BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2273

Length=1133
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006352325.1|  PREDICTED: oligopeptide transporter 3-like         315   1e-166   Solanum tuberosum [potatoes]
ref|XP_004250295.1|  PREDICTED: oligopeptide transporter 3              313   2e-166   Solanum lycopersicum
ref|XP_011095913.1|  PREDICTED: oligopeptide transporter 3              314   7e-166   Sesamum indicum [beniseed]
ref|XP_011040169.1|  PREDICTED: oligopeptide transporter 3              303   1e-163   Populus euphratica
ref|XP_011002374.1|  PREDICTED: oligopeptide transporter 3-like         301   1e-162   Populus euphratica
gb|EYU27660.1|  hypothetical protein MIMGU_mgv1a001879mg                309   2e-162   Erythranthe guttata [common monkey flower]
ref|XP_002308764.1|  OLIGOPEPTIDE TRANSPORTER family protein            302   8e-162   Populus trichocarpa [western balsam poplar]
gb|KEH32684.1|  oligopeptide transporter OPT family protein             316   1e-161   Medicago truncatula
ref|XP_012074788.1|  PREDICTED: oligopeptide transporter 3              306   4e-161   Jatropha curcas
ref|XP_006283198.1|  hypothetical protein CARUB_v10004230mg             300   1e-160   Capsella rubella
gb|KEH32683.1|  oligopeptide transporter OPT family protein             314   2e-160   Medicago truncatula
ref|XP_008224626.1|  PREDICTED: oligopeptide transporter 3              298   1e-159   Prunus mume [ume]
ref|XP_003529676.1|  PREDICTED: oligopeptide transporter 3-like         297   3e-159   Glycine max [soybeans]
ref|XP_010939248.1|  PREDICTED: oligopeptide transporter 3-like         307   1e-158   Elaeis guineensis
ref|XP_003549274.1|  PREDICTED: oligopeptide transporter 3-like         295   4e-158   Glycine max [soybeans]
ref|XP_009374520.1|  PREDICTED: oligopeptide transporter 3              292   1e-155   Pyrus x bretschneideri [bai li]
ref|XP_007211357.1|  hypothetical protein PRUPE_ppa001984mg             295   1e-155   
ref|XP_008464311.1|  PREDICTED: oligopeptide transporter 3              291   3e-155   Cucumis melo [Oriental melon]
ref|XP_002463867.1|  hypothetical protein SORBIDRAFT_01g007880          282   9e-150   Sorghum bicolor [broomcorn]
ref|XP_004139520.1|  PREDICTED: oligopeptide transporter 3              289   1e-149   Cucumis sativus [cucumbers]
gb|ACL82964.1|  glutathione transporter                                 280   3e-149   Zea mays [maize]
ref|XP_004981750.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    281   4e-149   
ref|XP_003559475.2|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    281   1e-148   
ref|NP_001292781.1|  oligopeptide transporter 3                         281   3e-148   Zea mays [maize]
gb|ABB55328.1|  small oligopeptide transporter, OPT family              281   7e-148   Asparagus officinalis
dbj|BAK07444.1|  predicted protein                                      281   2e-147   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AAQ91200.1|  putative glutathione transporter                        280   4e-146   Zea mays [maize]
gb|KHN42268.1|  Oligopeptide transporter 3                              293   9e-146   Glycine soja [wild soybean]
gb|AAO32313.1|  putative oligopeptide transporter protein               284   2e-145   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002522882.1|  Oligopeptide transporter, putative                 290   3e-145   
ref|NP_001051290.1|  Os03g0751100                                       283   3e-145   
ref|XP_006651827.1|  PREDICTED: oligopeptide transporter 3-like         281   4e-145   
gb|EMT33592.1|  Oligopeptide transporter 3                              276   6e-145   
emb|CAB10414.1|  isp4 like protein                                      293   6e-139   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002323123.2|  OLIGOPEPTIDE TRANSPORTER family protein            299   5e-129   
gb|KHN03544.1|  Oligopeptide transporter 3                              269   2e-125   Glycine soja [wild soybean]
emb|CDP04528.1|  unnamed protein product                                255   3e-109   Coffea canephora [robusta coffee]
ref|XP_004136415.1|  PREDICTED: oligopeptide transporter 2              224   5e-104   Cucumis sativus [cucumbers]
ref|XP_002313213.2|  hypothetical protein POPTR_0009s08290g             221   6e-104   Populus trichocarpa [western balsam poplar]
ref|XP_011003045.1|  PREDICTED: oligopeptide transporter 4              219   4e-103   Populus euphratica
ref|XP_008466130.1|  PREDICTED: oligopeptide transporter 2              222   5e-103   Cucumis melo [Oriental melon]
ref|XP_006394156.1|  hypothetical protein EUTSA_v10003716mg             217   6e-103   Eutrema salsugineum [saltwater cress]
ref|XP_009358688.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    214   7e-103   
ref|XP_009359568.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    216   8e-103   Pyrus x bretschneideri [bai li]
ref|XP_008239235.1|  PREDICTED: oligopeptide transporter 7-like         214   3e-102   Prunus mume [ume]
ref|XP_011070370.1|  PREDICTED: oligopeptide transporter 7              221   4e-102   Sesamum indicum [beniseed]
ref|XP_009801973.1|  PREDICTED: oligopeptide transporter 6-like         215   5e-102   Nicotiana sylvestris
ref|XP_010254620.1|  PREDICTED: oligopeptide transporter 4-like         221   7e-102   Nelumbo nucifera [Indian lotus]
ref|XP_002518328.1|  Oligopeptide transporter, putative                 208   7e-102   Ricinus communis
ref|XP_010553673.1|  PREDICTED: oligopeptide transporter 2              224   9e-102   Tarenaya hassleriana [spider flower]
ref|XP_002263530.1|  PREDICTED: oligopeptide transporter 4              219   1e-101   Vitis vinifera
emb|CDY31321.1|  BnaA02g34200D                                          216   1e-101   Brassica napus [oilseed rape]
ref|XP_008390299.1|  PREDICTED: oligopeptide transporter 7 isofor...    214   1e-101   Malus domestica [apple tree]
ref|XP_009790410.1|  PREDICTED: oligopeptide transporter 4              221   1e-101   Nicotiana sylvestris
emb|CDY46800.1|  BnaC02g43080D                                          216   1e-101   Brassica napus [oilseed rape]
ref|XP_002301110.1|  oligopeptide transporter OPT family protein        219   3e-101   
gb|AAM64614.1|  Isp4-like protein                                       216   3e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008239237.1|  PREDICTED: oligopeptide transporter 7              212   3e-101   Prunus mume [ume]
ref|XP_010691453.1|  PREDICTED: oligopeptide transporter 4              218   3e-101   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008803572.1|  PREDICTED: oligopeptide transporter 4-like i...    213   3e-101   Phoenix dactylifera
ref|XP_008803573.1|  PREDICTED: oligopeptide transporter 4-like i...    213   4e-101   Phoenix dactylifera
gb|EMS45172.1|  Oligopeptide transporter 7                              204   4e-101   Triticum urartu
ref|XP_003555686.1|  PREDICTED: oligopeptide transporter 7              211   4e-101   Glycine max [soybeans]
ref|NP_201246.1|  oligopeptide transporter 4                            216   4e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009130453.1|  PREDICTED: oligopeptide transporter 4              216   5e-101   Brassica rapa
ref|XP_007145948.1|  hypothetical protein PHAVU_006G000100g             208   5e-101   Phaseolus vulgaris [French bean]
ref|XP_010444374.1|  PREDICTED: oligopeptide transporter 4-like         216   5e-101   Camelina sativa [gold-of-pleasure]
ref|XP_011016978.1|  PREDICTED: oligopeptide transporter 2              220   6e-101   Populus euphratica
ref|XP_010484229.1|  PREDICTED: oligopeptide transporter 4              215   6e-101   Camelina sativa [gold-of-pleasure]
ref|XP_009601745.1|  PREDICTED: oligopeptide transporter 7-like         213   7e-101   Nicotiana tomentosiformis
ref|XP_008806363.1|  PREDICTED: oligopeptide transporter 7-like         205   9e-101   Phoenix dactylifera
ref|XP_004147543.1|  PREDICTED: oligopeptide transporter 4              215   1e-100   Cucumis sativus [cucumbers]
ref|XP_008800083.1|  PREDICTED: oligopeptide transporter 4-like         210   1e-100   Phoenix dactylifera
ref|XP_010461766.1|  PREDICTED: oligopeptide transporter 4-like         216   1e-100   Camelina sativa [gold-of-pleasure]
ref|XP_002866614.1|  hypothetical protein ARALYDRAFT_496649             214   1e-100   Arabidopsis lyrata subsp. lyrata
ref|XP_007210345.1|  hypothetical protein PRUPE_ppa001827mg             213   2e-100   Prunus persica
ref|XP_008378664.1|  PREDICTED: oligopeptide transporter 2-like         208   2e-100   
ref|XP_008806360.1|  PREDICTED: oligopeptide transporter 7-like         207   2e-100   
ref|XP_010029951.1|  PREDICTED: oligopeptide transporter 4-like         214   2e-100   Eucalyptus grandis [rose gum]
ref|XP_008803571.1|  PREDICTED: oligopeptide transporter 4-like i...    212   2e-100   Phoenix dactylifera
ref|XP_006280078.1|  hypothetical protein CARUB_v10025959mg             215   3e-100   Capsella rubella
emb|CDY19030.1|  BnaC01g20380D                                          208   3e-100   Brassica napus [oilseed rape]
ref|XP_006351838.1|  PREDICTED: oligopeptide transporter 4-like         217   4e-100   Solanum tuberosum [potatoes]
dbj|BAJ85948.1|  predicted protein                                      209   4e-100   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009612437.1|  PREDICTED: oligopeptide transporter 4              217   5e-100   Nicotiana tomentosiformis
ref|XP_009391956.1|  PREDICTED: oligopeptide transporter 7-like         202   5e-100   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB32170.1|  hypothetical protein B456_005G227300                    228   6e-100   Gossypium raimondii
emb|CDP01884.1|  unnamed protein product                                206   6e-100   Coffea canephora [robusta coffee]
ref|XP_009413226.1|  PREDICTED: oligopeptide transporter 4-like         205   6e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004238028.1|  PREDICTED: oligopeptide transporter 4-like         220   7e-100   Solanum lycopersicum
ref|XP_004288878.1|  PREDICTED: oligopeptide transporter 2-like         216   7e-100   Fragaria vesca subsp. vesca
ref|XP_008454451.1|  PREDICTED: oligopeptide transporter 4              212   1e-99    Cucumis melo [Oriental melon]
ref|XP_006364982.1|  PREDICTED: oligopeptide transporter 4-like         220   2e-99    Solanum tuberosum [potatoes]
ref|XP_011078828.1|  PREDICTED: oligopeptide transporter 7-like i...    207   2e-99    Sesamum indicum [beniseed]
ref|XP_011078837.1|  PREDICTED: oligopeptide transporter 7-like i...    207   3e-99    Sesamum indicum [beniseed]
gb|KFK28135.1|  hypothetical protein AALP_AA8G476800                    210   3e-99    Arabis alpina [alpine rockcress]
ref|XP_003564333.1|  PREDICTED: oligopeptide transporter 7-like         207   3e-99    Brachypodium distachyon [annual false brome]
ref|XP_010934487.1|  PREDICTED: oligopeptide transporter 7              202   3e-99    Elaeis guineensis
ref|XP_010065750.1|  PREDICTED: oligopeptide transporter 4-like         217   3e-99    Eucalyptus grandis [rose gum]
gb|KFK29294.1|  hypothetical protein AALP_AA7G114600                    204   4e-99    Arabis alpina [alpine rockcress]
ref|XP_004953567.1|  PREDICTED: oligopeptide transporter 4-like i...    207   4e-99    
ref|XP_004953566.1|  PREDICTED: oligopeptide transporter 4-like         203   5e-99    
ref|XP_004953568.1|  PREDICTED: oligopeptide transporter 4-like i...    207   5e-99    Setaria italica
ref|XP_004231372.1|  PREDICTED: oligopeptide transporter 4              217   5e-99    Solanum lycopersicum
ref|XP_011078507.1|  PREDICTED: oligopeptide transporter 4-like         224   6e-99    Sesamum indicum [beniseed]
ref|XP_009143920.1|  PREDICTED: oligopeptide transporter 6              203   6e-99    Brassica rapa
ref|XP_006417516.1|  hypothetical protein EUTSA_v10009349mg             218   6e-99    Eutrema salsugineum [saltwater cress]
ref|XP_002892535.1|  ATOPT2                                             216   1e-98    Arabidopsis lyrata subsp. lyrata
ref|XP_009615073.1|  PREDICTED: oligopeptide transporter 4-like         216   1e-98    Nicotiana tomentosiformis
ref|XP_007200086.1|  hypothetical protein PRUPE_ppa021086mg             218   1e-98    Prunus persica
ref|XP_002283680.1|  PREDICTED: oligopeptide transporter 4              224   1e-98    Vitis vinifera
ref|XP_009368318.1|  PREDICTED: oligopeptide transporter 4              217   2e-98    Pyrus x bretschneideri [bai li]
gb|EYU33488.1|  hypothetical protein MIMGU_mgv1a0023121mg               218   2e-98    Erythranthe guttata [common monkey flower]
ref|XP_006472993.1|  PREDICTED: oligopeptide transporter 2-like         204   2e-98    Citrus sinensis [apfelsine]
ref|XP_012074813.1|  PREDICTED: oligopeptide transporter 1-like         211   2e-98    Jatropha curcas
gb|ABE65610.1|  oligopeptide transporter OPT family protein             215   3e-98    Arabidopsis thaliana [mouse-ear cress]
ref|NP_172464.1|  oligopeptide transporter 2                            215   3e-98    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008237085.1|  PREDICTED: oligopeptide transporter 4-like         215   3e-98    Prunus mume [ume]
ref|XP_006304646.1|  hypothetical protein CARUB_v10011782mg             216   3e-98    Capsella rubella
ref|XP_010438561.1|  PREDICTED: oligopeptide transporter 6              200   4e-98    Camelina sativa [gold-of-pleasure]
gb|KGN53886.1|  hypothetical protein Csa_4G179700                       215   4e-98    Cucumis sativus [cucumbers]
ref|XP_007224505.1|  hypothetical protein PRUPE_ppa022679mg             202   4e-98    
gb|KJB32172.1|  hypothetical protein B456_005G227300                    221   4e-98    Gossypium raimondii
ref|XP_006433764.1|  hypothetical protein CICLE_v10003491mg             203   5e-98    Citrus clementina [clementine]
gb|KDO78545.1|  hypothetical protein CISIN_1g004659mg                   308   6e-98    Citrus sinensis [apfelsine]
ref|XP_009366375.1|  PREDICTED: oligopeptide transporter 2-like         201   7e-98    Pyrus x bretschneideri [bai li]
ref|XP_011626075.1|  PREDICTED: oligopeptide transporter 7              217   7e-98    Amborella trichopoda
gb|ERN13351.1|  hypothetical protein AMTR_s00041p00121000               217   8e-98    Amborella trichopoda
ref|XP_008361590.1|  PREDICTED: oligopeptide transporter 2-like         224   9e-98    
ref|XP_010501399.1|  PREDICTED: oligopeptide transporter 2              217   9e-98    Camelina sativa [gold-of-pleasure]
ref|XP_010475851.1|  PREDICTED: oligopeptide transporter 2-like         217   1e-97    Camelina sativa [gold-of-pleasure]
ref|XP_002867483.1|  ATOPT6                                             200   1e-97    
ref|XP_009590288.1|  PREDICTED: oligopeptide transporter 3              318   1e-97    Nicotiana tomentosiformis
ref|XP_010520694.1|  PREDICTED: oligopeptide transporter 4              209   1e-97    Tarenaya hassleriana [spider flower]
ref|NP_194503.1|  oligopeptide transporter                              200   1e-97    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010246854.1|  PREDICTED: oligopeptide transporter 7-like         209   2e-97    Nelumbo nucifera [Indian lotus]
ref|XP_010244695.1|  PREDICTED: oligopeptide transporter 4-like         213   2e-97    Nelumbo nucifera [Indian lotus]
ref|XP_010458316.1|  PREDICTED: oligopeptide transporter 2-like         216   3e-97    Camelina sativa [gold-of-pleasure]
gb|KDP35526.1|  hypothetical protein JCGZ_08964                         202   3e-97    Jatropha curcas
gb|KJB32171.1|  hypothetical protein B456_005G227300                    219   3e-97    Gossypium raimondii
gb|KJB32169.1|  hypothetical protein B456_005G227300                    219   3e-97    Gossypium raimondii
ref|XP_008338986.1|  PREDICTED: oligopeptide transporter 2-like         223   4e-97    
ref|XP_006285678.1|  hypothetical protein CARUB_v10007142mg             201   4e-97    Capsella rubella
gb|KHG09371.1|  Oligopeptide transporter 4 -like protein                218   4e-97    Gossypium arboreum [tree cotton]
ref|XP_009366376.1|  PREDICTED: oligopeptide transporter 2-like         223   5e-97    Pyrus x bretschneideri [bai li]
gb|EYU45286.1|  hypothetical protein MIMGU_mgv1a0020142mg               203   7e-97    Erythranthe guttata [common monkey flower]
ref|XP_010030910.1|  PREDICTED: oligopeptide transporter 4-like         202   7e-97    Eucalyptus grandis [rose gum]
ref|XP_010065749.1|  PREDICTED: oligopeptide transporter 4-like         215   8e-97    
gb|KCW63396.1|  hypothetical protein EUGRSUZ_G01042                     215   9e-97    Eucalyptus grandis [rose gum]
ref|XP_010112260.1|  Oligopeptide transporter 4                         209   1e-96    Morus notabilis
ref|XP_003603705.1|  Oligopeptide transporter                           209   1e-96    Medicago truncatula
gb|EPS60835.1|  hypothetical protein M569_13965                         214   1e-96    Genlisea aurea
ref|XP_009775420.1|  PREDICTED: oligopeptide transporter 2-like         219   1e-96    Nicotiana sylvestris
gb|KDO78543.1|  hypothetical protein CISIN_1g004659mg                   308   1e-96    Citrus sinensis [apfelsine]
ref|XP_002306519.1|  hypothetical protein POPTR_0005s19410g             211   2e-96    
gb|KDO78544.1|  hypothetical protein CISIN_1g004659mg                   309   5e-96    Citrus sinensis [apfelsine]
ref|XP_010052485.1|  PREDICTED: oligopeptide transporter 1-like         197   7e-96    Eucalyptus grandis [rose gum]
ref|XP_003570148.1|  PREDICTED: oligopeptide transporter 4-like         201   8e-96    Brachypodium distachyon [annual false brome]
gb|KCW76554.1|  hypothetical protein EUGRSUZ_D00943                     197   8e-96    Eucalyptus grandis [rose gum]
ref|XP_006486776.1|  PREDICTED: oligopeptide transporter 4-like         207   9e-96    Citrus sinensis [apfelsine]
gb|EPS62495.1|  hypothetical protein M569_12295                         204   1e-95    Genlisea aurea
ref|XP_011015796.1|  PREDICTED: oligopeptide transporter 4-like         210   1e-95    Populus euphratica
gb|KHG27446.1|  Oligopeptide transporter 4 -like protein                216   1e-95    Gossypium arboreum [tree cotton]
ref|XP_011074283.1|  PREDICTED: oligopeptide transporter 4-like         206   1e-95    Sesamum indicum [beniseed]
emb|CCO06497.1|  oligopeptide transporter                               199   1e-95    Arabis alpina [alpine rockcress]
emb|CDY69955.1|  BnaCnng66090D                                          205   1e-95    Brassica napus [oilseed rape]
dbj|BAJ90957.1|  predicted protein                                      201   2e-95    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB58808.1|  hypothetical protein B456_009G227000                    216   2e-95    Gossypium raimondii
gb|KJB58807.1|  hypothetical protein B456_009G227000                    216   2e-95    Gossypium raimondii
gb|KFK27168.1|  hypothetical protein AALP_AA8G344300                    198   2e-95    Arabis alpina [alpine rockcress]
ref|XP_006422648.1|  hypothetical protein CICLE_v10027887mg             206   2e-95    Citrus clementina [clementine]
gb|EEC79904.1|  hypothetical protein OsI_21444                          209   3e-95    Oryza sativa Indica Group [Indian rice]
ref|XP_006364985.1|  PREDICTED: oligopeptide transporter 2-like i...    218   5e-95    
ref|XP_011087976.1|  PREDICTED: oligopeptide transporter 4              221   5e-95    Sesamum indicum [beniseed]
ref|XP_002452706.1|  hypothetical protein SORBIDRAFT_04g031070          204   5e-95    Sorghum bicolor [broomcorn]
ref|XP_002529653.1|  Oligopeptide transporter, putative                 204   6e-95    
gb|EYU19483.1|  hypothetical protein MIMGU_mgv1a023929mg                192   7e-95    Erythranthe guttata [common monkey flower]
gb|EYU30413.1|  hypothetical protein MIMGU_mgv1a002159mg                192   7e-95    Erythranthe guttata [common monkey flower]
ref|XP_006364984.1|  PREDICTED: oligopeptide transporter 2-like i...    217   8e-95    Solanum tuberosum [potatoes]
ref|XP_006401399.1|  hypothetical protein EUTSA_v10012759mg             199   8e-95    Eutrema salsugineum [saltwater cress]
ref|XP_011626108.1|  PREDICTED: oligopeptide transporter 7              213   8e-95    
dbj|BAD08158.1|  putative sexual differentiation process protein ...    196   8e-95    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008339039.1|  PREDICTED: oligopeptide transporter 2-like         202   9e-95    
gb|ERN13358.1|  hypothetical protein AMTR_s00041p00133990               213   9e-95    Amborella trichopoda
gb|EEE57620.1|  hypothetical protein OsJ_08019                          196   1e-94    Oryza sativa Japonica Group [Japonica rice]
ref|XP_007225210.1|  hypothetical protein PRUPE_ppa002011mg             199   1e-94    Prunus persica
emb|CDP04526.1|  unnamed protein product                                311   1e-94    Coffea canephora [robusta coffee]
ref|XP_009407958.1|  PREDICTED: oligopeptide transporter 7-like         208   1e-94    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008219191.1|  PREDICTED: oligopeptide transporter 2-like         201   1e-94    Prunus mume [ume]
ref|XP_007018304.1|  Oligopeptide transporter 2                         192   2e-94    
ref|XP_010064240.1|  PREDICTED: oligopeptide transporter 4-like         204   2e-94    
ref|XP_007148333.1|  hypothetical protein PHAVU_006G200000g             198   2e-94    Phaseolus vulgaris [French bean]
ref|XP_006433763.1|  hypothetical protein CICLE_v10003230mg             212   2e-94    
ref|XP_010320236.1|  PREDICTED: oligopeptide transporter 2-like         209   3e-94    Solanum lycopersicum
ref|XP_009773627.1|  PREDICTED: oligopeptide transporter 3              309   3e-94    Nicotiana sylvestris
ref|XP_012071040.1|  PREDICTED: oligopeptide transporter 1-like         198   3e-94    Jatropha curcas
ref|XP_007156166.1|  hypothetical protein PHAVU_003G263700g             194   5e-94    Phaseolus vulgaris [French bean]
emb|CAN81605.1|  hypothetical protein VITISV_025060                     219   5e-94    Vitis vinifera
ref|XP_007042780.1|  Oligopeptide transporter 4                         211   5e-94    
ref|XP_008219210.1|  PREDICTED: oligopeptide transporter 2-like         202   7e-94    
ref|XP_006472404.1|  PREDICTED: oligopeptide transporter 4-like         209   8e-94    Citrus sinensis [apfelsine]
ref|XP_003593303.1|  Oligopeptide transporter                           201   1e-93    
ref|XP_009616769.1|  PREDICTED: oligopeptide transporter 2-like         215   1e-93    Nicotiana tomentosiformis
dbj|BAD67732.1|  putative sexual differentiation process protein ...    204   1e-93    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009398499.1|  PREDICTED: oligopeptide transporter 4-like         186   2e-93    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006401695.1|  hypothetical protein EUTSA_v10016096mg             208   2e-93    Eutrema salsugineum [saltwater cress]
emb|CDP00949.1|  unnamed protein product                                215   2e-93    Coffea canephora [robusta coffee]
ref|XP_003547106.1|  PREDICTED: oligopeptide transporter 4-like         202   2e-93    
gb|KDO78542.1|  hypothetical protein CISIN_1g004659mg                   306   3e-93    Citrus sinensis [apfelsine]
ref|XP_012068073.1|  PREDICTED: oligopeptide transporter 4-like         214   3e-93    Jatropha curcas
ref|XP_002864248.1|  predicted protein                                  202   3e-93    
ref|XP_009119900.1|  PREDICTED: oligopeptide transporter 9              210   3e-93    Brassica rapa
ref|XP_006467278.1|  PREDICTED: oligopeptide transporter 3-like         306   4e-93    Citrus sinensis [apfelsine]
ref|XP_008785648.1|  PREDICTED: oligopeptide transporter 3-like         305   5e-93    Phoenix dactylifera
gb|EEC73829.1|  hypothetical protein OsI_08562                          196   6e-93    Oryza sativa Indica Group [Indian rice]
gb|EAY75055.1|  hypothetical protein OsI_02950                          195   6e-93    Oryza sativa Indica Group [Indian rice]
ref|XP_006449924.1|  hypothetical protein CICLE_v10014396mg             305   7e-93    Citrus clementina [clementine]
gb|AES90550.2|  oligopeptide transporter OPT family protein             203   9e-93    Medicago truncatula
ref|XP_002864247.1|  ATOPT9                                             205   1e-92    Arabidopsis lyrata subsp. lyrata
emb|CDY35662.1|  BnaC09g29840D                                          210   1e-92    Brassica napus [oilseed rape]
emb|CDY38751.1|  BnaC03g14980D                                          196   1e-92    Brassica napus [oilseed rape]
ref|XP_011627877.1|  PREDICTED: oligopeptide transporter 4 isofor...    211   1e-92    
gb|KFK26970.1|  hypothetical protein AALP_AA8G317000                    210   2e-92    Arabis alpina [alpine rockcress]
ref|XP_003608353.1|  Oligopeptide transporter                           202   2e-92    
ref|XP_011627878.1|  PREDICTED: oligopeptide transporter 4 isofor...    211   2e-92    
emb|CDY47076.1|  BnaA03g12220D                                          195   2e-92    Brassica napus [oilseed rape]
