEPCISGPKRPHDRVPLKEMKADWHACLDNNVGFKGFAVPKEEQNKVAKFTFHGLP  520

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  521  AELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAYELGLEVKPWIKTSLAPGSGVVTKY  580

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLNQQGF+IVGYGCTTCIGNSG+LDESV+SAIS+NDI+AAAVLSGNRNFEGR
Sbjct  581  LLQSGLQKYLNQQGFNIVGYGCTTCIGNSGELDESVASAISENDIIAAAVLSGNRNFEGR  640

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  641  VHPLTRANYLASPP  654



>gb|KJB60835.1| hypothetical protein B456_009G327800 [Gossypium raimondii]
Length=990

 Score =   491 bits (1263),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 230/254 (91%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIE+YLRAN MFVDYNEPQQERVYSS L+L
Sbjct  398  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIESYLRANKMFVDYNEPQQERVYSSYLEL  457

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPL+EMKSDW+SCL+NK GFKGFAVPKEAQ+KVAKFSFHGQP
Sbjct  458  NLAEVEPCISGPKRPHDRVPLREMKSDWNSCLNNKAGFKGFAVPKEAQDKVAKFSFHGQP  517

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  518  AELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKTSLAPGSGVVTKY  577

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDIVA+AVLSGNRNFEGR
Sbjct  578  LLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISENDIVASAVLSGNRNFEGR  637

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  638  VHALTRANYLASPP  651



>ref|XP_010450391.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=980

 Score =   490 bits (1262),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 231/254 (91%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDY+EPQQERVYSS L+L
Sbjct  388  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYSEPQQERVYSSYLEL  447

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L  VEPC+SGPKRPHDRVPLKEMK+DWHSCLD+KVGFKGFA+PKEAQEKVAKFSF+GQP
Sbjct  448  NLDSVEPCISGPKRPHDRVPLKEMKADWHSCLDSKVGFKGFAIPKEAQEKVAKFSFNGQP  507

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW KTSLAPGSGVVTKY
Sbjct  508  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWTKTSLAPGSGVVTKY  567

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ+YLNQQGF+IVGYGCTTCIGNSG++DESV +AI++NDIVAAAVLSGNRNFEGR
Sbjct  568  LLKSGLQKYLNQQGFNIVGYGCTTCIGNSGEIDESVGAAITENDIVAAAVLSGNRNFEGR  627

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  628  VHPLTRANYLASPP  641



>ref|XP_008804304.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Phoenix 
dactylifera]
Length=1010

 Score =   491 bits (1264),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 229/254 (90%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIE+YLRAN MFVDY EPQ ERVYSS L+L
Sbjct  416  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIESYLRANKMFVDYREPQVERVYSSYLEL  475

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPK++Q+KV KFSFHGQP
Sbjct  476  DLTDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKDSQDKVVKFSFHGQP  535

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA E+GL VKPW+KTSLAPGSGVVTKY
Sbjct  536  AELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACEVGLEVKPWIKTSLAPGSGVVTKY  595

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ YLNQQGFHIVGYGCTTCIGNSGDLDESV++A+S+NDIVAAAVLSGNRNFEGR
Sbjct  596  LLKSGLQNYLNQQGFHIVGYGCTTCIGNSGDLDESVAAAVSENDIVAAAVLSGNRNFEGR  655

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  656  VHPLTRANYLASPP  669



>ref|XP_010412716.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=991

 Score =   490 bits (1262),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 230/254 (91%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDY+EPQQERVYSS L+L
Sbjct  399  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYSEPQQERVYSSYLEL  458

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L  VEPC+SGPKRPHDRVPLKEMK+DWHSCLD+KVGFKGFA+PKEAQEKVAKFSF+GQP
Sbjct  459  NLDSVEPCISGPKRPHDRVPLKEMKADWHSCLDSKVGFKGFAIPKEAQEKVAKFSFNGQP  518

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKAS+LGL VKPW+KTSLAPGSGVVTKY
Sbjct  519  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKASDLGLQVKPWIKTSLAPGSGVVTKY  578

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQEYLN QGFHIVGYGCTTCIGNSG+++ESV +AI++NDIVAAAVLSGNRNFEGR
Sbjct  579  LLKSGLQEYLNHQGFHIVGYGCTTCIGNSGEINESVGAAITENDIVAAAVLSGNRNFEGR  638

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  639  VHPLTRANYLASPP  652



>ref|XP_007132546.1| hypothetical protein PHAVU_011G1037001g, partial [Phaseolus vulgaris]
 gb|ESW04540.1| hypothetical protein PHAVU_011G1037001g, partial [Phaseolus vulgaris]
Length=846

 Score =   486 bits (1251),  Expect = 2e-163, Method: Compositional matrix adjust.
 Identities = 229/254 (90%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIE+YLR N +FVDYNEPQQERVYSS L+L
Sbjct  390  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIESYLRENKLFVDYNEPQQERVYSSYLEL  449

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK DWH+CLDN VGFKGFA+PKEAQ KVAKF+FHGQP
Sbjct  450  NLSDVEPCISGPKRPHDRVPLKEMKDDWHACLDNNVGFKGFAIPKEAQGKVAKFNFHGQP  509

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  510  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQVKPWVKTSLAPGSGVVTKY  569

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L QSGLQ+YLN+QGFHIVG+GCTTCIGNSG+L+ESVSSAIS+NDIVAAAVLSGNRNFEGR
Sbjct  570  LHQSGLQKYLNEQGFHIVGFGCTTCIGNSGELNESVSSAISENDIVAAAVLSGNRNFEGR  629

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  630  VHPLTRANYLASPP  643



>ref|XP_011620315.1| PREDICTED: aconitate hydratase, cytoplasmic [Amborella trichopoda]
Length=997

 Score =   490 bits (1262),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 230/254 (91%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIEAYLRAN MFVDY EPQ ERVYSS LQL
Sbjct  402  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANKMFVDYKEPQTERVYSSYLQL  461

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVE CLSGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE+Q+KV KFSFHG+P
Sbjct  462  DLADVETCLSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKESQDKVVKFSFHGKP  521

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVMLGAAL AKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  522  AEIKHGSVVIAAITSCTNTSNPSVMLGAALSAKKACELGLEVKPWIKTSLAPGSGVVTKY  581

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YL+QQGFHIVGYGCTTCIGNSG+LDESV+SAI+DND+VA+AVLSGNRNFEGR
Sbjct  582  LLQSGLQKYLDQQGFHIVGYGCTTCIGNSGELDESVASAIADNDLVASAVLSGNRNFEGR  641

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  642  VHPLTRANYLASPP  655



>gb|KHN41224.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=903

 Score =   487 bits (1254),  Expect = 3e-163, Method: Compositional matrix adjust.
 Identities = 229/254 (90%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIE+YLRAN +FVDYNEPQQ+RVYSS L+L
Sbjct  311  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIESYLRANKLFVDYNEPQQDRVYSSYLEL  370

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA+PKEAQ KVAKF FHGQP
Sbjct  371  NLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFAIPKEAQGKVAKFDFHGQP  430

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  431  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLKVKPWVKTSLAPGSGVVTKY  490

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGFHIVG+GCTTCIGNSG+LDESV+SAIS+ND+VAAAVLSGNRNFEGR
Sbjct  491  LLQSGLQKYLNEQGFHIVGFGCTTCIGNSGELDESVASAISENDVVAAAVLSGNRNFEGR  550

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  551  VHALTRANYLASPP  564



>emb|CBE71057.1| aconitate hydratase 3 [Citrus clementina]
Length=898

 Score =   487 bits (1254),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIE YLRAN MFVDYN+P+QER YSS LQL
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEEYLRANKMFVDYNKPEQERSYSSYLQL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLK+MK+DWH+CL+N+VGFKGFAVPK+ Q+KVAKFSFHGQP
Sbjct  366  DLADVEPCISGPKRPHDRVPLKDMKADWHACLENQVGFKGFAVPKQEQDKVAKFSFHGQP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  426  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L QSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV++AI++NDIVAAAVLSGNRNFEGR
Sbjct  486  LQQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVATAITENDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_006376779.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP54576.1| aconitate hydratase family protein [Populus trichocarpa]
Length=995

 Score =   490 bits (1261),  Expect = 4e-163, Method: Compositional matrix adjust.
 Identities = 230/254 (91%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRAN MFVDYNEPQ ERVYS+ LQL
Sbjct  403  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANKMFVDYNEPQPERVYSAYLQL  462

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLKEMK+DWH+CL+NKVGFKGFAVPKEAQ+KVAKFSFHGQP
Sbjct  463  DLADVEPCISGPKRPHDRVPLKEMKADWHACLNNKVGFKGFAVPKEAQDKVAKFSFHGQP  522

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  523  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLKVKPWIKTSLAPGSGVVTKY  582

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGF+IVGYGCTTCIGNSGDLDESV + I++NDI+AAAVLSGNRNFEGR
Sbjct  583  LLQSGLQKYLNEQGFNIVGYGCTTCIGNSGDLDESVGAVITENDILAAAVLSGNRNFEGR  642

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  643  VHALTRANYLASPP  656



>gb|AAC26045.1| aconitase-iron regulated protein 1 [Citrus limon]
Length=898

 Score =   487 bits (1253),  Expect = 5e-163, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIE YLRAN MFVDYN+P+QER YSS LQL
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEEYLRANKMFVDYNKPEQERSYSSYLQL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLK+MK+DWH+CL+N+VGFKGFAVPK+ Q+KVAKFSFHGQP
Sbjct  366  DLADVEPCISGPKRPHDRVPLKDMKADWHACLENQVGFKGFAVPKQEQDKVAKFSFHGQP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  426  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L QSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV++AI++NDIVAAAVLSGNRNFEGR
Sbjct  486  LQQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVATAITENDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_003596988.1| Aconitate hydratase [Medicago truncatula]
 gb|AES67239.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=979

 Score =   489 bits (1258),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 230/254 (91%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRAN +FVDYNEPQQ+R YSS L+L
Sbjct  387  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANKLFVDYNEPQQDRAYSSYLEL  446

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFA+PKEAQ KVAKF FHGQP
Sbjct  447  NLDEVEPCISGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAIPKEAQGKVAKFDFHGQP  506

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPWVKTSLAPGSGVVTKY
Sbjct  507  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHDLGLKVKPWVKTSLAPGSGVVTKY  566

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGF+IVG+GCTTCIGNSGDLDESV+SAIS+NDIVA+AVLSGNRNFEGR
Sbjct  567  LLQSGLQKYLNEQGFNIVGFGCTTCIGNSGDLDESVASAISENDIVASAVLSGNRNFEGR  626

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  627  VHPLTRANYLASPP  640



>ref|XP_006452377.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 ref|XP_006475065.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Citrus 
sinensis]
 gb|ESR65617.1| hypothetical protein CICLE_v10007338mg [Citrus clementina]
 gb|KDO62731.1| hypothetical protein CISIN_1g001863mg [Citrus sinensis]
Length=1002

 Score =   489 bits (1260),  Expect = 7e-163, Method: Compositional matrix adjust.
 Identities = 229/254 (90%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIE YLRAN MFVDYNEP+QER YSS LQL
Sbjct  410  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEEYLRANKMFVDYNEPEQERSYSSYLQL  469

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLK+MK+DWH+CL+N+VGFKGFAVPK+ Q+KVAKFSFHGQP
Sbjct  470  DLADVEPCISGPKRPHDRVPLKDMKADWHACLENQVGFKGFAVPKQEQDKVAKFSFHGQP  529

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  530  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKTSLAPGSGVVTKY  589

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L QSGLQ+YLNQQGFHIVGYGCTTCIGNSGDLDESV++AI++NDIVAAAVLSGNRNFEGR
Sbjct  590  LQQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLDESVATAITENDIVAAAVLSGNRNFEGR  649

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  650  VHPLTRANYLASPP  663



>ref|XP_003573387.2| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=987

 Score =   489 bits (1258),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 231/254 (91%), Positives = 242/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL YLKLTGRSDETV+MIEAYLRANNMFVDYNEPQ ERVYSS L L
Sbjct  393  EYGATMGFFPVDHVTLDYLKLTGRSDETVSMIEAYLRANNMFVDYNEPQLERVYSSYLAL  452

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL +VEPC+SGPKRPHDRV LKEMKSDWHSCLDNKVGFKGFAVPKE Q+KV KF FHGQP
Sbjct  453  DLDEVEPCISGPKRPHDRVTLKEMKSDWHSCLDNKVGFKGFAVPKEQQDKVVKFDFHGQP  512

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  513  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWVKTSLAPGSGVVTKY  572

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQEY N+QGFH+VGYGCTTCIGNSGDLDESVS+AI++ND+VAAAVLSGNRNFEGR
Sbjct  573  LLKSGLQEYFNKQGFHLVGYGCTTCIGNSGDLDESVSAAITENDVVAAAVLSGNRNFEGR  632

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  633  VHPLTRANYLASPP  646



>ref|XP_006828850.1| PREDICTED: aconitate hydratase, cytoplasmic [Amborella trichopoda]
 gb|ERM96266.1| hypothetical protein AMTR_s00001p00156400 [Amborella trichopoda]
Length=977

 Score =   488 bits (1257),  Expect = 9e-163, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 242/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIE+YLRAN MFVDYNEPQ ER+YSS LQL
Sbjct  383  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIESYLRANRMFVDYNEPQTERIYSSYLQL  442

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE+Q KV +FSFHG P
Sbjct  443  NLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKESQNKVVEFSFHGAP  502

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+LKHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  503  AQLKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  562

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQQGFHIVGYGCTTCIGNSGD+DE+V+S ISDNDIVAAAVLSGNRNFEGR
Sbjct  563  LQKSGLQKYLNQQGFHIVGYGCTTCIGNSGDIDETVASVISDNDIVAAAVLSGNRNFEGR  622

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  623  VHPLTRANYLASPP  636



>ref|XP_007045642.1| Aconitase 3 [Theobroma cacao]
 gb|EOY01474.1| Aconitase 3 [Theobroma cacao]
Length=995

 Score =   489 bits (1258),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 229/254 (90%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIE+YLRAN MFVDYNEPQQERVYSS L+L
Sbjct  403  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIESYLRANKMFVDYNEPQQERVYSSYLEL  462

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DW+SCL+NKVGFKGFAVPKEAQ+KVAKFSFHG+P
Sbjct  463  NLAEVEPCISGPKRPHDRVPLKEMKADWNSCLNNKVGFKGFAVPKEAQDKVAKFSFHGKP  522

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  523  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKTSLAPGSGVVTKY  582

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQEYLN+QGF+IVGYGCTTCIGNSG+LDESV+SAIS+ND++AAAVLSGNRNFEGR
Sbjct  583  LLQSGLQEYLNKQGFNIVGYGCTTCIGNSGELDESVASAISENDVIAAAVLSGNRNFEGR  642

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  643  VHALTRANYLASPP  656



>ref|XP_003527493.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=979

 Score =   488 bits (1256),  Expect = 1e-162, Method: Compositional matrix adjust.
 Identities = 229/254 (90%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIE+YLRAN +FVDYNEPQQ+RVYSS L+L
Sbjct  387  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIESYLRANKLFVDYNEPQQDRVYSSYLEL  446

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA+PKEAQ KVAKF FHGQP
Sbjct  447  NLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFAIPKEAQGKVAKFDFHGQP  506

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  507  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLKVKPWVKTSLAPGSGVVTKY  566

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGFHIVG+GCTTCIGNSG+LDESV+SAIS+ND+VAAAVLSGNRNFEGR
Sbjct  567  LLQSGLQKYLNEQGFHIVGFGCTTCIGNSGELDESVASAISENDVVAAAVLSGNRNFEGR  626

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  627  VHALTRANYLASPP  640



>ref|XP_012070835.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X1 [Jatropha 
curcas]
 gb|KDP39136.1| hypothetical protein JCGZ_00893 [Jatropha curcas]
Length=1002

 Score =   488 bits (1257),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 227/254 (89%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDH TLQYLKLTGRSDETVAM+EAYLRAN MFVDYNEPQ+ER Y+S LQL
Sbjct  407  EYGATMGFFPVDHATLQYLKLTGRSDETVAMVEAYLRANKMFVDYNEPQEERAYTSYLQL  466

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLKEMK+DWHSCLD++VGFKGF VPKE Q+KVAKFSFHGQP
Sbjct  467  DLADVEPCVSGPKRPHDRVPLKEMKTDWHSCLDSRVGFKGFGVPKEEQDKVAKFSFHGQP  526

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGS+VIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  527  AELKHGSIVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWIKTSLAPGSGVVTKY  586

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L QSGLQ+YLNQQGFHIVGYGCTTCIGNSG+LD  V+SAISDNDI+AAAVLSGNRNFEGR
Sbjct  587  LEQSGLQKYLNQQGFHIVGYGCTTCIGNSGELDSEVASAISDNDIIAAAVLSGNRNFEGR  646

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  647  VHPLTRANYLASPP  660



>dbj|BAJ85661.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=984

 Score =   488 bits (1256),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 229/254 (90%), Positives = 242/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL YL+LTGRSDETV+MIEAYLRANNMFVDYNEPQ ERVYSS+L L
Sbjct  390  EYGATMGFFPVDHVTLDYLRLTGRSDETVSMIEAYLRANNMFVDYNEPQAERVYSSNLAL  449

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRV LKEMKSDWH+CLDNKVGFKGFAVPKE Q+KV KF FHGQP
Sbjct  450  DLDDVEPCISGPKRPHDRVTLKEMKSDWHACLDNKVGFKGFAVPKEQQDKVVKFDFHGQP  509

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  510  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWVKTSLAPGSGVVTKY  569

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQEY N+QGFH+VGYGCTTCIGNSGDLDESVS+ I++ND+VAAAVLSGNRNFEGR
Sbjct  570  LLKSGLQEYFNKQGFHLVGYGCTTCIGNSGDLDESVSAVITENDVVAAAVLSGNRNFEGR  629

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  630  VHPLTRANYLASPP  643



>ref|XP_011047264.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047265.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
 ref|XP_011047266.1| PREDICTED: aconitate hydratase, cytoplasmic [Populus euphratica]
Length=1001

 Score =   488 bits (1256),  Expect = 2e-162, Method: Compositional matrix adjust.
 Identities = 231/254 (91%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVA IEAYLRAN MFVDY+EPQ ERVYSS LQL
Sbjct  409  EYGATMGFFPVDHVTLQYLKLTGRSDETVARIEAYLRANKMFVDYDEPQAERVYSSYLQL  468

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPL+EMK+DWHSCL NKVGFKGFAVPKEAQ+KVAKFSFHG P
Sbjct  469  DLADVEPCVSGPKRPHDRVPLREMKADWHSCLSNKVGFKGFAVPKEAQDKVAKFSFHGLP  528

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  529  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLKVKPWIKTSLAPGSGVVTKY  588

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+Y N+QGFHIVGYGCTTCIGNSGDLDESV+SAIS+NDI+AAAVLSGNRNFEGR
Sbjct  589  LQKSGLQKYFNEQGFHIVGYGCTTCIGNSGDLDESVASAISENDILAAAVLSGNRNFEGR  648

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  649  VHPLTRANYLASPP  662



>gb|KHG02134.1| hypothetical protein F383_25649 [Gossypium arboreum]
Length=993

 Score =   488 bits (1255),  Expect = 3e-162, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIEAYLRAN MFVDYNEPQQER YSS LQL
Sbjct  401  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANKMFVDYNEPQQERAYSSYLQL  460

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN VGFKGFAVPKE Q KV+KF+FHG P
Sbjct  461  DLAEVEPCISGPKRPHDRVPLKEMKADWHACLDNNVGFKGFAVPKEEQNKVSKFTFHGLP  520

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  521  AELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAYELGLEVKPWIKTSLAPGSGVVTKY  580

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLNQQGF+IVGYGCTTCIGNSG+LDESV+SAIS+NDI+AAAVLSGNRNFEGR
Sbjct  581  LLQSGLQKYLNQQGFNIVGYGCTTCIGNSGELDESVASAISENDIIAAAVLSGNRNFEGR  640

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  641  VHPLTRANYLASPP  654



>ref|XP_002445174.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
 gb|EES14669.1| hypothetical protein SORBIDRAFT_07g005390 [Sorghum bicolor]
Length=996

 Score =   487 bits (1254),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 229/254 (90%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL YLKLTGRSDETV+MIEAYLRAN MFVDYNEP  ER+YSS L+L
Sbjct  402  EYGATMGFFPVDHVTLDYLKLTGRSDETVSMIEAYLRANKMFVDYNEPPTERIYSSYLEL  461

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL +VEP +SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q+KV KF FHGQP
Sbjct  462  DLDEVEPSMSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEQQDKVVKFDFHGQP  521

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  522  AEMKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKTSLAPGSGVVTKY  581

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVS+AI++ND+VAAAVLSGNRNFEGR
Sbjct  582  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSAAITENDVVAAAVLSGNRNFEGR  641

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  642  VHPLTRANYLASPP  655



>gb|KJB62847.1| hypothetical protein B456_009G440000 [Gossypium raimondii]
Length=993

 Score =   487 bits (1254),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIEAYLRAN MFVDY+EPQQER YSS LQL
Sbjct  401  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANKMFVDYDEPQQERAYSSYLQL  460

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN VGFKGFAVPKE Q KVAKF+FHG P
Sbjct  461  DLAEVEPCISGPKRPHDRVPLKEMKADWHACLDNNVGFKGFAVPKEEQNKVAKFTFHGLP  520

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AEL+HGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  521  AELRHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAYELGLEVKPWIKTSLAPGSGVVTKY  580

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLNQQGF+IVGYGCTTCIGNSG+LDESV+SAIS+NDI+AAAVLSGNRNFEGR
Sbjct  581  LLQSGLQKYLNQQGFNIVGYGCTTCIGNSGELDESVASAISENDIIAAAVLSGNRNFEGR  640

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  641  VHPLTRANYLASPP  654



>ref|XP_007217144.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
 gb|EMJ18343.1| hypothetical protein PRUPE_ppa000812mg [Prunus persica]
Length=996

 Score =   487 bits (1254),  Expect = 4e-162, Method: Compositional matrix adjust.
 Identities = 227/254 (89%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRS+ETV+MIE+YLRAN +FVDYNEPQ ERVYSS L+L
Sbjct  404  EYGATMGFFPVDHVTLQYLKLTGRSEETVSMIESYLRANKLFVDYNEPQSERVYSSYLEL  463

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLK+MK DWH+CLDNKVGFKGFA+PKE Q+KVAKFSFHGQP
Sbjct  464  NLSEVEPCMSGPKRPHDRVPLKDMKVDWHACLDNKVGFKGFAIPKEVQDKVAKFSFHGQP  523

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL VKPWVKTSLAPGSGVVTKY
Sbjct  524  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLQVKPWVKTSLAPGSGVVTKY  583

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ+Y +QQGFHIVGYGCTTCIGNSGDLDE+V+SAI++NDIVAAAVLSGNRNFEGR
Sbjct  584  LLKSGLQKYFDQQGFHIVGYGCTTCIGNSGDLDETVASAIAENDIVAAAVLSGNRNFEGR  643

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  644  VHPLTRANYLASPP  657



>ref|XP_010440740.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Camelina sativa]
 ref|XP_010440741.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Camelina sativa]
Length=981

 Score =   486 bits (1252),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 229/254 (90%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDY+EPQQERVYSS L+L
Sbjct  389  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYSEPQQERVYSSYLEL  448

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L  VEPC+SGPKRPHDRVPLKEMK+DWH CLD+KVGFKGFA+PKEAQEKVAKFSF+GQP
Sbjct  449  NLDSVEPCISGPKRPHDRVPLKEMKADWHYCLDSKVGFKGFAIPKEAQEKVAKFSFNGQP  508

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW KTSLAPGSGVVTKY
Sbjct  509  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWTKTSLAPGSGVVTKY  568

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ++LNQQGF+IVGYGCTTCIGNSG++DESV +AI++NDIVAAAVLSGNRNFEGR
Sbjct  569  LLKSGLQKFLNQQGFNIVGYGCTTCIGNSGEIDESVGAAITENDIVAAAVLSGNRNFEGR  628

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  629  VHPLTRANYLASPP  642



>ref|XP_008676648.1| PREDICTED: uncharacterized protein LOC100216599 isoform X1 [Zea 
mays]
Length=987

 Score =   486 bits (1252),  Expect = 6e-162, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL YLKLTGRSDETV+MIEAYLRAN MFVDYNEP  ER+YSS L+L
Sbjct  393  EYGATMGFFPVDHVTLDYLKLTGRSDETVSMIEAYLRANKMFVDYNEPPTERIYSSYLEL  452

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEP +SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q+KV KF FHGQP
Sbjct  453  NLDEVEPSMSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEQQDKVVKFDFHGQP  512

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  513  AEMKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKTSLAPGSGVVTKY  572

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVS+AI++ND+VAAAVLSGNRNFEGR
Sbjct  573  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSTAITENDVVAAAVLSGNRNFEGR  632