ref|XP_003545740.1|  PREDICTED: oligopeptide transporter 4              191   2e-92    
ref|XP_004485624.1|  PREDICTED: oligopeptide transporter 4-like         198   3e-92    Cicer arietinum [garbanzo]
ref|XP_010087657.1|  Oligopeptide transporter 3                         303   3e-92    
dbj|BAB89477.1|  isp4 protein-like                                      192   4e-92    Oryza sativa Japonica Group [Japonica rice]
ref|NP_200163.1|  oligopeptide transporter 9                            206   4e-92    Arabidopsis thaliana [mouse-ear cress]
ref|NP_200164.1|  oligopeptide transporter 8                            200   4e-92    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011069784.1|  PREDICTED: oligopeptide transporter 5-like         186   5e-92    Sesamum indicum [beniseed]
gb|KJB58811.1|  hypothetical protein B456_009G227200                    189   6e-92    Gossypium raimondii
ref|XP_007026363.1|  Oligopeptide transporter isoform 2                 301   7e-92    
ref|XP_004507597.1|  PREDICTED: oligopeptide transporter 3-like         303   7e-92    Cicer arietinum [garbanzo]
ref|XP_006856596.1|  PREDICTED: oligopeptide transporter 4 isofor...    209   8e-92    Amborella trichopoda
ref|XP_003572326.1|  PREDICTED: oligopeptide transporter 5-like         198   1e-91    Brachypodium distachyon [annual false brome]
gb|KJB68518.1|  hypothetical protein B456_010G248000                    192   1e-91    Gossypium raimondii
ref|XP_009142514.1|  PREDICTED: oligopeptide transporter 5              195   1e-91    Brassica rapa
ref|XP_002283674.1|  PREDICTED: oligopeptide transporter 4-like         218   1e-91    Vitis vinifera
emb|CDX89322.1|  BnaA01g15710D                                          194   2e-91    
emb|CBI35438.3|  unnamed protein product                                185   2e-91    Vitis vinifera
emb|CDX94308.1|  BnaC01g18760D                                          194   2e-91    
gb|KJB67417.1|  hypothetical protein B456_010G190300                    301   2e-91    Gossypium raimondii
ref|XP_002273768.2|  PREDICTED: oligopeptide transporter 3              301   3e-91    Vitis vinifera
emb|CBI18634.3|  unnamed protein product                                301   3e-91    Vitis vinifera
ref|XP_012071039.1|  PREDICTED: oligopeptide transporter 1-like i...    189   3e-91    Jatropha curcas
ref|XP_007026362.1|  Oligopeptide transporter isoform 1                 301   4e-91    
emb|CDY55351.1|  BnaAnng13860D                                          186   4e-91    Brassica napus [oilseed rape]
ref|XP_009795358.1|  PREDICTED: oligopeptide transporter 2-like         209   5e-91    Nicotiana sylvestris
gb|KDP39296.1|  hypothetical protein JCGZ_01053                         187   5e-91    Jatropha curcas
ref|XP_010104576.1|  Oligopeptide transporter 2                         185   6e-91    
ref|XP_012071038.1|  PREDICTED: oligopeptide transporter 1-like i...    188   6e-91    Jatropha curcas
ref|XP_010520948.1|  PREDICTED: oligopeptide transporter 6              211   7e-91    Tarenaya hassleriana [spider flower]
ref|XP_009380132.1|  PREDICTED: oligopeptide transporter 3-like         300   7e-91    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009619170.1|  PREDICTED: oligopeptide transporter 2-like         218   7e-91    Nicotiana tomentosiformis
ref|XP_006401694.1|  hypothetical protein EUTSA_v10015543mg             197   8e-91    Eutrema salsugineum [saltwater cress]
ref|XP_006857743.1|  PREDICTED: oligopeptide transporter 1              188   8e-91    Amborella trichopoda
ref|XP_002452707.1|  hypothetical protein SORBIDRAFT_04g031080          204   1e-90    Sorghum bicolor [broomcorn]
ref|XP_006414361.1|  hypothetical protein EUTSA_v10024512mg             300   1e-90    Eutrema salsugineum [saltwater cress]
ref|XP_011627785.1|  PREDICTED: oligopeptide transporter 3 isofor...    294   1e-90    
ref|XP_007154044.1|  hypothetical protein PHAVU_003G086500g             300   1e-90    Phaseolus vulgaris [French bean]
ref|NP_567493.5|  oligopeptide transporter                              300   1e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_004252726.1|  PREDICTED: oligopeptide transporter 2-like         216   1e-90    Solanum lycopersicum
gb|KHG20373.1|  Oligopeptide transporter 3 -like protein                300   1e-90    Gossypium arboreum [tree cotton]
sp|O23482.3|OPT3_ARATH  RecName: Full=Oligopeptide transporter 3;...    299   1e-90    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132467.1|  PREDICTED: oligopeptide transporter 8-like         193   1e-90    Brassica rapa
ref|XP_010907563.1|  PREDICTED: oligopeptide transporter 3-like         299   2e-90    Elaeis guineensis
ref|XP_010039442.1|  PREDICTED: oligopeptide transporter 3-like         299   2e-90    Eucalyptus grandis [rose gum]
gb|ADW09325.1|  oligopeptide transporter 3                              299   2e-90    Noccaea caerulescens
ref|XP_012071261.1|  PREDICTED: oligopeptide transporter 1-like         189   2e-90    
ref|NP_001152089.1|  oligopeptide transporter 4                         202   2e-90    
ref|XP_009118291.1|  PREDICTED: oligopeptide transporter 2              205   3e-90    Brassica rapa
ref|XP_002527347.1|  Oligopeptide transporter, putative                 211   3e-90    Ricinus communis
emb|CDY22616.1|  BnaC08g42500D                                          204   3e-90    Brassica napus [oilseed rape]
ref|XP_008677393.1|  PREDICTED: oligopeptide transporter 4 isofor...    202   4e-90    
ref|XP_002868139.1|  hypothetical protein ARALYDRAFT_355122             298   4e-90    Arabidopsis lyrata subsp. lyrata
ref|XP_010440168.1|  PREDICTED: oligopeptide transporter 3-like         298   4e-90    Camelina sativa [gold-of-pleasure]
ref|XP_010436532.1|  PREDICTED: oligopeptide transporter 3              298   5e-90    
gb|AAK96781.1|  Unknown protein                                         298   5e-90    
ref|XP_010449801.1|  PREDICTED: oligopeptide transporter 3              298   5e-90    
ref|XP_010270227.1|  PREDICTED: oligopeptide transporter 3              298   6e-90    
gb|EPS68970.1|  hypothetical protein M569_05793                         197   7e-90    
ref|XP_010104574.1|  Oligopeptide transporter 4                         213   8e-90    
ref|XP_009404107.1|  PREDICTED: oligopeptide transporter 3-like         297   1e-89    
gb|KFK26550.1|  hypothetical protein AALP_AA8G263100                    297   1e-89    
ref|XP_009132469.1|  PREDICTED: oligopeptide transporter 9-like         213   1e-89    
ref|XP_009124517.1|  PREDICTED: oligopeptide transporter 3              296   2e-89    
ref|XP_006281882.1|  hypothetical protein CARUB_v10028080mg             199   3e-89    
ref|XP_008780991.1|  PREDICTED: oligopeptide transporter 3-like         296   3e-89    
ref|XP_002323113.2|  hypothetical protein POPTR_0016s00650g             193   5e-89    
emb|CAD91127.1|  glutathione transporter GT1                            293   6e-89    
ref|XP_009397220.1|  PREDICTED: oligopeptide transporter 3-like         293   4e-88    
emb|CDY42539.1|  BnaC08g10640D                                          293   4e-88    
gb|ABF70152.1|  oligopeptide transporter OPT family protein             293   4e-88    
ref|XP_006856263.1|  PREDICTED: oligopeptide transporter 3 isofor...    292   6e-88    
ref|XP_009615074.1|  PREDICTED: oligopeptide transporter 4-like         193   1e-87    
ref|XP_008466652.1|  PREDICTED: oligopeptide transporter 4-like         202   1e-87    
ref|XP_007026393.1|  Oligopeptide transporter 5                         190   1e-87    
ref|XP_001767301.1|  predicted protein                                  180   1e-87    
ref|XP_010113336.1|  Oligopeptide transporter 7                         201   2e-87    
ref|XP_010542186.1|  PREDICTED: oligopeptide transporter 3              291   2e-87    
ref|XP_008345787.1|  PREDICTED: oligopeptide transporter 3-like         291   3e-87    
gb|EYU43826.1|  hypothetical protein MIMGU_mgv1a0029011mg               181   4e-87    
ref|XP_003528403.1|  PREDICTED: oligopeptide transporter 4-like         184   5e-87    
ref|XP_010057794.1|  PREDICTED: oligopeptide transporter 3-like         290   6e-87    
ref|XP_010686627.1|  PREDICTED: oligopeptide transporter 3              290   7e-87    
ref|XP_004136414.1|  PREDICTED: oligopeptide transporter 4-like         200   1e-86    
ref|XP_007148334.1|  hypothetical protein PHAVU_006G200100g             180   2e-86    
emb|CDP19589.1|  unnamed protein product                                218   2e-86    
gb|KDP39297.1|  hypothetical protein JCGZ_01054                         178   7e-86    
ref|XP_012071036.1|  PREDICTED: oligopeptide transporter 1-like         177   7e-86    
ref|XP_011040149.1|  PREDICTED: oligopeptide transporter 1-like i...    195   8e-86    
ref|XP_007020441.1|  Oligopeptide transporter 5                         182   9e-86    
ref|XP_004238545.1|  PREDICTED: oligopeptide transporter 4-like         186   9e-86    
ref|XP_007159179.1|  hypothetical protein PHAVU_002G215700g             174   1e-85    
ref|XP_011040150.1|  PREDICTED: oligopeptide transporter 1-like i...    194   1e-85    
ref|XP_002971950.1|  hypothetical protein SELMODRAFT_148240             179   2e-85    
ref|XP_009374859.1|  PREDICTED: oligopeptide transporter 3-like         286   3e-85    
ref|XP_002977317.1|  hypothetical protein SELMODRAFT_232939             178   4e-85    
ref|XP_006364990.1|  PREDICTED: oligopeptide transporter 4-like         182   2e-84    
ref|XP_009780017.1|  PREDICTED: oligopeptide transporter 4-like         181   3e-84    
ref|XP_011002414.1|  PREDICTED: oligopeptide transporter 1-like         186   3e-84    
ref|XP_004295330.1|  PREDICTED: oligopeptide transporter 3              282   4e-84    
ref|XP_008349335.1|  PREDICTED: oligopeptide transporter 3-like         283   4e-84    
gb|EYU33719.1|  hypothetical protein MIMGU_mgv1a024635mg                196   5e-84    
gb|ADW66457.1|  oligopeptide transporter                                281   1e-83    
ref|XP_001772044.1|  predicted protein                                  180   4e-83    
gb|KCW45990.1|  hypothetical protein EUGRSUZ_L00158                     277   5e-82    
gb|EMS48793.1|  Oligopeptide transporter 3                              272   8e-82    
ref|XP_010039444.1|  PREDICTED: oligopeptide transporter 3-like i...    276   2e-81    
ref|XP_010039447.1|  PREDICTED: oligopeptide transporter 3-like i...    275   2e-81    
emb|CBI19305.3|  unnamed protein product                                188   2e-81    
emb|CDS03583.1|  hypothetical protein LRAMOSA00985                      167   4e-81    
ref|XP_010039443.1|  PREDICTED: oligopeptide transporter 3-like         273   4e-81    
emb|CDH48449.1|  oligopeptide transporter 7-like                        167   7e-81    
emb|CDS05455.1|  hypothetical protein LRAMOSA07983                      168   7e-81    
emb|CBI29553.3|  unnamed protein product                                177   9e-81    
emb|CDP04527.1|  unnamed protein product                                271   1e-80    
emb|CDO97358.1|  unnamed protein product                                209   3e-80    
gb|KDO78546.1|  hypothetical protein CISIN_1g004659mg                   266   5e-80    
emb|CDP19592.1|  unnamed protein product                                172   1e-79    
ref|XP_008390300.1|  PREDICTED: oligopeptide transporter 7 isofor...    214   7e-79    
dbj|BAJ95761.1|  predicted protein                                      193   8e-79    
emb|CDY11969.1|  BnaC03g13950D                                          189   9e-79    
emb|CDY38749.1|  BnaC03g15000D                                          176   3e-78    
dbj|BAJ85522.1|  predicted protein                                      193   5e-78    
emb|CDH52179.1|  oligopeptide transporter 3-like                        164   5e-78    
ref|XP_006422647.1|  hypothetical protein CICLE_v10027887mg             206   5e-77    
emb|CBI39769.3|  unnamed protein product                                180   7e-77    
gb|EPB84658.1|  OPT family small oligopeptide transporter               159   1e-76    
gb|KHN33580.1|  Oligopeptide transporter 4                              177   3e-76    
emb|CEP16328.1|  hypothetical protein                                   162   9e-76    
ref|XP_008366120.1|  PREDICTED: oligopeptide transporter 1-like         160   2e-75    
gb|EYU36438.1|  hypothetical protein MIMGU_mgv1a023798mg                197   2e-75    
dbj|GAN07270.1|  oligopeptide transporter isoform 1                     155   4e-75    
ref|XP_006380863.1|  hypothetical protein POPTR_0006s00560g             181   4e-75    
gb|EPB90054.1|  OPT family small oligopeptide transporter               163   6e-75    
gb|KFH70892.1|  OPT family small oligopeptide transporter               171   6e-75    
dbj|GAN10110.1|  oligopeptide transporter 7                             159   8e-75    
gb|EIE91872.1|  OPT family small oligopeptide transporter               159   2e-72    
gb|EMS45133.1|  Oligopeptide transporter 4                              162   4e-72    
gb|KFH67523.1|  OPT family small oligopeptide transporter               159   1e-71    
gb|KDP39295.1|  hypothetical protein JCGZ_01052                         172   6e-70    
ref|XP_007156164.1|  hypothetical protein PHAVU_003G263700g             179   2e-68    
gb|ABF98906.1|  oligopeptide transporter 3, putative, expressed         236   3e-68    
ref|XP_006452633.1|  hypothetical protein CICLE_v10007763mg             173   6e-68    
gb|KFH71018.1|  OPT family small oligopeptide transporter               159   9e-68    
gb|KFH66297.1|  OPT family small oligopeptide transporter               157   1e-67    
gb|KFH72322.1|  OPT family small oligopeptide transporter               161   3e-67    
gb|KDO65574.1|  hypothetical protein CISIN_1g037378mg                   149   3e-67    
gb|KHN33579.1|  Oligopeptide transporter 4                              155   3e-66    
gb|KFH71017.1|  OPT family small oligopeptide transporter               150   1e-65    
gb|KFH72323.1|  OPT family small oligopeptide transporter               163   1e-65    
ref|XP_010038756.1|  PREDICTED: oligopeptide transporter 5-like         141   2e-65    
gb|KCW45497.1|  hypothetical protein EUGRSUZ_L00776                     154   3e-65    
ref|XP_006494270.1|  PREDICTED: oligopeptide transporter 5-like         148   5e-65    
gb|KFH66299.1|  OPT family small oligopeptide transporter               152   6e-65    
gb|KFH69709.1|  OPT family small oligopeptide transporter               155   3e-64    
gb|KDQ26311.1|  OPT superfamily                                         137   6e-64    
gb|KIJ58764.1|  hypothetical protein HYDPIDRAFT_178006                  140   2e-63    
gb|EMS65130.1|  Oligopeptide transporter 7                              172   2e-63    
ref|XP_007388656.1|  OPT oligopeptide transporter                       136   2e-63    
gb|KFH66292.1|  OPT family small oligopeptide transporter               152   2e-63    
ref|XP_008374100.1|  PREDICTED: oligopeptide transporter 7-like i...    216   2e-63    
emb|CBI19304.3|  unnamed protein product                                226   5e-63    
gb|KIM85465.1|  hypothetical protein PILCRDRAFT_817493                  149   7e-63    
gb|KDQ28129.1|  OPT superfamily                                         137   1e-62    
gb|AEJ88342.1|  putative oligopeptide transporter                       220   2e-62    
ref|XP_010090590.1|  Oligopeptide transporter 7                         223   2e-62    
gb|EMD31506.1|  hypothetical protein CERSUDRAFT_119725                  142   3e-62    
gb|KDO67986.1|  hypothetical protein CISIN_1g029091mg                   209   4e-62    
ref|XP_007336417.1|  OPT-domain-containing protein                      137   4e-62    
emb|CDY06509.1|  BnaC06g11350D                                          210   5e-62    
ref|XP_002981747.1|  hypothetical protein SELMODRAFT_179057             223   6e-62    
ref|XP_002967597.1|  hypothetical protein SELMODRAFT_88962              223   6e-62    
gb|KIJ14873.1|  PF03169 OPT oligopeptide transporter protein            134   7e-62    
gb|EMT01286.1|  Oligopeptide transporter 4                              222   7e-62    
gb|KIJ32419.1|  hypothetical protein M422DRAFT_76535                    137   8e-62    
ref|XP_010038755.1|  PREDICTED: oligopeptide transporter 5-like         134   9e-62    
ref|XP_008044438.1|  small oligopeptide transporter                     134   1e-61    
ref|XP_012068072.1|  PREDICTED: oligopeptide transporter 2              222   1e-61    
gb|KEP46956.1|  OPT oligopeptide transporter                            141   1e-61    
gb|KIK93831.1|  hypothetical protein PAXRUDRAFT_33842                   133   1e-61    
gb|EMS64171.1|  Oligopeptide transporter 4                              143   1e-61    
gb|EGN97506.1|  hypothetical protein SERLA73DRAFT_57288                 140   1e-61    
ref|XP_002963418.1|  hypothetical protein SELMODRAFT_166204             221   2e-61    
gb|KIK22257.1|  hypothetical protein PISMIDRAFT_680460                  136   2e-61    
emb|CEL60217.1|  Sexual differentiation process protein isp4 OS=S...    144   2e-61    
gb|KIJ19317.1|  hypothetical protein PAXINDRAFT_174878                  140   2e-61    
ref|XP_007272091.1|  OPT oligopeptide transporter                       138   2e-61    
dbj|BAJ97716.1|  predicted protein                                      218   2e-61    
gb|EMS68344.1|  Oligopeptide transporter 4                              221   3e-61    
gb|KIJ67169.1|  hypothetical protein HYDPIDRAFT_37757                   132   3e-61    
gb|KFH66298.1|  OPT family small oligopeptide transporter               141   3e-61    
emb|CDO75767.1|  hypothetical protein BN946_scf185039.g3                133   3e-61    
gb|ELU37054.1|  OPT oligopeptide transporter, putative                  145   4e-61    
ref|XP_012074613.1|  PREDICTED: oligopeptide transporter 4-like         207   5e-61    
gb|KDQ59733.1|  hypothetical protein JAAARDRAFT_33300                   134   5e-61    
ref|XP_007320347.1|  hypothetical protein SERLADRAFT_371352             138   5e-61    
ref|XP_002971556.1|  hypothetical protein SELMODRAFT_172313             219   9e-61    
ref|XP_010676880.1|  PREDICTED: oligopeptide transporter 7-like         219   1e-60    
ref|XP_007870893.1|  small oligopeptide transporter                     137   1e-60    
ref|XP_007369046.1|  OPT oligopeptide transporter                       135   1e-60    
gb|EMD35965.1|  hypothetical protein CERSUDRAFT_115910                  138   1e-60    
ref|XP_006376658.1|  hypothetical protein POPTR_0012s02660g             211   2e-60    
ref|XP_008033179.1|  OPT oligopeptide transporter                       149   2e-60    
ref|XP_008034066.1|  OPT oligopeptide transporter                       137   2e-60    
gb|EMS53301.1|  Oligopeptide transporter 4                              142   3e-60    
ref|XP_004143945.1|  PREDICTED: oligopeptide transporter 7              218   3e-60    
gb|KIK91864.1|  hypothetical protein PAXRUDRAFT_13554                   141   3e-60    
gb|KHG17687.1|  Oligopeptide transporter 7                              218   4e-60    
gb|KJB24153.1|  hypothetical protein B456_004G130200                    218   4e-60    
ref|XP_007394583.1|  hypothetical protein PHACADRAFT_254040             136   4e-60    
gb|EUC55788.1|  OPT oligopeptide transporter                            142   4e-60    
gb|KFH66296.1|  hypothetical protein MVEG_08395                         157   5e-60    
ref|XP_002283691.1|  PREDICTED: oligopeptide transporter 2              218   5e-60    
gb|KHG17686.1|  Oligopeptide transporter 7                              218   5e-60    
emb|CAN79818.1|  hypothetical protein VITISV_040328                     216   6e-60    
ref|XP_007265955.1|  glutathione transporter                            136   7e-60    
gb|KIP05643.1|  hypothetical protein PHLGIDRAFT_108023                  135   7e-60    
gb|KIJ67177.1|  hypothetical protein HYDPIDRAFT_25652                   130   7e-60    
ref|XP_007385041.1|  small oligopeptide transporter                     132   9e-60    
ref|XP_006456142.1|  hypothetical protein AGABI2DRAFT_77707             134   1e-59    
gb|EMS65129.1|  Oligopeptide transporter 7                              217   1e-59    
emb|CBI19303.3|  unnamed protein product                                217   1e-59    
ref|XP_002437735.1|  hypothetical protein SORBIDRAFT_10g001530          217   1e-59    
ref|XP_003581597.1|  PREDICTED: oligopeptide transporter 4-like         216   1e-59    
emb|CDP12213.1|  unnamed protein product                                216   2e-59    
ref|XP_007771935.1|  OPT oligopeptide transporter                       135   2e-59    
gb|EPT04397.1|  hypothetical protein FOMPIDRAFT_1022010                 152   2e-59    
ref|XP_002267184.1|  PREDICTED: oligopeptide transporter 1-like         216   2e-59    
gb|EMT31419.1|  Oligopeptide transporter 7                              203   2e-59    
gb|KIO25491.1|  hypothetical protein M407DRAFT_210540                   133   2e-59    
ref|XP_006343795.1|  PREDICTED: oligopeptide transporter 7-like         216   2e-59    
gb|KIM63250.1|  hypothetical protein SCLCIDRAFT_1174261                 137   2e-59    
ref|XP_004245468.1|  PREDICTED: oligopeptide transporter 7-like         216   2e-59    
ref|XP_002272972.2|  PREDICTED: oligopeptide transporter 7              216   2e-59    
ref|XP_010267481.1|  PREDICTED: oligopeptide transporter 7-like         216   2e-59    
ref|XP_012086643.1|  PREDICTED: oligopeptide transporter 7              216   2e-59    
ref|XP_007359979.1|  OPT oligopeptide transporter                       153   3e-59    
gb|EJT98000.1|  OPT oligopeptide transporter                            150   4e-59    
gb|KIJ99283.1|  hypothetical protein K443DRAFT_680120                   141   5e-59    
ref|XP_010538850.1|  PREDICTED: oligopeptide transporter 7              214   6e-59    
gb|KIJ67380.1|  hypothetical protein HYDPIDRAFT_173934                  130   7e-59    
ref|XP_006376659.1|  hypothetical protein POPTR_0012s02660g             211   8e-59    
gb|KIJ51366.1|  hypothetical protein M422DRAFT_58909                    137   8e-59    
ref|XP_006960775.1|  OPT-domain-containing protein                      130   9e-59    
ref|XP_009540366.1|  oligopeptide transporter                           139   9e-59    
ref|XP_004309115.1|  PREDICTED: oligopeptide transporter 6-like         214   9e-59    
gb|EGN94176.1|  hypothetical protein SERLA73DRAFT_78096                 142   9e-59    
ref|XP_010644607.1|  PREDICTED: oligopeptide transporter 1-like         214   9e-59    
emb|CBI39770.3|  unnamed protein product                                214   1e-58    
ref|XP_007763525.1|  OPT oligopeptide transporter                       133   1e-58    
ref|XP_010676881.1|  PREDICTED: oligopeptide transporter 7              214   1e-58    
ref|XP_002447030.1|  hypothetical protein SORBIDRAFT_06g027230          214   1e-58    
ref|XP_007039426.1|  Oligopeptide transporter 7 isoform 1               214   1e-58    
ref|XP_004309550.1|  PREDICTED: oligopeptide transporter 7              214   1e-58    
ref|XP_009765351.1|  PREDICTED: oligopeptide transporter 7-like         214   1e-58    
gb|KIK13488.1|  hypothetical protein PISMIDRAFT_17954                   127   1e-58    
gb|KIK44503.1|  hypothetical protein CY34DRAFT_79680                    127   2e-58    
ref|XP_007323735.1|  hypothetical protein SERLADRAFT_453552             139   2e-58    
gb|KIO27118.1|  hypothetical protein M407DRAFT_73589                    127   2e-58    
emb|CDX86844.1|  BnaA09g22340D                                          213   2e-58    
dbj|BAJ87692.1|  predicted protein                                      213   2e-58    
gb|KIK98331.1|  hypothetical protein PAXRUDRAFT_31250                   145   2e-58    
ref|XP_007316488.1|  hypothetical protein SERLADRAFT_447545             131   2e-58    
ref|XP_008437437.1|  PREDICTED: LOW QUALITY PROTEIN: oligopeptide...    213   2e-58    
ref|XP_009108224.1|  PREDICTED: oligopeptide transporter 7              213   2e-58    
gb|KDQ58270.1|  hypothetical protein JAAARDRAFT_57989                   127   2e-58    
gb|EMT05384.1|  Oligopeptide transporter 4                              201   2e-58    
gb|EUC65575.1|  OPT oligopeptide transporter                            140   2e-58    
ref|XP_007220230.1|  hypothetical protein PRUPE_ppa002014mg             213   2e-58    
ref|XP_009608843.1|  PREDICTED: oligopeptide transporter 7-like         213   2e-58    
ref|XP_008349603.1|  PREDICTED: oligopeptide transporter 5-like         206   3e-58    
gb|EPT04456.1|  hypothetical protein FOMPIDRAFT_1113545                 130   3e-58    
ref|XP_008234693.1|  PREDICTED: oligopeptide transporter 6-like         212   3e-58    
gb|KII90413.1|  hypothetical protein PLICRDRAFT_173833                  132   3e-58    
gb|AGA20375.1|  oligopeptide transporter 4                              132   3e-58    



>ref|XP_006352325.1| PREDICTED: oligopeptide transporter 3-like [Solanum tuberosum]
Length=752

 Score =   315 bits (808),  Expect(2) = 1e-166, Method: Compositional matrix adjust.
 Identities = 150/184 (82%), Positives = 169/184 (92%), Gaps = 1/184 (1%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
            G+  +    RCPVEEVALVVPETDDPTLPV+TFRAWFLG++SC ILIFLNTFFIYRTQPL
Sbjct  23   GDTLSSDDDRCPVEEVALVVPETDDPTLPVMTFRAWFLGLSSCTILIFLNTFFIYRTQPL  82

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRW-SFTLNPGPFNIKEHVIITVMANCGVS  442
            +ISAILMQI+VLPIGKFMAATLP++ FA FGRW SF+LNPGPFNIKEHV+ITVMANCGVS
Sbjct  83   TISAILMQIAVLPIGKFMAATLPKKNFALFGRWGSFSLNPGPFNIKEHVVITVMANCGVS  142

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             GGGDAYSIGAIT+M+AYY Q++SFLC LIIVLTTQ++GYGWAG+LRRYLVDPVDMWWPS
Sbjct  143  IGGGDAYSIGAITVMRAYYNQSVSFLCSLIIVLTTQILGYGWAGMLRRYLVDPVDMWWPS  202

Query  623  TLLK  634
             L +
Sbjct  203  NLAQ  206


 Score =   300 bits (767),  Expect(2) = 1e-166, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E K+  +TRM+FFL+ M ASF YY LPGYLFPILTFFSWVCW +P 
Sbjct  203   NLAQVSLFRALHEKEPKTRSLTRMKFFLVFMAASFAYYALPGYLFPILTFFSWVCWAYPH  262

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLGVG FTLDWAGISAYHGSPLV+PW++ILNVAVGF+MFIYII+PLCY
Sbjct  263   SITAQQIGSGYHGLGVGAFTLDWAGISAYHGSPLVTPWSSILNVAVGFIMFIYIIIPLCY  322

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WKYNTFDA+KFPIFSNQLFT++GHKYDT  +LTPQFDLN+ AYE YSKLY
Sbjct  323   WKYNTFDAQKFPIFSNQLFTASGHKYDTTKILTPQFDLNIAAYEKYSKLY  372



>ref|XP_004250295.1| PREDICTED: oligopeptide transporter 3 [Solanum lycopersicum]
Length=755

 Score =   313 bits (801),  Expect(2) = 2e-166, Method: Compositional matrix adjust.
 Identities = 148/184 (80%), Positives = 170/184 (92%), Gaps = 1/184 (1%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
            G+ ++ +  RC VEEVALVVPETDDP+LPV+TFRAWFLG++SC ILIFLNTFFIYRTQPL
Sbjct  26   GDASSTNDERCSVEEVALVVPETDDPSLPVMTFRAWFLGLSSCTILIFLNTFFIYRTQPL  85

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRW-SFTLNPGPFNIKEHVIITVMANCGVS  442
            +ISAILMQI+VLPIGKFMAATLP++ FA FGRW SF+LNPGPFNIKEHV+ITVMANCGVS
Sbjct  86   TISAILMQIAVLPIGKFMAATLPKKSFAIFGRWGSFSLNPGPFNIKEHVVITVMANCGVS  145

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             GGGDAYSIGAIT+M+AYY Q++SFLC LIIVLTTQ++GYGWAG+LRRYLVDPVDMWWPS
Sbjct  146  IGGGDAYSIGAITVMRAYYNQSVSFLCSLIIVLTTQILGYGWAGMLRRYLVDPVDMWWPS  205

Query  623  TLLK  634
             L +
Sbjct  206  NLAQ  209


 Score =   301 bits (772),  Expect(2) = 2e-166, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E K+ G TRM+FFL+ M ASF YY LPGYLFPILTFFSWVCW +P 
Sbjct  206   NLAQVSLFRALHEKEPKTRGFTRMKFFLIFMAASFAYYALPGYLFPILTFFSWVCWAYPH  265

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLGVG FTLDWAGISAYHGSPLV+PW++ILNVAVGF+MFIYII+PLCY
Sbjct  266   SITAQQIGSGYHGLGVGAFTLDWAGISAYHGSPLVTPWSSILNVAVGFIMFIYIIIPLCY  325

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WKYNTFDA+KFPIFSNQLFT++GHKYDT  +LTPQFDLN+ AYE YSKLY
Sbjct  326   WKYNTFDAQKFPIFSNQLFTASGHKYDTTKILTPQFDLNIAAYEKYSKLY  375



>ref|XP_011095913.1| PREDICTED: oligopeptide transporter 3 [Sesamum indicum]
Length=740

 Score =   314 bits (804),  Expect(2) = 7e-166, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 170/188 (90%), Gaps = 2/188 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             PA+ GE  A +  RC VEEVALVVPETDDPTLPV+TFRAW LG+ SCIILIFLNTFFIY
Sbjct  9    KPASNGE--AETEERCSVEEVALVVPETDDPTLPVMTFRAWVLGLASCIILIFLNTFFIY  66

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQI VLPIGKFMAATLP +++  FGRWSF+LNPGPFNIKEHVIITVMAN
Sbjct  67   RTQPLTISAILMQIGVLPIGKFMAATLPTKQYTVFGRWSFSLNPGPFNIKEHVIITVMAN  126

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+++FLC L+IVLTTQ++GYGWAG+LR+YLVDPV+M
Sbjct  127  CGVSIGGGDAYSIGAITVMKAYYKQSVNFLCALLIVLTTQILGYGWAGMLRKYLVDPVEM  186

Query  611  WWPSTLLK  634
            WWPS L +
Sbjct  187  WWPSNLAQ  194


 Score =   299 bits (765),  Expect(2) = 7e-166, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E K+ GMTRM+FFL+ M ASF YY  PGYLFPILTFFSWVCW WP 
Sbjct  191   NLAQVSLFRALHEKETKAQGMTRMKFFLIFMAASFAYYLFPGYLFPILTFFSWVCWAWPH  250

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLGVG FTLDWAGISAYHGSPLV+P+++ILNV +GF+MFIYIIVP+CY
Sbjct  251   SITAQQIGSGYHGLGVGAFTLDWAGISAYHGSPLVTPFSSILNVMIGFIMFIYIIVPICY  310

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK+NTFDA KFPIFSNQLFTS+GHKYDT  +LTPQ++LN+PAYE YSKLY
Sbjct  311   WKFNTFDAHKFPIFSNQLFTSSGHKYDTTKILTPQYELNIPAYEKYSKLY  360



>ref|XP_011040169.1| PREDICTED: oligopeptide transporter 3 [Populus euphratica]
Length=743

 Score =   303 bits (776),  Expect(2) = 1e-163, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E KS GMTRMRFFL+ M ASF YY +PGYLFPILTFFSWVCW WP 
Sbjct  195   NLAQVSLFRALHEKEPKSKGMTRMRFFLIAMTASFFYYAVPGYLFPILTFFSWVCWAWPH  254

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             ++TAQQIGS YHGLGVG FTLDWAGISAYHGSPLV+PW++I+NVAVGF+MFIYIIVP+CY
Sbjct  255   NMTAQQIGSGYHGLGVGAFTLDWAGISAYHGSPLVAPWSSIVNVAVGFIMFIYIIVPVCY  314

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WKYNTFDARKFPIFSNQLFTS+G KYDT  +LTP+F LN+PAY+SYSKLY
Sbjct  315   WKYNTFDARKFPIFSNQLFTSSGQKYDTTKILTPEFQLNIPAYDSYSKLY  364


 Score =   302 bits (774),  Expect(2) = 1e-163, Method: Compositional matrix adjust.
 Identities = 144/182 (79%), Positives = 163/182 (90%), Gaps = 1/182 (1%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            +  A    RCPVEEVALVVPETDDPTLPVLTFRAWFLG+TSC+ILIFLNTFF YRTQPL+
Sbjct  18   DSAAEHHERCPVEEVALVVPETDDPTLPVLTFRAWFLGLTSCVILIFLNTFFTYRTQPLT  77

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            ISAILMQI+VLPIGKFMA TLP + +   G WSF+LNPGPFN+KEHVIIT+ ANCGVS G
Sbjct  78   ISAILMQIAVLPIGKFMAKTLPTKDYRILG-WSFSLNPGPFNMKEHVIITIFANCGVSYG  136

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTL  628
            GGDAYSIGAIT+MKAYY+Q+LSFLCGL+IVLTTQ++GYGWAG+LRRYLV PV+MWWPS L
Sbjct  137  GGDAYSIGAITVMKAYYRQSLSFLCGLLIVLTTQILGYGWAGMLRRYLVYPVEMWWPSNL  196

Query  629  LK  634
             +
Sbjct  197  AQ  198



>ref|XP_011002374.1| PREDICTED: oligopeptide transporter 3-like [Populus euphratica]
Length=744

 Score =   301 bits (772),  Expect(2) = 1e-162, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 166/193 (86%), Gaps = 4/193 (2%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
              +GL   ++ E+      RCPVEEVALVVPETDDPTLPVLTFRAWFLG+TSCIILIFLN
Sbjct  11   HTNGLGLDSSAEEQHE---RCPVEEVALVVPETDDPTLPVLTFRAWFLGLTSCIILIFLN  67

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP R +   G WSF+LNPGPFN+KEHVII
Sbjct  68   TFFTYRTQPLTISAILMQIAVLPIGKFMAKTLPPRDYRILG-WSFSLNPGPFNMKEHVII  126

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ LSFLCGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  127  TIFANCGVSFGGGDAYSIGAITVMKAYYKQNLSFLCGLFIVLTTQILGYGWAGMLRRYLV  186

Query  596  DPVDMWWPSTLLK  634
             PV+MWWPS L +
Sbjct  187  YPVEMWWPSNLAQ  199


 Score =   300 bits (769),  Expect(2) = 1e-162, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE + KS G+TRM+FFL+ M ASF+YYT+PGYLFPI+TFFSWVCWVWP 
Sbjct  196   NLAQVSLFRALHEKDPKSKGLTRMQFFLIAMTASFLYYTVPGYLFPIMTFFSWVCWVWPH  255

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQ+GS YHGLGVG FTLDWAGISAYHGSPLV+PW +I+NVAVGF+MFIYII+PLCY
Sbjct  256   SITAQQVGSGYHGLGVGAFTLDWAGISAYHGSPLVTPWASIVNVAVGFIMFIYIILPLCY  315

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WKYNTFDARKFPIFSNQLFTS+G KY+T  +LTP F LN+PAY+SYSKLY
Sbjct  316   WKYNTFDARKFPIFSNQLFTSSGQKYETTKILTPDFQLNIPAYDSYSKLY  365



>gb|EYU27660.1| hypothetical protein MIMGU_mgv1a001879mg [Erythranthe guttata]
Length=745

 Score =   309 bits (791),  Expect(2) = 2e-162, Method: Compositional matrix adjust.
 Identities = 144/174 (83%), Positives = 163/174 (94%), Gaps = 0/174 (0%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC VEEVALVVPETDDPTLPV+TFRAW LG+ SC ILIFLNTFFIYRTQPLSISAILMQI
Sbjct  26   RCSVEEVALVVPETDDPTLPVMTFRAWVLGLVSCTILIFLNTFFIYRTQPLSISAILMQI  85

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLP+G+FMAATLP +++A FGRW F+LNPGPFNIKEHVIITVMANCGVS GGGDAYSIG
Sbjct  86   AVLPVGRFMAATLPTKEYALFGRWRFSLNPGPFNIKEHVIITVMANCGVSVGGGDAYSIG  145

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            AIT+MKAYYKQ+L+FLC L+IVLTTQ++GYGWAG+LR+YLVDPV+MWWPS L +
Sbjct  146  AITVMKAYYKQSLNFLCALLIVLTTQILGYGWAGMLRKYLVDPVEMWWPSNLAQ  199


 Score =   293 bits (749),  Expect(2) = 2e-162, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E K+ G+TRM+FFL+ M ASF+YY  PGYLF ILTFFSWVCW WP 
Sbjct  196   NLAQVSLFRALHEKETKAQGITRMKFFLICMTASFIYYLFPGYLFQILTFFSWVCWAWPH  255

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLGVG FTLDWAGISAYHGSPLV+P+ +ILNV VGF+MFIYIIVP+CY
Sbjct  256   SITAQQIGSGYHGLGVGAFTLDWAGISAYHGSPLVTPFYSILNVMVGFIMFIYIIVPICY  315

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK+NTFDA KFPIFSNQLFTS GHKYDT  +LTPQ+DLN+ AYESYSKLY
Sbjct  316   WKFNTFDAHKFPIFSNQLFTSAGHKYDTTKILTPQYDLNISAYESYSKLY  365



>ref|XP_002308764.1| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
 gb|EEE92287.1| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
Length=744

 Score =   302 bits (773),  Expect(2) = 8e-162, Method: Compositional matrix adjust.
 Identities = 149/193 (77%), Positives = 166/193 (86%), Gaps = 4/193 (2%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
              +GL   ++ E+      RCPVEEVALVVPETDDPTLPVLTFRAWFLG+TSCIILIFLN
Sbjct  11   HTNGLGLDSSAEEQHE---RCPVEEVALVVPETDDPTLPVLTFRAWFLGLTSCIILIFLN  67

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP R +   G WSF+LNPGPFN+KEHVII
Sbjct  68   TFFTYRTQPLTISAILMQIAVLPIGKFMAKTLPTRDYRILG-WSFSLNPGPFNMKEHVII  126

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ LSFLCGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  127  TIFANCGVSFGGGDAYSIGAITVMKAYYKQNLSFLCGLFIVLTTQILGYGWAGMLRRYLV  186

Query  596  DPVDMWWPSTLLK  634
             PV+MWWPS L +
Sbjct  187  YPVEMWWPSNLAQ  199


 Score =   297 bits (760),  Expect(2) = 8e-162, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE + KS G+TRM+FFL+ M ASF+YYT+PGYLFPI+TFFSWVCWVWP 
Sbjct  196   NLAQVSLFRALHEKDPKSKGLTRMQFFLIAMTASFLYYTVPGYLFPIMTFFSWVCWVWPH  255

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQ+GS YHGLGVG FTLDWAGISAYHGSPLV+PW++I+NVAVGF+MFIYII+PLCY
Sbjct  256   SITAQQVGSGYHGLGVGAFTLDWAGISAYHGSPLVAPWSSIVNVAVGFIMFIYIILPLCY  315

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WKYNTFDA KFPIFSNQLFTS+G KY+T  +LTP F LN+PAY+SYSKLY
Sbjct  316   WKYNTFDAWKFPIFSNQLFTSSGQKYETTKILTPDFQLNIPAYDSYSKLY  365



>gb|KEH32684.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=546

 Score =   316 bits (810),  Expect(2) = 1e-161, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 171/195 (88%), Gaps = 3/195 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTA---PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIF  229
            M+ +NP    EK +   P   RCP+EEVALVVPETDDP+LPV+TFR+WFLGITSCIILIF
Sbjct  1    MAPMNPTPDTEKASNGVPPDDRCPIEEVALVVPETDDPSLPVMTFRSWFLGITSCIILIF  60

Query  230  LNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHV  409
            LNTFF +RTQPL+ISAILMQI+VLPIGKFMAATLP +++  FGRW FTLNPGPFN+KEHV
Sbjct  61   LNTFFTFRTQPLTISAILMQIAVLPIGKFMAATLPTKEYNFFGRWRFTLNPGPFNMKEHV  120

Query  410  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  589
            IIT+ ANCGVS GGGDAYSIGAITIMKAYYKQ+LSFL  L IVLTTQ++GYGWAG+LRRY
Sbjct  121  IITIFANCGVSQGGGDAYSIGAITIMKAYYKQSLSFLLALFIVLTTQILGYGWAGILRRY  180

Query  590  LVDPVDMWWPSTLLK  634
            LVDPV+MWWPS L +
Sbjct  181  LVDPVEMWWPSNLAQ  195


 Score =   283 bits (723),  Expect(2) = 1e-161, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 151/171 (88%), Gaps = 1/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NLAQVSLFRALHE E K+S G TRM+FFL+ MG SF+YY LPGYLF +LTFFSW+C+ WP
Sbjct  192   NLAQVSLFRALHEKENKASKGFTRMQFFLIAMGVSFLYYALPGYLFTVLTFFSWICYAWP  251

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              +ITAQQIGS YHGLG+G FTLDWAGISAYHGSPLV+PWT+I+NV VGF+MFIYII+P+C
Sbjct  252   HNITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVAPWTSIVNVGVGFIMFIYIILPVC  311

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW++NTFDARKFPIFSNQLFTS+GHKYDT  +LT ++DLN+ AY  Y KLY
Sbjct  312   YWRFNTFDARKFPIFSNQLFTSSGHKYDTTKILTKEYDLNIDAYNKYGKLY  362



>ref|XP_012074788.1| PREDICTED: oligopeptide transporter 3 [Jatropha curcas]
 gb|KDP35505.1| hypothetical protein JCGZ_08943 [Jatropha curcas]
Length=743

 Score =   306 bits (785),  Expect(2) = 4e-161, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E KS GMTRMRFFL+ + ASF+YY LPGYLFPILTFFSWVCW WP+
Sbjct  194   NLAQVSLFRALHEKEPKSKGMTRMRFFLIALTASFLYYALPGYLFPILTFFSWVCWAWPK  253

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLG+G FTLDWAGISAYHGSPLV+PWT+I+NV VGF+MFIYIIVPLCY
Sbjct  254   SITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVTPWTSIVNVGVGFIMFIYIIVPLCY  313

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WKYNTFDARKFPIFSNQLFT TGHKYDT  VLTP +DLN+ AY SYSKLY
Sbjct  314   WKYNTFDARKFPIFSNQLFTRTGHKYDTTKVLTPDYDLNIAAYNSYSKLY  363


 Score =   290 bits (743),  Expect(2) = 4e-161, Method: Compositional matrix adjust.
 Identities = 140/190 (74%), Positives = 159/190 (84%), Gaps = 1/190 (1%)
 Frame = +2

Query  65   GLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFF  244
            G     A    +    RC +EEVALVVPETDDPTLPV+TFRAWFLG+ SC +LIFLNTFF
Sbjct  9    GTESEKAANGDSTEHERCSIEEVALVVPETDDPTLPVMTFRAWFLGLASCSLLIFLNTFF  68

Query  245  IYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVM  424
             YRTQPL+ISAILMQI VLPIGKFMA TLP +++  FG + FTLNPGPFNIKEHVIIT+ 
Sbjct  69   TYRTQPLTISAILMQIGVLPIGKFMARTLPSKEYKIFG-YGFTLNPGPFNIKEHVIITIF  127

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            ANCGVS GGGDAYSIGAIT+MKAYYKQ L+FL  LIIVLT+Q++GYGWAG+LRRYLVDPV
Sbjct  128  ANCGVSYGGGDAYSIGAITVMKAYYKQGLNFLLALIIVLTSQILGYGWAGMLRRYLVDPV  187