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  633  VHPLTRANYLASPP  646



>ref|XP_002870438.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46697.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=977

 Score =   486 bits (1250),  Expect = 1e-161, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDY+EPQQERVYSS L+L
Sbjct  385  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYSEPQQERVYSSYLEL  444

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L  VEPC+SGPKRPHDRVPLKEMK+DWHSCLD+ VGFKGFA+PKEAQEKV KFSF+GQP
Sbjct  445  NLDSVEPCISGPKRPHDRVPLKEMKADWHSCLDSNVGFKGFAIPKEAQEKVVKFSFNGQP  504

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW KTSLAPGSGVVTKY
Sbjct  505  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLQVKPWTKTSLAPGSGVVTKY  564

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ+YLNQQGF+IVGYGCTTCIGNSG++DESV +AI++NDIVAAAVLSGNRNFEGR
Sbjct  565  LLKSGLQKYLNQQGFNIVGYGCTTCIGNSGEIDESVGAAITENDIVAAAVLSGNRNFEGR  624

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  625  VHPLTRANYLASPP  638



>ref|XP_010533007.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Tarenaya 
hassleriana]
Length=998

 Score =   486 bits (1250),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIE+YLRAN MFVDYNEPQQERVYSS L+L
Sbjct  406  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIESYLRANKMFVDYNEPQQERVYSSYLEL  465

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  VEPC+SGPKRPHDRVPLKEMK+DWHSCLDN VGFKGFA+PKEAQ+KVAKFSF GQP
Sbjct  466  DLSGVEPCISGPKRPHDRVPLKEMKADWHSCLDNTVGFKGFAIPKEAQDKVAKFSFDGQP  525

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  526  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLKVKPWIKTSLAPGSGVVTKY  585

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQEYLN+QGFHIVGYGCTTCIGNSG+++ESV +AIS+NDIVAAAVLSGNRNFEGR
Sbjct  586  LAKSGLQEYLNEQGFHIVGYGCTTCIGNSGEINESVGAAISENDIVAAAVLSGNRNFEGR  645

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  646  VHPLTRANYLASPP  659



>gb|KJB30565.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30568.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=898

 Score =   483 bits (1243),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYL+LTGRS ETVAMIE+YLRAN MFVDY EPQQERVYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLRLTGRSYETVAMIESYLRANKMFVDYKEPQQERVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DW+SCL+NKVGFKGFAVPKEAQEKVAKFSFHG+P
Sbjct  366  NLAEVEPCVSGPKRPHDRVPLKEMKADWNSCLNNKVGFKGFAVPKEAQEKVAKFSFHGKP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVI AITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AELKHGSVVITAITSCTNTSNPSVMLGAGLVAKKACELGLLVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDI+AAAVLSGNRNFEGR
Sbjct  486  LLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISENDIIAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  546  VHALTRANYLASPP  559



>ref|XP_006396145.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
 gb|ESQ36924.1| hypothetical protein EUTSA_v10002387mg [Eutrema salsugineum]
Length=995

 Score =   485 bits (1249),  Expect = 2e-161, Method: Compositional matrix adjust.
 Identities = 227/254 (89%), Positives = 247/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQ+RVYSS L+L
Sbjct  403  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQDRVYSSYLEL  462

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DWHSCLD+KVGFKGFA+PKEAQEKVA FSF+G+P
Sbjct  463  NLDNVEPCISGPKRPHDRVPLKEMKADWHSCLDSKVGFKGFAIPKEAQEKVANFSFNGKP  522

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  523  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLEVKPWIKTSLAPGSGVVTKY  582

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQEYLN+QGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAAAVLSGNRNFEGR
Sbjct  583  LLQSGLQEYLNKQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAAAVLSGNRNFEGR  642

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  643  VHPLTRANYLASPP  656



>gb|AAD25640.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
Length=898

 Score =   482 bits (1241),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 226/254 (89%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQ+RVYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQDRVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRV LKEMK+DWHSCLD+KVGFKGFA+PKEAQEKV  FSF GQP
Sbjct  366  NLDDVEPCISGPKRPHDRVTLKEMKADWHSCLDSKVGFKGFAIPKEAQEKVVNFSFDGQP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQEYLN+QGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAAAVLSGNRNFEGR
Sbjct  486  LLKSGLQEYLNEQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>gb|KFK39331.1| hypothetical protein AALP_AA3G230700 [Arabis alpina]
Length=986

 Score =   484 bits (1247),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 227/254 (89%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSS L+L
Sbjct  394  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSYLEL  453

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DWHSCLD+KVGFKGFA+PKEAQEKVA FSF+G+P
Sbjct  454  NLDNVEPCISGPKRPHDRVPLKEMKADWHSCLDSKVGFKGFAIPKEAQEKVANFSFNGKP  513

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AEL HGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  514  AELHHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQVKPWIKTSLAPGSGVVTKY  573

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAAAVLSGNRNFEGR
Sbjct  574  LLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAAAVLSGNRNFEGR  633

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  634  VHPLTRANYLASPP  647



>ref|XP_002532564.1| aconitase, putative [Ricinus communis]
 gb|EEF29825.1| aconitase, putative [Ricinus communis]
Length=990

 Score =   485 bits (1248),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 227/254 (89%), Positives = 239/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDH TLQYLKLTGRSDETVAMIEAYLRAN MFVDYNEPQ+E+VY+S LQL
Sbjct  398  EYGATMGFFPVDHATLQYLKLTGRSDETVAMIEAYLRANKMFVDYNEPQEEQVYTSYLQL  457

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLKEMK+DW  CLDN+ GFKGF VPKE Q+KVAKFSFHGQP
Sbjct  458  DLADVEPCVSGPKRPHDRVPLKEMKADWQKCLDNRAGFKGFGVPKEEQDKVAKFSFHGQP  517

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  518  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKTSLAPGSGVVTKY  577

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ YLN+ GFHIVGYGCTTCIGNSG+LD SV+SAISDNDI+AAAVLSGNRNFEGR
Sbjct  578  LLQSGLQRYLNELGFHIVGYGCTTCIGNSGELDPSVASAISDNDIIAAAVLSGNRNFEGR  637

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  638  VHPLTRANYLASPP  651



>gb|KHG25175.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=900

 Score =   482 bits (1241),  Expect = 3e-161, Method: Compositional matrix adjust.
 Identities = 224/254 (88%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYL+LTGRSDET+AMIE+YLRANNMFVDYNEPQ E+VYSS LQL
Sbjct  306  EYGATMGFFPVDHVTLQYLQLTGRSDETIAMIESYLRANNMFVDYNEPQIEKVYSSYLQL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
             L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA+PKE+Q+KVAKFSFHG P
Sbjct  366  KLEEVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAIPKESQDKVAKFSFHGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AEL+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AELRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ YLNQ GFHIVGYGCTTCIGNSGD+DESV+SAIS+ND+VAAAVLSGNRNFEGR
Sbjct  486  LQKSGLQRYLNQLGFHIVGYGCTTCIGNSGDIDESVASAISENDMVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>gb|ADD62592.1| cytosolic aconitase [Triticum aestivum]
Length=456

 Score =   467 bits (1201),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 220/249 (88%), Positives = 236/249 (95%), Gaps = 0/249 (0%)
 Frame = +1

Query  16   MGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQLDLVDV  195
            MGFFPVDHVTL YL+LTGRSDETV+MIEAYLRANNMFVDYNEPQ ERVYSS L LDL +V
Sbjct  1    MGFFPVDHVTLDYLRLTGRSDETVSMIEAYLRANNMFVDYNEPQLERVYSSYLALDLDEV  60

Query  196  EPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQPAELKH  375
            EPC+SGPKRPHDRV LK+MKSDWH+CLDNKVGFKGFAVPKE Q+KV KF F+GQPAELKH
Sbjct  61   EPCISGPKRPHDRVTLKDMKSDWHACLDNKVGFKGFAVPKEQQDKVVKFDFNGQPAELKH  120

Query  376  GSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKYLLQSG  555
            GSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKTSLAPGSGVVTKYLL+SG
Sbjct  121  GSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWVKTSLAPGSGVVTKYLLKSG  180

Query  556  LQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGRVHPLT  735
            LQEY N+QGFH+VGYGCTTCIGNSG+L ESVS+AI++ND+VAAAVLSGNRNFEGRVHPLT
Sbjct  181  LQEYFNKQGFHLVGYGCTTCIGNSGELHESVSAAITENDVVAAAVLSGNRNFEGRVHPLT  240

Query  736  RANYLASPP  762
            RANYLASPP
Sbjct  241  RANYLASPP  249



>ref|XP_010488774.1| PREDICTED: aconitate hydratase 2, mitochondrial [Camelina sativa]
Length=991

 Score =   484 bits (1246),  Expect = 5e-161, Method: Compositional matrix adjust.
 Identities = 227/254 (89%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQ +RVYSS L+L
Sbjct  399  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQIDRVYSSYLEL  458

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRV LK+MK+DWHSCLD+KVGFKGFA+PKEAQEKVA FSF+GQP
Sbjct  459  NLDNVEPCISGPKRPHDRVTLKDMKADWHSCLDSKVGFKGFAIPKEAQEKVANFSFNGQP  518

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKAS+LGL VKPW+KTSLAPGSGVVTKY
Sbjct  519  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKASDLGLQVKPWIKTSLAPGSGVVTKY  578

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQEYLNQQGFHIVGYGCTTCIGNSG+++ESV +AI++NDIVAAAVLSGNRNFEGR
Sbjct  579  LLKSGLQEYLNQQGFHIVGYGCTTCIGNSGEINESVGAAITENDIVAAAVLSGNRNFEGR  638

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  639  VHPLTRANYLASPP  652



>ref|XP_006592372.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Glycine max]
Length=890

 Score =   481 bits (1237),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 226/254 (89%), Positives = 242/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDE VAMIE+YLR N +FVDYNEPQQ+RVYSS L+L
Sbjct  392  EYGATMGFFPVDHVTLQYLKLTGRSDEIVAMIESYLRENKLFVDYNEPQQDRVYSSYLEL  451

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA+PKEAQ KVAKF FHGQP
Sbjct  452  NLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFAIPKEAQGKVAKFDFHGQP  511

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V PWVKTSLAPGSGVVTKY
Sbjct  512  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQVNPWVKTSLAPGSGVVTKY  571

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGFHIVG+GCTTCIGNSG+L+ESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  572  LLQSGLQKYLNEQGFHIVGFGCTTCIGNSGELEESVASAISENDIVAAAVLSGNRNFEGR  631

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  632  VHALTRANYLASPP  645



>gb|KJB30569.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=985

 Score =   483 bits (1244),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYL+LTGRS ETVAMIE+YLRAN MFVDY EPQQERVYSS L+L
Sbjct  393  EYGATMGFFPVDHVTLQYLRLTGRSYETVAMIESYLRANKMFVDYKEPQQERVYSSYLEL  452

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DW+SCL+NKVGFKGFAVPKEAQEKVAKFSFHG+P
Sbjct  453  NLAEVEPCVSGPKRPHDRVPLKEMKADWNSCLNNKVGFKGFAVPKEAQEKVAKFSFHGKP  512

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVI AITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  513  AELKHGSVVITAITSCTNTSNPSVMLGAGLVAKKACELGLLVKPWIKTSLAPGSGVVTKY  572

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDI+AAAVLSGNRNFEGR
Sbjct  573  LLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISENDIIAAAVLSGNRNFEGR  632

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  633  VHALTRANYLASPP  646



>gb|KJB30566.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
 gb|KJB30567.1| hypothetical protein B456_005G149700 [Gossypium raimondii]
Length=992

 Score =   483 bits (1244),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 228/254 (90%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYL+LTGRS ETVAMIE+YLRAN MFVDY EPQQERVYSS L+L
Sbjct  400  EYGATMGFFPVDHVTLQYLRLTGRSYETVAMIESYLRANKMFVDYKEPQQERVYSSYLEL  459

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DW+SCL+NKVGFKGFAVPKEAQEKVAKFSFHG+P
Sbjct  460  NLAEVEPCVSGPKRPHDRVPLKEMKADWNSCLNNKVGFKGFAVPKEAQEKVAKFSFHGKP  519

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVI AITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  520  AELKHGSVVITAITSCTNTSNPSVMLGAGLVAKKACELGLLVKPWIKTSLAPGSGVVTKY  579

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDI+AAAVLSGNRNFEGR
Sbjct  580  LLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISENDIIAAAVLSGNRNFEGR  639

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  640  VHALTRANYLASPP  653



>gb|KHN21232.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=918

 Score =   481 bits (1238),  Expect = 1e-160, Method: Compositional matrix adjust.
 Identities = 226/254 (89%), Positives = 242/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDE VAMIE+YLR N +FVDYNEPQQ+RVYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDEIVAMIESYLRENKLFVDYNEPQQDRVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA+PKEAQ KVAKF FHGQP
Sbjct  366  NLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFAIPKEAQGKVAKFDFHGQP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V PWVKTSLAPGSGVVTKY
Sbjct  426  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQVNPWVKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGFHIVG+GCTTCIGNSG+L+ESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  486  LLQSGLQKYLNEQGFHIVGFGCTTCIGNSGELEESVASAISENDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  546  VHALTRANYLASPP  559



>ref|NP_178634.2| aconitate hydratase 3 [Arabidopsis thaliana]
 sp|Q9SIB9.2|ACO2M_ARATH RecName: Full=Aconitate hydratase 2, mitochondrial; Short=Aconitase 
2; AltName: Full=Citrate hydro-lyase 2; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAM97080.1| cytoplasmic aconitate hydratase [Arabidopsis thaliana]
 gb|AAP68248.1| At2g05710 [Arabidopsis thaliana]
 gb|AEC05964.1| aconitate hydratase 3 [Arabidopsis thaliana]
Length=990

 Score =   483 bits (1242),  Expect = 3e-160, Method: Compositional matrix adjust.
 Identities = 226/254 (89%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQ+RVYSS L+L
Sbjct  398  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQDRVYSSYLEL  457

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRV LKEMK+DWHSCLD+KVGFKGFA+PKEAQEKV  FSF GQP
Sbjct  458  NLDDVEPCISGPKRPHDRVTLKEMKADWHSCLDSKVGFKGFAIPKEAQEKVVNFSFDGQP  517

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  518  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQVKPWIKTSLAPGSGVVTKY  577

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQEYLN+QGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAAAVLSGNRNFEGR
Sbjct  578  LLKSGLQEYLNEQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAAAVLSGNRNFEGR  637

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  638  VHPLTRANYLASPP  651



>ref|XP_004287944.1| PREDICTED: aconitate hydratase, cytoplasmic [Fragaria vesca subsp. 
vesca]
Length=990

 Score =   481 bits (1239),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 225/254 (89%), Positives = 242/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGR+DETVAMIE YLRAN +FVDYNEP+ ERVYSS L+L
Sbjct  398  EYGATMGFFPVDHVTLQYLKLTGRTDETVAMIEGYLRANKLFVDYNEPESERVYSSYLEL  457

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  VEPC+SGPKRPHDRV LK+MK+DWH+CLDNKVGFKGFA+PKE Q+K  KFSFHGQP
Sbjct  458  DLSQVEPCISGPKRPHDRVTLKDMKADWHACLDNKVGFKGFAIPKEVQDKEVKFSFHGQP  517

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPWVKTSLAPGSGVVTKY
Sbjct  518  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLRVKPWVKTSLAPGSGVVTKY  577

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGF+IVGYGCTTCIGNSGDLDESV+SAI++NDIVAAAVLSGNRNFEGR
Sbjct  578  LLQSGLQKYLNEQGFNIVGYGCTTCIGNSGDLDESVASAITENDIVAAAVLSGNRNFEGR  637

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  638  VHPLTRANYLASPP  651



>ref|XP_010467089.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Camelina 
sativa]
Length=994

 Score =   481 bits (1239),  Expect = 6e-160, Method: Compositional matrix adjust.
 Identities = 226/254 (89%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQ +RVYSS L+L
Sbjct  402  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQIDRVYSSYLEL  461

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRV LK+MK+DWHSCLD+KVGFKGFA+PKEAQEKVA FSF+GQP
Sbjct  462  NLDNVEPCISGPKRPHDRVTLKDMKADWHSCLDSKVGFKGFAIPKEAQEKVANFSFNGQP  521

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKAS+LGL VKPW+KTSLAPGSGVVTKY
Sbjct  522  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKASDLGLQVKPWIKTSLAPGSGVVTKY  581

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAAAVLSGNRNFEGR
Sbjct  582  LLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAAAVLSGNRNFEGR  641

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  642  VHPLTRANYLASPP  655



>ref|XP_002883704.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59963.1| hypothetical protein ARALYDRAFT_480186 [Arabidopsis lyrata subsp. 
lyrata]
Length=993

 Score =   481 bits (1239),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 225/254 (89%), Positives = 246/254 (97%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQ+RVYSS L+L
Sbjct  401  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQDRVYSSYLEL  460

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRV LK+MK+DWHSCLD+KVGFKGFA+PKEAQEKVA FSF+G+P
Sbjct  461  NLDNVEPCISGPKRPHDRVTLKDMKADWHSCLDSKVGFKGFAIPKEAQEKVANFSFNGEP  520

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  521  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQVKPWIKTSLAPGSGVVTKY  580

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAAAVLSGNRNFEGR
Sbjct  581  LLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAAAVLSGNRNFEGR  640

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  641  VHPLTRANYLASPP  654



>ref|XP_003539865.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X1 [Glycine max]
Length=984

 Score =   481 bits (1238),  Expect = 7e-160, Method: Compositional matrix adjust.
 Identities = 226/254 (89%), Positives = 242/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDE VAMIE+YLR N +FVDYNEPQQ+RVYSS L+L
Sbjct  392  EYGATMGFFPVDHVTLQYLKLTGRSDEIVAMIESYLRENKLFVDYNEPQQDRVYSSYLEL  451

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA+PKEAQ KVAKF FHGQP
Sbjct  452  NLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFAIPKEAQGKVAKFDFHGQP  511

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL V PWVKTSLAPGSGVVTKY
Sbjct  512  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQVNPWVKTSLAPGSGVVTKY  571

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGFHIVG+GCTTCIGNSG+L+ESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  572  LLQSGLQKYLNEQGFHIVGFGCTTCIGNSGELEESVASAISENDIVAAAVLSGNRNFEGR  631

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  632  VHALTRANYLASPP  645



>emb|CDP05740.1| unnamed protein product [Coffea canephora]
Length=1009

 Score =   482 bits (1240),  Expect = 8e-160, Method: Compositional matrix adjust.
 Identities = 225/254 (89%), Positives = 240/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIE YLR+N MFVDY+EPQQERVYSS L+L
Sbjct  419  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEGYLRSNKMFVDYSEPQQERVYSSYLEL  478

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  VEPC+SGPKRPHDRVPL++MK DWHSCLDNK+GFKGF VPKE Q KVAKFSF GQP
Sbjct  479  DLAGVEPCVSGPKRPHDRVPLRQMKDDWHSCLDNKIGFKGFGVPKEEQSKVAKFSFSGQP  538

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  539  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWIKTSLAPGSGVVTKY  598

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLNQQGFHIVGYGCTTCIGNSGDL ESV+SAI+++D++AAAVLSGNRNFEGR
Sbjct  599  LLQSGLQKYLNQQGFHIVGYGCTTCIGNSGDLQESVASAITEHDLIAAAVLSGNRNFEGR  658

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  659  VHPLTRANYLASPP  672



>ref|XP_008379632.1| PREDICTED: aconitate hydratase, cytoplasmic [Malus domestica]
Length=994

 Score =   481 bits (1237),  Expect = 1e-159, Method: Compositional matrix adjust.
 Identities = 227/254 (89%), Positives = 242/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIE+YLRAN +FVDYNEPQ ERVYSS L+L
Sbjct  402  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIESYLRANKLFVDYNEPQSERVYSSYLEL  461

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRV LK+MKSDWH+CLDNKVGFKGFA+PKE Q KVAKF F+GQP
Sbjct  462  NLSEVEPCVSGPKRPHDRVTLKDMKSDWHACLDNKVGFKGFAIPKEVQNKVAKFQFNGQP  521

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL VKPWVKTSLAPGSGVVTKY
Sbjct  522  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLEVKPWVKTSLAPGSGVVTKY  581

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL SGLQ+Y +QQGFHIVGYGCTTCIGNSGDL ESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  582  LLNSGLQKYFDQQGFHIVGYGCTTCIGNSGDLHESVASAISENDIVAAAVLSGNRNFEGR  641

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  642  VHPLTRANYLASPP  655



>ref|XP_004487412.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Cicer arietinum]
Length=984

 Score =   480 bits (1236),  Expect = 2e-159, Method: Compositional matrix adjust.
 Identities = 225/254 (89%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRAN +FVDY+EPQ++R YSS L+L
Sbjct  393  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANKLFVDYDEPQKDRAYSSYLEL  452

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDNKVGFKGFA+PKEAQ KVAKF FHGQP
Sbjct  453  NLDEVEPCISGPKRPHDRVPLKEMKADWHACLDNKVGFKGFAIPKEAQGKVAKFDFHGQP  512

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  513  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQVKPWVKTSLAPGSGVVTKY  572

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGF+IVG+GCTTCIGNSGDLDESV+SAI++NDI+AAAVLSGNRNFEGR
Sbjct  573  LLQSGLQKYLNEQGFNIVGFGCTTCIGNSGDLDESVASAITENDILAAAVLSGNRNFEGR  632

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  633  VHALTRANYLASPP  646



>gb|EMT33022.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=937

 Score =   478 bits (1231),  Expect = 3e-159, Method: Compositional matrix adjust.
 Identities = 225/254 (89%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL YL+LTGRSDETV+MIEAYLRANNMFVDYNEPQ ERVYSS L L
Sbjct  343  EYGATMGFFPVDHVTLDYLRLTGRSDETVSMIEAYLRANNMFVDYNEPQLERVYSSYLAL  402

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL +VEPC+SGPKRPHDRV LK+MKSDWH+CLDNKVGFKGFAVPKE Q+KV KF F+GQP
Sbjct  403  DLDEVEPCISGPKRPHDRVTLKDMKSDWHACLDNKVGFKGFAVPKEQQDKVVKFDFNGQP  462

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  463  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWVKTSLAPGSGVVTKY  522

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQEY N+QGFH+VGYGCTTCIGNSG+L ESVS+AI++ND+VAAAVLSGNRNFEGR
Sbjct  523  LLKSGLQEYFNKQGFHLVGYGCTTCIGNSGELHESVSAAITENDVVAAAVLSGNRNFEGR  582

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  583  VHPLTRANYLASPP  596



>gb|EPS60517.1| hypothetical protein M569_14286, partial [Genlisea aurea]
Length=862

 Score =   476 bits (1224),  Expect = 4e-159, Method: Compositional matrix adjust.
 Identities = 222/254 (87%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIEAYLRAN +F+DYNE QQERVYSS L+L
Sbjct  373  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANKLFIDYNEAQQERVYSSYLEL  432

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  VEPC+SGPKRPHDRVPLK+MK+DWHSCLD+KVGFKGFA+ KE Q K  KFSF+G+P
Sbjct  433  DLTSVEPCISGPKRPHDRVPLKDMKADWHSCLDSKVGFKGFAISKEQQNKTVKFSFNGEP  492

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  493  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKTSLAPGSGVVTKY  552

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLNQQGF+IVGYGCTTCIGNSGDL++SV++AI+DND+VAAAVLSGNRNFEGR
Sbjct  553  LLQSGLQKYLNQQGFNIVGYGCTTCIGNSGDLNDSVAAAIADNDLVAAAVLSGNRNFEGR  612

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  613  VHPLTRANYLASPP  626



>ref|XP_003543388.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   478 bits (1231),  Expect = 7e-159, Method: Compositional matrix adjust.
 Identities = 223/254 (88%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRAN +F+DYNEPQ +RVYSS L+L
Sbjct  392  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANKLFIDYNEPQPDRVYSSYLEL  451

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN VGFKGFA+PK+ Q KVAKF FHGQP
Sbjct  452  NLDEVEPCISGPKRPHDRVPLKEMKADWHACLDNNVGFKGFAIPKDVQGKVAKFDFHGQP  511

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  512  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQVKPWVKTSLAPGSGVVTKY  571

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ+YLN+QGF+IVG+GCTTCIGNSG+LD+SV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  572  LLKSGLQKYLNEQGFNIVGFGCTTCIGNSGELDQSVASAISENDIVAAAVLSGNRNFEGR  631

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  632  VHPLTRANYLASPP  645



>gb|ADM34980.1| cytosolic aconitase [Pyrus pyrifolia]
Length=898

 Score =   476 bits (1225),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 225/254 (89%), Positives = 239/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIE+YLRAN +FVDYNEPQ ER YSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIESYLRANKLFVDYNEPQIERAYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRV LK+MKSDWH+CLDNKVGFKGFA+PKE Q KVAKF F GQP
Sbjct  366  NLSEVEPCVSGPKRPHDRVTLKDMKSDWHACLDNKVGFKGFAIPKEVQNKVAKFQFDGQP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AEL HGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL VKPWVKTSLAPGSGVVTKY
Sbjct  426  AELNHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLQVKPWVKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL SGLQ+Y +QQGFHIVGYGCTTCIGNSGDL ESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  486  LLNSGLQKYFDQQGFHIVGYGCTTCIGNSGDLHESVASAISENDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>gb|KHN36531.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=984

 Score =   478 bits (1231),  Expect = 8e-159, Method: Compositional matrix adjust.
 Identities = 223/254 (88%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRAN +F+DYNEPQ +RVYSS L+L
Sbjct  392  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANKLFIDYNEPQPDRVYSSYLEL  451

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN VGFKGFA+PK+ Q KVAKF FHGQP
Sbjct  452  NLDEVEPCISGPKRPHDRVPLKEMKADWHACLDNNVGFKGFAIPKDVQGKVAKFDFHGQP  511

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  512  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLQVKPWVKTSLAPGSGVVTKY  571

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ+YLN+QGF+IVG+GCTTCIGNSG+LD+SV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  572  LLKSGLQKYLNEQGFNIVGFGCTTCIGNSGELDQSVASAISENDIVAAAVLSGNRNFEGR  631

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  632  VHPLTRANYLASPP  645



>ref|XP_008342002.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Malus domestica]
Length=992

 Score =   478 bits (1231),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 226/254 (89%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIE+YLRAN +FVDYNEPQ ER YSS L+L
Sbjct  400  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIESYLRANKLFVDYNEPQTERAYSSYLEL  459

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRV LK+MKSDWH+CLDNKVGFKGFA+PKE Q KVAKF F GQP
Sbjct  460  NLSEVEPCISGPKRPHDRVTLKDMKSDWHACLDNKVGFKGFAIPKEVQNKVAKFQFDGQP  519

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL VKPWVKTSLAPGSGVVTKY
Sbjct  520  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLQVKPWVKTSLAPGSGVVTKY  579

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+Y +QQGF+IVGYGCTTCIGNSGDL ESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  580  LLQSGLQKYFDQQGFNIVGYGCTTCIGNSGDLHESVASAISENDIVAAAVLSGNRNFEGR  639

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  640  VHPLTRANYLASPP  653



>emb|CDX93088.1| BnaA03g38100D [Brassica napus]
Length=994

 Score =   478 bits (1231),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 223/254 (88%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQ+R YSS L+L
Sbjct  402  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQDRAYSSYLEL  461

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DW+SCLD+KVGFKGFA+PKEAQEKVA FSF+G+P
Sbjct  462  NLDNVEPCISGPKRPHDRVPLKEMKADWNSCLDSKVGFKGFAIPKEAQEKVANFSFNGKP  521

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+ HGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  522  AEITHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQVKPWIKTSLAPGSGVVTKY  581

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAAAVLSGNRNFEGR
Sbjct  582  LLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAAAVLSGNRNFEGR  641

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  642  VHPLTRANYLASPP  655



>emb|CDX97969.1| BnaA06g07200D [Brassica napus]
Length=991

 Score =   478 bits (1230),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 223/254 (88%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQ+R YSS L+L
Sbjct  399  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQDRAYSSYLEL  458

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DW+SCLD+KVGFKGFA+PKEAQEKVA FSF+G+P
Sbjct  459  NLDNVEPCISGPKRPHDRVPLKEMKADWNSCLDSKVGFKGFAIPKEAQEKVANFSFNGKP  518

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+ HGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  519  AEITHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQVKPWIKTSLAPGSGVVTKY  578

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAAAVLSGNRNFEGR
Sbjct  579  LLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAAAVLSGNRNFEGR  638

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  639  VHPLTRANYLASPP  652



>ref|XP_009136177.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=995

 Score =   478 bits (1231),  Expect = 1e-158, Method: Compositional matrix adjust.
 Identities = 223/254 (88%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQ+R YSS L+L
Sbjct  403  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQDRAYSSYLEL  462

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DW+SCLD+KVGFKGFA+PKEAQEKVA FSF+G+P
Sbjct  463  NLDNVEPCISGPKRPHDRVPLKEMKADWNSCLDSKVGFKGFAIPKEAQEKVANFSFNGKP  522

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+ HGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  523  AEITHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQVKPWIKTSLAPGSGVVTKY  582

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAAAVLSGNRNFEGR
Sbjct  583  LLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAAAVLSGNRNFEGR  642

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  643  VHPLTRANYLASPP  656



>emb|CDY18054.1| BnaC07g04160D [Brassica napus]
Length=986

 Score =   478 bits (1229),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 223/254 (88%), Positives = 244/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDY+EPQQER YSS L+L
Sbjct  394  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYSEPQQERAYSSYLEL  453

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DW+SCLDNKVGFKGFA+PK+AQEKVA FSF+G+P
Sbjct  454  NLDNVEPCISGPKRPHDRVPLKEMKADWNSCLDNKVGFKGFAIPKKAQEKVANFSFNGKP  513

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  514  AEIKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQVKPWIKTSLAPGSGVVTKY  573

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV  AI++NDIV AAVLSGNRNFEGR
Sbjct  574  LLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGVAITENDIVVAAVLSGNRNFEGR  633

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  634  VHPLTRANYLASPP  647



>ref|XP_007149973.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
 gb|ESW21967.1| hypothetical protein PHAVU_005G115100g [Phaseolus vulgaris]
Length=983

 Score =   477 bits (1228),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 222/254 (87%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLR N +F+DYNEPQ +RVYSS L+L
Sbjct  391  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRQNKLFIDYNEPQPDRVYSSYLEL  450

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA+PK+ Q KVAKF FHGQP
Sbjct  451  NLDEVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAIPKDVQGKVAKFDFHGQP  510

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  511  AEIKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHELGLKVKPWVKTSLAPGSGVVTKY  570

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ+YLN+QGF+IVG+GCTTCIGNSG+LD+SV+SAIS+NDIVA+AVLSGNRNFEGR
Sbjct  571  LLKSGLQKYLNEQGFNIVGFGCTTCIGNSGELDQSVASAISENDIVASAVLSGNRNFEGR  630

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  631  VHPLTRANYLASPP  644



>ref|XP_006296904.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
 gb|EOA29802.1| hypothetical protein CARUB_v10012896mg [Capsella rubella]
Length=988

 Score =   478 bits (1229),  Expect = 2e-158, Method: Compositional matrix adjust.
 Identities = 223/254 (88%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGR+DETV MIEAYLRANNMFVDYNEPQQ+RVYSS L+L
Sbjct  396  EYGATMGFFPVDHVTLQYLKLTGRTDETVDMIEAYLRANNMFVDYNEPQQDRVYSSYLEL  455

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRV LK+MK+DWHSCLD+KVGFKGFA+PKEA EKVAKFSF+G+P
Sbjct  456  NLDNVEPCISGPKRPHDRVTLKDMKADWHSCLDSKVGFKGFAIPKEAHEKVAKFSFNGEP  515

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKAS+LGL VKPWVKTSLAPGSGVVTKY
Sbjct  516  AEIKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKASDLGLQVKPWVKTSLAPGSGVVTKY  575

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQEYLN QGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAAAVLSGNRNFEGR
Sbjct  576  LLKSGLQEYLNHQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAAAVLSGNRNFEGR  635

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  636  VHPLTRANYLASPP  649



>ref|XP_009353280.1| PREDICTED: aconitate hydratase, cytoplasmic [Pyrus x bretschneideri]
Length=994

 Score =   477 bits (1228),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 225/254 (89%), Positives = 240/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIE+YLRAN +FVDYNEPQ ERVYSS L+L
Sbjct  402  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIESYLRANKLFVDYNEPQSERVYSSYLEL  461

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRV LK+MKSDWH+CLD+KVGFKGFA+PKE Q KV KF F GQP
Sbjct  462  NLSEVEPCVSGPKRPHDRVTLKDMKSDWHACLDSKVGFKGFAIPKEVQNKVVKFQFEGQP  521

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL VKPWVKTSLAPGSGVVTKY
Sbjct  522  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLQVKPWVKTSLAPGSGVVTKY  581

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL SGLQ+Y +QQGFHIVGYGCTTCIGNSGDL ESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  582  LLNSGLQKYFDQQGFHIVGYGCTTCIGNSGDLHESVASAISENDIVAAAVLSGNRNFEGR  641

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  642  VHPLTRANYLASPP  655



>ref|XP_002530635.1| aconitase, putative [Ricinus communis]
 gb|EEF31743.1| aconitase, putative [Ricinus communis]
Length=900

 Score =   474 bits (1220),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 220/254 (87%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIE+YLRAN MFVDY+EPQ ERVYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIESYLRANRMFVDYSEPQIERVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC++GPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFAVPKE+Q KVA+F+FHG P
Sbjct  366  NLEDVEPCIAGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFAVPKESQSKVAEFNFHGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+DE+V+SAI++ND+VAAAVLSGNRNFEGR
Sbjct  486  LQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDEAVASAITENDLVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_007046597.1| Aconitase 1 [Theobroma cacao]
 gb|EOX90754.1| Aconitase 1 [Theobroma cacao]
Length=900

 Score =   474 bits (1220),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 220/254 (87%), Positives = 240/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYL+LTGRSDET+AMIE+YLRAN MFVDY+EPQ E+VYS+ L L
Sbjct  306  EYGATMGFFPVDHVTLQYLRLTGRSDETIAMIESYLRANKMFVDYSEPQTEKVYSTYLDL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
             L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA+PKE+Q KVAKFSF G P
Sbjct  366  KLEDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAIPKESQNKVAKFSFRGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AEL+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AELRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+DESV+SAIS+ND+VAAAVLSGNRNFEGR
Sbjct  486  LQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDESVASAISENDMVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>gb|KCW56578.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=797

 Score =   471 bits (1212),  Expect = 4e-158, Method: Compositional matrix adjust.
 Identities = 219/254 (86%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRS+ETVAMIE+YLRAN MFVDYNEPQ ER YSS L+L
Sbjct  203  EYGATMGFFPVDHVTLQYLKLTGRSEETVAMIESYLRANKMFVDYNEPQVERTYSSYLEL  262

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFAVPKE+Q KVA+F+F+G P
Sbjct  263  DLKDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAVPKESQGKVAEFTFNGTP  322

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVA+KA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  323  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVARKACELGLEVKPWIKTSLAPGSGVVTKY  382

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ YLNQ GF+IVGYGCTTCIGNSGD+DESV+SAI++ND+VAAAVLSGNRNFEGR
Sbjct  383  LQKSGLQTYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITENDLVAAAVLSGNRNFEGR  442

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  443  VHPLTRANYLASPP  456



>emb|CDY50945.1| BnaC03g74450D [Brassica napus]
Length=995

 Score =   476 bits (1226),  Expect = 6e-158, Method: Compositional matrix adjust.
 Identities = 222/254 (87%), Positives = 245/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDY+EPQQ+R YSS L+L
Sbjct  403  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYDEPQQDRAYSSYLEL  462

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DW+SCLD+KVGFKGFA+PKEAQEKVA FSF+G+P
Sbjct  463  NLDNVEPCISGPKRPHDRVPLKEMKADWNSCLDSKVGFKGFAIPKEAQEKVANFSFNGKP  522

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+ HGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  523  AEITHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQVKPWIKTSLAPGSGVVTKY  582

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAAAVLSGNRNFEGR
Sbjct  583  LLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAAAVLSGNRNFEGR  642

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  643  VHPLTRANYLASPP  656



>dbj|BAE98476.1| aconitase like protein [Arabidopsis thaliana]
Length=325

 Score =   454 bits (1167),  Expect = 7e-158, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 233/254 (92%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL+YLKLTGRSDETV+MIE+YLRANNMFVDYNEPQQER Y+S LQL
Sbjct  18   EYGATMGFFPVDHVTLEYLKLTGRSDETVSMIESYLRANNMFVDYNEPQQERAYTSYLQL  77

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFAVPKE QE+V KFS++GQP
Sbjct  78   DLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFAVPKEKQEEVVKFSYNGQP  137

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKAS+LGL VKPWVKTSLAPGS VV KY
Sbjct  138  AEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKASDLGLKVKPWVKTSLAPGSRVVEKY  197

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGL+E L +QGF IVGYGCTTCIGNSG+LD  V+SAI   DI+ AAVLSGNRNFEGR
Sbjct  198  LDRSGLRESLTKQGFEIVGYGCTTCIGNSGNLDPEVASAIEGTDIIPAAVLSGNRNFEGR  257

Query  721  VHPLTRANYLASPP  762
            VHP TRANYLASPP
Sbjct  258  VHPQTRANYLASPP  271



>ref|XP_010943467.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=995

 Score =   476 bits (1225),  Expect = 8e-158, Method: Compositional matrix adjust.
 Identities = 223/254 (88%), Positives = 242/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGR+D+TVAMIE+YLRAN +FVDY++PQ ERVYSS L+L
Sbjct  401  EYGATMGFFPVDHVTLQYLKLTGRNDDTVAMIESYLRANKLFVDYSQPQTERVYSSYLEL  460

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLK MK+DWHSCLDNKVGFKGFAVPKEAQ KVA+FSFHG P
Sbjct  461  NLEDVEPCVSGPKRPHDRVPLKVMKADWHSCLDNKVGFKGFAVPKEAQNKVAEFSFHGTP  520

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A++KHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  521  AQIKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  580

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GFHIVGYGCTTCIGNSGDLDE+VS+AIS+NDIVAAAVLSGNRNFEGR
Sbjct  581  LEKSGLQKYLNQLGFHIVGYGCTTCIGNSGDLDETVSAAISENDIVAAAVLSGNRNFEGR  640

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  641  VHPLTRANYLASPP  654



>ref|XP_003540302.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Glycine 
max]
Length=984

 Score =   476 bits (1224),  Expect = 9e-158, Method: Compositional matrix adjust.
 Identities = 221/254 (87%), Positives = 242/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV MIEAYLRAN +F+DYNEPQ +RVYSS L+L
Sbjct  392  EYGATMGFFPVDHVTLQYLKLTGRSDETVTMIEAYLRANKLFIDYNEPQPDRVYSSYLEL  451

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN VGFKGFA+PK+ Q KVAKF FHGQP
Sbjct  452  NLDEVEPCISGPKRPHDRVPLKEMKADWHACLDNNVGFKGFAIPKDVQGKVAKFDFHGQP  511

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPWVKTSLAPGSGVVTKY
Sbjct  512  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHDLGLQVKPWVKTSLAPGSGVVTKY  571

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ+YLN+QGF+IVG+GCTTCIGNSG+LD+SV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  572  LLKSGLQKYLNEQGFNIVGFGCTTCIGNSGELDQSVASAISENDIVAAAVLSGNRNFEGR  631

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  632  VHPLTRANYLASPP  645



>ref|XP_002263337.1| PREDICTED: aconitate hydratase 1 [Vitis vinifera]
Length=900

 Score =   473 bits (1216),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 219/254 (86%), Positives = 242/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGR DETV+MIE+YLRANNMFVDY++PQ E+VYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRRDETVSMIESYLRANNMFVDYSQPQVEKVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA+PKE+Q KV +FS+HG P
Sbjct  366  NLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAIPKESQSKVVEFSYHGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD++ESV+SAIS+ND+VAAAVLSGNRNFEGR
Sbjct  486  LEKSGLQKYLNQLGFHIVGYGCTTCIGNSGDINESVASAISENDMVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_004134842.1| PREDICTED: aconitate hydratase [Cucumis sativus]
Length=900

 Score =   472 bits (1215),  Expect = 2e-157, Method: Compositional matrix adjust.
 Identities = 218/254 (86%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGR DET++MIE+YLRAN MFVDY EPQ ERVYSS ++L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRKDETISMIESYLRANKMFVDYTEPQVERVYSSHIEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA+PKEAQ KVA+F+FHG P
Sbjct  366  NLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAIPKEAQVKVAEFNFHGSP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD+DESV+SAI++NDIVAAAVLSGNRNFEGR
Sbjct  486  LAKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITENDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_008440877.1| PREDICTED: aconitate hydratase [Cucumis melo]
Length=900

 Score =   472 bits (1215),  Expect = 3e-157, Method: Compositional matrix adjust.
 Identities = 218/254 (86%), Positives = 242/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGR DET++MIE+YLRAN MFVDY+EPQ ERVYSS ++L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRKDETISMIESYLRANKMFVDYSEPQVERVYSSHIEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA+PKEAQ KVA+F+FHG P
Sbjct  366  NLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAIPKEAQVKVAEFNFHGSP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD+DESV+SAI++NDIVAAAVLSGNRNFEGR
Sbjct  486  LAKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITENDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>emb|CBI24446.3| unnamed protein product [Vitis vinifera]
Length=918

 Score =   472 bits (1215),  Expect = 4e-157, Method: Compositional matrix adjust.
 Identities = 219/254 (86%), Positives = 242/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGR DETV+MIE+YLRANNMFVDY++PQ E+VYSS L+L
Sbjct  324  EYGATMGFFPVDHVTLQYLKLTGRRDETVSMIESYLRANNMFVDYSQPQVEKVYSSYLEL  383

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFA+PKE+Q KV +FS+HG P
Sbjct  384  NLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAIPKESQSKVVEFSYHGTP  443

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  444  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  503

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD++ESV+SAIS+ND+VAAAVLSGNRNFEGR
Sbjct  504  LEKSGLQKYLNQLGFHIVGYGCTTCIGNSGDINESVASAISENDMVAAAVLSGNRNFEGR  563

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  564  VHPLTRANYLASPP  577



>gb|KCW56576.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=898

 Score =   471 bits (1211),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 219/254 (86%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRS+ETVAMIE+YLRAN MFVDYNEPQ ER YSS L+L
Sbjct  304  EYGATMGFFPVDHVTLQYLKLTGRSEETVAMIESYLRANKMFVDYNEPQVERTYSSYLEL  363

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFAVPKE+Q KVA+F+F+G P
Sbjct  364  DLKDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAVPKESQGKVAEFTFNGTP  423

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVA+KA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  424  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVARKACELGLEVKPWIKTSLAPGSGVVTKY  483

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ YLNQ GF+IVGYGCTTCIGNSGD+DESV+SAI++ND+VAAAVLSGNRNFEGR
Sbjct  484  LQKSGLQTYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITENDLVAAAVLSGNRNFEGR  543

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  544  VHPLTRANYLASPP  557



>ref|XP_010029634.1| PREDICTED: aconitate hydratase 1 [Eucalyptus grandis]
 gb|KCW56577.1| hypothetical protein EUGRSUZ_I02307 [Eucalyptus grandis]
Length=900

 Score =   471 bits (1211),  Expect = 8e-157, Method: Compositional matrix adjust.
 Identities = 219/254 (86%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRS+ETVAMIE+YLRAN MFVDYNEPQ ER YSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSEETVAMIESYLRANKMFVDYNEPQVERTYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFAVPKE+Q KVA+F+F+G P
Sbjct  366  DLKDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAVPKESQGKVAEFTFNGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVA+KA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVARKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ YLNQ GF+IVGYGCTTCIGNSGD+DESV+SAI++ND+VAAAVLSGNRNFEGR
Sbjct  486  LQKSGLQTYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITENDLVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>gb|KJB48278.1| hypothetical protein B456_008G061900 [Gossypium raimondii]
Length=900

 Score =   471 bits (1211),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 218/254 (86%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYL+LTGRS++T+AMIE+YLRAN MFVDY+EPQ E+VYSS LQL
Sbjct  306  EYGATMGFFPVDHVTLQYLQLTGRSEKTIAMIESYLRANKMFVDYSEPQIEKVYSSYLQL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
             L +VEPC+SGPKRPHDRVPLKEMK+DW +CLDN+VGFKGFA+PKE+Q+K AKFSFHG P
Sbjct  366  KLEEVEPCISGPKRPHDRVPLKEMKADWQACLDNRVGFKGFAIPKESQDKAAKFSFHGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AEL+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AELRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+DESV+SAIS+ND+VAAAVLSGNRNFEGR
Sbjct  486  LQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDESVASAISENDMVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_008800034.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=997

 Score =   473 bits (1218),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 222/254 (87%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+TVAMIE+YLRAN MFVDY++PQ ERVYSS L+L
Sbjct  403  EYGATMGFFPVDHVTLQYLKLTGRSDDTVAMIESYLRANKMFVDYSQPQTERVYSSYLEL  462

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE Q KVA+FSFHG P
Sbjct  463  NLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQNKVAEFSFHGLP  522

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A++KHG VVIAAITSCTNTSNPSVMLGAALVAKKA E GL VKPW+KTSLAPGSGVVT+Y
Sbjct  523  AQIKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACEQGLEVKPWIKTSLAPGSGVVTRY  582

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF+IVGYGCTTCIGNSGDLDE+VS+AIS+NDIVAAAVLSGNRNFEGR
Sbjct  583  LERSGLQKYLNQLGFNIVGYGCTTCIGNSGDLDETVSAAISENDIVAAAVLSGNRNFEGR  642

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  643  VHPLTRANYLASPP  656



>ref|XP_010918136.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Elaeis guineensis]
Length=992

 Score =   473 bits (1217),  Expect = 1e-156, Method: Compositional matrix adjust.
 Identities = 220/254 (87%), Positives = 242/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHV+LQYLKLTGRSD+TVAMIE+YLRAN MF+DY++PQ ERVYSS L+L
Sbjct  398  EYGATMGFFPVDHVSLQYLKLTGRSDDTVAMIESYLRANKMFIDYSQPQTERVYSSYLEL  457

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKE Q KVA+FSFHG P
Sbjct  458  NLEEVEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKETQNKVAEFSFHGMP  517

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A++KHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVT+Y
Sbjct  518  AQIKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTRY  577

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF+IVGYGCTTCIGNSGDLDE+VS+AIS+NDIVAAAVLSGNRNFEGR
Sbjct  578  LEKSGLQKYLNQLGFNIVGYGCTTCIGNSGDLDETVSAAISENDIVAAAVLSGNRNFEGR  637

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  638  VHPLTRANYLASPP  651



>ref|XP_009148490.1| PREDICTED: aconitate hydratase 2, mitochondrial [Brassica rapa]
Length=991

 Score =   473 bits (1216),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 221/254 (87%), Positives = 243/254 (96%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            E G TMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQ+R YSS L+L
Sbjct  399  ENGETMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQDRAYSSYLEL  458

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DW+SCLD+KVGFKGFA+PKEAQEKVA FSF+G+P
Sbjct  459  NLDNVEPCISGPKRPHDRVPLKEMKADWNSCLDSKVGFKGFAIPKEAQEKVANFSFNGKP  518

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+ HGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  519  AEITHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACDLGLQVKPWIKTSLAPGSGVVTKY  578

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQEYLNQQGF+IVGYGCTTCIGNSG+++ESV +AI++NDIVAAAVLSGNRNFEGR
Sbjct  579  LLKSGLQEYLNQQGFNIVGYGCTTCIGNSGEINESVGAAITENDIVAAAVLSGNRNFEGR  638

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  639  VHPLTRANYLASPP  652



>ref|XP_009787326.1| PREDICTED: aconitate hydratase 2, mitochondrial-like isoform 
X2 [Nicotiana sylvestris]
Length=818

 Score =   468 bits (1203),  Expect = 2e-156, Method: Compositional matrix adjust.
 Identities = 217/254 (85%), Positives = 237/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDH+TLQYL+LTGRS+ET+ MIE YLRAN MFVDYNEPQ+ERVYSS   L
Sbjct  425  EYGATMGFFPVDHMTLQYLRLTGRSEETITMIEEYLRANKMFVDYNEPQEERVYSSYSGL  484

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRP+DRV LK+MK+DWH+CLDNK GFKGFAVPK+ Q+KVAKF+FHG P
Sbjct  485  DLADVEPCISGPKRPNDRVALKDMKADWHACLDNKHGFKGFAVPKQEQDKVAKFTFHGLP  544

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGS+VIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSG VTKY
Sbjct  545  AELKHGSIVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWIKTSLAPGSGAVTKY  604

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQQGFH+VGYGCTTCIGNSGDLDESV+SAI+DNDIVAAAVLSGNRNFEGR
Sbjct  605  LHKSGLQKYLNQQGFHLVGYGCTTCIGNSGDLDESVASAITDNDIVAAAVLSGNRNFEGR  664

Query  721  VHPLTRANYLASPP  762
            VHP TRANYLASPP
Sbjct  665  VHPQTRANYLASPP  678



>ref|XP_011022256.1| PREDICTED: aconitate hydratase 1 [Populus euphratica]
Length=899

 Score =   468 bits (1205),  Expect = 6e-156, Method: Compositional matrix adjust.
 Identities = 216/254 (85%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDET++MIE+YLRAN MFVDY+EPQ ER+YSS L L
Sbjct  305  EYGATMGFFPVDHVTLQYLKLTGRSDETISMIESYLRANRMFVDYSEPQIERMYSSYLAL  364