Query  605  DMWWPSTLLK  634
            +MWWPS L +
Sbjct  188  EMWWPSNLAQ  197



>ref|XP_006283198.1| hypothetical protein CARUB_v10004230mg [Capsella rubella]
 gb|EOA16096.1| hypothetical protein CARUB_v10004230mg [Capsella rubella]
Length=737

 Score =   300 bits (768),  Expect(2) = 1e-160, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 166/193 (86%), Gaps = 5/193 (3%)
 Frame = +2

Query  68   LNPATAGEKT----APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            ++   AG+K     +    RCPVEEVALVVPETDDP++PV+TFRAWFLG+TSC++LIFLN
Sbjct  1    MDAEKAGDKNNAHLSSDHERCPVEEVALVVPETDDPSIPVMTFRAWFLGLTSCVLLIFLN  60

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
            TFF YRTQPL+ISAILMQI+VLPIGKFMA TLP       G W+F+LNPGPFNIKEHVII
Sbjct  61   TFFTYRTQPLTISAILMQIAVLPIGKFMARTLPTTSHNLLG-WNFSLNPGPFNIKEHVII  119

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  120  TIFANCGVSYGGGDAYSIGAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLV  179

Query  596  DPVDMWWPSTLLK  634
            DPVDMWWPS L +
Sbjct  180  DPVDMWWPSNLAQ  192


 Score =   295 bits (756),  Expect(2) = 1e-160, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E KS G TRM+FFL+ + ASF+YY LPGYLFPILTFFSWVCW WP 
Sbjct  189   NLAQVSLFRALHEREEKSKGFTRMQFFLVALAASFLYYALPGYLFPILTFFSWVCWAWPN  248

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQ+GS YHGLGVG FTLDWAGISAYHGSPLV+PW++ILNV VGF+MFIYIIVP+CY
Sbjct  249   SITAQQVGSGYHGLGVGAFTLDWAGISAYHGSPLVAPWSSILNVGVGFIMFIYIIVPVCY  308

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK+NTFDARKFPIFSNQLFT++G KYDT  +LTPQFDL++ AY+SY KLY
Sbjct  309   WKFNTFDARKFPIFSNQLFTTSGQKYDTTKILTPQFDLDIGAYDSYGKLY  358



>gb|KEH32683.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=741

 Score =   314 bits (804),  Expect(2) = 2e-160, Method: Compositional matrix adjust.
 Identities = 150/195 (77%), Positives = 171/195 (88%), Gaps = 3/195 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTA---PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIF  229
            M+ +NP    EK +   P   RCP+EEVALVVPETDDP+LPV+TFR+WFLGITSCIILIF
Sbjct  1    MAPMNPTPDTEKASNGVPPDDRCPIEEVALVVPETDDPSLPVMTFRSWFLGITSCIILIF  60

Query  230  LNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHV  409
            LNTFF +RTQPL+ISAILMQI+VLPIGKFMAATLP +++  FGRW FTLNPGPFN+KEHV
Sbjct  61   LNTFFTFRTQPLTISAILMQIAVLPIGKFMAATLPTKEYNFFGRWRFTLNPGPFNMKEHV  120

Query  410  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  589
            IIT+ ANCGVS GGGDAYSIGAITIMKAYYKQ+LSFL  L IVLTTQ++GYGWAG+LRRY
Sbjct  121  IITIFANCGVSQGGGDAYSIGAITIMKAYYKQSLSFLLALFIVLTTQILGYGWAGILRRY  180

Query  590  LVDPVDMWWPSTLLK  634
            LVDPV+MWWPS L +
Sbjct  181  LVDPVEMWWPSNLAQ  195


 Score =   280 bits (717),  Expect(2) = 2e-160, Method: Compositional matrix adjust.
 Identities = 129/171 (75%), Positives = 151/171 (88%), Gaps = 1/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NLAQVSLFRALHE E K+S G TRM+FFL+ MG SF+YY LPGYLF +LTFFSW+C+ WP
Sbjct  192   NLAQVSLFRALHEKENKASKGFTRMQFFLIAMGVSFLYYALPGYLFTVLTFFSWICYAWP  251

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              +ITAQQIGS YHGLG+G FTLDWAGISAYHGSPLV+PWT+I+NV VGF+MFIYII+P+C
Sbjct  252   HNITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVAPWTSIVNVGVGFIMFIYIILPVC  311

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW++NTFDARKFPIFSNQLFTS+GHKYDT  +LT ++DLN+ AY  Y KLY
Sbjct  312   YWRFNTFDARKFPIFSNQLFTSSGHKYDTTKILTKEYDLNIDAYNKYGKLY  362



>ref|XP_008224626.1| PREDICTED: oligopeptide transporter 3 [Prunus mume]
Length=739

 Score =   298 bits (762),  Expect(2) = 1e-159, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE + K+ G+TRM+FFL+ M ASF YY LPGYLFPILTFFSWVCW WP 
Sbjct  191   NLAQVSLFRALHEKDNKAKGLTRMQFFLIAMTASFAYYALPGYLFPILTFFSWVCWAWPH  250

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLGVG FTLDWAGISAYHGSPLV+PWT+ILNV VGFV+FIY+IVP+CY
Sbjct  251   SITAQQIGSGYHGLGVGAFTLDWAGISAYHGSPLVTPWTSILNVGVGFVLFIYVIVPVCY  310

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK+NTFDARKFPIFSNQLFTS+G KYDT  +LTPQFDLN+ AY SY KLY
Sbjct  311   WKFNTFDARKFPIFSNQLFTSSGQKYDTTKILTPQFDLNIDAYNSYGKLY  360


 Score =   295 bits (754),  Expect(2) = 1e-159, Method: Compositional matrix adjust.
 Identities = 137/191 (72%), Positives = 167/191 (87%), Gaps = 1/191 (1%)
 Frame = +2

Query  62   SGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTF  241
            + ++P  A   ++    RC +EEVALVVPETDDP++PV+TFRAWFLG+T+CIILIFLNTF
Sbjct  5    NHMDPEKAANGSSEDHERCAIEEVALVVPETDDPSMPVMTFRAWFLGLTTCIILIFLNTF  64

Query  242  FIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITV  421
            F +RTQPLSISAILMQI+ LPIGK MA+TLP+R+++  G W F+LNPGPFN+KEHVIIT+
Sbjct  65   FTFRTQPLSISAILMQIASLPIGKLMASTLPKREYSLLG-WRFSLNPGPFNMKEHVIITI  123

Query  422  MANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDP  601
             ANCG+S GGGDAYSIGAITIMKAYYKQ+LSFL  LIIVLT+Q++GYGWAG+LRR+LVDP
Sbjct  124  FANCGISYGGGDAYSIGAITIMKAYYKQSLSFLLALIIVLTSQILGYGWAGILRRFLVDP  183

Query  602  VDMWWPSTLLK  634
            V+MWWPS L +
Sbjct  184  VEMWWPSNLAQ  194



>ref|XP_003529676.1| PREDICTED: oligopeptide transporter 3-like [Glycine max]
Length=742

 Score =   297 bits (760),  Expect(2) = 3e-159, Method: Compositional matrix adjust.
 Identities = 142/191 (74%), Positives = 165/191 (86%), Gaps = 4/191 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGG---RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTF  241
            + +T  EK A       RCPVEEVALVVPETDDP+LPV+TFRAWFLGI SC++LIFLNTF
Sbjct  7    SSSTDAEKAANGESPPERCPVEEVALVVPETDDPSLPVMTFRAWFLGIASCVLLIFLNTF  66

Query  242  FIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITV  421
            F +RTQPL+ISAILMQI+VLPIG+FMAATLP +++   G W FT NPGPFN+KEHVIIT+
Sbjct  67   FTFRTQPLTISAILMQIAVLPIGRFMAATLPTKEYGFLG-WRFTFNPGPFNMKEHVIITI  125

Query  422  MANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDP  601
             ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L IVLTTQ++GYGWAG+LRRYLVDP
Sbjct  126  FANCGVSFGGGDAYSIGAITVMKAYYKQSLSFLCALFIVLTTQMLGYGWAGILRRYLVDP  185

Query  602  VDMWWPSTLLK  634
            V+MWWP+ L +
Sbjct  186  VEMWWPANLAQ  196


 Score =   294 bits (752),  Expect(2) = 3e-159, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E KS G+TRM+FFL+ MGASF+YY LPGYLF +LTFFSW+CW WP 
Sbjct  193   NLAQVSLFRALHEKEPKSKGLTRMQFFLIAMGASFLYYALPGYLFMVLTFFSWICWAWPH  252

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             +ITAQQIGS YHGLG+G FTLDWAGISAYHGSPLVSPW++I+NV +GF+MFIYIIVP+CY
Sbjct  253   NITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVSPWSSIVNVGIGFIMFIYIIVPVCY  312

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK+NTFDA KFPIFSNQLFT++GHKYDT  +LTP++DLNV AY  YSKLY
Sbjct  313   WKFNTFDAHKFPIFSNQLFTASGHKYDTTKILTPEYDLNVDAYNKYSKLY  362



>ref|XP_010939248.1| PREDICTED: oligopeptide transporter 3-like [Elaeis guineensis]
Length=729

 Score =   307 bits (787),  Expect(2) = 1e-158, Method: Compositional matrix adjust.
 Identities = 143/183 (78%), Positives = 164/183 (90%), Gaps = 0/183 (0%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
             EK      RCPVEEVALVVPETDD +LPV+TFRAWFLGITSC +LIFLNTFF YRTQPL
Sbjct  2    AEKQEVDQERCPVEEVALVVPETDDMSLPVMTFRAWFLGITSCTVLIFLNTFFTYRTQPL  61

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  445
            +ISAILMQISVLP+G+FMA+ LP ++   FG+W F LNPGPFNIKEHVIITV ANCGVSP
Sbjct  62   TISAILMQISVLPLGRFMASALPNKEVKVFGQWGFNLNPGPFNIKEHVIITVFANCGVSP  121

Query  446  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPST  625
            GGGDAYSIGAIT+MKAYY+Q+LSFLCGLIIV+TTQL+GYGWAG++R++LVDPV+MWWPST
Sbjct  122  GGGDAYSIGAITVMKAYYRQSLSFLCGLIIVMTTQLLGYGWAGMMRKFLVDPVEMWWPST  181

Query  626  LLK  634
            L +
Sbjct  182  LAQ  184


 Score =   281 bits (719),  Expect(2) = 1e-158, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              LAQVSLFRALHE +  S G +RM+FF++    SF+YY LPGYLFPILTFFSWVCWVWP 
Sbjct  181   TLAQVSLFRALHEKDSPSKGPSRMKFFMIFFVGSFLYYALPGYLFPILTFFSWVCWVWPH  240

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLG+G FTLDWAGISAYHGSPLV+PW +I+N AVGF+MFIYIIVPLCY
Sbjct  241   SITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVTPWFSIINTAVGFIMFIYIIVPLCY  300

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WKYNTFDARKFPIFSNQLFTS G KYDT  VLTPQ++LN  AY++Y KLY
Sbjct  301   WKYNTFDARKFPIFSNQLFTSKGLKYDTTKVLTPQYELNEAAYDNYGKLY  350



>ref|XP_003549274.1| PREDICTED: oligopeptide transporter 3-like [Glycine max]
Length=741

 Score =   295 bits (756),  Expect(2) = 4e-158, Method: Compositional matrix adjust.
 Identities = 141/194 (73%), Positives = 166/194 (86%), Gaps = 2/194 (1%)
 Frame = +2

Query  53   VEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            V+ S ++   A    +P   RCPVEEVALVVPETDDP+LPV+TFRAWFLGI SC++LIFL
Sbjct  4    VKSSSMDAEKAANGESPPE-RCPVEEVALVVPETDDPSLPVMTFRAWFLGIASCVLLIFL  62

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVI  412
            NTFF +RTQPL+ISAILMQI+VLPIG+FMAATLP +++   G   FT NPGPFN+KEHVI
Sbjct  63   NTFFTFRTQPLTISAILMQIAVLPIGRFMAATLPTKEYGFLGS-RFTFNPGPFNMKEHVI  121

Query  413  ITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYL  592
            IT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L IVLTTQ++GYGWAG+LRRYL
Sbjct  122  ITIFANCGVSFGGGDAYSIGAITVMKAYYKQSLSFLCALFIVLTTQMMGYGWAGILRRYL  181

Query  593  VDPVDMWWPSTLLK  634
            VDPV+MWWP+ L +
Sbjct  182  VDPVEMWWPANLAQ  195


 Score =   291 bits (745),  Expect(2) = 4e-158, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E KS G+TRM+FFL+ MGASF+YY LPGYLF +LTFFSW+CW WP 
Sbjct  192   NLAQVSLFRALHEKEPKSKGLTRMQFFLIAMGASFLYYALPGYLFMVLTFFSWICWAWPH  251

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLG+G FTLDWAGISAYHGSPLVSPW++I+NV +GF+MFIYII+PLCY
Sbjct  252   SITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVSPWSSIVNVGIGFIMFIYIILPLCY  311

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK+NTFDA KFPIFSNQLFT++GHKYDT  +LTP++ LNV AY  YSKLY
Sbjct  312   WKFNTFDAHKFPIFSNQLFTASGHKYDTTKILTPEYVLNVDAYNKYSKLY  361



>ref|XP_009374520.1| PREDICTED: oligopeptide transporter 3 [Pyrus x bretschneideri]
Length=749

 Score =   292 bits (748),  Expect(2) = 1e-155, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE + K+ G+TRM+FFL+ + ASF+YY LPGYLFPILTFFSWVCW WP 
Sbjct  201   NLAQVSLFRALHEKDHKAKGLTRMQFFLIALTASFLYYALPGYLFPILTFFSWVCWAWPH  260

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS Y+GLGVG FTLDWAGISAYHGSPLV+PWT+ILNV VGFV+FIYII+PLCY
Sbjct  261   SITAQQIGSGYYGLGVGAFTLDWAGISAYHGSPLVTPWTSILNVGVGFVIFIYIIMPLCY  320

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK+NTFDA+KFPIFS++LFTSTGHKYDT  +LTPQFDLN+ AY SY KLY
Sbjct  321   WKFNTFDAQKFPIFSSKLFTSTGHKYDTTKILTPQFDLNIDAYNSYGKLY  370


 Score =   286 bits (733),  Expect(2) = 1e-155, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 155/173 (90%), Gaps = 1/173 (1%)
 Frame = +2

Query  116  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  295
            C +EEVALVVPETDDPT+PV+TFRAWFLG+TSC ILIFLNTFF YRTQPL+ISAILMQI+
Sbjct  33   CKIEEVALVVPETDDPTMPVMTFRAWFLGLTSCTILIFLNTFFTYRTQPLAISAILMQIT  92

Query  296  VLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  475
             LPIGKFMA+ LP  + +  G W F+LNPGPFNIKEHVIIT+ ANCG+S GGGDAYSIGA
Sbjct  93   TLPIGKFMASALPRHEHSLLG-WGFSLNPGPFNIKEHVIITIFANCGISYGGGDAYSIGA  151

Query  476  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            ITIMKAYYKQ+LSF+  L++VLTTQ+IGYGWAG+LRRYLVDPV+MWWPS L +
Sbjct  152  ITIMKAYYKQSLSFILSLVLVLTTQIIGYGWAGILRRYLVDPVEMWWPSNLAQ  204



>ref|XP_007211357.1| hypothetical protein PRUPE_ppa001984mg [Prunus persica]
 gb|EMJ12556.1| hypothetical protein PRUPE_ppa001984mg [Prunus persica]
Length=733

 Score =   295 bits (754),  Expect(2) = 1e-155, Method: Compositional matrix adjust.
 Identities = 137/188 (73%), Positives = 165/188 (88%), Gaps = 1/188 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +P  A   ++    RC +EEVALVVPETDDP++PV+TFRAWFLG+T+CIILIFLNTFF +
Sbjct  8    DPEKAANGSSEDHERCAIEEVALVVPETDDPSMPVMTFRAWFLGLTTCIILIFLNTFFTF  67

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPLSISAILMQI+ LPIGK MA+TLP+R+++  G W F+LNPGPFN+KEHVIIT+ AN
Sbjct  68   RTQPLSISAILMQIAALPIGKLMASTLPKREYSLLG-WRFSLNPGPFNMKEHVIITIFAN  126

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CG+S GGGDAYSIGAITIMKAYYKQ+LSFL  LIIVLT+Q++GYGWAG+LRR+LVDPV+M
Sbjct  127  CGISYGGGDAYSIGAITIMKAYYKQSLSFLLALIIVLTSQILGYGWAGILRRFLVDPVEM  186

Query  611  WWPSTLLK  634
            WWPS L +
Sbjct  187  WWPSNLAQ  194


 Score =   284 bits (727),  Expect(2) = 1e-155, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 147/170 (86%), Gaps = 6/170 (4%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFR +      S G TRM+FFL+ M ASF YY LPGYLFPILTFFSWVCW WP 
Sbjct  191   NLAQVSLFRTI------SKGFTRMQFFLIAMAASFAYYALPGYLFPILTFFSWVCWAWPH  244

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLGVG FTLDWAGISAYHGSPLV+PWT+ILNV VGFV+FIY+IVP+CY
Sbjct  245   SITAQQIGSGYHGLGVGAFTLDWAGISAYHGSPLVTPWTSILNVGVGFVLFIYVIVPVCY  304

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK+NTFDARKFPIFSNQLFTS+GHKYDT  +LTPQFDLN+ AY SY KLY
Sbjct  305   WKFNTFDARKFPIFSNQLFTSSGHKYDTTKILTPQFDLNIDAYNSYGKLY  354



>ref|XP_008464311.1| PREDICTED: oligopeptide transporter 3 [Cucumis melo]
Length=745

 Score =   291 bits (744),  Expect(2) = 3e-155, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 160/183 (87%), Gaps = 1/183 (1%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
            G    PS  RCPVEEVALVVPETDDP+LPV+TFR+W LG+ SC +LIFLNTFF YR+QPL
Sbjct  19   GGGELPSEDRCPVEEVALVVPETDDPSLPVMTFRSWVLGLASCCLLIFLNTFFTYRSQPL  78

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  445
            +ISAILMQI+VLPIG+FMA+TLP R F  F RW F+LNPGPFN+KEHVIIT+ ANCG+S 
Sbjct  79   AISAILMQIAVLPIGRFMASTLPNRDFH-FLRWKFSLNPGPFNMKEHVIITIFANCGISY  137

Query  446  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPST  625
            GGGDAYSIGAIT+MKAYYKQ+L+F   L+IVLTTQ++GYGWAG+LRRYLVDPV+MWWP+ 
Sbjct  138  GGGDAYSIGAITVMKAYYKQSLNFFLALLIVLTTQVLGYGWAGMLRRYLVDPVEMWWPAN  197

Query  626  LLK  634
            L +
Sbjct  198  LAQ  200


 Score =   286 bits (733),  Expect(2) = 3e-155, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E KS GMTRM+FFL+ MGASF+YY  PGYL  IL+FFSWVCWVWP 
Sbjct  197   NLAQVSLFRALHEKEDKSKGMTRMKFFLIFMGASFIYYAFPGYLLQILSFFSWVCWVWPH  256

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGSS  GLG+G F+ DWAGISAYHGSPLVSPW +ILNV VGFVMFIYIIVP+CY
Sbjct  257   SITAQQIGSSKSGLGLGAFSFDWAGISAYHGSPLVSPWFSILNVGVGFVMFIYIIVPVCY  316

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK+NTFDARKFPIFSNQLFT TG KYDT  VLTP F+LNV AY SY KLY
Sbjct  317   WKFNTFDARKFPIFSNQLFTRTGQKYDTKKVLTPDFELNVAAYNSYGKLY  366



>ref|XP_002463867.1| hypothetical protein SORBIDRAFT_01g007880 [Sorghum bicolor]
 gb|EER90865.1| hypothetical protein SORBIDRAFT_01g007880 [Sorghum bicolor]
Length=747

 Score =   282 bits (721),  Expect(2) = 9e-150, Method: Compositional matrix adjust.
 Identities = 135/173 (78%), Positives = 147/173 (85%), Gaps = 3/173 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEV---KSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  792
             NLAQVSLFRALHE E    KS G +RMRFFL+V  ASF YY LPGYL PILTFFSW CWV
Sbjct  196   NLAQVSLFRALHEKEEEGGKSRGPSRMRFFLIVFFASFAYYALPGYLLPILTFFSWACWV  255

Query  793   WPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVP  972
             WP SITAQQ+GS YHGLGVG FTLDWAGISAYHGSPLV+PW +I N AVGFVMFIY+IVP
Sbjct  256   WPHSITAQQVGSGYHGLGVGAFTLDWAGISAYHGSPLVAPWASIANTAVGFVMFIYVIVP  315

Query  973   LCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             LCYW++NTFDAR+FPIFSNQLFT++G KYDT  VLT  FDLNV AY+SY KLY
Sbjct  316   LCYWQFNTFDARRFPIFSNQLFTASGQKYDTTKVLTKDFDLNVAAYDSYGKLY  368


 Score =   277 bits (708),  Expect(2) = 9e-150, Method: Compositional matrix adjust.
 Identities = 136/193 (70%), Positives = 155/193 (80%), Gaps = 5/193 (3%)
 Frame = +2

Query  71   NPATAGEKTA---PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTF  241
            +P  A E+       G RC VEEVALVVPETDDP+LPV+TFRAW LG+ SC++LIFLNTF
Sbjct  7    SPVVAEERAGMEEGKGERCAVEEVALVVPETDDPSLPVMTFRAWTLGLGSCVVLIFLNTF  66

Query  242  FIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVII  415
            F YRTQPL+IS IL QI VLP G+FMAA LP R+    G    SF LNPGPFN+KEHVII
Sbjct  67   FTYRTQPLTISGILAQILVLPAGRFMAAVLPNREVRLLGGRLGSFNLNPGPFNVKEHVII  126

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ LSF C L+IVLTTQ++GYGWAG+LRRYLV
Sbjct  127  TIFANCGVSYGGGDAYSIGAITVMKAYYKQTLSFACALLIVLTTQILGYGWAGMLRRYLV  186

Query  596  DPVDMWWPSTLLK  634
            DP +MWWPS L +
Sbjct  187  DPAEMWWPSNLAQ  199



>ref|XP_004139520.1| PREDICTED: oligopeptide transporter 3 [Cucumis sativus]
 gb|KGN65011.1| hypothetical protein Csa_1G180750 [Cucumis sativus]
Length=745

 Score =   289 bits (740),  Expect(2) = 1e-149, Method: Compositional matrix adjust.
 Identities = 136/183 (74%), Positives = 159/183 (87%), Gaps = 1/183 (1%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
            G    PS  RC VEEVALVVPETDDPTLPV+TFR+W LG+ SC +LIFLNTFF YR+QPL
Sbjct  19   GGGELPSEDRCSVEEVALVVPETDDPTLPVMTFRSWVLGLASCCLLIFLNTFFTYRSQPL  78

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  445
            +ISAILMQI+VLPIG+FMA+TLP R F  F RW F+LNPGPFN+KEHVIIT+ ANCG+S 
Sbjct  79   AISAILMQIAVLPIGRFMASTLPNRDFH-FLRWKFSLNPGPFNMKEHVIITIFANCGISY  137

Query  446  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPST  625
            GGGDAYSIGAIT+MKAYYKQ+L+F   L+IVLTTQ++GYGWAG+LRRYLVDPV+MWWP+ 
Sbjct  138  GGGDAYSIGAITVMKAYYKQSLNFFLALLIVLTTQVLGYGWAGMLRRYLVDPVEMWWPAN  197

Query  626  LLK  634
            L +
Sbjct  198  LAQ  200


 Score =   269 bits (688),  Expect(2) = 1e-149, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 147/170 (86%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E KS GMTRM+FFL+ MGASF+YY  PGYL  IL+FFSWVCWVWP 
Sbjct  197   NLAQVSLFRALHEKEDKSKGMTRMKFFLIFMGASFIYYAFPGYLLQILSFFSWVCWVWPH  256