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPL+EMK+DWH+CLDN+VGFKGFA+PKE+Q KVA+FSF G P
Sbjct  365  NLEDVEPCISGPKRPHDRVPLREMKADWHACLDNRVGFKGFAIPKESQSKVAEFSFRGTP  424

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  425  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  484

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+DE+V+SAI++ND+VAAAVLSGNRNFEGR
Sbjct  485  LEKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDEAVASAITENDLVAAAVLSGNRNFEGR  544

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  545  VHPLTRANYLASPP  558



>ref|XP_010266897.1| PREDICTED: aconitate hydratase 1 [Nelumbo nucifera]
Length=900

 Score =   468 bits (1205),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 219/254 (86%), Positives = 239/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIE+YLRAN MFVDY++PQ ERVYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIESYLRANKMFVDYSQPQTERVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK DWH+CLDNKVGFKGFA+PK++Q KV +FSFH  P
Sbjct  366  NLEEVEPCVSGPKRPHDRVPLKEMKVDWHACLDNKVGFKGFAIPKDSQSKVVEFSFHETP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+LKHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ +LNQ GFHIVGYGCTTCIGNSGD+DESV+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  486  LQKSGLQNHLNQLGFHIVGYGCTTCIGNSGDIDESVASAISENDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_008785050.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Phoenix dactylifera]
Length=998

 Score =   471 bits (1212),  Expect = 7e-156, Method: Compositional matrix adjust.
 Identities = 223/256 (87%), Positives = 242/256 (95%), Gaps = 2/256 (1%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQ--QERVYSSSL  174
            EYGATMGFFPVDHVTLQYLKLTGR+D+TVAMIE+YLRAN MFVDY++PQ  +ERVYSS L
Sbjct  402  EYGATMGFFPVDHVTLQYLKLTGRNDDTVAMIESYLRANKMFVDYSQPQTERERVYSSYL  461

Query  175  QLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHG  354
            +L+L D EPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKEAQ KVA+FSFHG
Sbjct  462  ELNLEDAEPCVSGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKEAQNKVAEFSFHG  521

Query  355  QPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVT  534
             PA++KHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVT
Sbjct  522  TPAQIKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVT  581

Query  535  KYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFE  714
            KYL +SGLQ+YLNQ GFHIVGYGCTTCIGNSGDL E+VS+AIS+NDIVAAAVLSGNRNFE
Sbjct  582  KYLEKSGLQKYLNQLGFHIVGYGCTTCIGNSGDLHETVSAAISENDIVAAAVLSGNRNFE  641

Query  715  GRVHPLTRANYLASPP  762
            GRVHPLTRANYLASPP
Sbjct  642  GRVHPLTRANYLASPP  657



>gb|KDO71348.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=702

 Score =   461 bits (1187),  Expect = 1e-155, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+TV+MIE+YLRAN MFVDY+EPQ ERVYSS L+L
Sbjct  108  EYGATMGFFPVDHVTLQYLKLTGRSDDTVSMIESYLRANKMFVDYSEPQSERVYSSYLEL  167

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PKE Q KVA+F+FHG P
Sbjct  168  NLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPKEYQSKVAEFNFHGTP  227

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  228  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  287

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDIVAAAVLSGNRNFEGR
Sbjct  288  LQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDIVAAAVLSGNRNFEGR  347

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  348  VHPLTRANYLASPP  361



>ref|XP_008393748.1| PREDICTED: aconitate hydratase 1-like [Malus domestica]
Length=795

 Score =   464 bits (1195),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 239/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+ VA+IE+YLRAN MFVDYNEPQ ERVYSS L+L
Sbjct  203  EYGATMGFFPVDHVTLQYLKLTGRSDDKVALIESYLRANKMFVDYNEPQIERVYSSYLEL  262

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFAVP+E+Q KV +F+FHG P
Sbjct  263  NLNDVEPCISGPKRPHDRVTLKEMKGDWHACLDNRVGFKGFAVPEESQSKVVEFNFHGTP  322

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  323  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  382

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V++AI++ND+VAAAVLSGNRNFEGR
Sbjct  383  LQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDLVAAAVLSGNRNFEGR  442

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  443  VHPLTRANYLASPP  456



>ref|XP_010526818.1| PREDICTED: aconitate hydratase 1 [Tarenaya hassleriana]
Length=899

 Score =   467 bits (1202),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 216/254 (85%), Positives = 237/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+TVAMIE+YLRAN MF+DYNEPQ E VYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDDTVAMIESYLRANKMFIDYNEPQSEIVYSSCLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
             L DVEPC+SGPKRPHDRVP+KEMK+DWH+CLDN+VGFKGFA+PKEAQ KV  F FHG P
Sbjct  366  KLEDVEPCISGPKRPHDRVPIKEMKADWHACLDNRVGFKGFAIPKEAQNKVVDFDFHGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD+DE+V+ AI+DND+VAAAVLSGNRNFEGR
Sbjct  486  LQKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDEAVALAIADNDMVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_009598331.1| PREDICTED: aconitate hydratase 2, mitochondrial isoform X2 [Nicotiana 
tomentosiformis]
Length=865

 Score =   466 bits (1199),  Expect = 2e-155, Method: Compositional matrix adjust.
 Identities = 218/254 (86%), Positives = 235/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDH+TLQYLKLTGRS+ET+ MIE YLRAN MFVDYNEPQ+ERVYSS L L
Sbjct  472  EYGATMGFFPVDHMTLQYLKLTGRSEETITMIEEYLRANKMFVDYNEPQEERVYSSYLGL  531

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRP+DRV L +MK+DWH+CLDNK GFKGFAVPK+ Q+KVA F+FHG P
Sbjct  532  DLADVEPCVSGPKRPNDRVALNDMKADWHACLDNKHGFKGFAVPKQEQDKVATFTFHGLP  591

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSG VTKY
Sbjct  592  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWIKTSLAPGSGAVTKY  651

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ YLNQQGFH+VGYGCTTCIGNSGDLDESV+SAI+DNDIVAAAVLSGNRNFEGR
Sbjct  652  LHKSGLQTYLNQQGFHLVGYGCTTCIGNSGDLDESVASAITDNDIVAAAVLSGNRNFEGR  711

Query  721  VHPLTRANYLASPP  762
            VHP TRANYLASPP
Sbjct  712  VHPQTRANYLASPP  725



>ref|XP_008363078.1| PREDICTED: LOW QUALITY PROTEIN: aconitate hydratase 1-like [Malus 
domestica]
Length=795

 Score =   463 bits (1192),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+ VA+IE+YLRAN MFVDYNEPQ ERVYSS L+L
Sbjct  203  EYGATMGFFPVDHVTLQYLKLTGRSDDKVALIESYLRANKMFVDYNEPQIERVYSSYLEL  262

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFAVPKE+Q KV +F+FHG P
Sbjct  263  NLNDVEPCISGPKRPHDRVTLKEMKGDWHACLDNRVGFKGFAVPKESQSKVVEFNFHGTP  322

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  323  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  382

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V++AI++ND+VAAAVLSGNR FEGR
Sbjct  383  LQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDLVAAAVLSGNRXFEGR  442

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  443  VHPLTRANYLASPP  456



>gb|KHG25176.1| Aconitate hydratase, cytoplasmic [Gossypium arboreum]
Length=929

 Score =   467 bits (1202),  Expect = 5e-155, Method: Compositional matrix adjust.
 Identities = 224/283 (79%), Positives = 243/283 (86%), Gaps = 29/283 (10%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYL+LTGRSDET+AMIE+YLRANNMFVDYNEPQ E+VYSS LQL
Sbjct  306  EYGATMGFFPVDHVTLQYLQLTGRSDETIAMIESYLRANNMFVDYNEPQIEKVYSSYLQL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
             L +VEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA+PKE+Q+KVAKFSFHG P
Sbjct  366  KLEEVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAIPKESQDKVAKFSFHGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AEL+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AELRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDN-----------------  669
            L +SGLQ YLNQ GFHIVGYGCTTCIGNSGD+DESV+SAIS+N                 
Sbjct  486  LQKSGLQRYLNQLGFHIVGYGCTTCIGNSGDIDESVASAISENGKFFNKNILGYTCIRML  545

Query  670  ------------DIVAAAVLSGNRNFEGRVHPLTRANYLASPP  762
                        D+VAAAVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  546  EADRLAVFYMRPDMVAAAVLSGNRNFEGRVHPLTRANYLASPP  588



>ref|XP_006346211.1| PREDICTED: aconitate hydratase 2, mitochondrial-like [Solanum 
tuberosum]
Length=980

 Score =   468 bits (1205),  Expect = 6e-155, Method: Compositional matrix adjust.
 Identities = 217/253 (86%), Positives = 240/253 (95%), Gaps = 0/253 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDH+TLQYL+LTGRS+ET+ MIE YLRAN MFVDYNEPQ+ERVYSS L+L
Sbjct  388  EYGATMGFFPVDHMTLQYLRLTGRSEETITMIEEYLRANKMFVDYNEPQEERVYSSYLEL  447

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRP+DRVPLK+MK+DWH+CLDNK GFKGFAVPKE Q+KVAKF+FHG P
Sbjct  448  ELADVEPCVSGPKRPNDRVPLKDMKADWHACLDNKQGFKGFAVPKEEQDKVAKFTFHGLP  507

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNP+VMLGA LVAKKA ELGL VKPW+KTSLAPGSG VTKY
Sbjct  508  AELKHGSVVIAAITSCTNTSNPNVMLGAGLVAKKACELGLEVKPWIKTSLAPGSGAVTKY  567

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGL++YLNQQGF++VGYGCTTCIGNSGDLDESV+SAI+DNDIVAAAVLSGNRNFEGR
Sbjct  568  LHKSGLEKYLNQQGFNLVGYGCTTCIGNSGDLDESVASAITDNDIVAAAVLSGNRNFEGR  627

Query  721  VHPLTRANYLASP  759
            VHPLTRANYLASP
Sbjct  628  VHPLTRANYLASP  640



>ref|XP_006380559.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
 gb|ERP58356.1| hypothetical protein POPTR_0007s09260g [Populus trichocarpa]
Length=899

 Score =   466 bits (1198),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD TV+MIE+YLRAN MFVDY+EPQ +RVYSS + L
Sbjct  305  EYGATMGFFPVDHVTLQYLKLTGRSDGTVSMIESYLRANKMFVDYSEPQIDRVYSSYIAL  364

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPL+EMK+DWH+CLDNKVGFKGFA+PKE+Q KVA+F+FHG P
Sbjct  365  NLRDVEPCISGPKRPHDRVPLREMKADWHACLDNKVGFKGFAIPKESQSKVAEFNFHGTP  424

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLG+ALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  425  AQLRHGDVVIAAITSCTNTSNPSVMLGSALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  484

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            + +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+DE+V+SAI++ND+VAAAVLSGNRNFEGR
Sbjct  485  MEKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDEAVASAITENDVVAAAVLSGNRNFEGR  544

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  545  VHPLTRANYLASPP  558



>ref|XP_012088458.1| PREDICTED: aconitate hydratase 1 [Jatropha curcas]
 gb|KDP23953.1| hypothetical protein JCGZ_25341 [Jatropha curcas]
Length=900

 Score =   466 bits (1198),  Expect = 8e-155, Method: Compositional matrix adjust.
 Identities = 216/254 (85%), Positives = 240/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGR+DETV +IE+YLRAN MFVDY+EPQ ERVY+S L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRTDETVCLIESYLRANKMFVDYSEPQIERVYTSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLD++VGFKGFA+PKE+Q KV +F+FHG P
Sbjct  366  NLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDSRVGFKGFAIPKESQSKVVEFNFHGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+LKHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  426  AQLKHGDVVIAAITSCTNTSNPSVMLGAALVAKKAFELGLEVKPWVKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLN  GFHIVGYGCTTCIGNSGD+DE+V+SAI++ND+VAAAVLSGNRNFEGR
Sbjct  486  LEKSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDEAVASAITENDLVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_009384004.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384006.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=977

 Score =   468 bits (1203),  Expect = 1e-154, Method: Compositional matrix adjust.
 Identities = 219/254 (86%), Positives = 241/254 (95%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+TVAMIE+YL+AN MFVDY++PQ ERVYSS L+L
Sbjct  383  EYGATMGFFPVDHVTLQYLKLTGRSDDTVAMIESYLQANKMFVDYSQPQTERVYSSYLEL  442

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DW SCLDNKVGFKGFAVPKE+Q+K+A+FSFHG  
Sbjct  443  NLGDVEPCVSGPKRPHDRVPLKEMKADWQSCLDNKVGFKGFAVPKESQDKIAEFSFHGTT  502

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
             ++KHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  503  TQIKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  562

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF+IVGYGCTTCIGNSGDLDE+VS+AIS+NDIVAAAVLSGNRNFEGR
Sbjct  563  LEKSGLQKYLNQLGFNIVGYGCTTCIGNSGDLDEAVSAAISENDIVAAAVLSGNRNFEGR  622

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  623  VHPLTRANYLASPP  636



>gb|KDO71347.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=797

 Score =   462 bits (1188),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+TV+MIE+YLRAN MFVDY+EPQ ERVYSS L+L
Sbjct  203  EYGATMGFFPVDHVTLQYLKLTGRSDDTVSMIESYLRANKMFVDYSEPQSERVYSSYLEL  262

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PKE Q KVA+F+FHG P
Sbjct  263  NLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPKEYQSKVAEFNFHGTP  322

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  323  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  382

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDIVAAAVLSGNRNFEGR
Sbjct  383  LQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDIVAAAVLSGNRNFEGR  442

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  443  VHPLTRANYLASPP  456



>gb|KEH27599.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=797

 Score =   461 bits (1187),  Expect = 2e-154, Method: Compositional matrix adjust.
 Identities = 216/254 (85%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIE+YLRAN MFVDYNEPQ ERVYSS L+L
Sbjct  203  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIESYLRANKMFVDYNEPQVERVYSSYLEL  262

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRV LKEMK+DWH+CL+NKVGFKGFAVPKE+Q K A+F FH  P
Sbjct  263  NLEDVEPCVSGPKRPHDRVTLKEMKADWHACLNNKVGFKGFAVPKESQTKFAEFKFHETP  322

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  323  AKLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLQVKPWIKTSLAPGSGVVTKY  382

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ YLNQ GF+IVGYGCTTCIGNSGD++E+V+SAI++NDIVAAAVLSGNRNFEGR
Sbjct  383  LQKSGLQPYLNQLGFNIVGYGCTTCIGNSGDINEAVASAITENDIVAAAVLSGNRNFEGR  442

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  443  VHPLTRANYLASPP  456



>gb|KDO71346.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=807

 Score =   461 bits (1186),  Expect = 4e-154, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+TV+MIE+YLRAN MFVDY+EPQ ERVYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDDTVSMIESYLRANKMFVDYSEPQSERVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PKE Q KVA+F+FHG P
Sbjct  366  NLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPKEYQSKVAEFNFHGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDIVAAAVLSGNRNFEGR
Sbjct  486  LQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_006412054.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 ref|XP_006412055.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53507.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53508.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=763

 Score =   459 bits (1182),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+TV+MIEAYLRAN MFVDY+EP+ + VYSS+L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDDTVSMIEAYLRANKMFVDYSEPESKTVYSSNLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFAVPKEAQ K  +F+F+G P
Sbjct  366  NLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFAVPKEAQSKAVEFNFNGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+AVLSGNRNFEGR
Sbjct  486  LAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVASAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_009382046.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=986

 Score =   466 bits (1199),  Expect = 5e-154, Method: Compositional matrix adjust.
 Identities = 219/254 (86%), Positives = 239/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIE YLRAN MFVDY++PQ ERVYSS L+L
Sbjct  392  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIETYLRANKMFVDYSQPQTERVYSSYLEL  451

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLK MKSDW +CLDNKVGFKGFAVPKE+Q K+A+FSF G P
Sbjct  452  NLEDVEPCISGPKRPHDRVPLKGMKSDWQTCLDNKVGFKGFAVPKESQNKIAEFSFRGTP  511

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A++KHG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  512  AQIKHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  571

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YL+Q GF+IVGYGCTTCIGNSG+LDE+VS+AIS+NDIVAAAVLSGNRNFEGR
Sbjct  572  LEKSGLQKYLDQLGFNIVGYGCTTCIGNSGELDEAVSAAISENDIVAAAVLSGNRNFEGR  631

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  632  VHPLTRANYLASPP  645



>ref|XP_008242011.1| PREDICTED: aconitate hydratase 1 [Prunus mume]
Length=898

 Score =   463 bits (1192),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 215/254 (85%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD VTLQYLKLTGRSD+ VA+IE+YLRAN MFVDYNEPQ ERVYSS L+L
Sbjct  306  EYGATMGFFPVDRVTLQYLKLTGRSDDKVALIESYLRANRMFVDYNEPQVERVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFAVPKE+Q KV +F+FHG P
Sbjct  366  NLNEVEPCISGPKRPHDRVTLKEMKVDWHACLDNRVGFKGFAVPKESQNKVVEFTFHGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V+SAI++NDIVAAAVLSGNRNFEGR
Sbjct  486  LQKSGLQQYLNQLGFHIVGYGCTTCIGNSGDIDDAVASAITENDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_009363442.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   463 bits (1192),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+ VA+IE+YLRAN MFVDYNEPQ ERVYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDDKVALIESYLRANKMFVDYNEPQIERVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFAVPKE+Q KV +F FHG P
Sbjct  366  NLNEVEPCISGPKRPHDRVALKEMKVDWHACLDNRVGFKGFAVPKESQSKVVEFDFHGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V+SAI++ND+VAAAVLSGNRNFEGR
Sbjct  486  LQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDDAVASAITENDVVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_007203240.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
 gb|EMJ04439.1| hypothetical protein PRUPE_ppa001138mg [Prunus persica]
Length=898

 Score =   463 bits (1192),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 215/254 (85%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD VTLQYLKLTGRSD+ VA+IE+YLRAN MFVDYNEPQ ERVYSS L+L
Sbjct  306  EYGATMGFFPVDRVTLQYLKLTGRSDDKVALIESYLRANRMFVDYNEPQVERVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFAVPKE+Q KV +F+FHG P
Sbjct  366  NLNEVEPCISGPKRPHDRVTLKEMKVDWHACLDNRVGFKGFAVPKESQNKVVEFTFHGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V+SAI++NDIVAAAVLSGNRNFEGR
Sbjct  486  LQKSGLQQYLNQLGFHIVGYGCTTCIGNSGDIDDAVASAITENDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_009787319.1| PREDICTED: aconitate hydratase, cytoplasmic-like isoform X1 [Nicotiana 
sylvestris]
Length=1017

 Score =   466 bits (1200),  Expect = 7e-154, Method: Compositional matrix adjust.
 Identities = 217/254 (85%), Positives = 237/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDH+TLQYL+LTGRS+ET+ MIE YLRAN MFVDYNEPQ+ERVYSS   L
Sbjct  425  EYGATMGFFPVDHMTLQYLRLTGRSEETITMIEEYLRANKMFVDYNEPQEERVYSSYSGL  484

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRP+DRV LK+MK+DWH+CLDNK GFKGFAVPK+ Q+KVAKF+FHG P
Sbjct  485  DLADVEPCISGPKRPNDRVALKDMKADWHACLDNKHGFKGFAVPKQEQDKVAKFTFHGLP  544

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGS+VIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSG VTKY
Sbjct  545  AELKHGSIVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWIKTSLAPGSGAVTKY  604

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQQGFH+VGYGCTTCIGNSGDLDESV+SAI+DNDIVAAAVLSGNRNFEGR
Sbjct  605  LHKSGLQKYLNQQGFHLVGYGCTTCIGNSGDLDESVASAITDNDIVAAAVLSGNRNFEGR  664

Query  721  VHPLTRANYLASPP  762
            VHP TRANYLASPP
Sbjct  665  VHPQTRANYLASPP  678



>gb|EYU24785.1| hypothetical protein MIMGU_mgv1a000742mg [Erythranthe guttata]
Length=997

 Score =   466 bits (1199),  Expect = 8e-154, Method: Compositional matrix adjust.
 Identities = 222/255 (87%), Positives = 238/255 (93%), Gaps = 1/255 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD VTLQYLKLTGRSDETV+MIEAYLRANNMFVDY+EPQQERVYSS L L
Sbjct  403  EYGATMGFFPVDKVTLQYLKLTGRSDETVSMIEAYLRANNMFVDYSEPQQERVYSSYLHL  462

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQ-  357
            DL DV PC+SGPKRPHDRVPLK+MK+DWHSCLD+KVGFKGFAVPKE QEKV KF F G+ 
Sbjct  463  DLGDVVPCVSGPKRPHDRVPLKDMKADWHSCLDSKVGFKGFAVPKETQEKVVKFLFKGEE  522

Query  358  PAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTK  537
            PAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGV TK
Sbjct  523  PAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLKVKPWVKTSLAPGSGVATK  582

Query  538  YLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEG  717
            YL +SGLQ+YLN+QGF+IVGYGCTTCIGNSGDL+++V  AI++NDIVAAAVLSGNRNFEG
Sbjct  583  YLQESGLQKYLNEQGFNIVGYGCTTCIGNSGDLEKTVGDAITENDIVAAAVLSGNRNFEG  642

Query  718  RVHPLTRANYLASPP  762
            RVHPLTRANYLASPP
Sbjct  643  RVHPLTRANYLASPP  657



>ref|XP_003537655.1| PREDICTED: aconitate hydratase, cytoplasmic-like [Glycine max]
Length=901

 Score =   463 bits (1191),  Expect = 9e-154, Method: Compositional matrix adjust.
 Identities = 215/254 (85%), Positives = 240/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYL+LTGRSDETV+MIE+YLRAN MFVDY+EPQ ERVYSS L+L
Sbjct  307  EYGATMGFFPVDHVTLQYLRLTGRSDETVSMIESYLRANKMFVDYSEPQVERVYSSYLEL  366

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPL+EMK DWH+CL+NKVGFKGFAVPKE+Q KVA+F+F G P
Sbjct  367  NLEDVEPCVSGPKRPHDRVPLREMKVDWHACLNNKVGFKGFAVPKESQNKVAEFTFQGTP  426

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  427  AHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWIKTSLAPGSGVVTKY  486

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLN+ GF+IVGYGCTTCIGNSGD++E+V+SAI++NDIVAAAVLSGNRNFEGR
Sbjct  487  LQRSGLQKYLNELGFNIVGYGCTTCIGNSGDINEAVASAITENDIVAAAVLSGNRNFEGR  546

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  547  VHPLTRANYLASPP  560



>gb|KHN41868.1| Aconitate hydratase 1 [Glycine soja]
Length=901

 Score =   463 bits (1191),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 215/254 (85%), Positives = 240/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYL+LTGRSDETV+MIE+YLRAN MFVDY+EPQ ERVYSS L+L
Sbjct  307  EYGATMGFFPVDHVTLQYLRLTGRSDETVSMIESYLRANKMFVDYSEPQVERVYSSYLEL  366

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPL+EMK DWH+CL+NKVGFKGFAVPKE+Q KVA+F+F G P
Sbjct  367  NLEDVEPCVSGPKRPHDRVPLREMKVDWHACLNNKVGFKGFAVPKESQNKVAEFTFQGTP  426

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  427  AHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWIKTSLAPGSGVVTKY  486

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLN+ GF+IVGYGCTTCIGNSGD++E+V+SAI++NDIVAAAVLSGNRNFEGR
Sbjct  487  LQRSGLQKYLNELGFNIVGYGCTTCIGNSGDINEAVASAITENDIVAAAVLSGNRNFEGR  546

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  547  VHPLTRANYLASPP  560



>ref|XP_010113288.1| Aconitate hydratase 1 [Morus notabilis]
 gb|EXC35295.1| Aconitate hydratase 1 [Morus notabilis]
Length=977

 Score =   465 bits (1196),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 215/254 (85%), Positives = 240/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+T++MIE+YLRAN MFVDY+EPQ ERVYSS L+L
Sbjct  366  EYGATMGFFPVDHVTLQYLKLTGRSDDTISMIESYLRANKMFVDYSEPQVERVYSSYLEL  425

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFAV KE+Q KV +F+FHG P
Sbjct  426  NLEDVEPCVSGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAVAKESQSKVVEFTFHGTP  485

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  486  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACKLGLEVKPWIKTSLAPGSGVVTKY  545

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ+YLN  GF+IVGYGCTTCIGNSGD+DE+V SAI++NDIVAAAVLSGNRNFEGR
Sbjct  546  LLKSGLQKYLNHLGFYIVGYGCTTCIGNSGDIDEAVGSAITENDIVAAAVLSGNRNFEGR  605

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  606  VHPLTRANYLASPP  619



>ref|XP_006383042.1| aconitate hydratase family protein [Populus trichocarpa]
 gb|ERP60839.1| aconitate hydratase family protein [Populus trichocarpa]
Length=899