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGSS  GLG+G F+ DWAGISAYHGSPLVSPW +ILNV VGFVMFIYIIVP+CY
Sbjct  257   SITAQQIGSSKGGLGLGAFSFDWAGISAYHGSPLVSPWFSILNVGVGFVMFIYIIVPVCY  316

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK+NTFDARKFPIFSNQLFT TG KYDT  VLTP F+LNV AY SY KLY
Sbjct  317   WKFNTFDARKFPIFSNQLFTRTGQKYDTKKVLTPDFELNVAAYNSYGKLY  366



>gb|ACL82964.1| glutathione transporter [Zea mays]
Length=746

 Score =   280 bits (717),  Expect(2) = 3e-149, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 146/173 (84%), Gaps = 3/173 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEV---KSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  792
             NLAQVSLFRALHE E    KS G +RMRFFL+V  ASF YY LPGYL PILTFFSW CW 
Sbjct  195   NLAQVSLFRALHEKEEEGGKSRGPSRMRFFLIVFFASFAYYALPGYLLPILTFFSWACWA  254

Query  793   WPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVP  972
             WP SITAQQ+GS YHGLGVG FTLDWAGISAYHGSPLV+PW +I N AVGFVMFIY+IVP
Sbjct  255   WPHSITAQQVGSGYHGLGVGAFTLDWAGISAYHGSPLVAPWASIANTAVGFVMFIYVIVP  314

Query  973   LCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             LCYW++NTFDAR+FPIFSNQLFT++G KYDT  VLT  FDLNV AY+SY KLY
Sbjct  315   LCYWQFNTFDARRFPIFSNQLFTASGQKYDTTKVLTKDFDLNVAAYDSYGKLY  367


 Score =   277 bits (708),  Expect(2) = 3e-149, Method: Compositional matrix adjust.
 Identities = 135/193 (70%), Positives = 156/193 (81%), Gaps = 5/193 (3%)
 Frame = +2

Query  71   NPATAGEKTAP---SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTF  241
            +P  A E+       G RC VEEVALVVPETDDP+LPV+TFRAW LG+ SC++LIFLNTF
Sbjct  6    SPVAAEERAGTGEGKGERCAVEEVALVVPETDDPSLPVMTFRAWALGLGSCVVLIFLNTF  65

Query  242  FIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVII  415
            F YRTQPL+IS IL QI VLP G+F+AA LP+R+    G    SF LNPGPFN+KEHVII
Sbjct  66   FTYRTQPLTISGILAQILVLPAGRFLAAVLPDREVRILGGRLGSFNLNPGPFNVKEHVII  125

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ LSF C L+IVLTTQ++GYGWAG+LRRYLV
Sbjct  126  TIFANCGVSYGGGDAYSIGAITVMKAYYKQTLSFACALLIVLTTQILGYGWAGLLRRYLV  185

Query  596  DPVDMWWPSTLLK  634
            DP +MWWPS L +
Sbjct  186  DPAEMWWPSNLAQ  198



>ref|XP_004981750.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 3-like 
[Setaria italica]
Length=750

 Score =   281 bits (720),  Expect(2) = 4e-149, Method: Compositional matrix adjust.
 Identities = 135/172 (78%), Positives = 146/172 (85%), Gaps = 2/172 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETE--VKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  795
             NLAQVSLFRALHE E   KS G +RMRFFL+V  ASF YY LPGYL PILTFFSW CWVW
Sbjct  200   NLAQVSLFRALHEKEDGEKSRGPSRMRFFLIVFFASFAYYALPGYLLPILTFFSWACWVW  259

Query  796   PRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPL  975
             P SITAQQ+GS YHGLG+G FTLDWAGISAYHGSPLV+PW +I N AVGFVMFIYIIVPL
Sbjct  260   PHSITAQQVGSGYHGLGIGAFTLDWAGISAYHGSPLVAPWASIANTAVGFVMFIYIIVPL  319

Query  976   CYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             CYW++NTFDAR+FPIFSNQLFT+ G KYDT  VLT  FDLNV AY+SY KLY
Sbjct  320   CYWQFNTFDARRFPIFSNQLFTAAGQKYDTTKVLTKDFDLNVAAYDSYGKLY  371


 Score =   275 bits (704),  Expect(2) = 4e-149, Method: Compositional matrix adjust.
 Identities = 132/176 (75%), Positives = 151/176 (86%), Gaps = 2/176 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDP+LPV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL QI
Sbjct  28   RCPVEEVALVVPETDDPSLPVMTFRAWTLGLASCVVLIFLNTFFTYRTQPLTISGILAQI  87

Query  293  SVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  466
             VLP G+FMAA LP+R+    G    SF LNPGPFN+KEHVIIT+ ANCGVS GGGDAYS
Sbjct  88   LVLPAGRFMAAVLPDREVRLLGGRLGSFNLNPGPFNVKEHVIITIFANCGVSYGGGDAYS  147

Query  467  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            IGAIT+MKAYYKQ LSF+  L+IVLTTQ++GYGWAG+LRRYLVDP +MWWPS L +
Sbjct  148  IGAITVMKAYYKQTLSFVLALLIVLTTQILGYGWAGMLRRYLVDPAEMWWPSNLAQ  203



>ref|XP_003559475.2| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 3, partial 
[Brachypodium distachyon]
Length=494

 Score =   281 bits (720),  Expect(2) = 1e-148, Method: Compositional matrix adjust.
 Identities = 137/199 (69%), Positives = 160/199 (80%), Gaps = 7/199 (4%)
 Frame = +2

Query  59   MSGLNPATAGE-----KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIIL  223
            MS L    A E     K    G R PVEEVALVVPETDDP+ PV+TFRAW LG++SC++L
Sbjct  1    MSSLKSPVAAEEAMRGKQQGEGERYPVEEVALVVPETDDPSTPVMTFRAWTLGLSSCVVL  60

Query  224  IFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNI  397
            IFLNTFF YRTQPL+IS IL QI VLP+G+FMA+ LP+R+    G    SF LNPGPFN+
Sbjct  61   IFLNTFFTYRTQPLTISGILAQILVLPVGRFMASVLPDREVRLLGGRLGSFNLNPGPFNV  120

Query  398  KEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGV  577
            KEHVIIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L+IVL+TQ++GYGWAG+
Sbjct  121  KEHVIITIFANCGVSYGGGDAYSIGAITVMKAYYKQSLSFLCALLIVLSTQILGYGWAGM  180

Query  578  LRRYLVDPVDMWWPSTLLK  634
            LRRYLVDP +MWWPS L +
Sbjct  181  LRRYLVDPAEMWWPSNLAQ  199


 Score =   273 bits (699),  Expect(2) = 1e-148, Method: Compositional matrix adjust.
 Identities = 138/173 (80%), Positives = 147/173 (85%), Gaps = 3/173 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETE---VKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  792
             NLAQVSLFRALHET+     S G TRMRFFL+   ASF YY LPGYL PILTFFSW CWV
Sbjct  196   NLAQVSLFRALHETKEGGKPSKGPTRMRFFLIFFFASFAYYALPGYLLPILTFFSWACWV  255

Query  793   WPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVP  972
             WPRSITAQQIGS YHGLGVG FTLDWAGISAYHGSPLV+PW++I N AVGFVMFIY+IVP
Sbjct  256   WPRSITAQQIGSGYHGLGVGAFTLDWAGISAYHGSPLVAPWSSIANTAVGFVMFIYLIVP  315

Query  973   LCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             LCYW++NTFDARKFPIFSNQLFT +G KYDT  VLT  FDLNV AYESY KLY
Sbjct  316   LCYWRFNTFDARKFPIFSNQLFTGSGQKYDTTKVLTRDFDLNVAAYESYGKLY  368



>ref|NP_001292781.1| oligopeptide transporter 3 [Zea mays]
 tpg|DAA51401.1| TPA: glutathione transporter [Zea mays]
Length=748

 Score =   281 bits (718),  Expect(2) = 3e-148, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 146/173 (84%), Gaps = 3/173 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEV---KSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  792
             NLAQVSLFRALHE E    KS G +RMRFFL+V  ASF YY LPGYL PILTFFSW CW 
Sbjct  197   NLAQVSLFRALHEKEEEGGKSRGPSRMRFFLIVFFASFAYYALPGYLLPILTFFSWACWA  256

Query  793   WPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVP  972
             WP SITAQQ+GS YHGLGVG FTLDWAGISAYHGSPLV+PW +I N AVGFVMFIY+IVP
Sbjct  257   WPHSITAQQVGSGYHGLGVGAFTLDWAGISAYHGSPLVAPWASIANTAVGFVMFIYVIVP  316

Query  973   LCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             LCYW++NTFDAR+FPIFSNQLFT++G KYDT  VLT  FDLNV AY+SY KLY
Sbjct  317   LCYWQFNTFDARRFPIFSNQLFTASGQKYDTTKVLTKDFDLNVAAYDSYGKLY  369


 Score =   273 bits (699),  Expect(2) = 3e-148, Method: Compositional matrix adjust.
 Identities = 130/176 (74%), Positives = 150/176 (85%), Gaps = 2/176 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC VEEVALVVPETDDP++PV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL QI
Sbjct  25   RCAVEEVALVVPETDDPSMPVMTFRAWALGLGSCVVLIFLNTFFTYRTQPLTISGILAQI  84

Query  293  SVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  466
             VLP G+F+AA LP+R+    G    SF LNPGPFN+KEHVIIT+ ANCGVS GGGDAYS
Sbjct  85   LVLPAGRFLAAVLPDREVRILGGRLGSFNLNPGPFNVKEHVIITIFANCGVSYGGGDAYS  144

Query  467  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            IGAIT+MKAYYKQ LSF C L+IVLTTQ++GYGWAG+LRRYLVDP +MWWPS L +
Sbjct  145  IGAITVMKAYYKQTLSFACALLIVLTTQILGYGWAGLLRRYLVDPAEMWWPSNLAQ  200



>gb|ABB55328.1| small oligopeptide transporter, OPT family [Asparagus officinalis]
Length=755

 Score =   281 bits (718),  Expect(2) = 7e-148, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE +V S G +RM+FF++    SF+YY  PGYLFPILTFFSWVCW WP 
Sbjct  237   NLAQVSLFRALHEKDVNSKGPSRMKFFMIFFIGSFLYYAFPGYLFPILTFFSWVCWAWPH  296

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLG+G FTLDWAGISAYHGSPLV+PW +ILN+A GF+MF+YIIVP+CY
Sbjct  297   SITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVAPWFSILNIAAGFIMFVYIIVPICY  356

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WKYNTFDARKFP+FSNQLFTS G KY+T  VLTPQF+LN  AY SY KLY
Sbjct  357   WKYNTFDARKFPMFSNQLFTSKGTKYNTTAVLTPQFELNEAAYNSYGKLY  406


 Score =   272 bits (695),  Expect(2) = 7e-148, Method: Compositional matrix adjust.
 Identities = 139/231 (60%), Positives = 158/231 (68%), Gaps = 49/231 (21%)
 Frame = +2

Query  89   EKTAP-SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
            +K  P    RCP+EEVALVVPETDDP LPVLTFRAWFLG+TSC +LIFLNTFF YRTQPL
Sbjct  10   QKPVPVESDRCPIEEVALVVPETDDPNLPVLTFRAWFLGLTSCSVLIFLNTFFTYRTQPL  69

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  445
            +ISAIL QI+VLPIG+FMA+ LP+++    G W F LNPGPF+IKEHVIIT+ ANCGVS 
Sbjct  70   TISAILTQIAVLPIGRFMASALPDKEVRVLGGWGFNLNPGPFSIKEHVIITIFANCGVST  129

Query  446  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQ-------------------------  550
            GGGDAYSIGAIT+MKAYYKQ L FLC LIIVLTTQ                         
Sbjct  130  GGGDAYSIGAITVMKAYYKQGLGFLCALIIVLTTQAVLSHYLLMGFKSSSSSSSSSHRKV  189

Query  551  -----------------------LIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
                                   +IGYGWAGVLRR+LVDPV+MWWP+ L +
Sbjct  190  TVGFIAELTVTSTFAAVRAPDFNVIGYGWAGVLRRFLVDPVEMWWPANLAQ  240



>dbj|BAK07444.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=745

 Score =   281 bits (719),  Expect(2) = 2e-147, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 157/189 (83%), Gaps = 2/189 (1%)
 Frame = +2

Query  74   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
            PA  G+     G R PVEEVALVVPETDDP  PV+TFRAW LG+TSC++LIFLNTFF YR
Sbjct  8    PAAGGKGAQGEGERYPVEEVALVVPETDDPATPVMTFRAWTLGLTSCVVLIFLNTFFTYR  67

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMA  427
            TQPL+IS IL QI VLP+G+FMA+ LP+R+    G    SF LNPGPFNIKEHVIIT+ A
Sbjct  68   TQPLTISGILAQILVLPVGRFMASVLPDREVRLLGGRLGSFNLNPGPFNIKEHVIITIFA  127

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            NCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L+IVL+TQ++GYGWAG+LRR+LVDP +
Sbjct  128  NCGVSYGGGDAYSIGAITVMKAYYKQSLSFLCALLIVLSTQILGYGWAGMLRRFLVDPAE  187

Query  608  MWWPSTLLK  634
            MWWPS L +
Sbjct  188  MWWPSNLAQ  196


 Score =   270 bits (691),  Expect(2) = 2e-147, Method: Compositional matrix adjust.
 Identities = 136/173 (79%), Positives = 147/173 (85%), Gaps = 3/173 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETE---VKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  792
             NLAQVSLFRALHET+     S G +RMRFFL+   ASF YY LPGYL PILTFFSW CWV
Sbjct  193   NLAQVSLFRALHETKEGGKPSKGPSRMRFFLIFFFASFAYYALPGYLLPILTFFSWACWV  252

Query  793   WPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVP  972
             WPRSITAQQ+GS YHGLGVG FTLDWAGISAYHGSPLV+PW +I N AVGFVMFIY+IVP
Sbjct  253   WPRSITAQQVGSGYHGLGVGAFTLDWAGISAYHGSPLVAPWASIANTAVGFVMFIYVIVP  312

Query  973   LCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             LCYW++NTFDAR+FPIFSNQLFTSTG KYDT  VLT  FDLNV AY+SY KLY
Sbjct  313   LCYWRFNTFDARRFPIFSNQLFTSTGQKYDTTKVLTSDFDLNVAAYDSYGKLY  365



>gb|AAQ91200.1| putative glutathione transporter [Zea mays]
Length=721

 Score =   280 bits (716),  Expect(2) = 4e-146, Method: Compositional matrix adjust.
 Identities = 134/173 (77%), Positives = 146/173 (84%), Gaps = 3/173 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEV---KSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  792
             NLAQVSLFRALHE E    KS G +RMRFFL+V  ASF YY LPGYL PILTFFSW CW 
Sbjct  170   NLAQVSLFRALHEKEEEGGKSRGPSRMRFFLIVFFASFAYYALPGYLLPILTFFSWACWA  229

Query  793   WPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVP  972
             WP SITAQQ+GS YHGLGVG FTLDWAGISAYHGSPLV+PW +I N AVGFVMFIY+IVP
Sbjct  230   WPHSITAQQVGSGYHGLGVGAFTLDWAGISAYHGSPLVAPWASIANTAVGFVMFIYVIVP  289

Query  973   LCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             LCYW++NTFDAR+FPIFSNQLFT++G KYDT  VLT  FDLNV AY+SY KLY
Sbjct  290   LCYWQFNTFDARRFPIFSNQLFTASGQKYDTTKVLTKDFDLNVAAYDSYGKLY  342


 Score =   267 bits (682),  Expect(2) = 4e-146, Method: Compositional matrix adjust.
 Identities = 128/173 (74%), Positives = 148/173 (86%), Gaps = 2/173 (1%)
 Frame = +2

Query  122  VEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVL  301
            VEEVALVVPETDDP++PV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL QI VL
Sbjct  1    VEEVALVVPETDDPSMPVMTFRAWALGLGSCVVLIFLNTFFTYRTQPLTISGILAQILVL  60

Query  302  PIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  475
            P G+F+AA LP+R+    G    SF LNPGPFN+KEHVIIT+ ANCGVS GGGDAYSIGA
Sbjct  61   PAGRFLAAVLPDREVRILGGRLGSFNLNPGPFNVKEHVIITIFANCGVSYGGGDAYSIGA  120

Query  476  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            IT+MKAYYKQ LSF C L+IVLTTQ++GYGWAG+LRRYLVDP +MWWPS L +
Sbjct  121  ITVMKAYYKQTLSFACALLIVLTTQILGYGWAGLLRRYLVDPAEMWWPSNLAQ  173



>gb|KHN42268.1| Oligopeptide transporter 3 [Glycine soja]
Length=698

 Score =   293 bits (750),  Expect(2) = 9e-146, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E KS G+TRM+FFL+ MGASF+YY LPGYLF +LTFFSW+CW WP 
Sbjct  149   NLAQVSLFRALHEKEPKSKGLTRMQFFLIAMGASFLYYALPGYLFMVLTFFSWICWAWPH  208

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             +ITAQQIGS YHGLG+G FTLDWAGISAYHGSPLVSPW++I+NV +GF+MFIYIIVP+CY
Sbjct  209   NITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVSPWSSIVNVGIGFIMFIYIIVPVCY  268

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK+NTFDA KFPIFSNQLFT++GHKYDT  +LTP++DLNV AY  YSKLY
Sbjct  269   WKFNTFDAHKFPIFSNQLFTASGHKYDTTKILTPEYDLNVDAYNKYSKLY  318


 Score =   253 bits (645),  Expect(2) = 9e-146, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 138/153 (90%), Gaps = 1/153 (1%)
 Frame = +2

Query  176  LTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPF  355
            +TFRAWFLGI SC++LIFLNTFF +RTQPL+ISAILMQI+VLPIG+FMAATLP +++   
Sbjct  1    MTFRAWFLGIASCVLLIFLNTFFTFRTQPLTISAILMQIAVLPIGRFMAATLPTKEYGFL  60

Query  356  GRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLII  535
            G W FT NPGPFN+KEHVIIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L I
Sbjct  61   G-WRFTFNPGPFNMKEHVIITIFANCGVSFGGGDAYSIGAITVMKAYYKQSLSFLCALFI  119

Query  536  VLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            VLTTQ++GYGWAG+LRRYLVDPV+MWWP+ L +
Sbjct  120  VLTTQMLGYGWAGILRRYLVDPVEMWWPANLAQ  152



>gb|AAO32313.1| putative oligopeptide transporter protein [Oryza sativa Japonica 
Group]
Length=726

 Score =   284 bits (726),  Expect(2) = 2e-145, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 152/179 (85%), Gaps = 2/179 (1%)
 Frame = +2

Query  104  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  283
             G RCPVEEVALVVPETDDPT PV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL
Sbjct  25   EGERCPVEEVALVVPETDDPTTPVMTFRAWTLGLASCVVLIFLNTFFTYRTQPLTISGIL  84

Query  284  MQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGD  457
             QI VLP G+FMAA LP R+    G    SF LNPGPFNIKEHVIIT+ ANCGVS GGGD
Sbjct  85   AQILVLPAGQFMAAVLPSREVRLLGGRLGSFNLNPGPFNIKEHVIITIFANCGVSYGGGD  144

Query  458  AYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            AYSIGAIT+MKAYYKQ+LSFLC L+IVLTTQ++GYGWAG+LRRYLVDP DMWWPS L +
Sbjct  145  AYSIGAITVMKAYYKQSLSFLCALLIVLTTQILGYGWAGMLRRYLVDPADMWWPSNLAQ  203


 Score =   261 bits (666),  Expect(2) = 2e-145, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 144/177 (81%), Gaps = 7/177 (4%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGM-------TRMRFFLLVMGASFVYYTLPGYLFPILTFFSW  780
             NLAQVSLFRALHE E    G        TRMRFFL+   ASF YY LPGYL PILTFFSW
Sbjct  200   NLAQVSLFRALHEKEGGDGGKGSSSRGPTRMRFFLIFFFASFAYYALPGYLLPILTFFSW  259

Query  781   VCWVWPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIY  960
              CW WP SITAQQ+GS YHGLGVG FTLDWAGISAYHGSPLV+PW++I N A GFVMFIY
Sbjct  260   ACWAWPHSITAQQVGSGYHGLGVGAFTLDWAGISAYHGSPLVAPWSSIANTAAGFVMFIY  319

Query  961   IIVPLCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             +IVPLCYWK++TFDARKFPIFSNQLFT++G KYDT  VLT +FDLNV AYESY KLY
Sbjct  320   LIVPLCYWKFDTFDARKFPIFSNQLFTASGQKYDTTKVLTREFDLNVAAYESYGKLY  376



>ref|XP_002522882.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF39482.1| Oligopeptide transporter, putative [Ricinus communis]
Length=734

 Score =   290 bits (742),  Expect(2) = 3e-145, Method: Compositional matrix adjust.
 Identities = 135/161 (84%), Positives = 148/161 (92%), Gaps = 0/161 (0%)
 Frame = +1

Query  649   ALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRSITAQQIGS  828
             ALHE + KS GMTRMRFFLLVM ASF+YY LPGYLFPILTFFSWVCW WP SITAQQ+GS
Sbjct  194   ALHEKDPKSKGMTRMRFFLLVMIASFLYYALPGYLFPILTFFSWVCWAWPHSITAQQLGS  253

Query  829   SYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYWKYNTFDAR  1008
              YHGLG+G FTLDWAGISAYHGSPLV+PW++ILNVAVGFVMFIYIIVPLCYWK+NTFDAR
Sbjct  254   GYHGLGIGAFTLDWAGISAYHGSPLVTPWSSILNVAVGFVMFIYIIVPLCYWKFNTFDAR  313

Query  1009  KFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             KFPIFSNQLFT++GHKYDT  +LTP ++LNVPAY SYSKLY
Sbjct  314   KFPIFSNQLFTTSGHKYDTTKILTPDYELNVPAYNSYSKLY  354


 Score =   254 bits (649),  Expect(2) = 3e-145, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 139/166 (84%), Gaps = 1/166 (1%)
 Frame = +2

Query  53   VEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            ++ +G  P       A    RC VEEVALVVPETDDPTLPV+TFRAWFLG+TSC++LIFL
Sbjct  7    IQDNGFKPNGEHSSAAEEHERCSVEEVALVVPETDDPTLPVMTFRAWFLGLTSCVLLIFL  66

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVI  412
            NTFF YRTQPL+ISAILMQI VLPIGKFMA  LP +++  FG W F+LNPGPFNIKEHVI
Sbjct  67   NTFFTYRTQPLTISAILMQIGVLPIGKFMAKALPTKQYKIFG-WGFSLNPGPFNIKEHVI  125

Query  413  ITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQ  550
            IT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+L+FLC L+IVLTTQ
Sbjct  126  ITIFANCGVSFGGGDAYSIGAITVMKAYYKQSLNFLCALLIVLTTQ  171



>ref|NP_001051290.1| Os03g0751100 [Oryza sativa Japonica Group]
 gb|AAR87263.1| putative oligopeptide transporter protein [Oryza sativa Japonica 
Group]
 gb|ABF98905.1| oligopeptide transporter 3, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF13204.1| Os03g0751100 [Oryza sativa Japonica Group]
 gb|EEC76189.1| hypothetical protein OsI_13528 [Oryza sativa Indica Group]
 gb|EEE59939.1| hypothetical protein OsJ_12589 [Oryza sativa Japonica Group]
Length=757

 Score =   283 bits (725),  Expect(2) = 3e-145, Method: Compositional matrix adjust.
 Identities = 137/179 (77%), Positives = 152/179 (85%), Gaps = 2/179 (1%)
 Frame = +2

Query  104  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  283
             G RCPVEEVALVVPETDDPT PV+TFRAW LG+ SC++LIFLNTFF YRTQPL+IS IL
Sbjct  25   EGERCPVEEVALVVPETDDPTTPVMTFRAWTLGLASCVVLIFLNTFFTYRTQPLTISGIL  84

Query  284  MQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPGGGD  457
             QI VLP G+FMAA LP R+    G    SF LNPGPFNIKEHVIIT+ ANCGVS GGGD
Sbjct  85   AQILVLPAGQFMAAVLPSREVRLLGGRLGSFNLNPGPFNIKEHVIITIFANCGVSYGGGD  144

Query  458  AYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            AYSIGAIT+MKAYYKQ+LSFLC L+IVLTTQ++GYGWAG+LRRYLVDP DMWWPS L +
Sbjct  145  AYSIGAITVMKAYYKQSLSFLCALLIVLTTQILGYGWAGMLRRYLVDPADMWWPSNLAQ  203


 Score =   260 bits (665),  Expect(2) = 3e-145, Method: Compositional matrix adjust.
 Identities = 133/177 (75%), Positives = 144/177 (81%), Gaps = 7/177 (4%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGM-------TRMRFFLLVMGASFVYYTLPGYLFPILTFFSW  780
             NLAQVSLFRALHE E    G        TRMRFFL+   ASF YY LPGYL PILTFFSW
Sbjct  200   NLAQVSLFRALHEKEGGDGGKGSSSRGPTRMRFFLIFFFASFAYYALPGYLLPILTFFSW  259

Query  781   VCWVWPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIY  960
              CW WP SITAQQ+GS YHGLGVG FTLDWAGISAYHGSPLV+PW++I N A GFVMFIY
Sbjct  260   ACWAWPHSITAQQVGSGYHGLGVGAFTLDWAGISAYHGSPLVAPWSSIANTAAGFVMFIY  319

Query  961   IIVPLCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             +IVPLCYWK++TFDARKFPIFSNQLFT++G KYDT  VLT +FDLNV AYESY KLY
Sbjct  320   LIVPLCYWKFDTFDARKFPIFSNQLFTASGQKYDTTKVLTREFDLNVAAYESYGKLY  376



>ref|XP_006651827.1| PREDICTED: oligopeptide transporter 3-like [Oryza brachyantha]
Length=742

 Score =   281 bits (719),  Expect(2) = 4e-145, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 153/182 (84%), Gaps = 2/182 (1%)
 Frame = +2

Query  95   TAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSIS  274
             A  G RCPVEEVALVVPETDDPT PV+TFRAW LG+TSC++LIFLNTFF YRTQPL+IS
Sbjct  6    AALQGERCPVEEVALVVPETDDPTTPVMTFRAWTLGLTSCVVLIFLNTFFTYRTQPLTIS  65

Query  275  AILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHVIITVMANCGVSPG  448
             IL QI VLP G+FMAA LP R+    G    SF LNPGPFNIKEHVIIT+ ANCGVS G
Sbjct  66   GILAQILVLPAGQFMAAVLPNREGRLLGGRLGSFNLNPGPFNIKEHVIITIFANCGVSYG  125

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTL  628
            GGDAYSIGAIT+MKAYYKQ+L F+C L+IVLTTQ++GYGWAG+LRRYLVDP DMWWPS L
Sbjct  126  GGDAYSIGAITVMKAYYKQSLGFVCALLIVLTTQILGYGWAGMLRRYLVDPADMWWPSNL  185

Query  629  LK  634
             +
Sbjct  186  AQ  187


 Score =   263 bits (671),  Expect(2) = 4e-145, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 144/178 (81%), Gaps = 8/178 (4%)
 Frame = +1

Query  622   NLAQVSLFRALHETE--------VKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFS  777
             NLAQVSLFRALHE E          S G TRMRFFL+   ASF YY LPGYL PILTFFS
Sbjct  184   NLAQVSLFRALHEKEDGDGRKGSPSSRGPTRMRFFLIFFFASFAYYALPGYLLPILTFFS  243

Query  778   WVCWVWPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFI  957
             W CW WP SITAQQ+GS YHGLGVG FTLDWAGISAYHGSPLV+PW++I N A GFVMFI
Sbjct  244   WACWAWPHSITAQQVGSGYHGLGVGAFTLDWAGISAYHGSPLVAPWSSIANTAAGFVMFI  303

Query  958   YIIVPLCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YIIVPLCYW+++TFDAR+FPIFSNQLFT+ G KYDT  VLT +FDLNV AYESY KLY
Sbjct  304   YIIVPLCYWRFDTFDARRFPIFSNQLFTAAGQKYDTTKVLTREFDLNVAAYESYGKLY  361



>gb|EMT33592.1| Oligopeptide transporter 3 [Aegilops tauschii]
Length=750

 Score =   276 bits (706),  Expect(2) = 6e-145, Method: Compositional matrix adjust.
 Identities = 135/195 (69%), Positives = 158/195 (81%), Gaps = 5/195 (3%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            + +G   A  GE     G R PVEEVALVVPETDDP  PV+TFRAW LG+ SC++LIFLN
Sbjct  10   DATGGKAAAQGEG---EGERYPVEEVALVVPETDDPATPVMTFRAWTLGLASCVVLIFLN  66

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEHV  409
            TFF YRTQPL+IS IL QI VLP+G+FMA+ LP+R+    G    SF LNPGPFNIKEHV
Sbjct  67   TFFTYRTQPLTISGILAQILVLPVGRFMASVLPDREVRLLGGRLGSFNLNPGPFNIKEHV  126

Query  410  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  589
            IIT+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L+IVL+TQ++GYGWAG+LRR+
Sbjct  127  IITIFANCGVSYGGGDAYSIGAITVMKAYYKQSLSFLCALLIVLSTQILGYGWAGMLRRF  186

Query  590  LVDPVDMWWPSTLLK  634
            LVDP +MWWPS L +
Sbjct  187  LVDPAEMWWPSNLAQ  201


 Score =   267 bits (682),  Expect(2) = 6e-145, Method: Compositional matrix adjust.
 Identities = 133/173 (77%), Positives = 146/173 (84%), Gaps = 3/173 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEV---KSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  792
             NLAQVSLFRALHET+     S+G +RMRFFL+   ASF YY LPGYL PILTFFSW CWV
Sbjct  198   NLAQVSLFRALHETKEGGKPSTGPSRMRFFLIFFFASFAYYALPGYLLPILTFFSWACWV  257

Query  793   WPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVP  972
             WPRSITAQQ+GS YHGLGVG FTLDWAGISAYHGSPLV+PW +I N AVGFVMFIY+IVP
Sbjct  258   WPRSITAQQVGSGYHGLGVGAFTLDWAGISAYHGSPLVAPWASIANTAVGFVMFIYVIVP  317

Query  973   LCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             LCYW++NTFDAR+FPIFSNQLFT+ G KYDT   LT  FDLNV AY+SY KLY
Sbjct  318   LCYWRFNTFDARRFPIFSNQLFTAAGQKYDTTKALTSDFDLNVAAYDSYGKLY  370



>emb|CAB10414.1| isp4 like protein [Arabidopsis thaliana]
 emb|CAB78679.1| isp4 like protein [Arabidopsis thaliana]
Length=691

 Score =   293 bits (751),  Expect(2) = 6e-139, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E KS G+TRM+FFL+ +GASF+YY LPGYLFPILTF SWVCW WP 
Sbjct  167   NLAQVSLFRALHEKENKSKGLTRMKFFLVALGASFIYYALPGYLFPILTFSSWVCWAWPN  226

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQ+GS YHGLGVG FTLDWAGISAYHGSPLV+PW++ILNV VGF+MFIYIIVP+CY
Sbjct  227   SITAQQVGSGYHGLGVGAFTLDWAGISAYHGSPLVAPWSSILNVGVGFIMFIYIIVPVCY  286

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK+NTFDARKFPI SNQLFT++G KYDT  +LTPQFDL++ AY +Y KLY
Sbjct  287   WKFNTFDARKFPISSNQLFTTSGQKYDTTKILTPQFDLDIGAYNNYGKLY  336


 Score =   229 bits (584),  Expect(2) = 6e-139, Method: Compositional matrix adjust.
 Identities = 121/193 (63%), Positives = 139/193 (72%), Gaps = 27/193 (14%)
 Frame = +2

Query  68   LNPATAGEKT----APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            ++   A +KT    +    RCPVEEVALVVPETDDP+LPV+TFRA               
Sbjct  1    MDAEKATDKTNVHLSSDHERCPVEEVALVVPETDDPSLPVMTFRACH-------------  47

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
                  +QP      LMQI+ LPIGKFMA TLP       G WSF+LNPGPFNIKEHVII
Sbjct  48   ----SPSQP-----SLMQIAGLPIGKFMARTLPTTSHNLLG-WSFSLNPGPFNIKEHVII  97

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGV+ GGGDAYSIGAIT+MKAYYKQ+LSF+CGL IVLTTQ++GYGWAG+LRRYLV
Sbjct  98   TIFANCGVAYGGGDAYSIGAITVMKAYYKQSLSFICGLFIVLTTQILGYGWAGILRRYLV  157

Query  596  DPVDMWWPSTLLK  634
            DPVDMWWPS L +
Sbjct  158  DPVDMWWPSNLAQ  170



>ref|XP_002323123.2| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
 gb|EEF04884.2| OLIGOPEPTIDE TRANSPORTER family protein [Populus trichocarpa]
Length=661

 Score =   299 bits (765),  Expect(2) = 5e-129, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E +S GMTRMRFFL+ M  SF YY +PGYLFPILTFFSWVCW WP 
Sbjct  113   NLAQVSLFRALHEKEPQSKGMTRMRFFLIAMTVSFFYYAVPGYLFPILTFFSWVCWAWPH  172

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             ++TAQQIGS YHGLGVG FTLDWAGISAYHGSPLV+PW++I+NVAVGF+MFIY+IVP+CY
Sbjct  173   NMTAQQIGSGYHGLGVGAFTLDWAGISAYHGSPLVAPWSSIVNVAVGFIMFIYVIVPVCY  232

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WKYNTFDARKFPIFSNQLFTS+G KYDT  +LTP+F LN+PAY+SYSKLY
Sbjct  233   WKYNTFDARKFPIFSNQLFTSSGQKYDTTKILTPEFQLNIPAYDSYSKLY  282


 Score =   191 bits (485),  Expect(2) = 5e-129, Method: Compositional matrix adjust.
 Identities = 89/117 (76%), Positives = 105/117 (90%), Gaps = 1/117 (1%)
 Frame = +2

Query  284  MQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAY  463
            MQI+VLP+GKFMA TLP + +   G WSF+LNPGPFN+KEHVIIT+ ANCGVS GGGDAY
Sbjct  1    MQIAVLPVGKFMAKTLPTKDYRILG-WSFSLNPGPFNMKEHVIITIFANCGVSYGGGDAY  59

Query  464  SIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            SIGAIT+MKAYY+Q+LSFLCGL+IVLTTQ++GYGWAG+LRRYLV PV+MWWPS L +
Sbjct  60   SIGAITVMKAYYRQSLSFLCGLLIVLTTQILGYGWAGMLRRYLVYPVEMWWPSNLAQ  116



>gb|KHN03544.1| Oligopeptide transporter 3 [Glycine soja]
Length=725

 Score =   269 bits (688),  Expect(2) = 2e-125, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E KS G+TRM+FFL+ MGASF+YY LPGYLF +LTFFSW+CW WP 
Sbjct  176   NLAQVSLFRALHEKEPKSKGLTRMQFFLIAMGASFLYYALPGYLFMVLTFFSWICWAWPH  235

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLG+G FTLDWAGISAYHGSPLVSPW++I+NV +GF++FIYII+PLCY
Sbjct  236   SITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVSPWSSIVNVGIGFIIFIYIILPLCY  295

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK+NTFDA KFPIFSNQLFT++GHKYDT  +LTP++ LNV AY  YSKLY
Sbjct  296   WKFNTFDAHKFPIFSNQLFTASGHKYDTTKILTPEYVLNVDAYNKYSKLY  345


 Score =   208 bits (530),  Expect(2) = 2e-125, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 115/129 (89%), Gaps = 1/129 (1%)
 Frame = +2

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            +RTQPL+ISAILMQI+VLPIG+FMAATLP +++   G   FT NPGPFN+KEHVIIT+ A
Sbjct  52   FRTQPLTISAILMQIAVLPIGRFMAATLPTKEYGFLGS-RFTFNPGPFNMKEHVIITIFA  110

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            NCGVS GGGDAYSIGAIT+MKAYYKQ+LSFLC L IVLTTQ++GYGWAG+LRRYLVDPV+
Sbjct  111  NCGVSFGGGDAYSIGAITVMKAYYKQSLSFLCALFIVLTTQMMGYGWAGILRRYLVDPVE  170

Query  608  MWWPSTLLK  634
            MWWP+ L +
Sbjct  171  MWWPANLAQ  179



>emb|CDP04528.1| unnamed protein product [Coffea canephora]
Length=637

 Score =   255 bits (651),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 140/178 (79%), Gaps = 8/178 (4%)
 Frame = +1

Query  622   NLAQVSLFRALHETE--------VKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFS  777
             NLAQVSLFR++                G+TRM+FFL  + ASF YYT PGYLFP+LTFFS
Sbjct  114   NLAQVSLFRSVQLFNSLPHFAFFFAKEGLTRMQFFLAFLAASFAYYTFPGYLFPLLTFFS  173

Query  778   WVCWVWPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFI  957
             WVCWVWP S+TAQQIGS YHGLG+G F+LDWAGI+AYHGSPLV+PW++ILN+A GFV+F+
Sbjct  174   WVCWVWPNSVTAQQIGSGYHGLGLGAFSLDWAGIAAYHGSPLVTPWSSILNIAFGFVLFV  233

Query  958   YIIVPLCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             Y+I PLCYWKYNTFDARKFPIFSNQLFTS+G KYD   +L  Q +L+  AY  Y KLY
Sbjct  234   YVIYPLCYWKYNTFDARKFPIFSNQLFTSSGQKYDVTKILNSQLELDTAAYAKYGKLY  291


 Score =   169 bits (427),  Expect(2) = 3e-109, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 95/117 (81%), Gaps = 0/117 (0%)
 Frame = +2

Query  284  MQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAY  463
            MQI  LPIGKFMAA LPE K+  FGRWSF+LNPGPFN+KEHV+IT++A+CG + GG +AY
Sbjct  1    MQIVALPIGKFMAAVLPEEKYTVFGRWSFSLNPGPFNVKEHVVITILASCGAAAGGSEAY  60

Query  464  SIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            S+GAIT+MK+YYK    +L     V+  QLIGYGWAG+LRRYL++PV+MWWP+ L +
Sbjct  61   SMGAITVMKSYYKLNFIWLHPAAYVILLQLIGYGWAGMLRRYLIEPVEMWWPANLAQ  117



>ref|XP_004136415.1| PREDICTED: oligopeptide transporter 2 [Cucumis sativus]
 gb|KGN60282.1| hypothetical protein Csa_3G893320 [Cucumis sativus]
Length=742

 Score =   224 bits (571),  Expect(2) = 5e-104, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 141/190 (74%), Gaps = 2/190 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +  T  +K  P     P+E+V L V   DDP++PV TFR WFLG+ SCIIL FLNTFF Y
Sbjct  11   DSTTTTQKPIPDDEISPIEQVRLTVSNEDDPSIPVWTFRMWFLGLLSCIILSFLNTFFGY  70

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL IS I +Q++ LPIG+FMA  LP + F    FG  +F+LNPGPFNIKEHV+I++ 
Sbjct  71   RTEPLVISMISVQVATLPIGRFMANVLPTKTFRIPGFGDRNFSLNPGPFNIKEHVLISIF  130

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY+IG + I+ A+Y + +SFL G I+V+TTQ++GYGWAG+LR+Y+VDP 
Sbjct  131  ANAGSAFGNGAAYAIGIVDIVMAFYHRKISFLTGWILVITTQVMGYGWAGILRKYVVDPA  190

Query  605  DMWWPSTLLK  634
            +MWWPS+L++
Sbjct  191  EMWWPSSLVQ  200


 Score =   182 bits (463),  Expect(2) = 5e-104, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 125/169 (74%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRA+HE +   S M+R +FFL+ +  SF +Y  PGYLFP L+  SWVCW++PR
Sbjct  197   SLVQVSLFRAMHEKD--ESRMSRGKFFLITLICSFSWYVFPGYLFPTLSTISWVCWIYPR  254

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQ+GS   GLG+G F+LDW+ +++Y  SPL+SP+ A +NVAVG+++ +YI++P+ Y
Sbjct  255   SVTAQQLGSGMRGLGLGSFSLDWSVVASYLYSPLISPFFATVNVAVGYIVIMYIMLPVAY  314

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             WK N ++AR FPIFS+ L+ + G  Y+   ++  +F++++ AYE   ++
Sbjct  315   WKANVYNARNFPIFSSHLYDANGQIYNVSAIVNDKFEIDMDAYEKQGRI  363



>ref|XP_002313213.2| hypothetical protein POPTR_0009s08290g [Populus trichocarpa]
 gb|EEE87168.2| hypothetical protein POPTR_0009s08290g [Populus trichocarpa]
Length=752

 Score =   221 bits (562),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 136/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL IS I +QI+ 
Sbjct  33   PIEEVRLTVANTDDPTLPVWTFRMWFLGLISCSLLAFLNQFFSYRTEPLIISQITVQIAS  92

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG+ MAA LP+ KF    FG  +F+LNPGPFNIKEHV+I++ AN G + G G AY++G
Sbjct  93   LPIGRSMAAVLPKTKFKIPGFGSRTFSLNPGPFNIKEHVLISIFANAGSAFGSGSAYAVG  152

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +TI+KA+Y +++SFL G +++ TTQ++GYGWAG+LR+Y+V+P  MWWP TL++
Sbjct  153  IVTIIKAFYGRSISFLAGWLLITTTQVLGYGWAGLLRKYVVEPAHMWWPGTLVQ  206


 Score =   186 bits (472),  Expect(2) = 6e-104, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 121/169 (72%), Gaps = 1/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE +     MTR +FF++ +  SFV+Y  PGYLF  L+  SWVCWV+P+S
Sbjct  204   LVQVSLFRALHEKD-DGHRMTRAKFFVIALACSFVWYLFPGYLFTTLSSISWVCWVFPKS  262

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQ+GS   GLG+G  TLDW+ ++++  SPL+SP+ AI NV VG+V  IY+ +PL YW
Sbjct  263   VTAQQLGSGMRGLGLGAITLDWSVVASFLFSPLISPFFAIANVLVGYVFIIYVAMPLAYW  322

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
               + + ARKFPIFS+ LFT+ GHKY+   ++  +F L++P YE   +++
Sbjct  323   GLDLYSARKFPIFSSHLFTAEGHKYNITAIVNNKFQLDIPNYEQQGRIH  371



>ref|XP_011003045.1| PREDICTED: oligopeptide transporter 4 [Populus euphratica]
Length=749

 Score =   219 bits (557),  Expect(2) = 4e-103, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 135/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPTLP+ TFR WFLG+ SC +L FLN FF YRT+PL IS I +Q++ 
Sbjct  33   PIEEVRLTVANTDDPTLPIWTFRMWFLGLISCSLLAFLNQFFSYRTEPLIISQITVQVAS  92

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG+ MAA LP+ KF    FG  +F+LNPGPFNIKEHV+I++ AN G + G G AY++G
Sbjct  93   LPIGRSMAAVLPKTKFKIPGFGSRTFSLNPGPFNIKEHVLISIFANAGSAFGSGSAYAVG  152

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +TI+KA+Y + +SFL G +++ TTQ++GYGWAG+LR+Y+V+P  MWWP TL++
Sbjct  153  IVTIIKAFYGRRISFLAGWLLITTTQVLGYGWAGLLRKYVVEPAHMWWPGTLVQ  206


 Score =   185 bits (469),  Expect(2) = 4e-103, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 121/169 (72%), Gaps = 1/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE +     MTR +FF++ +  SFV+Y  PGYLF  L+  SWVCWV+P+S
Sbjct  204   LVQVSLFRALHEKD-DGHRMTRAKFFVIALACSFVWYLFPGYLFTTLSSISWVCWVFPKS  262

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQ+GS   GLG+G  TLDW+ ++++  SPL+SP+ AI NV VG+V  IY+ +PL YW
Sbjct  263   VTAQQLGSGMRGLGLGAITLDWSVVASFLFSPLISPFFAIANVLVGYVFIIYVAMPLSYW  322

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
               + + ARKFPIFS+ LFT+ GHKY+   ++  +F L++P YE   +++
Sbjct  323   GLDLYSARKFPIFSSHLFTAEGHKYNITAIVNNKFQLDLPNYEQQGRIH  371



>ref|XP_008466130.1| PREDICTED: oligopeptide transporter 2 [Cucumis melo]
Length=741

 Score =   222 bits (566),  Expect(2) = 5e-103, Method: Compositional matrix adjust.
 Identities = 105/196 (54%), Positives = 143/196 (73%), Gaps = 2/196 (1%)
 Frame = +2

Query  53   VEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            +E+     +T  +K  P     P+E+V L V   DDP++PV TFR WFLG+ SC+IL FL
Sbjct  4    LEIELEQDSTTTQKPIPDDEISPIEQVRLTVSNEDDPSIPVWTFRMWFLGLLSCMILSFL  63

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEH  406
            NTFF YRT+PL IS I +Q++ LPIG+FMA  LP   F    FG  +F+LNPGPFNIKEH
Sbjct  64   NTFFGYRTEPLVISMISVQVATLPIGRFMANVLPTTTFRIPGFGDRNFSLNPGPFNIKEH  123

Query  407  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  586
            V+I++ AN G + G G AY+IG + I+ A+Y + +SFL G I+V+TTQ++GYGWAG+LR+
Sbjct  124  VLISIFANAGSAFGNGAAYAIGIVDIVMAFYHRKISFLAGWILVITTQVMGYGWAGILRK  183

Query  587  YLVDPVDMWWPSTLLK  634
            Y+VDP +MWWPS+L++
Sbjct  184  YVVDPAEMWWPSSLVQ  199


 Score =   181 bits (459),  Expect(2) = 5e-103, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 125/169 (74%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRA+HE +   S M+R +FFL+ +  SF +Y  PGYLFP L+  SWVCW++PR
Sbjct  196   SLVQVSLFRAMHEKD--ESRMSRGKFFLITLICSFSWYVFPGYLFPTLSTISWVCWIYPR  253

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQ+GS   GLG+G F+LDW+ I++Y  SPL+SP+ A +NVAVG+++ +YI++P+ Y
Sbjct  254   SVTAQQLGSGMRGLGLGSFSLDWSVIASYLYSPLISPFFATVNVAVGYIVIMYIMLPIAY  313

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             WK N ++A+ FPIFS+ L+ + G  Y+   ++  +F++++ AYE   ++
Sbjct  314   WKTNVYNAQNFPIFSSHLYDAKGQIYNVSAIVNDKFEIDMGAYEKQGRI  362



>ref|XP_006394156.1| hypothetical protein EUTSA_v10003716mg [Eutrema salsugineum]
 gb|ESQ31442.1| hypothetical protein EUTSA_v10003716mg [Eutrema salsugineum]
Length=729

 Score =   217 bits (553),  Expect(2) = 6e-103, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 135/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPTLPV TFR WFLGI SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDPTLPVWTFRMWFLGIISCSLLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTRFGLPGLGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +TI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  134  IVTIIKAFYRRNISFVAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  187


 Score =   186 bits (472),  Expect(2) = 6e-103, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 123/169 (73%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE + +   MTR +FF++ +  SF +Y +PGYLF  LT  SW+CW +PR
Sbjct  184   TLVQVSLFRALHEKDEQR--MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWICWAFPR  241

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G FTLDW  ++++  SPL+SP+ AI NV +G+V+ IY+++PL Y
Sbjct  242   SVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFIGYVLLIYLVLPLAY  301

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W ++++ A++FPIFS+ LFTS G KYD   ++  +F+L+V  YE   ++
Sbjct  302   WGFDSYHAKRFPIFSSHLFTSVGQKYDIPAIVNNKFELDVAKYEQQGRI  350