 Score =   462 bits (1190),  Expect = 1e-153, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 240/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDET++MIE+YLRAN MFVDY+EPQ ER+YSS L L
Sbjct  305  EYGATMGFFPVDHVTLQYLKLTGRSDETISMIESYLRANRMFVDYSEPQIERMYSSYLAL  364

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPL+EMK+DWH+CLDN+VGFKGFA+PKE+Q KVA+FSF G  
Sbjct  365  NLEDVEPCISGPKRPHDRVPLREMKADWHACLDNRVGFKGFAIPKESQSKVAEFSFRGTS  424

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  425  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  484

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD+DE+V+SAI++ND+VAAAVLSGNRNFEGR
Sbjct  485  LEKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDEAVASAITENDLVAAAVLSGNRNFEGR  544

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  545  VHPLTRANYLASPP  558



>ref|XP_009344825.1| PREDICTED: aconitate hydratase 1 [Pyrus x bretschneideri]
Length=898

 Score =   462 bits (1189),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 237/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+ VA+IE+YLRAN MFVDYNEPQ  RVYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDDKVALIESYLRANKMFVDYNEPQIVRVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFAVPKE+Q KV +F FHG P
Sbjct  366  NLNDVEPCISGPKRPHDRVTLKEMKGDWHACLDNRVGFKGFAVPKESQSKVVEFDFHGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V++AI++ND+VAAAVLSGNRNFEGR
Sbjct  486  LQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDLVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_010437416.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   462 bits (1189),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 215/254 (85%), Positives = 237/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+TV+MIEAYLRAN MFVDY+EP+ + VYSSSL+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDDTVSMIEAYLRANKMFVDYSEPESKTVYSSSLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPL+EMK+DWHSCLDN+VGFKGFAVPKEAQ KV +F F+G P
Sbjct  366  NLADVEPCVSGPKRPHDRVPLREMKADWHSCLDNRVGFKGFAVPKEAQSKVVEFDFNGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+AVLSGNRNFEGR
Sbjct  486  LAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVASAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_004287770.1| PREDICTED: aconitate hydratase 1 [Fragaria vesca subsp. vesca]
Length=898

 Score =   462 bits (1188),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 215/254 (85%), Positives = 239/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGR+ +TVAMIE+YLRAN MFVDY+EPQ ERVYS+SL+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRTADTVAMIESYLRANKMFVDYSEPQLERVYSASLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
             L DVEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFAVPKE+Q KV +FSFHG P
Sbjct  366  KLEDVEPCISGPKRPHDRVSLKEMKVDWHACLDNRVGFKGFAVPKESQTKVVEFSFHGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD+D++V+SAI++NDIVAAAVLSGNRNFEGR
Sbjct  486  LEKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDDAVASAITENDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_009337075.1| PREDICTED: aconitate hydratase 1-like [Pyrus x bretschneideri]
Length=898

 Score =   462 bits (1188),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+ VA+IE+YLRAN MFVDYNEPQ ERVYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDDKVALIESYLRANKMFVDYNEPQIERVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFAVPKE+Q KV +F FHG P
Sbjct  366  NLNEVEPCISGPKRPHDRVALKEMKVDWHACLDNRVGFKGFAVPKESQSKVVEFDFHGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V++AI++ND+VAAAVLSGNRNFEGR
Sbjct  486  LQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDVVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>gb|KFK30197.1| hypothetical protein AALP_AA7G230700 [Arabis alpina]
Length=898

 Score =   462 bits (1188),  Expect = 2e-153, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 239/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+TV+MIEAYLRAN MFVDY+EP+ + VYSS+L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDDTVSMIEAYLRANKMFVDYSEPESKTVYSSNLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFAVPKEAQ KV +F F+G P
Sbjct  366  NLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFAVPKEAQSKVVEFDFNGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI+DND+VA+AVLSGNRNFEGR
Sbjct  486  LAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHETVASAITDNDLVASAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_011100304.1| PREDICTED: aconitate hydratase, cytoplasmic [Sesamum indicum]
Length=1001

 Score =   464 bits (1195),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 224/259 (86%), Positives = 238/259 (92%), Gaps = 6/259 (2%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSS----  168
            EYGATMGFFPVDHVTLQYLKLTGRSDETV MIEAYLRAN MFVDY+E  Q  ++S     
Sbjct  405  EYGATMGFFPVDHVTLQYLKLTGRSDETVEMIEAYLRANKMFVDYSE-IQSFLFSKCQXX  463

Query  169  -SLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFS  345
              L LDL DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDNKVGFKGFAVPKEAQ+KVA FS
Sbjct  464  XXLHLDLADVEPCISGPKRPHDRVPLKEMKADWHSCLDNKVGFKGFAVPKEAQQKVASFS  523

Query  346  FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSG  525
            FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSG
Sbjct  524  FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKTSLAPGSG  583

Query  526  VVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNR  705
            VVTKYL +SGLQ+YLNQQGF+IVGYGCTTCIGNSG+LDESV++ IS+NDIVAAAVLSGNR
Sbjct  584  VVTKYLQKSGLQKYLNQQGFNIVGYGCTTCIGNSGELDESVAATISENDIVAAAVLSGNR  643

Query  706  NFEGRVHPLTRANYLASPP  762
            NFEGRVHPLTRANYLASPP
Sbjct  644  NFEGRVHPLTRANYLASPP  662



>gb|KDO71345.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=889

 Score =   461 bits (1186),  Expect = 3e-153, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+TV+MIE+YLRAN MFVDY+EPQ ERVYSS L+L
Sbjct  295  EYGATMGFFPVDHVTLQYLKLTGRSDDTVSMIESYLRANKMFVDYSEPQSERVYSSYLEL  354

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PKE Q KVA+F+FHG P
Sbjct  355  NLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPKEYQSKVAEFNFHGTP  414

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  415  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  474

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDIVAAAVLSGNRNFEGR
Sbjct  475  LQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDIVAAAVLSGNRNFEGR  534

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  535  VHPLTRANYLASPP  548



>ref|XP_009598330.1| PREDICTED: aconitate hydratase, cytoplasmic isoform X1 [Nicotiana 
tomentosiformis]
Length=1063

 Score =   466 bits (1198),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 218/254 (86%), Positives = 235/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDH+TLQYLKLTGRS+ET+ MIE YLRAN MFVDYNEPQ+ERVYSS L L
Sbjct  472  EYGATMGFFPVDHMTLQYLKLTGRSEETITMIEEYLRANKMFVDYNEPQEERVYSSYLGL  531

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRP+DRV L +MK+DWH+CLDNK GFKGFAVPK+ Q+KVA F+FHG P
Sbjct  532  DLADVEPCVSGPKRPNDRVALNDMKADWHACLDNKHGFKGFAVPKQEQDKVATFTFHGLP  591

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSG VTKY
Sbjct  592  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWIKTSLAPGSGAVTKY  651

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ YLNQQGFH+VGYGCTTCIGNSGDLDESV+SAI+DNDIVAAAVLSGNRNFEGR
Sbjct  652  LHKSGLQTYLNQQGFHLVGYGCTTCIGNSGDLDESVASAITDNDIVAAAVLSGNRNFEGR  711

Query  721  VHPLTRANYLASPP  762
            VHP TRANYLASPP
Sbjct  712  VHPQTRANYLASPP  725



>ref|XP_003612247.1| Aconitate hydratase [Medicago truncatula]
 gb|AES95205.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=901

 Score =   461 bits (1187),  Expect = 4e-153, Method: Compositional matrix adjust.
 Identities = 216/254 (85%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIE+YLRAN MFVDYNEPQ ERVYSS L+L
Sbjct  307  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIESYLRANKMFVDYNEPQVERVYSSYLEL  366

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRV LKEMK+DWH+CL+NKVGFKGFAVPKE+Q K A+F FH  P
Sbjct  367  NLEDVEPCVSGPKRPHDRVTLKEMKADWHACLNNKVGFKGFAVPKESQTKFAEFKFHETP  426

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  427  AKLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLQVKPWIKTSLAPGSGVVTKY  486

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ YLNQ GF+IVGYGCTTCIGNSGD++E+V+SAI++NDIVAAAVLSGNRNFEGR
Sbjct  487  LQKSGLQPYLNQLGFNIVGYGCTTCIGNSGDINEAVASAITENDIVAAAVLSGNRNFEGR  546

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  547  VHPLTRANYLASPP  560



>ref|XP_006425366.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
 gb|ESR38606.1| hypothetical protein CICLE_v10024840mg [Citrus clementina]
Length=900

 Score =   461 bits (1186),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+TV+MIE+YLRAN MFVDY+EPQ ERVYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDDTVSMIESYLRANKMFVDYSEPQSERVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PKE Q KVA+F+FHG P
Sbjct  366  NLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPKEYQSKVAEFNFHGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDIVAAAVLSGNRNFEGR
Sbjct  486  LQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>gb|KDO71342.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=900

 Score =   461 bits (1186),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+TV+MIE+YLRAN MFVDY+EPQ ERVYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDDTVSMIESYLRANKMFVDYSEPQSERVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PKE Q KVA+F+FHG P
Sbjct  366  NLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPKEYQSKVAEFNFHGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDIVAAAVLSGNRNFEGR
Sbjct  486  LQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>emb|CBE71056.1| aconitate hydratase 1 [Citrus clementina]
Length=900

 Score =   461 bits (1186),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+TV+MIE+YLRAN MFVDY+EPQ ERVYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDDTVSMIESYLRANKMFVDYSEPQSERVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PKE Q KVA+F+FHG P
Sbjct  366  NLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPKEYQSKVAEFNFHGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDIVAAAVLSGNRNFEGR
Sbjct  486  LQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_006467022.1| PREDICTED: aconitate hydratase 1 [Citrus sinensis]
Length=900

 Score =   461 bits (1186),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+TV+MIE+YLRAN MFVDY+EPQ ERVYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDDTVSMIESYLRANKMFVDYSEPQSERVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PKE Q KVA+F+FHG P
Sbjct  366  NLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPKEYQSKVAEFNFHGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDIVAAAVLSGNRNFEGR
Sbjct  486  LQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDIVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_007157870.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
 gb|ESW29864.1| hypothetical protein PHAVU_002G105000g [Phaseolus vulgaris]
Length=901

 Score =   461 bits (1186),  Expect = 5e-153, Method: Compositional matrix adjust.
 Identities = 216/254 (85%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYL+LTGRSDETV+MIE+YLRAN MFVDY+EPQ ERVYSS L+L
Sbjct  307  EYGATMGFFPVDHVTLQYLRLTGRSDETVSMIESYLRANKMFVDYSEPQVERVYSSYLEL  366

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVE C+SGPKRPHDRVPLKEMK+DW +CL+N+VGFKGFAVP E+Q KVA F+FHG P
Sbjct  367  NLEDVESCVSGPKRPHDRVPLKEMKADWLACLNNRVGFKGFAVPVESQIKVADFTFHGTP  426

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  427  AHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWIKTSLAPGSGVVTKY  486

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+DE+V+SAI++NDIVAAAVLSGNRNFEGR
Sbjct  487  LQRSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDEAVASAITENDIVAAAVLSGNRNFEGR  546

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  547  VHPLTRANYLASPP  560



>emb|CDY41626.1| BnaC03g62580D [Brassica napus]
Length=905

 Score =   461 bits (1185),  Expect = 9e-153, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIEAYLRAN MFVDY+EP+ + VYS++L+L
Sbjct  313  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANKMFVDYSEPESKTVYSANLEL  372

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFAVPKEAQ K  +F+F+G P
Sbjct  373  NLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFAVPKEAQSKAVEFNFNGTP  432

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  433  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  492

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF +VGYGCTTCIGNSGD+ E+V+SAI DND+VA+AVLSGNRNFEGR
Sbjct  493  LAKSGLQKYLNQLGFSVVGYGCTTCIGNSGDIHEAVASAIVDNDLVASAVLSGNRNFEGR  552

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  553  VHPLTRANYLASPP  566



>ref|XP_006412056.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
 gb|ESQ53509.1| hypothetical protein EUTSA_v10024358mg [Eutrema salsugineum]
Length=898

 Score =   460 bits (1184),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+TV+MIEAYLRAN MFVDY+EP+ + VYSS+L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDDTVSMIEAYLRANKMFVDYSEPESKTVYSSNLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFAVPKEAQ K  +F+F+G P
Sbjct  366  NLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFAVPKEAQSKAVEFNFNGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+AVLSGNRNFEGR
Sbjct  486  LAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVASAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>emb|CDY24823.1| BnaA08g14870D [Brassica napus]
Length=922

 Score =   461 bits (1185),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIEAYLRAN MFVDY+EP+ + VYS++L+L
Sbjct  330  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANKMFVDYSEPESKTVYSANLEL  389

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFAVPKEAQ K  +F+F+G P
Sbjct  390  NLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFAVPKEAQSKAVEFNFNGTP  449

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  450  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  509

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+AVLSGNRNFEGR
Sbjct  510  LAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVASAVLSGNRNFEGR  569

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  570  VHPLTRANYLASPP  583



>ref|XP_003517155.1| PREDICTED: aconitate hydratase 1 [Glycine max]
Length=901

 Score =   460 bits (1183),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 239/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYL+LTGRSDETV+MIE+YLRAN MFVDY+EPQ ERVYSS L+L
Sbjct  307  EYGATMGFFPVDHVTLQYLRLTGRSDETVSMIESYLRANKMFVDYSEPQVERVYSSYLEL  366

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPL+EMK DWH+CL+NKVGFKGFAV KE+Q KVA+F+F G P
Sbjct  367  NLEDVEPCVSGPKRPHDRVPLREMKVDWHACLNNKVGFKGFAVSKESQNKVAEFTFQGTP  426

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  427  AHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWIKTSLAPGSGVVTKY  486

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLN+ GF+IVGYGCTTCIGNSGD++E+V+SAI++NDIVAAAVLSGNRNFEGR
Sbjct  487  LQRSGLQKYLNELGFNIVGYGCTTCIGNSGDINEAVASAITENDIVAAAVLSGNRNFEGR  546

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  547  VHPLTRANYLASPP  560



>ref|XP_010446873.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
 ref|XP_010446874.1| PREDICTED: aconitate hydratase 1 [Camelina sativa]
Length=898

 Score =   460 bits (1183),  Expect = 1e-152, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 237/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+TV+MIEAYLRAN MFVDY+EP+ + VYSSSL+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDDTVSMIEAYLRANKMFVDYSEPESKTVYSSSLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPL+EMK+DWHSCLDN+VGFKGFAVPKEAQ KV +F F+G P
Sbjct  366  NLEDVEPCVSGPKRPHDRVPLREMKADWHSCLDNRVGFKGFAVPKEAQSKVVEFDFNGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+AVLSGNRNFEGR
Sbjct  486  LAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVASAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>gb|KHN36000.1| Aconitate hydratase, cytoplasmic [Glycine soja]
Length=908

 Score =   460 bits (1183),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 239/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYL+LTGRSDETV+MIE+YLRAN MFVDY+EPQ ERVYSS L+L
Sbjct  314  EYGATMGFFPVDHVTLQYLRLTGRSDETVSMIESYLRANKMFVDYSEPQVERVYSSYLEL  373

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPL+EMK DWH+CL+NKVGFKGFAV KE+Q KVA+F+F G P
Sbjct  374  NLEDVEPCVSGPKRPHDRVPLREMKVDWHACLNNKVGFKGFAVSKESQNKVAEFTFQGTP  433

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  434  AHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWIKTSLAPGSGVVTKY  493

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLN+ GF+IVGYGCTTCIGNSGD++E+V+SAI++NDIVAAAVLSGNRNFEGR
Sbjct  494  LQRSGLQKYLNELGFNIVGYGCTTCIGNSGDINEAVASAITENDIVAAAVLSGNRNFEGR  553

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  554  VHPLTRANYLASPP  567



>ref|XP_006285963.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
 gb|EOA18861.1| hypothetical protein CARUB_v10007484mg [Capsella rubella]
Length=898

 Score =   459 bits (1182),  Expect = 2e-152, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+TV+MIEAYLRAN MFVDY+EP+ + VYSS+L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDDTVSMIEAYLRANKMFVDYSEPESKTVYSSNLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L  VEPC+SGPKRPHDRVPL+EMK+DWHSCLDN+VGFKGFAVPKEAQ KVA+F+F+G P
Sbjct  366  NLEGVEPCVSGPKRPHDRVPLREMKADWHSCLDNRVGFKGFAVPKEAQSKVAEFNFNGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+AVLSGNRNFEGR
Sbjct  486  LAKSGLQQYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVASAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_010432222.1| PREDICTED: aconitate hydratase 1-like [Camelina sativa]
Length=898

 Score =   459 bits (1181),  Expect = 3e-152, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 236/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+TV+MIEAYLRAN MFVDY+EP+ + VYSSSL+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDDTVSMIEAYLRANKMFVDYSEPESKTVYSSSLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPL+EMK+DWHSCLDN+VGFKGFAVPKEAQ KV +F F+G P
Sbjct  366  NLEDVEPCVSGPKRPHDRVPLREMKADWHSCLDNRVGFKGFAVPKEAQNKVVEFDFNGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AHLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLN  GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+AVLSGNRNFEGR
Sbjct  486  LAKSGLQKYLNHLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVASAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_009150005.1| PREDICTED: aconitate hydratase 1 [Brassica rapa]
Length=898

 Score =   459 bits (1180),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 215/254 (85%), Positives = 236/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRAN MFVDYNEP  + VYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANKMFVDYNEPASKTVYSSKLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLD++VGFKGFAVPKEAQ K  +F+F+G P
Sbjct  366  NLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDSRVGFKGFAVPKEAQSKAVEFNFNGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AKLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YL+Q GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+AVLSGNRNFEGR
Sbjct  486  LAKSGLQKYLSQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVASAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|XP_008337967.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=898

 Score =   459 bits (1180),  Expect = 4e-152, Method: Compositional matrix adjust.
 Identities = 211/254 (83%), Positives = 238/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+ VA+IE+YLRAN MFVDYNEPQ ERVYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDDKVALIESYLRANKMFVDYNEPQIERVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGF+VPKE+Q KV +F+F G P
Sbjct  366  NLNEVEPCISGPKRPHDRVALKEMKVDWHACLDNRVGFKGFSVPKESQSKVVEFNFQGSP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V++AI++ND+VAAAVLSGNRNFEGR
Sbjct  486  LQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDVVAAAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>emb|CDX75532.1| BnaA01g01700D [Brassica napus]
Length=925

 Score =   459 bits (1181),  Expect = 5e-152, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 237/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRAN MFVDY+EP  + +YSS+L+L
Sbjct  333  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANKMFVDYSEPASKTIYSSTLEL  392

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLD++VGFKGFAVPKEAQ K  +F+F+G P
Sbjct  393  NLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDSRVGFKGFAVPKEAQSKAVEFNFNGTP  452

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  453  AKLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  512

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+AVLSGNRNFEGR
Sbjct  513  LAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVASAVLSGNRNFEGR  572

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  573  VHPLTRANYLASPP  586



>ref|XP_004512178.1| PREDICTED: aconitate hydratase 1-like [Cicer arietinum]
Length=901

 Score =   458 bits (1178),  Expect = 7e-152, Method: Compositional matrix adjust.
 Identities = 215/254 (85%), Positives = 240/254 (94%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV++IE+YLRAN MFVDY+EPQ ERVYSS L+L
Sbjct  307  EYGATMGFFPVDHVTLQYLKLTGRSDETVSLIESYLRANKMFVDYSEPQVERVYSSYLEL  366

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRV LKEMK DWH+CL+NKVGFKGFAVPKE+Q KVA+F+F+  P
Sbjct  367  NLEDVEPCVSGPKRPHDRVTLKEMKIDWHACLNNKVGFKGFAVPKESQTKVAEFTFNETP  426

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  427  AKLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWIKTSLAPGSGVVTKY  486

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD++E+V+SAI++NDIVAAAVLSGNRNFEGR
Sbjct  487  LQRSGLQKYLNQLGFNIVGYGCTTCIGNSGDINEAVASAITENDIVAAAVLSGNRNFEGR  546

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  547  VHPLTRANYLASPP  560



>emb|CDX69174.1| BnaC01g02790D [Brassica napus]
Length=901

 Score =   458 bits (1178),  Expect = 8e-152, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 237/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRAN MFVDY+EP  + VYSS+L+L
Sbjct  309  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANKMFVDYSEPASKTVYSSNLEL  368

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDR+PLKEMK+DWHSCLD++VGFKGFAVPKEAQ K  +F+F+G P
Sbjct  369  NLEDVEPCVSGPKRPHDRLPLKEMKADWHSCLDSRVGFKGFAVPKEAQSKAVEFNFNGTP  428

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  429  AKLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  488

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+AVLSGNRNFEGR
Sbjct  489  LAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVASAVLSGNRNFEGR  548

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  549  VHPLTRANYLASPP  562



>ref|XP_009109264.1| PREDICTED: aconitate hydratase 1-like [Brassica rapa]
Length=898

 Score =   457 bits (1177),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 212/254 (83%), Positives = 236/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIEAYLRAN MFVDY+EP+ + VYS++L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAYLRANKMFVDYSEPESKTVYSANLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFAVPKEAQ K  +F+F+G P
Sbjct  366  NLEDVEPCISGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFAVPKEAQSKAVEFNFNGTP  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIA ITSCTNTSNP VMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAPITSCTNTSNPRVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+AVLSGNRNFEGR
Sbjct  486  LAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVASAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>ref|NP_001119125.1| aconitate hydratase 1 [Arabidopsis thaliana]
 gb|AEE86577.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=795

 Score =   454 bits (1169),  Expect = 1e-151, Method: Compositional matrix adjust.
 Identities = 211/254 (83%), Positives = 236/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYL+LTGRSD+TV+MIEAYLRAN MFVDY+EP+ + VYSS L+L
Sbjct  203  EYGATMGFFPVDHVTLQYLRLTGRSDDTVSMIEAYLRANKMFVDYSEPESKTVYSSCLEL  262

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFAVPKEAQ K  +F+F+G  
Sbjct  263  NLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFAVPKEAQSKAVEFNFNGTT  322

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  323  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEVKPWIKTSLAPGSGVVTKY  382

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+AVLSGNRNFEGR
Sbjct  383  LAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVASAVLSGNRNFEGR  442

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  443  VHPLTRANYLASPP  456



>ref|XP_002869584.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45843.1| hypothetical protein ARALYDRAFT_492099 [Arabidopsis lyrata subsp. 
lyrata]
Length=995

 Score =   458 bits (1179),  Expect = 5e-151, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 234/254 (92%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL+YLKLTGRSDETV+MIE+YLRANNMFVDYNEPQQER Y+S LQL
Sbjct  403  EYGATMGFFPVDHVTLEYLKLTGRSDETVSMIESYLRANNMFVDYNEPQQERAYTSYLQL  462

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFAVPKE QE+V KFS++GQP
Sbjct  463  DLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFAVPKEKQEEVVKFSYNGQP  522

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKAS+LGL VKPWVKTSLAPGS VV KY
Sbjct  523  AEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKASDLGLEVKPWVKTSLAPGSRVVEKY  582

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGL+EYL +QGF IVGYGCTTCIGNSG+LD  V+SAI   DI+ AAVLSGNRNFEGR
Sbjct  583  LDRSGLREYLTKQGFEIVGYGCTTCIGNSGNLDPEVASAIEGTDIIPAAVLSGNRNFEGR  642

Query  721  VHPLTRANYLASPP  762
            VHP TRANYLASPP
Sbjct  643  VHPQTRANYLASPP  656



>ref|XP_010438674.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=795

 Score =   451 bits (1161),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 212/254 (83%), Positives = 231/254 (91%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL+YLKLTGRSDETV+MIE+YLRANNMFVDYNEP QER Y+S LQL
Sbjct  203  EYGATMGFFPVDHVTLEYLKLTGRSDETVSMIESYLRANNMFVDYNEPPQERAYTSYLQL  262

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  VEPC+SGPKRPHDRVPLK+MK+DW +CLDN VGFKGFAVPKE QE+V KFS+ GQP
Sbjct  263  DLGHVEPCISGPKRPHDRVPLKDMKADWQACLDNPVGFKGFAVPKEKQEEVVKFSYKGQP  322

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA ELG+ VKPWVKTSLAPGS VV KY
Sbjct  323  AEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKALELGVEVKPWVKTSLAPGSRVVEKY  382

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGL+EYLN+QGF IVGYGCTTCIGNSGDL+  V+SAI   DI+ AAVLSGNRNFEGR
Sbjct  383  LDRSGLREYLNKQGFQIVGYGCTTCIGNSGDLEPEVASAIEGTDIIPAAVLSGNRNFEGR  442