>ref|XP_009358688.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7-like 
[Pyrus x bretschneideri]
Length=749

 Score =   214 bits (544),  Expect(2) = 7e-103, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 130/174 (75%), Gaps = 4/174 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PL+I+AI  QI
Sbjct  38   NSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLTITAISAQI  97

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MA+ +  R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  98   AVVPLGQLMASKITNRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  153

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +T +K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+ L++
Sbjct  154  IVTAVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQ  207


 Score =   189 bits (480),  Expect(2) = 7e-103, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 116/171 (68%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE EV+   G+TR +FFL+    SF YY  PGYLF +LT  SW+CW++P
Sbjct  204   NLVQVSLFRALHEKEVRHKGGLTRTQFFLIAFMCSFAYYVFPGYLFQMLTSLSWICWIFP  263

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              ++ AQQ+GS  HGLG+G   +DW+ ISAY GSPL SPW A  NVA GF   +YI+ PL 
Sbjct  264   TNVLAQQLGSGLHGLGIGAVGVDWSTISAYLGSPLASPWFATANVAAGFFFVMYILTPLS  323

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW +N + A+ FPIFSN +FTS G +Y+   ++   F L+  AYE    LY
Sbjct  324   YW-FNIYKAKTFPIFSNSMFTSDGQEYNITAIIDSNFHLDYDAYEQEGHLY  373



>ref|XP_009359568.1| PREDICTED: LOW QUALITY PROTEIN: oligopeptide transporter 7-like 
[Pyrus x bretschneideri]
Length=757

 Score =   216 bits (549),  Expect(2) = 8e-103, Method: Compositional matrix adjust.
 Identities = 97/172 (56%), Positives = 131/172 (76%), Gaps = 4/172 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            PVE+VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI+V
Sbjct  48   PVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAV  107

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MA+ +  R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  108  VPLGQLMASKITNRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIHIV  163

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+ L++
Sbjct  164  TVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQ  215


 Score =   187 bits (474),  Expect(2) = 8e-103, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 117/171 (68%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E +   G+TR +FFL+    SF YY  PGYLF +LT  SW+CW++P
Sbjct  212   NLVQVSLFRALHEKEARPKGGLTRTQFFLISFMCSFAYYVFPGYLFQMLTSLSWICWIFP  271

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              ++ AQQ+GS  +GLG+G   +DW+ IS+Y GSPL SPW A  NVA GF   +YI+ P+C
Sbjct  272   NNVLAQQLGSGLYGLGIGAVGIDWSTISSYLGSPLASPWFATANVAAGFFFVMYILTPIC  331

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW +N + A+ FPIFS+ LFTS G +Y+   ++   F L++ AYE    LY
Sbjct  332   YW-FNIYKAKTFPIFSDTLFTSNGQEYNITAIIDSNFHLDLEAYEREGPLY  381



>ref|XP_008239235.1| PREDICTED: oligopeptide transporter 7-like [Prunus mume]
Length=759

 Score =   214 bits (546),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 130/174 (75%), Gaps = 4/174 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI
Sbjct  48   NSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQI  107

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MA+ +    F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  108  AVVPLGQLMASKITTHAFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  163

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+ L++
Sbjct  164  VVTVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQ  217


 Score =   186 bits (473),  Expect(2) = 3e-102, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 115/171 (67%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E +   G+TR +FFL+    SF YY  PGYLF +LT  SW+CW++P
Sbjct  214   NLVQVSLFRALHEKEARPKGGLTRTQFFLIAFMCSFAYYVFPGYLFEMLTSLSWICWIFP  273

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              ++ AQQ+GS  +GLG+G   LDW+ IS+Y GSPL SPW A  NVA GF   +YI+ PLC
Sbjct  274   NNVLAQQLGSGLYGLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFFFVMYILTPLC  333

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW  N + A+ FPIFS+ LFTS G +Y+   ++   F L+  AY+    LY
Sbjct  334   YW-LNVYKAKTFPIFSDTLFTSDGQEYNITAIIDSNFHLDSAAYDREGPLY  383



>ref|XP_011070370.1| PREDICTED: oligopeptide transporter 7 [Sesamum indicum]
Length=753

 Score =   221 bits (563),  Expect(2) = 4e-102, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 133/176 (76%), Gaps = 4/176 (2%)
 Frame = +2

Query  107  GGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILM  286
            G   P+++VAL VP TDDPTLPVLTFR WFLG  SC++L FLN FF YRT+PLSI+AI  
Sbjct  39   GENSPIKQVALTVPTTDDPTLPVLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLSITAISA  98

Query  287  QISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  466
            QI+V+P+G+ MAA + +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+
Sbjct  99   QIAVVPLGQLMAAKITDRVFFRGTRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYA  154

Query  467  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            I  +T +K +YKQ +SF   LI+V+TTQ++G+GWAG+ RRYLV+P  MWWP+ L++
Sbjct  155  IHVVTAVKVFYKQHISFFVSLIVVITTQVLGFGWAGIYRRYLVEPAAMWWPANLVQ  210


 Score =   179 bits (455),  Expect(2) = 4e-102, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 116/171 (68%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE + +   G+TR +FF++    SF YY  PGYLF +LT  SW+CW++P
Sbjct  207   NLVQVSLFRALHEKDERPKGGVTRTQFFIIAFICSFAYYIFPGYLFQMLTSLSWICWIFP  266

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +S+ AQQ+GS   GLG+G   LDW+ IS+Y GSPL SPW A  NVAVGF   +Y++ PL 
Sbjct  267   KSVIAQQLGSGLKGLGIGAIGLDWSTISSYLGSPLASPWFATANVAVGFFFVMYVVTPLS  326

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW  N ++A+ FPIFS+ LFTS+G  Y+   ++   F L+  AY+    L+
Sbjct  327   YW-LNIYEAKTFPIFSDDLFTSSGQIYNISSIIDLNFHLDAAAYQREGPLH  376



>ref|XP_009801973.1| PREDICTED: oligopeptide transporter 6-like [Nicotiana sylvestris]
Length=732

 Score =   215 bits (548),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 133/187 (71%), Gaps = 4/187 (2%)
 Frame = +2

Query  74   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
            P             CP++EV + VP+TDDPT PVLTFR WFLGITSC++L F+N FF YR
Sbjct  5    PVNMAAANEADEDLCPIKEVDMTVPKTDDPTTPVLTFRMWFLGITSCVLLSFVNQFFWYR  64

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANC  433
            T+PL+IS+  +QI+V+PIG  MA T+ +R F    RW FTLNPGPFNIKEHV+IT+ AN 
Sbjct  65   TEPLTISSTAVQIAVVPIGHLMAKTITKRLFFEGTRWEFTLNPGPFNIKEHVLITIFANA  124

Query  434  GVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMW  613
                G G  Y+   ++ +K YYK+ LSF   L+I+ TTQ++G+GWAG+ R++LV+P +MW
Sbjct  125  ----GAGSVYATHILSAVKLYYKRPLSFFPALLIMATTQMLGFGWAGIFRKHLVEPAEMW  180

Query  614  WPSTLLK  634
            WP +L++
Sbjct  181  WPGSLVQ  187


 Score =   184 bits (468),  Expect(2) = 5e-102, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 118/171 (69%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             +L QVSLFRALHE E +   G TR++FFL+ +  SF YY  PGYLF +L+ FSW+CW+ P
Sbjct  184   SLVQVSLFRALHEKETRPKGGTTRIQFFLIALVFSFAYYIFPGYLFQMLSSFSWICWLAP  243

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +SI  QQ+GS   GLG+G    DW  IS+Y GSPL SPW A  NVA GFV+ +Y++ PL 
Sbjct  244   KSILVQQLGSGMRGLGIGALGFDWTTISSYLGSPLASPWFATANVAAGFVLVMYLMTPLT  303

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW +N ++A+ FPIFS+ LFT  G KY+T  V+   F L++ AY  Y +L+
Sbjct  304   YW-FNVYNAKNFPIFSSSLFTLNGTKYNTEGVINSHFQLDIAAYNQYGQLH  353



>ref|XP_010254620.1| PREDICTED: oligopeptide transporter 4-like [Nelumbo nucifera]
Length=738

 Score =   221 bits (562),  Expect(2) = 7e-102, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 136/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  23   PIEQVRLTVTNTDDPTLPVWTFRMWFLGLISCALLSFLNQFFAYRTEPLIITQITVQVAT  82

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG+FMA+ LP  KF    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  83   LPIGRFMASVLPRTKFRLPGFGSTEFSLNPGPFNMKEHVLISIFANAGSAFGSGYAYAVG  142

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I+KA+Y++ +SFL G I+V+TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  143  IVNIIKAFYRKNISFLAGWILVITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  196


 Score =   179 bits (453),  Expect(2) = 7e-102, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 120/170 (71%), Gaps = 2/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE + +   M+R +FFL+ +  SF +Y +PGYLFP LT  SWVCW + +
Sbjct  193   TLVQVSLFRALHEKDEER--MSRGKFFLIALICSFSWYAIPGYLFPTLTSISWVCWAFSK  250

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQ+GS   GLG+G  TLDW+ ++++  SPL+SP+ AI NV VG+VM +Y+ +P+ Y
Sbjct  251   SVTAQQLGSGMKGLGLGALTLDWSAVASFLFSPLISPFFAIANVFVGYVMVMYVAIPIAY  310

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W  + + A+ FPIFS+ LFT  G KY+   ++  +F+L++P YE   ++Y
Sbjct  311   WGLDLYKAKTFPIFSSHLFTVQGGKYNITAIVNDKFELDIPNYEEQGRIY  360



>ref|XP_002518328.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF44088.1| Oligopeptide transporter, putative [Ricinus communis]
Length=754

 Score =   208 bits (529),  Expect(2) = 7e-102, Method: Compositional matrix adjust.
 Identities = 100/175 (57%), Positives = 137/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  116  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  295
             P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++
Sbjct  36   SPIEEVRLTVSNTDDPTLPVWTFRMWFLGLLSCGLLSFLNQFFAYRTEPLVITQITVQVA  95

Query  296  VLPIGKFMAATLPERKF--APFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSI  469
             LPIG F+A+ LP+ KF  A FG  +F+LNPGPFN+KEHV+I++ AN G + G G AY++
Sbjct  96   TLPIGHFLASVLPKTKFRIAGFGSKTFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAV  155

Query  470  GAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            G +TI+KA+Y++ +SF    I+++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  156  GIVTIIKAFYQRKISFFASWILIVTTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  210


 Score =   191 bits (486),  Expect(2) = 7e-102, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 126/169 (75%), Gaps = 0/169 (0%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE + K  GMTR +FFL+ +  SF +Y +PGYLF  LT  SWVCWV+ +S
Sbjct  208   LVQVSLFRALHEKDDKGQGMTRAKFFLIALVCSFSWYVVPGYLFTTLTSISWVCWVFSKS  267

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQ+GS   GLG+G FTLDW+ ++++  SPL+SP+ AI+NVA+G+V+ +YI +P+ YW
Sbjct  268   VTAQQLGSGMRGLGLGAFTLDWSAVASFLFSPLISPFFAIVNVAIGYVLILYIAIPVAYW  327

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
               + ++A +FPIFS+ LFT+ G KY+   ++  +F+L++P Y+   +++
Sbjct  328   GLDLYNAHRFPIFSSHLFTAQGQKYNIPAIVNDKFELDLPKYDEQGRIH  376



>ref|XP_010553673.1| PREDICTED: oligopeptide transporter 2 [Tarenaya hassleriana]
Length=734

 Score =   224 bits (570),  Expect(2) = 9e-102, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 136/182 (75%), Gaps = 1/182 (1%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            ++        PVEEV L VP  DDP+LPV TFR WFLG+ SC++L FLNTFF YRTQPL 
Sbjct  12   DEEEGDNDESPVEEVRLTVPNHDDPSLPVWTFRMWFLGLFSCVLLSFLNTFFGYRTQPLM  71

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            IS I +Q+  LPIGK MA  LP++KF   G + F+LNPGPFN+KEHV+I++ AN G   G
Sbjct  72   ISMISIQVVTLPIGKMMARVLPDKKFR-VGSFEFSLNPGPFNVKEHVLISMFANAGAGYG  130

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTL  628
             G AY++G + I+KA+YK+ +SFL   ++V+TTQ++GYGWAG++RR LV+P  MWWPS+L
Sbjct  131  SGTAYAVGIVDIIKAFYKRNISFLASWLLVITTQVLGYGWAGIMRRLLVEPAQMWWPSSL  190

Query  629  LK  634
            L+
Sbjct  191  LQ  192


 Score =   175 bits (444),  Expect(2) = 9e-102, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 125/170 (74%), Gaps = 2/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALHE + +   M+R +FFL+    SF +Y  PGYLFP L+  SWVCWV+P+
Sbjct  189   SLLQVSLFRALHEKDTQR--MSRGKFFLIAFLCSFAWYIFPGYLFPTLSAISWVCWVFPK  246

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G F LDW+ I++Y GSPL+SP+ AI+NV VG+V+ +Y+ +P+ Y
Sbjct  247   SVTAQQIGSGMSGLGLGAFALDWSVIASYLGSPLISPFFAIVNVIVGYVLVMYMFIPIAY  306

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W  N +DA+KFPIFS+ LF S G  Y+T  ++  +F+L++P+Y    ++Y
Sbjct  307   WGVNMYDAKKFPIFSSDLFDSKGQLYNTSAIVNDEFELDIPSYGREGRVY  356



>ref|XP_002263530.1| PREDICTED: oligopeptide transporter 4 [Vitis vinifera]
Length=744

 Score =   219 bits (558),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 143/188 (76%), Gaps = 6/188 (3%)
 Frame = +2

Query  77   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  256
            AT G++   S    P+EEV L V  TDDP+LPV TFR WF+G+ SC +L FL+ FF YRT
Sbjct  19   ATDGDEDELS----PIEEVRLTVTNTDDPSLPVWTFRMWFMGLFSCALLSFLDQFFAYRT  74

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMAN  430
            +PL I+ I +Q++ LPIG FMAA LP  +F    FG  SF+LNPGPFN+KEHV+I++ AN
Sbjct  75   EPLIITQITVQVATLPIGHFMAAVLPTTRFRIPGFGSRSFSLNPGPFNMKEHVLISIFAN  134

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
             G + G G AY++G +TI+KA+Y++ +SFL G ++++TTQ++GYGWAG+LR+Y+V+P  M
Sbjct  135  AGSAFGSGSAYAVGIVTIIKAFYQRKISFLSGWLLIITTQVLGYGWAGLLRKYVVEPAHM  194

Query  611  WWPSTLLK  634
            WWPS+L++
Sbjct  195  WWPSSLVQ  202


 Score =   180 bits (456),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 120/169 (71%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALHE E +   MTR +FF++ +  SF +Y +PGYLF  LT  SWVCW +P+
Sbjct  199   SLVQVSLFRALHEKEEQR--MTRAKFFVIALICSFSWYLIPGYLFSTLTSISWVCWAFPK  256

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQ+GS   GLG+G  TLDW  ++++  SPLVSP+ AILN+ VG+V+ +Y ++PL Y
Sbjct  257   SVTAQQLGSGMRGLGLGALTLDWTVVASFLFSPLVSPFFAILNIFVGYVLLVYAVIPLAY  316

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W ++ ++A +FPIFS+ LFTS G  YD   ++  +F++N   YE   ++
Sbjct  317   WGFDMYNAHRFPIFSSHLFTSQGQLYDIGAIVNDKFEINRQKYEEQGRI  365



>emb|CDY31321.1| BnaA02g34200D [Brassica napus]
Length=729

 Score =   216 bits (550),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 135/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDD TLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDHTLPVWTFRMWFLGLISCALLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP+ +F    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTQFGIPGFGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +TI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  134  IVTIIKAFYRKNISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  187


 Score =   183 bits (464),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 121/169 (72%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE + +   MTR +FF++ +  SF +Y +PGYLF  LT  SW+CW +PR
Sbjct  184   TLVQVSLFRALHEKDEQR--MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWICWAFPR  241

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G FTLDW  ++++  SPL+SP+ AI NV +G+V+ IYI++PL Y
Sbjct  242   SVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFIGYVLLIYIVLPLSY  301

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W ++ ++A +FPIFS+ LFTS G  YD   ++  +F+L++  YE   ++
Sbjct  302   WGFDAYNATRFPIFSSHLFTSVGQTYDIPAIVNDKFELDLAKYEQQGRI  350



>ref|XP_008390299.1| PREDICTED: oligopeptide transporter 7 isoform X1 [Malus domestica]
Length=757

 Score =   214 bits (544),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 131/172 (76%), Gaps = 4/172 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            PV++VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YRT+PLSI+AI  QI+V
Sbjct  48   PVKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRTEPLSITAISAQIAV  107

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G+ MA+ +  R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +
Sbjct  108  VPLGQLMASKITNRVFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIHIV  163

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+ L++
Sbjct  164  TVVKVFYKRHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQ  215


 Score =   185 bits (470),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 116/171 (68%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E +   G+TR +FFL+    SF YY  PGYLF +LT  SW+CW++P
Sbjct  212   NLVQVSLFRALHEKEARPKGGLTRTQFFLISFMCSFAYYVFPGYLFQMLTSLSWICWIFP  271

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              ++ AQQ+GS  +GLG+G   LDW+ IS+Y GSPL SPW A  NVA GF   +YI+ P+C
Sbjct  272   NNVLAQQLGSGLYGLGIGAVGLDWSTISSYLGSPLASPWFATANVAAGFFFVMYILTPIC  331

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW +N + A+ FPIFS+ LFTS G +Y+   ++   F L+  AY+    LY
Sbjct  332   YW-FNIYKAKTFPIFSDTLFTSDGQEYNITAIIDSNFHLDSEAYDREGPLY  381



>ref|XP_009790410.1| PREDICTED: oligopeptide transporter 4 [Nicotiana sylvestris]
Length=738

 Score =   221 bits (563),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 105/189 (56%), Positives = 140/189 (74%), Gaps = 6/189 (3%)
 Frame = +2

Query  74   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
            PA A +    S    P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YR
Sbjct  12   PAGAADDDDES----PIEEVRLTVTNTDDPTLPVWTFRMWFLGLFSCCLLSFLNQFFSYR  67

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMA  427
            T+PL I+ I +Q++ LPIG F+A  LP  KF    FG  SF+LNPGPFN+KEHV+I++ A
Sbjct  68   TEPLVITQITVQVATLPIGHFLATVLPTTKFRLPGFGSRSFSLNPGPFNMKEHVLISIFA  127

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N G + G G AY++G +TI+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V+P  
Sbjct  128  NAGSAFGNGSAYAVGIVTIIKAFYHRNISFLAGWLLIITTQVLGYGWAGLLRKYVVEPAH  187

Query  608  MWWPSTLLK  634
            MWWPSTL++
Sbjct  188  MWWPSTLVQ  196


 Score =   177 bits (450),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 121/169 (72%), Gaps = 2/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE + +   M+R +FFL+ +  SF +Y +PGYLF  LT  SW+CW + +S
Sbjct  194   LVQVSLFRALHEKDDRR--MSRAKFFLIALVCSFCWYLVPGYLFSTLTSISWICWAFSKS  251

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS   GLG+G  TLDW+ ++++  SPL+ P+ AI+NV  G+++ IY+++P+ YW
Sbjct  252   VTAQQIGSGMRGLGLGAITLDWSAVASFLFSPLICPFFAIVNVFAGYMLIIYMVIPIAYW  311

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              ++ + ARKFPIFS+ LFT+ G KYD   ++  +F+L++  YE   +++
Sbjct  312   GFDLYGARKFPIFSSHLFTAQGQKYDISAIVNDKFELDIGKYEEQGRIH  360



>emb|CDY46800.1| BnaC02g43080D [Brassica napus]
Length=729

 Score =   216 bits (549),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 135/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDD TLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDHTLPVWTFRMWFLGLISCALLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP+ +F    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTQFGIPGFGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +TI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  134  IVTIIKAFYRKNISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  187


 Score =   182 bits (463),  Expect(2) = 1e-101, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 121/169 (72%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE + +   MTR +FF++ +  SF +Y +PGYLF  LT  SW+CW +PR
Sbjct  184   TLVQVSLFRALHEKDEQR--MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWICWAFPR  241

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G FTLDW  ++++  SPL+SP+ AI NV +G+V+ IYI++PL Y
Sbjct  242   SVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFIGYVLLIYIVLPLSY  301

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W ++ ++A +FPIFS+ LFTS G  YD   ++  +F+L++  YE   ++
Sbjct  302   WGFDAYNATRFPIFSSHLFTSVGQTYDIPAIVNDKFELDLAKYEQQGRI  350



>ref|XP_002301110.1| oligopeptide transporter OPT family protein [Populus trichocarpa]
 gb|EEE80383.1| oligopeptide transporter OPT family protein [Populus trichocarpa]
Length=724

 Score =   219 bits (559),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 135/185 (73%), Gaps = 6/185 (3%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
             E      G  P+EEV L VP  DD TLPV TFR WFLGI SCIIL FLNTFF YRT+PL
Sbjct  2    NENIEEDDGVSPIEEVRLTVPTRDDHTLPVWTFRMWFLGIASCIILSFLNTFFSYRTEPL  61

Query  266  SISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGV  439
            +IS I +Q+  LPIG+FMA TLP  KF    FG   F+LNPGPFN+KEHV+I++ AN G 
Sbjct  62   TISMISVQVVTLPIGRFMAKTLPTAKFRVPGFGGREFSLNPGPFNVKEHVLISIFANVGS  121

Query  440  SPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWP  619
            S     AY++G I I+ A+YK+ +SFL   I+VLTTQ++GYGWAG++R+Y+VDP +MWWP
Sbjct  122  S----TAYAVGIIDIIMAFYKRKISFLASWILVLTTQMLGYGWAGIMRKYVVDPAEMWWP  177

Query  620  STLLK  634
             +L++
Sbjct  178  LSLMQ  182


 Score =   178 bits (452),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 122/170 (72%), Gaps = 2/170 (1%)
 Frame = +1

Query  619   FNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
              +L QVSLFRALHE +  +S M+R +FFL+ +  SF +Y  PGYLFP +   SWVCW +P
Sbjct  178   LSLMQVSLFRALHEKD--NSRMSRGKFFLIALICSFSWYVFPGYLFPAIGTISWVCWAFP  235

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +S+TAQQ+GS   GLG+G F LDW+ I+++ GSPL++P+ A +NV VG+  F+Y+I+P+ 
Sbjct  236   KSVTAQQLGSGMRGLGIGAFGLDWSVIASFIGSPLITPFFAAVNVLVGYAAFMYVILPIA  295

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             YW++N ++A+ FPIFS+ LF + GH Y+   ++   F+L+V A++    +
Sbjct  296   YWRFNLYNAKTFPIFSSHLFDTKGHVYNVSAIVDNNFELDVAAFQRQGNI  345



>gb|AAM64614.1| Isp4-like protein [Arabidopsis thaliana]
Length=729

 Score =   216 bits (549),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 140/188 (74%), Gaps = 4/188 (2%)
 Frame = +2

Query  77   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  256
            ATA E +       P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT
Sbjct  2    ATADEFSDED--TSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRT  59

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMAN  430
            +PL I+ I +Q++ LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN
Sbjct  60   EPLVITQITVQVATLPIGHFLAKVLPKTRFGLPGCGSARFSLNPGPFNMKEHVLISIFAN  119

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
             G + G G AY++G ITI+KA+Y +++SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  M
Sbjct  120  AGSAFGSGSAYAVGIITIIKAFYGRSISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHM  179

Query  611  WWPSTLLK  634
            WWPSTL++
Sbjct  180  WWPSTLVQ  187


 Score =   182 bits (461),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 121/169 (72%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE + +   MTR +FF++ +  SF +Y +PGYLF  LT  SWVCW +PR
Sbjct  184   TLVQVSLFRALHEKDDQR--MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWVCWAFPR  241