Query  721  VHPLTRANYLASPP  762
            VHP TRANYLASPP
Sbjct  443  VHPQTRANYLASPP  456



>ref|NP_195308.1| aconitate hydratase 1 [Arabidopsis thaliana]
 sp|Q42560.2|ACO1_ARATH RecName: Full=Aconitate hydratase 1; Short=Aconitase 1; AltName: 
Full=Citrate hydro-lyase 1 [Arabidopsis thaliana]
 emb|CAA21469.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 emb|CAB81492.1| cytoplasmatic aconitate hydratase (citrate hydro-lyase)(aconitase)(EC 
4.2.1.3) [Arabidopsis thaliana]
 gb|AAL32850.1| Unknown protein [Arabidopsis thaliana]
 gb|AEE86576.1| aconitate hydratase 1 [Arabidopsis thaliana]
Length=898

 Score =   454 bits (1168),  Expect = 2e-150, Method: Compositional matrix adjust.
 Identities = 211/254 (83%), Positives = 236/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYL+LTGRSD+TV+MIEAYLRAN MFVDY+EP+ + VYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLRLTGRSDDTVSMIEAYLRANKMFVDYSEPESKTVYSSCLEL  365

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFAVPKEAQ K  +F+F+G  
Sbjct  366  NLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFAVPKEAQSKAVEFNFNGTT  425

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  426  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEVKPWIKTSLAPGSGVVTKY  485

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+AVLSGNRNFEGR
Sbjct  486  LAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVASAVLSGNRNFEGR  545

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  546  VHPLTRANYLASPP  559



>emb|CAA58046.1| aconitase [Arabidopsis thaliana]
Length=919

 Score =   454 bits (1169),  Expect = 3e-150, Method: Compositional matrix adjust.
 Identities = 211/254 (83%), Positives = 236/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYL+LTGRSD+TV+MIEAYLRAN MFVDY+EP+ + VYSS L+L
Sbjct  328  EYGATMGFFPVDHVTLQYLRLTGRSDDTVSMIEAYLRANKMFVDYSEPESKTVYSSCLEL  387

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWHSCLDN+VGFKGFAVPKEAQ K  +F+F+G  
Sbjct  388  NLEDVEPCVSGPKRPHDRVPLKEMKADWHSCLDNRVGFKGFAVPKEAQSKAVEFNFNGTT  447

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPW+KTSLAPGSGVVTKY
Sbjct  448  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACDLGLEVKPWIKTSLAPGSGVVTKY  507

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+ E+V+SAI DND+VA+AVLSGNRNFEGR
Sbjct  508  LAKSGLQKYLNQLGFSIVGYGCTTCIGNSGDIHEAVASAIVDNDLVASAVLSGNRNFEGR  567

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  568  VHPLTRANYLASPP  581



>ref|XP_010448188.1| PREDICTED: aconitate hydratase 3, mitochondrial-like [Camelina 
sativa]
Length=998

 Score =   455 bits (1171),  Expect = 9e-150, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 232/254 (91%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL+YLKLTGRSDETV+MIE+YLRANNMFVDYNEPQQER Y+S LQL
Sbjct  406  EYGATMGFFPVDHVTLEYLKLTGRSDETVSMIESYLRANNMFVDYNEPQQERAYTSYLQL  465

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  VEPC+SGPKRPHDRVPLK+MK+DW +CLDN VGFKGFAVPKE QE+V KFS+ GQP
Sbjct  466  DLGHVEPCISGPKRPHDRVPLKDMKADWQACLDNPVGFKGFAVPKEKQEEVVKFSYKGQP  525

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA ELG+ VKPWVKTSLAPGS VV KY
Sbjct  526  AEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKALELGVEVKPWVKTSLAPGSRVVEKY  585

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGL+EYLN+QGF IVGYGCTTCIGNSGDL+  V+SAI   DI+ AAVLSGNRNFEGR
Sbjct  586  LDRSGLREYLNKQGFQIVGYGCTTCIGNSGDLEPEVASAIEGTDIIPAAVLSGNRNFEGR  645

Query  721  VHPLTRANYLASPP  762
            VHP TRANYLASPP
Sbjct  646  VHPQTRANYLASPP  659



>ref|XP_010433420.1| PREDICTED: aconitate hydratase 3, mitochondrial [Camelina sativa]
Length=997

 Score =   455 bits (1170),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 232/254 (91%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL+YLKLTGRSDETV+MIE+YLRANNMFVDYNEPQQER Y+S LQL
Sbjct  405  EYGATMGFFPVDHVTLEYLKLTGRSDETVSMIESYLRANNMFVDYNEPQQERAYTSYLQL  464

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  VEPC+SGPKRPHDRVPLK+MK+DW +CLDN VGFKGFAVPKE QE+V KFS+ GQP
Sbjct  465  DLGHVEPCISGPKRPHDRVPLKDMKADWQACLDNPVGFKGFAVPKEKQEEVVKFSYKGQP  524

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA ELG+ VKPWVKTSLAPGS VV KY
Sbjct  525  AEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKALELGVEVKPWVKTSLAPGSRVVEKY  584

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGL+EYLN+QGF IVGYGCTTCIGNSGDL+  V+SAI   DI+ AAVLSGNRNFEGR
Sbjct  585  LDRSGLREYLNKQGFQIVGYGCTTCIGNSGDLEPEVASAIEGTDIIPAAVLSGNRNFEGR  644

Query  721  VHPLTRANYLASPP  762
            VHP TRANYLASPP
Sbjct  645  VHPQTRANYLASPP  658



>gb|AFW61053.1| hypothetical protein ZEAMMB73_482448 [Zea mays]
Length=617

 Score =   444 bits (1141),  Expect = 1e-149, Method: Compositional matrix adjust.
 Identities = 209/240 (87%), Positives = 222/240 (93%), Gaps = 0/240 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL YLKLTGRSDETV+MIEAYLRAN MFVDYNEP  ER+YSS L+L
Sbjct  203  EYGATMGFFPVDHVTLDYLKLTGRSDETVSMIEAYLRANKMFVDYNEPPTERIYSSYLEL  262

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEP +SGPKRPHDRVPLKEMKSDWH+CLDNKVGFKGFAVPKE Q+KV KF FHGQP
Sbjct  263  NLDEVEPSMSGPKRPHDRVPLKEMKSDWHACLDNKVGFKGFAVPKEQQDKVVKFDFHGQP  322

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  323  AEMKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKPWVKTSLAPGSGVVTKY  382

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVS+AI++ND+VAAAVLSGN     R
Sbjct  383  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSTAITENDVVAAAVLSGNDEVMAR  442



>gb|EEE58288.1| hypothetical protein OsJ_09326 [Oryza sativa Japonica Group]
Length=907

 Score =   452 bits (1163),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 216/254 (85%), Positives = 234/254 (92%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD  TL YLKLTGRSD+TVAMIE+YLRAN MFVDYN+P+ ERVYSS L+L
Sbjct  315  EYGATMGFFPVDGKTLDYLKLTGRSDDTVAMIESYLRANKMFVDYNQPEAERVYSSYLEL  374

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPCLSGPKRPHDRV LK MKSDW SCLDN VGFKGFAVPKE+Q KVA+FSFHG P
Sbjct  375  NLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDNDVGFKGFAVPKESQGKVAEFSFHGTP  434

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+LKHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KTSLAPGSGVV KY
Sbjct  435  AKLKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVKKY  494

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDE+VS+AISDNDIVAAAVLSGNRNFEGR
Sbjct  495  LDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDETVSAAISDNDIVAAAVLSGNRNFEGR  554

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  555  VHALTRANYLASPP  568



>ref|NP_567763.2| aconitase 2 [Arabidopsis thaliana]
 sp|Q94A28.3|ACO3M_ARATH RecName: Full=Aconitate hydratase 3, mitochondrial; Short=Aconitase 
3; AltName: Full=Citrate hydro-lyase 3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AEE85279.1| aconitase 2 [Arabidopsis thaliana]
Length=995

 Score =   454 bits (1168),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 233/254 (92%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL+YLKLTGRSDETV+MIE+YLRANNMFVDYNEPQQER Y+S LQL
Sbjct  403  EYGATMGFFPVDHVTLEYLKLTGRSDETVSMIESYLRANNMFVDYNEPQQERAYTSYLQL  462

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFAVPKE QE+V KFS++GQP
Sbjct  463  DLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFAVPKEKQEEVVKFSYNGQP  522

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKAS+LGL VKPWVKTSLAPGS VV KY
Sbjct  523  AEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKASDLGLKVKPWVKTSLAPGSRVVEKY  582

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGL+E L +QGF IVGYGCTTCIGNSG+LD  V+SAI   DI+ AAVLSGNRNFEGR
Sbjct  583  LDRSGLRESLTKQGFEIVGYGCTTCIGNSGNLDPEVASAIEGTDIIPAAVLSGNRNFEGR  642

Query  721  VHPLTRANYLASPP  762
            VHP TRANYLASPP
Sbjct  643  VHPQTRANYLASPP  656



>emb|CDY66424.1| BnaAnng22230D [Brassica napus]
Length=995

 Score =   454 bits (1168),  Expect = 2e-149, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 233/254 (92%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL+YLKLTGRSDETV+MIE+YLRANNMFVDYNEPQQER Y+S LQL
Sbjct  403  EYGATMGFFPVDHVTLEYLKLTGRSDETVSMIESYLRANNMFVDYNEPQQERAYTSYLQL  462

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFAVPKE Q +V KFS+ GQP
Sbjct  463  DLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFAVPKEKQGEVVKFSYEGQP  522

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA +LGL VKPWVKTSLAPGS VV KY
Sbjct  523  AEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKAFDLGLKVKPWVKTSLAPGSRVVEKY  582

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGL+E LN+QGF IVGYGCTTCIGNSGDLD+SV++AI   DI+ AAVLSGNRNFEGR
Sbjct  583  LDRSGLREDLNKQGFQIVGYGCTTCIGNSGDLDKSVAAAIEGTDIIPAAVLSGNRNFEGR  642

Query  721  VHPLTRANYLASPP  762
            VHP TRANYLASPP
Sbjct  643  VHPQTRANYLASPP  656



>gb|KDO71343.1| hypothetical protein CISIN_1g002610mg [Citrus sinensis]
Length=898

 Score =   451 bits (1161),  Expect = 3e-149, Method: Compositional matrix adjust.
 Identities = 211/254 (83%), Positives = 236/254 (93%), Gaps = 2/254 (1%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+TV+MIE+YLRAN MFVDY+E   ERVYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDDTVSMIESYLRANKMFVDYSE--SERVYSSYLEL  363

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +V PC+SGPKRPHDRVPL EMK+DWH+CLDN+VGFKGFA+PKE Q KVA+F+FHG P
Sbjct  364  NLEEVVPCVSGPKRPHDRVPLNEMKADWHACLDNRVGFKGFAIPKEYQSKVAEFNFHGTP  423

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  424  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  483

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L  SGLQ+YLN  GFHIVGYGCTTCIGNSGD+D++V++AI++NDIVAAAVLSGNRNFEGR
Sbjct  484  LQNSGLQKYLNHLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDIVAAAVLSGNRNFEGR  543

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  544  VHPLTRANYLASPP  557



>sp|Q42669.1|ACOC_CUCMC RecName: Full=Aconitate hydratase; Short=Aconitase; AltName: 
Full=Citrate hydro-lyase, partial [Cucumis melo var. conomon]
 emb|CAA58047.1| aconitase [Cucumis melo]
Length=764

 Score =   447 bits (1149),  Expect = 4e-149, Method: Compositional matrix adjust.
 Identities = 210/254 (83%), Positives = 234/254 (92%), Gaps = 1/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGR DET++MIE+YL AN MFVDY+EPQ ERVYSS ++L
Sbjct  172  EYGATMGFFPVDHVTLQYLKLTGRKDETISMIESYLLANKMFVDYSEPQVERVYSSHIEL  231

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L DVEPC+SGPKRPHDRVPLKEMK+DWH+CLDN+VGFKGFA+PKEAQ KVA+F+FHG P
Sbjct  232  NLSDVEPCISGPKRPHDRVPLKEMKADWHACLDNRVGFKGFAIPKEAQVKVAEFNFHGSP  291

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTS+ SVMLGAALVAKKA ELGL VKPW+KT L    GVVTKY
Sbjct  292  AQLRHGDVVIAAITSCTNTSS-SVMLGAALVAKKACELGLEVKPWIKTVLLQALGVVTKY  350

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF+IVGYGCTTCIGNSGD+DESV+SAI+ NDIVAAAVLSGNRNFEGR
Sbjct  351  LAKSGLQKYLNQLGFNIVGYGCTTCIGNSGDIDESVASAITGNDIVAAAVLSGNRNFEGR  410

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  411  VHPLTRANYLASPP  424



>emb|CDY14291.1| BnaA08g14220D [Brassica napus]
Length=995

 Score =   453 bits (1166),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 233/254 (92%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL+YLKLTGRSDETV+MIE+YLRANNMFVDYNEPQQER Y+S LQL
Sbjct  403  EYGATMGFFPVDHVTLEYLKLTGRSDETVSMIESYLRANNMFVDYNEPQQERAYTSYLQL  462

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFAVPKE Q +V KFS+ GQP
Sbjct  463  DLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFAVPKEKQGEVVKFSYDGQP  522

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA +LGL VKPWVKTSLAPGS VV KY
Sbjct  523  AEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKAFDLGLKVKPWVKTSLAPGSRVVEKY  582

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGL+E LN+QGF IVGYGCTTCIGNSGDLD+SV++AI   DI+ AAVLSGNRNFEGR
Sbjct  583  LDRSGLREDLNKQGFQIVGYGCTTCIGNSGDLDKSVAAAIEGTDIIPAAVLSGNRNFEGR  642

Query  721  VHPLTRANYLASPP  762
            VHP TRANYLASPP
Sbjct  643  VHPQTRANYLASPP  656



>ref|XP_004985790.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Setaria 
italica]
Length=986

 Score =   453 bits (1165),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 235/254 (93%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD  TL YL+LTGRSD+TVAM+E+YLRAN MFVD+N+ + ERVYSS L+L
Sbjct  394  EYGATMGFFPVDGKTLDYLRLTGRSDDTVAMVESYLRANKMFVDHNQVEAERVYSSYLEL  453

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPCLSGPKRPHDRV LK MKSDWHSCLDN VGFKGFAVPKE+Q KVA+FSFHG P
Sbjct  454  NLEEVEPCLSGPKRPHDRVTLKNMKSDWHSCLDNDVGFKGFAVPKESQSKVAEFSFHGAP  513

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KTSLAPGSGVV KY
Sbjct  514  AKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVKKY  573

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YL+Q GFHIVGYGCTTCIGNSGDLDESVS+AIS+NDIVAAAVLSGNRNFEGR
Sbjct  574  LDKSGLQKYLDQLGFHIVGYGCTTCIGNSGDLDESVSAAISENDIVAAAVLSGNRNFEGR  633

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  634  VHPLTRANYLASPP  647



>gb|EEC74472.1| hypothetical protein OsI_09921 [Oryza sativa Indica Group]
Length=986

 Score =   453 bits (1165),  Expect = 5e-149, Method: Compositional matrix adjust.
 Identities = 216/254 (85%), Positives = 234/254 (92%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD  TL YLKLTGRSD+TVAMIE+YLRAN MFVDYN+P+ ERVYSS L+L
Sbjct  394  EYGATMGFFPVDGKTLDYLKLTGRSDDTVAMIESYLRANKMFVDYNQPEAERVYSSYLEL  453

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPCLSGPKRPHDRV LK MKSDW SCLDN VGFKGFAVPKE+Q KVA+FSFHG P
Sbjct  454  NLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDNDVGFKGFAVPKESQGKVAEFSFHGTP  513

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+LKHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KTSLAPGSGVV KY
Sbjct  514  AKLKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVKKY  573

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDE+VS+AISDNDIVAAAVLSGNRNFEGR
Sbjct  574  LDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDETVSAAISDNDIVAAAVLSGNRNFEGR  633

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  634  VHALTRANYLASPP  647



>ref|NP_001048898.1| Os03g0136900 [Oryza sativa Japonica Group]
 gb|ABF93861.1| Aconitate hydratase, cytoplasmic, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF10812.1| Os03g0136900 [Oryza sativa Japonica Group]
Length=986

 Score =   453 bits (1165),  Expect = 6e-149, Method: Compositional matrix adjust.
 Identities = 216/254 (85%), Positives = 234/254 (92%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD  TL YLKLTGRSD+TVAMIE+YLRAN MFVDYN+P+ ERVYSS L+L
Sbjct  394  EYGATMGFFPVDGKTLDYLKLTGRSDDTVAMIESYLRANKMFVDYNQPEAERVYSSYLEL  453

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPCLSGPKRPHDRV LK MKSDW SCLDN VGFKGFAVPKE+Q KVA+FSFHG P
Sbjct  454  NLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDNDVGFKGFAVPKESQGKVAEFSFHGTP  513

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+LKHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KTSLAPGSGVV KY
Sbjct  514  AKLKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVKKY  573

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDE+VS+AISDNDIVAAAVLSGNRNFEGR
Sbjct  574  LDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDETVSAAISDNDIVAAAVLSGNRNFEGR  633

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  634  VHALTRANYLASPP  647



>ref|XP_006651017.1| PREDICTED: putative aconitate hydratase, cytoplasmic-like [Oryza 
brachyantha]
Length=906

 Score =   450 bits (1158),  Expect = 8e-149, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 234/254 (92%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD  TL YLKLTGRSD+TV+MIE+YLRAN MFVDYN+P+ ERVYSS L+L
Sbjct  314  EYGATMGFFPVDGKTLDYLKLTGRSDDTVSMIESYLRANKMFVDYNQPEAERVYSSYLEL  373

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPCLSGPKRPHDRV LK MKSDW SCLDN VGFKGFAVPKE+Q KVA FSFHG P
Sbjct  374  NLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDNDVGFKGFAVPKESQGKVADFSFHGTP  433

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KTSLAPGSGVV KY
Sbjct  434  AKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVKKY  493

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDE+VS+AI++NDIVAAAVLSGNRNFEGR
Sbjct  494  LDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDETVSAAIAENDIVAAAVLSGNRNFEGR  553

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  554  VHPLTRANYLASPP  567



>gb|AAK91447.1| AT4g26970/F10M23_310 [Arabidopsis thaliana]
 gb|AAN18061.1| At4g26970/F10M23_310 [Arabidopsis thaliana]
Length=995

 Score =   452 bits (1163),  Expect = 1e-148, Method: Compositional matrix adjust.
 Identities = 212/254 (83%), Positives = 232/254 (91%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGA MGFFPVDHVTL+YLKLTGRSDETV+MIE+YLRANNMFVDYNEPQQER Y+S LQL
Sbjct  403  EYGAAMGFFPVDHVTLEYLKLTGRSDETVSMIESYLRANNMFVDYNEPQQERAYTSYLQL  462

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFAVPKE QE+V KFS++GQP
Sbjct  463  DLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFAVPKEKQEEVVKFSYNGQP  522

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKAS+LGL VKPWVKTSLAPGS VV KY
Sbjct  523  AEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKASDLGLKVKPWVKTSLAPGSRVVEKY  582

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGL+E L +QGF IVGYGCTTCIGNSG+LD  V+SAI   DI+ AAVLSGNRNFEGR
Sbjct  583  LDRSGLRESLTKQGFEIVGYGCTTCIGNSGNLDPEVASAIEGTDIIPAAVLSGNRNFEGR  642

Query  721  VHPLTRANYLASPP  762
            VHP TRANYLASPP
Sbjct  643  VHPQTRANYLASPP  656



>ref|XP_009109156.1| PREDICTED: aconitate hydratase 3, mitochondrial [Brassica rapa]
Length=995

 Score =   452 bits (1162),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 212/254 (83%), Positives = 233/254 (92%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL+YLKLTGRSDETV+MIE+YLRANNMFVDYNEPQQER Y+S LQL
Sbjct  403  EYGATMGFFPVDHVTLEYLKLTGRSDETVSMIESYLRANNMFVDYNEPQQERAYTSYLQL  462

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFAVPKE Q +V KFS+ GQP
Sbjct  463  DLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFAVPKEKQGEVVKFSYDGQP  522

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA +LGL VKPWVKTSLAPGS VV KY
Sbjct  523  AEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKAFDLGLKVKPWVKTSLAPGSRVVEKY  582

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGL+E LN+QGF IVGYGCTTCIGNSGDLD+SV++AI   +I+ AAVLSGNRNFEGR
Sbjct  583  LDRSGLREDLNKQGFQIVGYGCTTCIGNSGDLDKSVAAAIEGTEIIPAAVLSGNRNFEGR  642

Query  721  VHPLTRANYLASPP  762
            VHP TRANYLASPP
Sbjct  643  VHPQTRANYLASPP  656



>ref|XP_006413121.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
 gb|ESQ54574.1| hypothetical protein EUTSA_v10024309mg [Eutrema salsugineum]
Length=999

 Score =   452 bits (1162),  Expect = 2e-148, Method: Compositional matrix adjust.
 Identities = 215/255 (84%), Positives = 233/255 (91%), Gaps = 1/255 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL+YLKLTGRSDETVAMIE+YLRANNMFVDYNEPQQER Y+S LQL
Sbjct  406  EYGATMGFFPVDHVTLEYLKLTGRSDETVAMIESYLRANNMFVDYNEPQQERAYTSYLQL  465

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQ-  357
            DL  VEPC+SGPKRPHDRV LK+MK+DWH+CLDN VGFKGFA+PKE QE   KF F  + 
Sbjct  466  DLGHVEPCISGPKRPHDRVLLKDMKADWHACLDNPVGFKGFAIPKEKQEDTVKFLFEEKI  525

Query  358  PAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTK  537
            PAELK+GSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPWVKTSLAPGSGVVTK
Sbjct  526  PAELKNGSVVIAAITSCTNTSNPSVMLGAALVAKKAYDLGLMVKPWVKTSLAPGSGVVTK  585

Query  538  YLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEG  717
            YL QSGLQEYL++QGF IVGYGCTTCIGNSG+L +SV SAI +ND+V A+VLSGNRNFEG
Sbjct  586  YLDQSGLQEYLDKQGFQIVGYGCTTCIGNSGNLKKSVESAIKNNDVVVASVLSGNRNFEG  645

Query  718  RVHPLTRANYLASPP  762
            RVHPLTRANYLASPP
Sbjct  646  RVHPLTRANYLASPP  660



>tpg|DAA43248.1| TPA: hypothetical protein ZEAMMB73_889153 [Zea mays]
Length=664

 Score =   441 bits (1135),  Expect = 3e-148, Method: Compositional matrix adjust.
 Identities = 210/254 (83%), Positives = 233/254 (92%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD  TL YLKLTGRSD+TVAM+E+YLRAN MFVD+++   ERVYSS L+L
Sbjct  93   EYGATMGFFPVDGKTLDYLKLTGRSDDTVAMVESYLRANKMFVDHSQVDAERVYSSYLEL  152

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPCLSGPKRPHDRV LK MKSDW SCLD+ VGFKGFAVPKE+Q KVA+FSFHG P
Sbjct  153  NLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDSDVGFKGFAVPKESQGKVAEFSFHGTP  212

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KTSLAPGSGVV KY
Sbjct  213  AKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVKKY  272

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDESVS+AI++NDIVAAAVLSGNRNFEGR
Sbjct  273  LDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDESVSAAITENDIVAAAVLSGNRNFEGR  332

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  333  VHPLTRANYLASPP  346



>gb|KFK29204.1| hypothetical protein AALP_AA7G102800 [Arabis alpina]
Length=999

 Score =   451 bits (1160),  Expect = 5e-148, Method: Compositional matrix adjust.
 Identities = 210/254 (83%), Positives = 232/254 (91%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL+YLKLTGRSDETV+MIE+YLRANNMF+DY EPQQER Y+S LQL
Sbjct  407  EYGATMGFFPVDHVTLEYLKLTGRSDETVSMIESYLRANNMFIDYKEPQQERAYTSYLQL  466

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  VEPC+SGPKRPHDRV LK+MK+DWH+CLDN VGFKGFAVPKE QE+  KFSF GQP
Sbjct  467  DLGHVEPCISGPKRPHDRVALKDMKADWHACLDNPVGFKGFAVPKEKQEEFVKFSFKGQP  526

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA +LGL VKPWVKTSLAPGS VV KY
Sbjct  527  AEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKAFDLGLEVKPWVKTSLAPGSRVVEKY  586

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGL+EYL +QGF IVGYGCTTCIGNSGDL++SV++AI  +DI+ AAVLSGNRNFEGR
Sbjct  587  LDRSGLREYLTKQGFEIVGYGCTTCIGNSGDLEKSVAAAIEGSDIIPAAVLSGNRNFEGR  646

Query  721  VHPLTRANYLASPP  762
            VHP TRANYLASPP
Sbjct  647  VHPQTRANYLASPP  660



>tpg|DAA43249.1| TPA: hypothetical protein ZEAMMB73_889153 [Zea mays]
Length=685

 Score =   441 bits (1135),  Expect = 6e-148, Method: Compositional matrix adjust.
 Identities = 210/254 (83%), Positives = 233/254 (92%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD  TL YLKLTGRSD+TVAM+E+YLRAN MFVD+++   ERVYSS L+L
Sbjct  93   EYGATMGFFPVDGKTLDYLKLTGRSDDTVAMVESYLRANKMFVDHSQVDAERVYSSYLEL  152

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPCLSGPKRPHDRV LK MKSDW SCLD+ VGFKGFAVPKE+Q KVA+FSFHG P
Sbjct  153  NLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDSDVGFKGFAVPKESQGKVAEFSFHGTP  212

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KTSLAPGSGVV KY
Sbjct  213  AKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVKKY  272

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDESVS+AI++NDIVAAAVLSGNRNFEGR
Sbjct  273  LDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDESVSAAITENDIVAAAVLSGNRNFEGR  332

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  333  VHPLTRANYLASPP  346



>ref|XP_006283068.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
 gb|EOA15966.1| hypothetical protein CARUB_v10004061mg [Capsella rubella]
Length=995

 Score =   450 bits (1157),  Expect = 1e-147, Method: Compositional matrix adjust.
 Identities = 211/254 (83%), Positives = 231/254 (91%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL+YLKLTGRSDETV+MIE+YLRANNMFVDYNEPQ ER Y+S LQL
Sbjct  403  EYGATMGFFPVDHVTLEYLKLTGRSDETVSMIESYLRANNMFVDYNEPQPERAYTSYLQL  462

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  VEPC+SGPKRPHDRVPLK+MK+DWH+CLDN VGFKGFAVPKE QE+V KFS+ GQP
Sbjct  463  DLGHVEPCISGPKRPHDRVPLKDMKADWHACLDNPVGFKGFAVPKEKQEEVVKFSYKGQP  522

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVVIAAITSCTNTSNPSVM+GAALVAKKA +LG+ VKPWVKTSLAPGS VV KY
Sbjct  523  AEIKHGSVVIAAITSCTNTSNPSVMIGAALVAKKALDLGVEVKPWVKTSLAPGSRVVEKY  582

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGL+E LN+QGF IVGYGCTTCIGNSGDL+  V+SAI   DI+ AAVLSGNRNFEGR
Sbjct  583  LDRSGLRECLNKQGFQIVGYGCTTCIGNSGDLEPEVASAIEGTDIIPAAVLSGNRNFEGR  642

Query  721  VHPLTRANYLASPP  762
            VHP TRANYLASPP
Sbjct  643  VHPQTRANYLASPP  656



>ref|XP_008230066.1| PREDICTED: aconitate hydratase, cytoplasmic [Prunus mume]
Length=994

 Score =   449 bits (1155),  Expect = 2e-147, Method: Compositional matrix adjust.
 Identities = 215/254 (85%), Positives = 233/254 (92%), Gaps = 2/254 (1%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIE+YLRAN +FVDYNE     ++   L +
Sbjct  404  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIESYLRANKLFVDYNEVGAAALFF--LPI  461

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
                 +P +SGPKRPHDRVPLK+MK DWH+CLDNKVGFKGFA+PKE Q+KVAKFSFHGQP
Sbjct  462  FKYQNQPXMSGPKRPHDRVPLKDMKVDWHACLDNKVGFKGFAIPKEVQDKVAKFSFHGQP  521

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGL VKPWVKTSLAPGSGVVTKY
Sbjct  522  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLQVKPWVKTSLAPGSGVVTKY  581

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ+Y +QQGF IVGYGCTTCIGNSGDLDE+V+SAIS+NDIVAAAVLSGNRNFEGR
Sbjct  582  LLKSGLQKYFDQQGFQIVGYGCTTCIGNSGDLDETVASAISENDIVAAAVLSGNRNFEGR  641

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  642  VHPLTRANYLASPP  655



>ref|XP_003558862.1| PREDICTED: putative aconitate hydratase, cytoplasmic [Brachypodium 
distachyon]
Length=994

 Score =   448 bits (1153),  Expect = 4e-147, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 232/254 (91%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD  TL YLKLTGRSD+TVAMIE YLRANNMFVDYN+ Q ERVYSS L+L
Sbjct  401  EYGATMGFFPVDAKTLDYLKLTGRSDDTVAMIETYLRANNMFVDYNQVQAERVYSSYLEL  460

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPCLSGPKRPHDRV LK MKSDW SCLDN VGFKGFAVPKE+Q KVA FSFHG P
Sbjct  461  NLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDNDVGFKGFAVPKESQGKVADFSFHGTP  520

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KTSLAPGSGVV KY
Sbjct  521  AKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVKKY  580

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YL+Q GF+IVGYGCTTCIGNSGDLDESV++AIS+ND+VAAAVLSGNRNFEGR
Sbjct  581  LDKSGLQKYLDQLGFNIVGYGCTTCIGNSGDLDESVAAAISENDVVAAAVLSGNRNFEGR  640

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  641  VHALTRANYLASPP  654



>ref|XP_008670445.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA40969.1| TPA: hypothetical protein ZEAMMB73_742994 [Zea mays]
Length=980

 Score =   447 bits (1150),  Expect = 9e-147, Method: Compositional matrix adjust.
 Identities = 206/254 (81%), Positives = 228/254 (90%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL YLKLTGRSDE V M+EAYLRANNMFVDYNE Q ERVYSS L+L
Sbjct  385  EYGATMGFFPVDHVTLGYLKLTGRSDEKVEMVEAYLRANNMFVDYNETQTERVYSSYLEL  444

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHD V LK+MKSDWHSCL NKVGFKGF VPKE  +K  KF+FHGQP
Sbjct  445  DLADVEPCVSGPKRPHDHVALKDMKSDWHSCLGNKVGFKGFGVPKEQHDKFVKFTFHGQP  504

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE++HGS+VIAAITSCTNTSNPSVMLGA LVAKKA ELGL V PW+KTSLAPGSG VTKY
Sbjct  505  AEIRHGSIVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVNPWIKTSLAPGSGAVTKY  564

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ+YL+  GF+++GYGCTTCIGNSG+LDE V+ A++DNDI+AAAVLSGNRNFEGR
Sbjct  565  LLKSGLQKYLDHLGFNLIGYGCTTCIGNSGELDEDVAKAVTDNDIIAAAVLSGNRNFEGR  624

Query  721  VHPLTRANYLASPP  762
            +H L RANYLASPP
Sbjct  625  IHALVRANYLASPP  638



>dbj|BAJ92965.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=999

 Score =   446 bits (1148),  Expect = 3e-146, Method: Compositional matrix adjust.
 Identities = 214/254 (84%), Positives = 231/254 (91%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD  TL YLKLTGRSDETVAMIE YLRANNMFVDY + Q ERVYSS L+L
Sbjct  406  EYGATMGFFPVDAKTLDYLKLTGRSDETVAMIETYLRANNMFVDYKQVQAERVYSSYLEL  465

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL +V PCLSGPKRPHDRV LK MKSDW SCLDNKVGFKGFAVPKE+Q KVA+FSF G P
Sbjct  466  DLDEVGPCLSGPKRPHDRVTLKNMKSDWLSCLDNKVGFKGFAVPKESQGKVAEFSFRGTP  525

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA +LGL VKPW+KTSLAPGSGVV KY
Sbjct  526  AKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACDLGLEVKPWIKTSLAPGSGVVKKY  585

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GF+IVGYGCTTCIGNSGDLDESV++AI+DND+VAAAVLSGNRNFEGR
Sbjct  586  LDKSGLQKYLNQLGFNIVGYGCTTCIGNSGDLDESVAAAITDNDVVAAAVLSGNRNFEGR  645

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  646  VHALTRANYLASPP  659



>ref|XP_002460765.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
 gb|EER97286.1| hypothetical protein SORBIDRAFT_02g034590 [Sorghum bicolor]
Length=979

 Score =   445 bits (1144),  Expect = 6e-146, Method: Compositional matrix adjust.
 Identities = 203/254 (80%), Positives = 229/254 (90%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL YLKLTGRSDE V M+EAYLRAN MFVDYNE Q ERVYSS L+L
Sbjct  383  EYGATMGFFPVDHVTLGYLKLTGRSDEKVDMVEAYLRANKMFVDYNETQTERVYSSYLEL  442

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRV LK+MK+DW +CL NKVGFKGF +PKE Q+K+ KF+FHGQP
Sbjct  443  DLADVEPCVSGPKRPHDRVALKDMKADWRACLRNKVGFKGFGIPKEQQDKLVKFTFHGQP  502

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE++HGS+VIAAITSCTNTSNPSVMLGA LVAKKA ELGL V PW+KTSLAPGSG VTKY
Sbjct  503  AEIRHGSIVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVNPWIKTSLAPGSGAVTKY  562

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LL+SGLQ+YL+  GF+++GYGCTTCIGNSG+LDE V+ A++DNDI+AAAVLSGNRNFEGR
Sbjct  563  LLKSGLQKYLDHLGFNLIGYGCTTCIGNSGELDEDVAKAVTDNDIIAAAVLSGNRNFEGR  622

Query  721  VHPLTRANYLASPP  762
            +H L RANYLASPP
Sbjct  623  IHALVRANYLASPP  636



>ref|XP_010033531.1| PREDICTED: aconitate hydratase 1-like [Eucalyptus grandis]
Length=903

 Score =   442 bits (1136),  Expect = 1e-145, Method: Compositional matrix adjust.
 Identities = 208/254 (82%), Positives = 233/254 (92%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIE+YLRANNMFVDY+EP  E+V+SS L+L
Sbjct  307  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIESYLRANNMFVDYDEPPAEKVFSSYLEL  366

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEP +SGPKRPHDRV LKEMK+DW +CL+NKVGFKGFA+P EAQ K A+ +F+G  
Sbjct  367  DLKDVEPSVSGPKRPHDRVLLKEMKADWRACLNNKVGFKGFAIPVEAQSKFAELTFNGTR  426

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
             +L+HG VVIAAITSCTNTSNPSVMLGAAL+AKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  427  EKLRHGDVVIAAITSCTNTSNPSVMLGAALLAKKACELGLEVKPWIKTSLAPGSGVVTKY  486

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YL+Q GF+ VGYGCTTCIGNSGDL E+V+SAI+DNDIVAAAVLSGNRNFEGR
Sbjct  487  LTKSGLQKYLDQLGFYTVGYGCTTCIGNSGDLHEAVASAITDNDIVAAAVLSGNRNFEGR  546

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  547  VHPLTRANYLASPP  560



>ref|XP_006413195.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
 gb|ESQ54648.1| hypothetical protein EUTSA_v10024325mg [Eutrema salsugineum]
Length=962

 Score =   443 bits (1140),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 212/255 (83%), Positives = 231/255 (91%), Gaps = 1/255 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL+YLKLTGRSDETVAMIE+YLRANNMFVDY+EPQQER Y+S LQL
Sbjct  401  EYGATMGFFPVDHVTLEYLKLTGRSDETVAMIESYLRANNMFVDYSEPQQERAYTSYLQL  460

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQ-  357
            DL  VEPC+SGPKRPHDRV LK+MK+DWH+CLDN VGFKGFA+PKE QE   KF F  + 
Sbjct  461  DLGHVEPCISGPKRPHDRVLLKDMKADWHACLDNPVGFKGFAIPKEKQEDTVKFLFEEKL  520

Query  358  PAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTK  537
            PAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKA +LGL VKPWVKTSLAPGSGVVTK
Sbjct  521  PAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKAYDLGLMVKPWVKTSLAPGSGVVTK  580

Query  538  YLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEG  717
            YL QSGLQEYL++QGF I GYGCTT IGNSG+L +SV SAI +ND+V A+VLSGN+NFEG
Sbjct  581  YLDQSGLQEYLDKQGFQIFGYGCTTFIGNSGNLKKSVESAIKNNDVVVASVLSGNQNFEG  640

Query  718  RVHPLTRANYLASPP  762
            RVHPLTRANYLASPP
Sbjct  641  RVHPLTRANYLASPP  655



>ref|XP_010529315.1| PREDICTED: aconitate hydratase 1-like [Tarenaya hassleriana]
Length=901

 Score =   441 bits (1135),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 205/254 (81%), Positives = 232/254 (91%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHV L+YLKLTGRSD+TV+MIE YLRAN MFVDYNEP+ E VYS SL+L
Sbjct  308  EYGATMGFFPVDHVALKYLKLTGRSDDTVSMIEHYLRANMMFVDYNEPRDEIVYSCSLEL  367

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
             L DVEPC+SGPKRPHDRVPL++MK+DW +CL+N++GFKGFA+PKEAQ KV  F F G  
Sbjct  368  KLEDVEPCISGPKRPHDRVPLRDMKADWGTCLNNRLGFKGFAIPKEAQNKVVNFVFRGTR  427

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG+VVIAAITSCTNTSNPSV+LGAALVAKKA ELGL VKPW+KTSLAPGSGVV KY
Sbjct  428  AQLRHGAVVIAAITSCTNTSNPSVVLGAALVAKKAYELGLEVKPWIKTSLAPGSGVVAKY  487

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGL++YLNQ GFHIV YGCTTCIGNSGD+DESV+SAI++ND+VAAAVLSGNRNFEGR
Sbjct  488  LQKSGLEKYLNQLGFHIVAYGCTTCIGNSGDIDESVASAIAENDLVAAAVLSGNRNFEGR  547

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  548  VHPLTRANYLASPP  561



>ref|NP_001159229.1| uncharacterized protein LOC100304315 [Zea mays]
 gb|ACN25517.1| unknown [Zea mays]
 gb|AFW89612.1| hypothetical protein ZEAMMB73_646589 [Zea mays]
Length=685

 Score =   435 bits (1118),  Expect = 2e-145, Method: Compositional matrix adjust.
 Identities = 206/254 (81%), Positives = 233/254 (92%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD  TL YLKLTGRSD+TVAM+E+YLRAN MFVD+++ + ERVYSS L+L
Sbjct  93   EYGATMGFFPVDGKTLDYLKLTGRSDDTVAMVESYLRANKMFVDHSQAEAERVYSSYLEL  152

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPCLSGPKRPHDRV LK MKSDW SCLD+ VGFKGFAVPKE+Q KVA+F FHG P
Sbjct  153  NLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDSDVGFKGFAVPKESQGKVAEFLFHGTP  212

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KTSLAPGSGVV +Y
Sbjct  213  AKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVKQY  272

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YL+Q GF+IVGYGCTTCIGNSG+LDESVS+AI++NDIV+AAVLSGNRNFEGR
Sbjct  273  LDKSGLQKYLDQLGFNIVGYGCTTCIGNSGELDESVSAAITENDIVSAAVLSGNRNFEGR  332

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  333  VHPLTRANYLASPP  346



>gb|KCW53221.1| hypothetical protein EUGRSUZ_J02488 [Eucalyptus grandis]
Length=930

 Score =   442 bits (1136),  Expect = 4e-145, Method: Compositional matrix adjust.
 Identities = 208/254 (82%), Positives = 233/254 (92%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIE+YLRANNMFVDY+EP  E+V+SS L+L
Sbjct  334  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIESYLRANNMFVDYDEPPAEKVFSSYLEL  393

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEP +SGPKRPHDRV LKEMK+DW +CL+NKVGFKGFA+P EAQ K A+ +F+G  
Sbjct  394  DLKDVEPSVSGPKRPHDRVLLKEMKADWRACLNNKVGFKGFAIPVEAQSKFAELTFNGTR  453

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
             +L+HG VVIAAITSCTNTSNPSVMLGAAL+AKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  454  EKLRHGDVVIAAITSCTNTSNPSVMLGAALLAKKACELGLEVKPWIKTSLAPGSGVVTKY  513

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YL+Q GF+ VGYGCTTCIGNSGDL E+V+SAI+DNDIVAAAVLSGNRNFEGR
Sbjct  514  LTKSGLQKYLDQLGFYTVGYGCTTCIGNSGDLHEAVASAITDNDIVAAAVLSGNRNFEGR  573

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  574  VHPLTRANYLASPP  587



>gb|AAL13084.1| putative aconitase [Prunus avium]
Length=902

 Score =   440 bits (1132),  Expect = 6e-145, Method: Compositional matrix adjust.
 Identities = 209/258 (81%), Positives = 232/258 (90%), Gaps = 4/258 (2%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD VTLQYLKLTGRSD+ VA+IE+YLRAN MFVDYNEPQ ERVYSS L+L
Sbjct  306  EYGATMGFFPVDRVTLQYLKLTGRSDDKVALIESYLRANRMFVDYNEPQVERVYSSYLEL  365

Query  181  DLVDVEPCLSGPKRP----HDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSF  348
            +L +VEPC+SGPKRP    HDRV LKEMK DWH+CLDN+VGFKGFAVPKE+Q KV +F+F
Sbjct  366  NLNEVEPCISGPKRPTTRPHDRVTLKEMKVDWHACLDNRVGFKGFAVPKESQNKVVEFAF  425

Query  349  HGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGV  528
            HG PA+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KT L    GV
Sbjct  426  HGTPAQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTVLLRVLGV  485

Query  529  VTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRN  708
            VTKYL +SGLQ+YLNQ GF IVGYGCTTCIGNSGD+D++V+SAI++NDIVAAAVLSGNRN
Sbjct  486  VTKYLQKSGLQQYLNQLGFIIVGYGCTTCIGNSGDIDDAVASAITENDIVAAAVLSGNRN  545

Query  709  FEGRVHPLTRANYLASPP  762
            FEGRVHPLTRANYLASPP
Sbjct  546  FEGRVHPLTRANYLASPP  563



>ref|XP_008670444.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
Length=982

 Score =   442 bits (1137),  Expect = 8e-145, Method: Compositional matrix adjust.
 Identities = 206/256 (80%), Positives = 228/256 (89%), Gaps = 2/256 (1%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNE--PQQERVYSSSL  174
            EYGATMGFFPVDHVTL YLKLTGRSDE V M+EAYLRANNMFVDYNE   Q ERVYSS L
Sbjct  385  EYGATMGFFPVDHVTLGYLKLTGRSDEKVEMVEAYLRANNMFVDYNEFQTQTERVYSSYL  444

Query  175  QLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHG  354
            +LDL DVEPC+SGPKRPHD V LK+MKSDWHSCL NKVGFKGF VPKE  +K  KF+FHG
Sbjct  445  ELDLADVEPCVSGPKRPHDHVALKDMKSDWHSCLGNKVGFKGFGVPKEQHDKFVKFTFHG  504

Query  355  QPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVT  534
            QPAE++HGS+VIAAITSCTNTSNPSVMLGA LVAKKA ELGL V PW+KTSLAPGSG VT
Sbjct  505  QPAEIRHGSIVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVNPWIKTSLAPGSGAVT  564

Query  535  KYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFE  714
            KYLL+SGLQ+YL+  GF+++GYGCTTCIGNSG+LDE V+ A++DNDI+AAAVLSGNRNFE
Sbjct  565  KYLLKSGLQKYLDHLGFNLIGYGCTTCIGNSGELDEDVAKAVTDNDIIAAAVLSGNRNFE  624

Query  715  GRVHPLTRANYLASPP  762
            GR+H L RANYLASPP
Sbjct  625  GRIHALVRANYLASPP  640



>gb|KHG08189.1| hypothetical protein F383_11434 [Gossypium arboreum]
Length=879

 Score =   439 bits (1128),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 227/254 (89%), Gaps = 19/254 (7%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDET                   PQQERVYSS L+L
Sbjct  306  EYGATMGFFPVDHVTLQYLKLTGRSDET-------------------PQQERVYSSYLEL  346

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DW+SCL+NKVGFKGFAVPKEA EKVAKFSF G+P
Sbjct  347  NLAEVEPCVSGPKRPHDRVPLKEMKADWNSCLNNKVGFKGFAVPKEALEKVAKFSFDGKP  406

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  407  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKTSLAPGSGVVTKY  466

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDI+AAAVLSGNRNFEGR
Sbjct  467  LLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISENDIIAAAVLSGNRNFEGR  526

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  527  VHALTRANYLASPP  540



>ref|XP_002465901.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
 gb|ABE77202.1| putative aconitate hydratase 1 [Sorghum bicolor]
 gb|EER92899.1| hypothetical protein SORBIDRAFT_01g047850 [Sorghum bicolor]
Length=991

 Score =   441 bits (1135),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 209/254 (82%), Positives = 234/254 (92%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD  TL YLKLTGRSD+TVAM+E+YLRAN MFVD+++ + ERVYSS L+L
Sbjct  399  EYGATMGFFPVDAKTLDYLKLTGRSDDTVAMVESYLRANKMFVDHSQVEAERVYSSYLEL  458

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPCLSGPKRPHDRV LK MKSDW SCLD+ VGFKGFAVPKE+Q KVA+FSFHG P
Sbjct  459  NLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDSDVGFKGFAVPKESQGKVAEFSFHGTP  518

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KTSLAPGSGVV KY
Sbjct  519  AKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVKKY  578

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YL+Q GFHIVGYGCTTCIGNSG+LDESVS+AI++ND+VAAAVLSGNRNFEGR
Sbjct  579  LDKSGLQKYLDQLGFHIVGYGCTTCIGNSGELDESVSAAITENDVVAAAVLSGNRNFEGR  638

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  639  VHPLTRANYLASPP  652



>ref|XP_002991024.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
 gb|EFJ07832.1| hypothetical protein SELMODRAFT_132907 [Selaginella moellendorffii]
Length=907

 Score =   439 bits (1130),  Expect = 2e-144, Method: Compositional matrix adjust.
 Identities = 199/254 (78%), Positives = 230/254 (91%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHV+LQYL++TGR ++ V MIE+YLRAN MF+DYNEP+ E+VYSS L+L
Sbjct  314  EYGATMGFFPVDHVSLQYLRMTGREEKKVEMIESYLRANKMFIDYNEPETEKVYSSYLEL  373

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  V+PC+SGPKRPHDRV LK+MK DWH+CLD+KVGFKGF VPK+ Q  +AKF F G+P
Sbjct  374  DLDSVQPCVSGPKRPHDRVNLKDMKEDWHNCLDSKVGFKGFGVPKDEQSAIAKFKFEGKP  433

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AEL+HG VVIAAITSCTNTSNPSVMLGA LVAKKA+ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  434  AELRHGDVVIAAITSCTNTSNPSVMLGAGLVAKKATELGLQVKPWIKTSLAPGSGVVTKY  493

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L QSGL EYL++QGF +VGYGCTTCIGNSG++ E V+SAI+DND++AAAVLSGNRNFEGR
Sbjct  494  LKQSGLTEYLDKQGFSLVGYGCTTCIGNSGEIHEDVASAIADNDMIAAAVLSGNRNFEGR  553

Query  721  VHPLTRANYLASPP  762
            +HPLTRANYLASPP
Sbjct  554  IHPLTRANYLASPP  567



>ref|XP_008344247.1| PREDICTED: aconitate hydratase 1 [Malus domestica]
Length=779

 Score =   434 bits (1116),  Expect = 6e-144, Method: Compositional matrix adjust.
 Identities = 203/254 (80%), Positives = 226/254 (89%), Gaps = 16/254 (6%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSD+ VA+IE+YLRAN MFVDYN+             
Sbjct  203  EYGATMGFFPVDHVTLQYLKLTGRSDDKVALIESYLRANKMFVDYND-------------  249

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
               DVEPC+SGPKRPHDRV LKEMK DWH+CLDN+VGFKGFAVPKE+Q KV +F+FHG P
Sbjct  250  ---DVEPCISGPKRPHDRVTLKEMKGDWHACLDNRVGFKGFAVPKESQSKVVEFNFHGTP  306

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A+L+HG VVIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  307  AQLRHGDVVIAAITSCTNTSNPSVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVTKY  366

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YLNQ GFHIVGYGCTTCIGNSGD+D++V++AI++ND+VAAAVLSGNRNFEGR
Sbjct  367  LQKSGLQKYLNQLGFHIVGYGCTTCIGNSGDIDDAVAAAITENDLVAAAVLSGNRNFEGR  426

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  427  VHPLTRANYLASPP  440



>gb|KHG08190.1| Aconitate hydratase 2, mitochondrial [Gossypium arboreum]
Length=973

 Score =   439 bits (1130),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 227/254 (89%), Gaps = 19/254 (7%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDET                   PQQERVYSS L+L
Sbjct  400  EYGATMGFFPVDHVTLQYLKLTGRSDET-------------------PQQERVYSSYLEL  440

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPC+SGPKRPHDRVPLKEMK+DW+SCL+NKVGFKGFAVPKEA EKVAKFSF G+P
Sbjct  441  NLAEVEPCVSGPKRPHDRVPLKEMKADWNSCLNNKVGFKGFAVPKEALEKVAKFSFDGKP  500

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  501  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLQVKPWIKTSLAPGSGVVTKY  560

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQEYLN+QGFHIVGYGCTTCIGNSG+LDESV+SAIS+NDI+AAAVLSGNRNFEGR
Sbjct  561  LLQSGLQEYLNKQGFHIVGYGCTTCIGNSGELDESVASAISENDIIAAAVLSGNRNFEGR  620

Query  721  VHPLTRANYLASPP  762
            VH LTRANYLASPP
Sbjct  621  VHALTRANYLASPP  634



>ref|XP_002991716.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
 gb|EFJ07287.1| hypothetical protein SELMODRAFT_133937 [Selaginella moellendorffii]
Length=907

 Score =   437 bits (1125),  Expect = 8e-144, Method: Compositional matrix adjust.
 Identities = 198/254 (78%), Positives = 230/254 (91%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHV+LQYL++TGR ++ V MIE+YLRAN MF+DY+EP+ E+VYSS L+L
Sbjct  314  EYGATMGFFPVDHVSLQYLRMTGRDEKKVEMIESYLRANKMFIDYDEPETEKVYSSYLEL  373

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL  V+PC+SGPKRPHDRV LK+MK DWH+CLD+KVGFKGF VPK+ Q  +AKF F G+P
Sbjct  374  DLDSVQPCVSGPKRPHDRVNLKDMKEDWHNCLDSKVGFKGFGVPKDEQSAIAKFKFEGKP  433

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AEL+HG VVIAAITSCTNTSNPSVMLGA LVAKKA+ELGL VKPW+KTSLAPGSGVVTKY
Sbjct  434  AELRHGDVVIAAITSCTNTSNPSVMLGAGLVAKKATELGLQVKPWIKTSLAPGSGVVTKY  493

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L QSGL EYL++QGF +VGYGCTTCIGNSG++ E V+SAI+DND++AAAVLSGNRNFEGR
Sbjct  494  LKQSGLTEYLDKQGFSLVGYGCTTCIGNSGEIHEDVASAIADNDMIAAAVLSGNRNFEGR  553

Query  721  VHPLTRANYLASPP  762
            +HPLTRANYLASPP
Sbjct  554  IHPLTRANYLASPP  567



>gb|KEH38306.1| cytoplasmic-like aconitate hydratase [Medicago truncatula]
Length=865

 Score =   436 bits (1121),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 217/268 (81%), Positives = 231/268 (86%), Gaps = 20/268 (7%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETV--------------AMIEAYLRANNMFVDYN  138
            EYGATMGFFPVDHVTLQYLKLTGRSDETV              AMIEAYLRAN +FVDYN
Sbjct  389  EYGATMGFFPVDHVTLQYLKLTGRSDETVDEIKPQVHGLTEVVAMIEAYLRANKLFVDYN  448

Query  139  EPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKE  318
            EPQQ+  YSS L+L+L +V         PHDRVPLKEMKSDWHSCLDNKVGFKGFA+PKE
Sbjct  449  EPQQDIAYSSYLELNLDEVRTI------PHDRVPLKEMKSDWHSCLDNKVGFKGFAIPKE  502

Query  319  AQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWV  498
            AQ KVAKF FHGQPAELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA +LGL VKPWV
Sbjct  503  AQGKVAKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKAHDLGLKVKPWV  562

Query  499  KTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIV  678
            KTSLA GSGVVTKYLLQSGLQ+YLN+QGF+ V +GCTTCIGNSGDLDESV+SAIS+NDIV
Sbjct  563  KTSLALGSGVVTKYLLQSGLQKYLNEQGFNFVRFGCTTCIGNSGDLDESVASAISENDIV  622

Query  679  AAAVLSGNRNFEGRVHPLTRANYLASPP  762
            A+AVLS NRNFEGRVHPLTRANYLASPP
Sbjct  623  ASAVLSRNRNFEGRVHPLTRANYLASPP  650



>dbj|BAD62409.1| putative aconitate hydratase [Oryza sativa Japonica Group]
Length=750

 Score =   432 bits (1112),  Expect = 1e-143, Method: Compositional matrix adjust.
 Identities = 199/254 (78%), Positives = 227/254 (89%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGA+MGFFPVDHVTL YLKLTGRS+ETV+MIEAYLRANNMFV+++EP  ERVYSS L+L
Sbjct  240  EYGASMGFFPVDHVTLDYLKLTGRSNETVSMIEAYLRANNMFVEHHEPHTERVYSSYLEL  299

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L+DVEPC+SGPKRPHDRVPLKEMKSDWH+CLD++VGFKGFAVP+E Q+KV KF F GQP
Sbjct  300  NLIDVEPCISGPKRPHDRVPLKEMKSDWHACLDSRVGFKGFAVPRECQDKVVKFDFQGQP  359

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVV+AAI S TNTSNPSV++GA LVAKKA ELGL VKPWVKTS   GS V  +Y
Sbjct  360  AEIKHGSVVLAAICSSTNTSNPSVIVGAGLVAKKACELGLEVKPWVKTSFTHGSAVTREY  419

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L  S LQ+YLNQQGFH+  +GC TC+GNSGDLDESVS+AI++NDIV+ AVLS NRNFEGR
Sbjct  420  LKHSHLQDYLNQQGFHLAAFGCATCVGNSGDLDESVSAAITENDIVSVAVLSANRNFEGR  479

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  480  VHPLTRANYLASPP  493



>ref|NP_001136484.1| uncharacterized protein LOC100216599 [Zea mays]
 gb|ACF82029.1| unknown [Zea mays]
Length=565

 Score =   426 bits (1094),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 200/224 (89%), Positives = 212/224 (95%), Gaps = 0/224 (0%)
 Frame = +1

Query  91   MIEAYLRANNMFVDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKSDWHS  270
            MIEAYLRAN MFVDYNEP  ER+YSS L+L+L +VEP +SGPKRPHDRVPLKEMKSDWH+
Sbjct  1    MIEAYLRANKMFVDYNEPPTERIYSSYLELNLDEVEPSMSGPKRPHDRVPLKEMKSDWHA  60

Query  271  CLDNKVGFKGFAVPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVMLGAAL  450
            CLDNKVGFKGFAVPKE Q+KV KF FHGQPAE+KHGSVVIAAITSCTNTSNPSVMLGA L
Sbjct  61   CLDNKVGFKGFAVPKEQQDKVVKFDFHGQPAEMKHGSVVIAAITSCTNTSNPSVMLGAGL  120

Query  451  VAKKASELGLHVKPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSG  630
            VAKKA ELGL VKPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSG
Sbjct  121  VAKKACELGLEVKPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCIGNSG  180

Query  631  DLDESVSSAISDNDIVAAAVLSGNRNFEGRVHPLTRANYLASPP  762
            DLDESVS+AI++ND+VAAAVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  181  DLDESVSTAITENDVVAAAVLSGNRNFEGRVHPLTRANYLASPP  224



>ref|XP_007020807.1| Aconitase 3 [Theobroma cacao]
 gb|EOY12332.1| Aconitase 3 [Theobroma cacao]
Length=883

 Score =   435 bits (1119),  Expect = 3e-143, Method: Compositional matrix adjust.
 Identities = 214/282 (76%), Positives = 231/282 (82%), Gaps = 34/282 (12%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETV+MIEA+LR N MFVD+NEPQQER Y+S L L
Sbjct  321  EYGATMGFFPVDHVTLQYLKLTGRSDETVSMIEAFLRGNKMFVDFNEPQQERAYTSYLHL  380

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL DVEPC+SGPKRPHDRVPLK+MK+DWH+CLDNK+GFK      + Q KVAKF+F G P
Sbjct  381  DLADVEPCVSGPKRPHDRVPLKKMKADWHACLDNKLGFK------KEQNKVAKFTFQGLP  434

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAI SCTNTSNPSVMLGA LVAKKA E GL VKPWVKTSLAPGSGVVTKY
Sbjct  435  AELKHGSVVIAAIASCTNTSNPSVMLGAGLVAKKACEFGLEVKPWVKTSLAPGSGVVTKY  494

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDN-----------------  669
            LLQSGLQ+YLNQQGF+I+GYGCTTCIGNSG+LDESV+SAIS+N                 
Sbjct  495  LLQSGLQKYLNQQGFNILGYGCTTCIGNSGELDESVASAISENGYSLNLFQIQLVACVTL  554

Query  670  -----------DIVAAAVLSGNRNFEGRVHPLTRANYLASPP  762
                       DIVAA VLSGNRNFEGRVHP TRANYLASPP
Sbjct  555  WFTILIYVCTIDIVAADVLSGNRNFEGRVHPPTRANYLASPP  596



>ref|XP_008669747.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X2 [Zea mays]
 tpg|DAA38798.1| TPA: hypothetical protein ZEAMMB73_641300 [Zea mays]
Length=905

 Score =   435 bits (1119),  Expect = 7e-143, Method: Compositional matrix adjust.
 Identities = 204/254 (80%), Positives = 227/254 (89%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD V L YLKLTGRSDETV+MIEAYLRAN MFVD +EP+ ERV+SS L+L
Sbjct  311  EYGATMGFFPVDQVALDYLKLTGRSDETVSMIEAYLRANKMFVDKHEPETERVFSSYLEL  370

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL +VEPC+SGPKRPHDRVPLKEMKSDWH+CLDN+VGFKG+AVPKE Q KV KF FHG+P
Sbjct  371  DLSEVEPCVSGPKRPHDRVPLKEMKSDWHACLDNEVGFKGYAVPKEQQGKVVKFDFHGRP  430

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVV+AAI S TNTSNPSVM+GA LVAKKA ELGL VKPWVKTSL PGS V T+Y
Sbjct  431  AEIKHGSVVLAAICSSTNTSNPSVMIGAGLVAKKACELGLEVKPWVKTSLTPGSVVATEY  490

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L  SGLQ+YLNQQGFH+  +GC TC+GNSGDLD SVS+AI++NDIVAAAVLS NRNFEGR
Sbjct  491  LKHSGLQDYLNQQGFHVAAHGCATCVGNSGDLDGSVSAAITENDIVAAAVLSANRNFEGR  550

Query  721  VHPLTRANYLASPP  762
            V+PLTRANYLASPP
Sbjct  551  VNPLTRANYLASPP  564



>ref|NP_001147431.1| aconitase2 [Zea mays]
 gb|ACG27495.1| aconitate hydratase, cytoplasmic [Zea mays]
 gb|ACN28210.1| unknown [Zea mays]
 gb|AFW57775.1| aconitate hydratase, cytoplasmic [Zea mays]
Length=905

 Score =   434 bits (1116),  Expect = 1e-142, Method: Compositional matrix adjust.
 Identities = 203/254 (80%), Positives = 227/254 (89%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD V L YLKLTGRSDETV+MIEAYLRAN MFVD +EP+ ERV+SS L+L
Sbjct  310  EYGATMGFFPVDQVALDYLKLTGRSDETVSMIEAYLRANKMFVDKHEPETERVFSSHLEL  369

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL +VEPC+SGPKRPHDRVPLKEMKSDWH+CLDN+VGFKG+AVPKE Q KV KF FHG+P
Sbjct  370  DLSEVEPCVSGPKRPHDRVPLKEMKSDWHACLDNEVGFKGYAVPKEQQGKVVKFDFHGRP  429

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVV+AAI S TNTSNPSVM+GA LVAKKA ELGL VKPWVKTSL PGS V T+Y
Sbjct  430  AEIKHGSVVLAAICSSTNTSNPSVMIGAGLVAKKACELGLEVKPWVKTSLTPGSVVATEY  489

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L  SGLQ+YLNQQGFH+  +GC TC+GNSGDLD SVS+AI++ND+VAAAVLS NRNFEGR
Sbjct  490  LKHSGLQDYLNQQGFHVAAHGCATCVGNSGDLDGSVSAAITENDMVAAAVLSANRNFEGR  549

Query  721  VHPLTRANYLASPP  762
            V+PLTRANYLASPP
Sbjct  550  VNPLTRANYLASPP  563



>ref|XP_008661884.1| PREDICTED: aconitase2 isoform X1 [Zea mays]
Length=949

 Score =   434 bits (1117),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 203/254 (80%), Positives = 227/254 (89%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD V L YLKLTGRSDETV+MIEAYLRAN MFVD +EP+ ERV+SS L+L
Sbjct  371  EYGATMGFFPVDQVALDYLKLTGRSDETVSMIEAYLRANKMFVDKHEPETERVFSSHLEL  430

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL +VEPC+SGPKRPHDRVPLKEMKSDWH+CLDN+VGFKG+AVPKE Q KV KF FHG+P
Sbjct  431  DLSEVEPCVSGPKRPHDRVPLKEMKSDWHACLDNEVGFKGYAVPKEQQGKVVKFDFHGRP  490

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVV+AAI S TNTSNPSVM+GA LVAKKA ELGL VKPWVKTSL PGS V T+Y
Sbjct  491  AEIKHGSVVLAAICSSTNTSNPSVMIGAGLVAKKACELGLEVKPWVKTSLTPGSVVATEY  550

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L  SGLQ+YLNQQGFH+  +GC TC+GNSGDLD SVS+AI++ND+VAAAVLS NRNFEGR
Sbjct  551  LKHSGLQDYLNQQGFHVAAHGCATCVGNSGDLDGSVSAAITENDMVAAAVLSANRNFEGR  610

Query  721  VHPLTRANYLASPP  762
            V+PLTRANYLASPP
Sbjct  611  VNPLTRANYLASPP  624



>ref|XP_008658754.1| PREDICTED: uncharacterized protein LOC100304315 isoform X1 [Zea 
mays]
Length=989

 Score =   436 bits (1120),  Expect = 3e-142, Method: Compositional matrix adjust.
 Identities = 206/254 (81%), Positives = 233/254 (92%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD  TL YLKLTGRSD+TVAM+E+YLRAN MFVD+++ + ERVYSS L+L
Sbjct  397  EYGATMGFFPVDGKTLDYLKLTGRSDDTVAMVESYLRANKMFVDHSQAEAERVYSSYLEL  456

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L +VEPCLSGPKRPHDRV LK MKSDW SCLD+ VGFKGFAVPKE+Q KVA+F FHG P
Sbjct  457  NLEEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDSDVGFKGFAVPKESQGKVAEFLFHGTP  516

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA ELGL VKPW+KTSLAPGSGVV +Y
Sbjct  517  AKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACELGLEVKPWIKTSLAPGSGVVKQY  576

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L +SGLQ+YL+Q GF+IVGYGCTTCIGNSG+LDESVS+AI++NDIV+AAVLSGNRNFEGR
Sbjct  577  LDKSGLQKYLDQLGFNIVGYGCTTCIGNSGELDESVSAAITENDIVSAAVLSGNRNFEGR  636

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  637  VHPLTRANYLASPP  650



>ref|XP_008669746.1| PREDICTED: putative aconitate hydratase, cytoplasmic isoform 
X1 [Zea mays]
 tpg|DAA38797.1| TPA: hypothetical protein ZEAMMB73_641300 [Zea mays]
Length=975

 Score =   435 bits (1118),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 204/254 (80%), Positives = 227/254 (89%), Gaps = 0/254 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVD V L YLKLTGRSDETV+MIEAYLRAN MFVD +EP+ ERV+SS L+L
Sbjct  381  EYGATMGFFPVDQVALDYLKLTGRSDETVSMIEAYLRANKMFVDKHEPETERVFSSYLEL  440

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL +VEPC+SGPKRPHDRVPLKEMKSDWH+CLDN+VGFKG+AVPKE Q KV KF FHG+P
Sbjct  441  DLSEVEPCVSGPKRPHDRVPLKEMKSDWHACLDNEVGFKGYAVPKEQQGKVVKFDFHGRP  500

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AE+KHGSVV+AAI S TNTSNPSVM+GA LVAKKA ELGL VKPWVKTSL PGS V T+Y
Sbjct  501  AEIKHGSVVLAAICSSTNTSNPSVMIGAGLVAKKACELGLEVKPWVKTSLTPGSVVATEY  560

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            L  SGLQ+YLNQQGFH+  +GC TC+GNSGDLD SVS+AI++NDIVAAAVLS NRNFEGR
Sbjct  561  LKHSGLQDYLNQQGFHVAAHGCATCVGNSGDLDGSVSAAITENDIVAAAVLSANRNFEGR  620

Query  721  VHPLTRANYLASPP  762
            V+PLTRANYLASPP
Sbjct  621  VNPLTRANYLASPP  634



>gb|EMT03129.1| Putative aconitate hydratase, cytoplasmic [Aegilops tauschii]
Length=1967

 Score =   449 bits (1156),  Expect = 5e-142, Method: Compositional matrix adjust.
 Identities = 215/254 (85%), Positives = 232/254 (91%), Gaps = 0/254 (0%)
 Frame = +1

Query  1     EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
             EYGATMGFFPVD  TL YLKLTGRSDETVAMIE YLRANNMFVDY + Q ERVYSS L+L
Sbjct  1374  EYGATMGFFPVDAKTLDYLKLTGRSDETVAMIETYLRANNMFVDYKQVQAERVYSSYLEL  1433

Query  181   DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
             DL +VEPCLSGPKRPHDRV LK MKSDW SCLDNKVGFKGFAVPKE+Q KVA+FSF G P
Sbjct  1434  DLDEVEPCLSGPKRPHDRVTLKNMKSDWLSCLDNKVGFKGFAVPKESQGKVAEFSFRGTP  1493

Query  361   AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
             A++KHG VVIAAITSCTNTSNP+VMLGAALVAKKA +LGL VKPW+KTSLAPGSGVV KY
Sbjct  1494  AKIKHGDVVIAAITSCTNTSNPNVMLGAALVAKKACDLGLEVKPWIKTSLAPGSGVVKKY  1553

Query  541   LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
             L +SGLQ+YLNQ GF+IVGYGCTTCIGNSGDLDESV++AI+DND+VAAAVLSGNRNFEGR
Sbjct  1554  LDKSGLQKYLNQLGFNIVGYGCTTCIGNSGDLDESVAAAITDNDVVAAAVLSGNRNFEGR  1613

Query  721   VHPLTRANYLASPP  762
             VH LTRANYLASPP
Sbjct  1614  VHALTRANYLASPP  1627



>gb|EEC83021.1| hypothetical protein OsI_28098 [Oryza sativa Indica Group]
Length=621

 Score =   424 bits (1089),  Expect = 8e-142, Method: Compositional matrix adjust.
 Identities = 203/228 (89%), Positives = 214/228 (94%), Gaps = 4/228 (2%)
 Frame = +1

Query  79   ETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQLDLVDVEPCLSGPKRPHDRVPLKEMKS  258
            + VAMIEAYLRAN MFVDYNEPQ ERVYSS L+LDL +VEPC+SGPKRPHDRVPLKEMKS
Sbjct  59   QQVAMIEAYLRANKMFVDYNEPQTERVYSSYLELDLNEVEPCISGPKRPHDRVPLKEMKS  118

Query  259  DWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQPAELKHGSVVIAAITSCTNTSNPSVML  438
            DWHSCLDN+    GFAVPKE Q+KV KF FHGQPAELKHGSVVIAAITSCTNTSNPSVML
Sbjct  119  DWHSCLDNR----GFAVPKEQQDKVVKFDFHGQPAELKHGSVVIAAITSCTNTSNPSVML  174

Query  439  GAALVAKKASELGLHVKPWVKTSLAPGSGVVTKYLLQSGLQEYLNQQGFHIVGYGCTTCI  618
            GAALVAKKA ELGL VKPWVKTSLAPGSGVVTKYLLQSGLQEYLN+QGFH+VGYGCTTCI
Sbjct  175  GAALVAKKACELGLEVKPWVKTSLAPGSGVVTKYLLQSGLQEYLNKQGFHVVGYGCTTCI  234

Query  619  GNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGRVHPLTRANYLASPP  762
            GNSGDLDESVS+AIS+ND+VAAAVLSGNRNFEGRVHPLTRANYLASPP
Sbjct  235  GNSGDLDESVSAAISENDVVAAAVLSGNRNFEGRVHPLTRANYLASPP  282



>emb|CDY56501.1| BnaAnng14360D [Brassica napus]
Length=973

 Score =   434 bits (1115),  Expect = 1e-141, Method: Compositional matrix adjust.
 Identities = 207/255 (81%), Positives = 231/255 (91%), Gaps = 1/255 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYG TMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQER YSS L+L
Sbjct  400  EYGVTMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERAYSSYLEL  459

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            +L + +PC+SGPKRPHDRVPLKEMK+DW+SCL NKVGFKGFA+PKEAQEKVA FSF+G+ 
Sbjct  460  NLDNFKPCISGPKRPHDRVPLKEMKADWNSCLGNKVGFKGFAIPKEAQEKVANFSFNGKS  519

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            A++KHGSVVIAAITSCTNTSN SVMLGA LVAKKA +LGL VKPW+KTSLAPG GVVTKY
Sbjct  520  AKIKHGSVVIAAITSCTNTSNQSVMLGAGLVAKKACDLGLQVKPWIKTSLAPGLGVVTKY  579

Query  541  LLQSGLQEYLN-QQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEG  717
             L+  +  + +   GF+IVGYGCTTCIGNSG+++ESV  AI++NDIVAAAVLSGNRNFEG
Sbjct  580  FLKRYVVVFSSFFVGFNIVGYGCTTCIGNSGEINESVGVAITENDIVAAAVLSGNRNFEG  639

Query  718  RVHPLTRANYLASPP  762
            RVHPLTRANYLASPP
Sbjct  640  RVHPLTRANYLASPP  654



>ref|XP_010100637.1| Aconitate hydratase [Morus notabilis]
 gb|EXB83385.1| Aconitate hydratase [Morus notabilis]
Length=938

 Score =   432 bits (1111),  Expect = 2e-141, Method: Compositional matrix adjust.
 Identities = 213/254 (84%), Positives = 224/254 (88%), Gaps = 22/254 (9%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRAN MFVDY+E             
Sbjct  368  EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANKMFVDYSE-------------  414

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
                V  C+     PHDRV LKEMK DWH+CLDNKVGFKGFAVPKEAQ+KVAKFSFHGQP
Sbjct  415  ----VMVCV-----PHDRVALKEMKVDWHACLDNKVGFKGFAVPKEAQDKVAKFSFHGQP  465

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGS+VIAAITSCTNTSNPSVMLGAALVAKKA ELGL VKPWVKTSLAPGSGVVTKY
Sbjct  466  AELKHGSIVIAAITSCTNTSNPSVMLGAALVAKKACELGLQVKPWVKTSLAPGSGVVTKY  525

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDNDIVAAAVLSGNRNFEGR  720
            LLQSGLQ+YLN+QGF+IVGYGCTTCIGNSG+LDESV SAI++NDIVAAAVLSGNRNFEGR
Sbjct  526  LLQSGLQKYLNEQGFNIVGYGCTTCIGNSGELDESVGSAITENDIVAAAVLSGNRNFEGR  585

Query  721  VHPLTRANYLASPP  762
            VHPLTRANYLASPP
Sbjct  586  VHPLTRANYLASPP  599



>gb|ACK56135.1| putative aconitase, partial [Dimocarpus longan]
Length=317

 Score =   410 bits (1054),  Expect = 9e-141, Method: Compositional matrix adjust.
 Identities = 191/224 (85%), Positives = 209/224 (93%), Gaps = 0/224 (0%)
 Frame = +1

Query  1    EYGATMGFFPVDHVTLQYLKLTGRSDETVAMIEAYLRANNMFVDYNEPQQERVYSSSLQL  180
            EYGATMGFFPVDHVTL YLKLTG SDETV+M+E+YLRAN MFVDY+EP+Q+R YSS L L
Sbjct  94   EYGATMGFFPVDHVTLLYLKLTGTSDETVSMVESYLRANKMFVDYSEPEQDRAYSSYLLL  153

Query  181  DLVDVEPCLSGPKRPHDRVPLKEMKSDWHSCLDNKVGFKGFAVPKEAQEKVAKFSFHGQP  360
            DL +VEPC+SGPKRPHDRV LK+MK+DWH CLDNKVGFKGFAVPK+ Q+KVAKFSFHGQP
Sbjct  154  DLAEVEPCISGPKRPHDRVALKDMKADWHPCLDNKVGFKGFAVPKQEQDKVAKFSFHGQP  213

Query  361  AELKHGSVVIAAITSCTNTSNPSVMLGAALVAKKASELGLHVKPWVKTSLAPGSGVVTKY  540
            AELKHGSVVIAAITSCTNTSNPSVMLGA LVAKKA ELGL VK W+KTSLAPGSGVVTKY
Sbjct  214  AELKHGSVVIAAITSCTNTSNPSVMLGAGLVAKKACELGLEVKRWIKTSLAPGSGVVTKY  273

Query  541  LLQSGLQEYLNQQGFHIVGYGCTTCIGNSGDLDESVSSAISDND  672
            L QSGLQ+YLNQQGFH+VGYGCTTCIGNSGDLDESV++AIS+ND
Sbjct  274  LHQSGLQKYLNQQGFHLVGYGCTTCIGNSGDLDESVANAISEND  317



Lambda      K        H        a         alpha
   0.316    0.132    0.391    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1497111138900