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G FTLDW  ++++  SPL+SP+ AI NV +G+V+ IY+++PL Y
Sbjct  242   SVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFIGYVLLIYLVLPLAY  301

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W +++++A +FPIFS+ LFTS G  YD   ++   F+L++  YE   ++
Sbjct  302   WGFDSYNATRFPIFSSHLFTSVGKTYDIPAIVNDNFELDLAKYEQQGRI  350



>ref|XP_008239237.1| PREDICTED: oligopeptide transporter 7 [Prunus mume]
Length=760

 Score =   212 bits (539),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 129/174 (74%), Gaps = 4/174 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YR +PLSI+AI  QI
Sbjct  49   NSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRKEPLSITAISAQI  108

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MA+ +    F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  109  AVVPLGQLMASKITTHAFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  164

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+ L++
Sbjct  165  IVTVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQ  218


 Score =   186 bits (471),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 116/171 (68%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E +   G+TR +FFL+    SF YY  PGYLF +LT  SW+CW++P
Sbjct  215   NLVQVSLFRALHEKEARPKGGLTRTQFFLIAFICSFAYYVFPGYLFEMLTSLSWICWIFP  274

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +S+ AQQ+GS  +GLG+G   LDW+ IS+Y GSPL SPW A  NVA GFV+ +YI+ P C
Sbjct  275   KSVLAQQLGSGLYGLGIGTIGLDWSTISSYLGSPLASPWFATANVAAGFVLVMYILTPFC  334

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW +N + A+ FPIFS+ +F S G +Y+   ++   F L+  AY     LY
Sbjct  335   YW-FNVYKAKTFPIFSSTMFKSDGEEYNITAIIDSNFHLDSAAYNREGPLY  384



>ref|XP_010691453.1| PREDICTED: oligopeptide transporter 4 [Beta vulgaris subsp. vulgaris]
Length=746

 Score =   218 bits (555),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 139/187 (74%), Gaps = 5/187 (3%)
 Frame = +2

Query  89   EKTAPSGGR---CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQ  259
            EK+ P        P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+
Sbjct  15   EKSKPDIDEDDISPIEEVRLTVTNTDDPTLPVWTFRMWFLGLVSCGMLSFLNQFFSYRTE  74

Query  260  PLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANC  433
            PL I+ I +Q++ LP+G F+A  LPE KF    FG  +F+LNPGPFN+KEHV+IT+ AN 
Sbjct  75   PLIITQITVQVATLPLGHFLARILPETKFRIPGFGPRTFSLNPGPFNVKEHVLITIFANA  134

Query  434  GVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMW  613
            G + G G AY++G + I+KA+YK+ +SFL   I+++TTQ++GYGWAG++R+Y+V+P  MW
Sbjct  135  GSAFGNGSAYAVGIVNIIKAFYKRNISFLAAWILIITTQVLGYGWAGLMRKYVVEPAHMW  194

Query  614  WPSTLLK  634
            WP+TL++
Sbjct  195  WPNTLVQ  201


 Score =   179 bits (455),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 120/171 (70%), Gaps = 1/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMT-RMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
              L QVSLFRALHE + K    T R +FFL+ +  SF++Y +PGYLF  LT  SWVCWV+ 
Sbjct  198   TLVQVSLFRALHEKDDKEEKRTSRAKFFLIALMCSFLWYAVPGYLFSTLTSISWVCWVFS  257

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             RS+TAQQ+GS   GLG+G  TLDW+ ++++  SPL++P+ AI NV VG+V+ IYI +P+ 
Sbjct  258   RSVTAQQLGSGMRGLGLGAITLDWSAVASFLLSPLITPFFAIANVCVGYVLIIYIFIPIA  317

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW  + + ARKFPIFS+ LFT+ G  Y+   ++  +F+L++  YE   +++
Sbjct  318   YWGLDLYSARKFPIFSSHLFTAQGQIYNISAIVNDKFELDIAQYEKQGQIH  368



>ref|XP_008803572.1| PREDICTED: oligopeptide transporter 4-like isoform X2 [Phoenix 
dactylifera]
Length=606

 Score =   213 bits (543),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 140/196 (71%), Gaps = 4/196 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGR--CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            M+    A   EKTA        P+E+V L VP TD+PTLPV TFR WF+GI SC ++ FL
Sbjct  26   MTATVSAMDVEKTAGGDEEEVSPIEQVRLTVPTTDNPTLPVWTFRMWFIGILSCSLMSFL  85

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEH  406
            N FF YRT+PL I+ I +Q++ LP+G F+A  LP  KF    FG   F+LNPGPFN+KEH
Sbjct  86   NQFFSYRTEPLIITQISIQVASLPVGHFLARVLPAAKFRLPGFGDRQFSLNPGPFNMKEH  145

Query  407  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  586
            V+I++ AN G + G G AY +G + I++A+YK+ +SF  G I+++TTQ++GYGWAG++R+
Sbjct  146  VLISIFANAGYAFGNGPAYGVGIVNIIRAFYKRTISFTAGWILIITTQVLGYGWAGLMRK  205

Query  587  YLVDPVDMWWPSTLLK  634
            Y+V+P  MWWP+TL++
Sbjct  206  YVVEPAHMWWPTTLVQ  221


 Score =   184 bits (466),  Expect(2) = 3e-101, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 120/169 (71%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE E +   MTR +FF++ +  SF +Y +PGYLF  +T  SWVCWV+ +
Sbjct  218   TLVQVSLFRALHEKEDRR--MTRAKFFVIALACSFAWYAVPGYLFSTVTSMSWVCWVFSK  275

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQ+GS  HGLG+G FTLDW  +S++  SPLV P+ AI NV +G+   +YII P+ Y
Sbjct  276   SVTAQQLGSGMHGLGLGAFTLDWTVVSSFLFSPLVCPFFAIANVFIGYAFTVYIITPVAY  335

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W  N ++A+ FPIFS+ LFTSTG  YD   ++  +F++++ AYE + ++
Sbjct  336   WGLNLYNAQTFPIFSSNLFTSTGQPYDITSIVNDKFEIDMEAYEKHGRI  384



>ref|XP_008803573.1| PREDICTED: oligopeptide transporter 4-like isoform X3 [Phoenix 
dactylifera]
Length=600

 Score =   213 bits (543),  Expect(2) = 4e-101, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 140/196 (71%), Gaps = 4/196 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGR--CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            M+    A   EKTA        P+E+V L VP TD+PTLPV TFR WF+GI SC ++ FL
Sbjct  26   MTATVSAMDVEKTAGGDEEEVSPIEQVRLTVPTTDNPTLPVWTFRMWFIGILSCSLMSFL  85

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEH  406
            N FF YRT+PL I+ I +Q++ LP+G F+A  LP  KF    FG   F+LNPGPFN+KEH
Sbjct  86   NQFFSYRTEPLIITQISIQVASLPVGHFLARVLPAAKFRLPGFGDRQFSLNPGPFNMKEH  145

Query  407  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  586
            V+I++ AN G + G G AY +G + I++A+YK+ +SF  G I+++TTQ++GYGWAG++R+
Sbjct  146  VLISIFANAGYAFGNGPAYGVGIVNIIRAFYKRTISFTAGWILIITTQVLGYGWAGLMRK  205

Query  587  YLVDPVDMWWPSTLLK  634
            Y+V+P  MWWP+TL++
Sbjct  206  YVVEPAHMWWPTTLVQ  221


 Score =   184 bits (466),  Expect(2) = 4e-101, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 120/169 (71%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE E +   MTR +FF++ +  SF +Y +PGYLF  +T  SWVCWV+ +
Sbjct  218   TLVQVSLFRALHEKEDRR--MTRAKFFVIALACSFAWYAVPGYLFSTVTSMSWVCWVFSK  275

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQ+GS  HGLG+G FTLDW  +S++  SPLV P+ AI NV +G+   +YII P+ Y
Sbjct  276   SVTAQQLGSGMHGLGLGAFTLDWTVVSSFLFSPLVCPFFAIANVFIGYAFTVYIITPVAY  335

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W  N ++A+ FPIFS+ LFTSTG  YD   ++  +F++++ AYE + ++
Sbjct  336   WGLNLYNAQTFPIFSSNLFTSTGQPYDITSIVNDKFEIDMEAYEKHGRI  384



>gb|EMS45172.1| Oligopeptide transporter 7 [Triticum urartu]
Length=925

 Score =   204 bits (519),  Expect(2) = 4e-101, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 125/171 (73%), Gaps = 4/171 (2%)
 Frame = +2

Query  122  VEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVL  301
            +E+VAL VP  DDP  PVLTFR W LG+ SC +L FLN FF YR +PL+I+AI  QI+V+
Sbjct  52   IEQVALTVPVGDDPDTPVLTFRMWVLGMASCAVLSFLNQFFWYRKEPLTITAISAQIAVV  111

Query  302  PIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAIT  481
            P+G+ MAA LPER F     + FTLNPGPFN+KEHV+IT+ AN     G G  Y+I  +T
Sbjct  112  PLGRLMAAALPERAFFRGRAYEFTLNPGPFNVKEHVLITIFANA----GAGTVYAIHVVT  167

Query  482  IMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             ++ +Y + L+F   L++VLTTQ++G+GWAG+ RRYLV+P  MWWPS L++
Sbjct  168  AVRVFYGKNLTFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPSNLVQ  218


 Score =   193 bits (490),  Expect(2) = 4e-101, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 118/171 (69%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE EV+S G  TR +FFL+    SFVYY  PGYLF +LT  SW+CWV+P
Sbjct  215   NLVQVSLFRALHEKEVRSKGGFTRSQFFLVAFVCSFVYYIFPGYLFQMLTSLSWICWVFP  274

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+ AQQ+GS  +GLG+G   LDWA +S+Y GSPL SPW A  NVA GF + +Y+I P+ 
Sbjct  275   NSVFAQQLGSGLYGLGIGSIGLDWASVSSYLGSPLASPWFATANVAAGFFIIMYVITPIA  334

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW +N + AR FPIFS+ LFT TG KY+   ++  QF  +  AYE    LY
Sbjct  335   YW-FNFYKARNFPIFSDGLFTETGQKYNITSIVDSQFHFDTKAYEKNGPLY  384



>ref|XP_003555686.1| PREDICTED: oligopeptide transporter 7 [Glycine max]
Length=749

 Score =   211 bits (538),  Expect(2) = 4e-101, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 130/174 (75%), Gaps = 4/174 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+++VAL VP TDDP+LPVLTFR W LG  SC++L FLN FF YR QPL+I+AI  QI
Sbjct  38   NSPIKQVALTVPTTDDPSLPVLTFRMWVLGTLSCVLLSFLNQFFWYRIQPLTITAISAQI  97

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAAT+ +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  98   AVVPLGQLMAATITKRVFFRGTRWEFTLNPGPFNVKEHVLITIFAN----SGAGTVYAIH  153

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +T +K +Y + +SF   L++V+TTQ++G+GWAG+ RRYLV+P  MWWP+ L++
Sbjct  154  VVTAVKIFYHKHISFFVSLLVVITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQ  207


 Score =   186 bits (471),  Expect(2) = 4e-101, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 119/171 (70%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE + +   G+TR +FF++    SF YY  PGY+F +LT  SW+CW++P
Sbjct  204   NLVQVSLFRALHEKDERPKGGLTRSQFFVIAFLCSFAYYVFPGYIFQMLTSLSWICWLYP  263

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              ++ AQQ+GS  +GLG+G   LDW+ IS+Y GSPL SPW A  NVAVGFV  +Y++ PLC
Sbjct  264   NNVLAQQLGSGLNGLGIGAIGLDWSTISSYLGSPLASPWFATANVAVGFVFVMYVLTPLC  323

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW  + ++A+ FPIFS++LFT  G  Y+   ++   F L++ AYE   +LY
Sbjct  324   YW-LDLYNAKTFPIFSDELFTEKGQVYNITAIIDSNFHLDLAAYERQGRLY  373



>ref|NP_201246.1| oligopeptide transporter 4 [Arabidopsis thaliana]
 sp|Q9FME8.1|OPT4_ARATH RecName: Full=Oligopeptide transporter 4; Short=AtOPT4 [Arabidopsis 
thaliana]
 dbj|BAB09872.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AAM20694.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AAN15658.1| Isp4-like protein [Arabidopsis thaliana]
 dbj|BAE99084.1| Isp4-like protein [Arabidopsis thaliana]
 gb|AED97890.1| oligopeptide transporter 4 [Arabidopsis thaliana]
Length=729

 Score =   216 bits (549),  Expect(2) = 4e-101, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 140/188 (74%), Gaps = 4/188 (2%)
 Frame = +2

Query  77   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  256
            ATA E +       P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT
Sbjct  2    ATADEFSDED--TSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRT  59

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMAN  430
            +PL I+ I +Q++ LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN
Sbjct  60   EPLVITQITVQVATLPIGHFLAKVLPKTRFGLPGCGSARFSLNPGPFNMKEHVLISIFAN  119

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
             G + G G AY++G ITI+KA+Y +++SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  M
Sbjct  120  AGSAFGSGSAYAVGIITIIKAFYGRSISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHM  179

Query  611  WWPSTLLK  634
            WWPSTL++
Sbjct  180  WWPSTLVQ  187


 Score =   181 bits (460),  Expect(2) = 4e-101, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 121/169 (72%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE + +   MTR +FF++ +  SF +Y +PGYLF  LT  SWVCW +PR
Sbjct  184   TLVQVSLFRALHEKDDQR--MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWVCWAFPR  241

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G FTLDW  ++++  SPL+SP+ AI NV +G+V+ IY ++PL Y
Sbjct  242   SVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFIGYVLLIYFVLPLAY  301

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W +++++A +FPIFS+ LFTS G+ YD   ++   F+L++  YE   ++
Sbjct  302   WGFDSYNATRFPIFSSHLFTSVGNTYDIPAIVNDNFELDLAKYEQQGRI  350



>ref|XP_009130453.1| PREDICTED: oligopeptide transporter 4 [Brassica rapa]
Length=729

 Score =   216 bits (549),  Expect(2) = 5e-101, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 135/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDD TLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDHTLPVWTFRMWFLGLISCALLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP+ +F    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTQFGIPGFGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +TI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  134  IVTIIKAFYRKNISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  187


 Score =   181 bits (459),  Expect(2) = 5e-101, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 121/169 (72%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE + +   MTR +FF++ +  SF +Y +PGYLF  LT  SW+CW +PR
Sbjct  184   TLVQVSLFRALHEKDEQR--MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWICWAFPR  241

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G FTLDW  ++++  SPL+SP+ AI NV +G+V+ IYI++PL Y
Sbjct  242   SVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFIGYVLLIYIVLPLSY  301

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W ++ ++A +FPIFS+ LFTS G  Y+   ++  +F+L++  YE   ++
Sbjct  302   WGFDAYNATRFPIFSSHLFTSVGQTYNIPAIVNDKFELDLAKYEQQGRI  350



>ref|XP_007145948.1| hypothetical protein PHAVU_006G000100g [Phaseolus vulgaris]
 gb|ESW17942.1| hypothetical protein PHAVU_006G000100g [Phaseolus vulgaris]
Length=760

 Score =   208 bits (529),  Expect(2) = 5e-101, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 130/174 (75%), Gaps = 4/174 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+++VA+ V  TDDP+LPVLTFR W LG  SC++L FLN FF YR +PL+I+AI  QI
Sbjct  48   NSPIKQVAMTVSTTDDPSLPVLTFRMWVLGSLSCVVLSFLNQFFWYRREPLAITAISAQI  107

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MAAT+ +R F    RW F LNPGPFN+KEHV+IT+ AN     G G+ Y+I 
Sbjct  108  AVVPLGQLMAATMTKRVFLRGTRWEFRLNPGPFNVKEHVLITIFANS----GAGNVYAIH  163

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +T +K +Y+Q +SF   L++V+TTQ++G+GWAG+ RRYLV+P  MWWP+ L++
Sbjct  164  IVTAVKIFYRQHISFFVSLLVVITTQVLGFGWAGIFRRYLVEPAAMWWPANLVQ  217


 Score =   189 bits (479),  Expect(2) = 5e-101, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 120/171 (70%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE + ++ G +TR +FF++    SF YY  PGY+F +L   SWVCW++P
Sbjct  214   NLVQVSLFRALHEKDERAKGGLTRSQFFVMAFVCSFAYYVFPGYIFQMLVSLSWVCWLFP  273

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              +I AQQ+GS  +GLG+G   LDW+ IS+Y GSPL SPW A  N+AVGFV+ IY++ PLC
Sbjct  274   NNILAQQLGSGLYGLGIGAVGLDWSTISSYLGSPLASPWFATANIAVGFVLVIYVLTPLC  333

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW +N + A+ FPIFSN+LFT  G  Y+   ++   F L++ AY+   +LY
Sbjct  334   YW-FNVYRAKTFPIFSNKLFTDQGQIYNITAIIDSNFHLDLAAYQRQDRLY  383



>ref|XP_010444374.1| PREDICTED: oligopeptide transporter 4-like [Camelina sativa]
Length=729

 Score =   216 bits (549),  Expect(2) = 5e-101, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 135/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTRFGLPGCGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             ITI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  134  IITIIKAFYRRNISFVAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  187


 Score =   181 bits (459),  Expect(2) = 5e-101, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 121/169 (72%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE + +   MTR +FF++ +  SF +Y +PGYLF  LT  SWVCW +PR
Sbjct  184   TLVQVSLFRALHEKDDQK--MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWVCWAFPR  241

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G FTLDW  ++++  SPL+SP+ AI NV  G+V+ IYI++P+ Y
Sbjct  242   SVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFFGYVLLIYIVLPIAY  301

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W +++++A +FPIFS+ LFTS G  YD   ++  +F+L++  YE   ++
Sbjct  302   WGFDSYNATRFPIFSSHLFTSVGKTYDIPAIVNDKFELDLAKYEQQGRI  350



>ref|XP_011016978.1| PREDICTED: oligopeptide transporter 2 [Populus euphratica]
Length=738

 Score =   220 bits (561),  Expect(2) = 6e-101, Method: Compositional matrix adjust.
 Identities = 109/200 (55%), Positives = 141/200 (71%), Gaps = 7/200 (4%)
 Frame = +2

Query  41   EHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCII  220
            + + +E    NP    E      G  P+EEV L VP  DD TLPV TFR WFLGI SCII
Sbjct  2    DSLEIEGKPQNP-NMNENIEEDDGVSPIEEVRLTVPTRDDHTLPVWTFRMWFLGIASCII  60

Query  221  LIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFN  394
            L FLNTFF YRT+PL+IS I +Q+  LP+G+FMA TLP  KF    FG   F+LNPGPFN
Sbjct  61   LSFLNTFFSYRTEPLTISMISVQVVTLPVGRFMAKTLPTTKFRVPGFGGREFSLNPGPFN  120

Query  395  IKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAG  574
            +KEHV+I++ AN G S     AY++G I I+ A+YK+ +SFL   I+VLTTQ++GYGWAG
Sbjct  121  VKEHVLISIFANVGSS----TAYAVGIIDIIMAFYKRKISFLASWILVLTTQMLGYGWAG  176

Query  575  VLRRYLVDPVDMWWPSTLLK  634
            ++R+Y+VDP +MWWP +L++
Sbjct  177  IMRKYVVDPAEMWWPLSLMQ  196


 Score =   176 bits (446),  Expect(2) = 6e-101, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 121/170 (71%), Gaps = 2/170 (1%)
 Frame = +1

Query  619   FNLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
              +L QVSLFRALHE +  +S M+R +FFL+ +  SF +Y  PGYLFP +   SWVCW +P
Sbjct  192   LSLMQVSLFRALHEKD--NSRMSRGKFFLVALICSFSWYVFPGYLFPAIGTISWVCWAFP  249

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +S+TAQQ+GS   GLG+G F LDW+ I+++ GSPL++P+ A++NV VG+  F+Y+I+P+ 
Sbjct  250   KSVTAQQLGSGMRGLGIGAFGLDWSVIASFIGSPLITPFFAVVNVLVGYAAFMYVILPIA  309

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             YW+ N ++A+ FPIFS+ LF + GH Y+   ++   F+L+  A++    +
Sbjct  310   YWRLNIYNAKTFPIFSSHLFDNKGHVYNVSAIVDNNFELDEAAFQRQGNI  359



>ref|XP_010484229.1| PREDICTED: oligopeptide transporter 4 [Camelina sativa]
Length=729

 Score =   215 bits (548),  Expect(2) = 6e-101, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 135/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTRFGLPGCGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             ITI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  134  IITIIKAFYRRDISFVAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  187


 Score =   181 bits (459),  Expect(2) = 6e-101, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 121/169 (72%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE + +   MTR +FF++ +  SF +Y +PGYLF  LT  SWVCW +PR
Sbjct  184   TLVQVSLFRALHEKDDQK--MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWVCWAFPR  241

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G FTLDW  ++++  SPL+SP+ AI NV  G+V+ IYI++P+ Y
Sbjct  242   SVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFFGYVLLIYIVLPIAY  301

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W +++++A +FPIFS+ LFTS G  YD   ++  +F+L++  YE   ++
Sbjct  302   WGFDSYNATRFPIFSSHLFTSVGKTYDIPAIVNDKFELDLAKYEQQGRI  350



>ref|XP_009601745.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana tomentosiformis]
 ref|XP_009601746.1| PREDICTED: oligopeptide transporter 7-like [Nicotiana tomentosiformis]
Length=732

 Score =   213 bits (542),  Expect(2) = 7e-101, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 136/189 (72%), Gaps = 7/189 (4%)
 Frame = +2

Query  68   LNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            +N A A E        CP++EV + VP+TDDPT PV+TFR WFLGITSC++L F+N FF 
Sbjct  6    VNMAAANEADE---DLCPIKEVDMTVPKTDDPTTPVVTFRMWFLGITSCVLLSFVNQFFW  62

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            YRT+PL+IS+  +QI+V+PIG  MA T+ +R F    RW FTLNPGPFNIKEHV+IT+ A
Sbjct  63   YRTEPLTISSTAVQIAVVPIGHLMAKTITKRVFFEGTRWEFTLNPGPFNIKEHVLITIFA  122

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N     G G  Y+   ++ +K YYK+ LSF   L+I+ TTQ++G+GWAG+ R+ LV+P +
Sbjct  123  NA----GAGSVYATHILSAVKLYYKRPLSFFPALLIMATTQMLGFGWAGIFRKQLVEPAE  178

Query  608  MWWPSTLLK  634
            MWWP +L++
Sbjct  179  MWWPGSLVQ  187


 Score =   183 bits (465),  Expect(2) = 7e-101, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 118/171 (69%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             +L QVSLFRALHE E +   G TR++FFL+ +  SF YY  PGYLF +L+ FSW+CW+ P
Sbjct  184   SLVQVSLFRALHEKETRPKGGTTRIQFFLIALVFSFAYYIFPGYLFQMLSSFSWICWLAP  243

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +SI  QQ+GS   GLG+G    DW  IS+Y GSPL SPW A  NVA GFV+ +Y++ PL 
Sbjct  244   KSILVQQLGSGMRGLGIGALGFDWTTISSYLGSPLASPWFATANVAAGFVLVMYLMTPLT  303

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW +N ++A+ FPIFS+ LFT  G KY+T  V+   F+L+  AY  Y +L+
Sbjct  304   YW-FNVYNAKNFPIFSSGLFTLNGTKYNTEGVINSHFELDKAAYNQYGQLH  353



>ref|XP_008806363.1| PREDICTED: oligopeptide transporter 7-like [Phoenix dactylifera]
Length=765

 Score =   205 bits (521),  Expect(2) = 9e-101, Method: Compositional matrix adjust.
 Identities = 94/172 (55%), Positives = 126/172 (73%), Gaps = 4/172 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+VAL VP  DDP++PVLTFR W LG  SC +L FLN FF YR +PLSI++I  QI+V
Sbjct  53   PIEQVALTVPVGDDPSVPVLTFRMWVLGTISCALLSFLNQFFWYRKEPLSITSISAQIAV  112

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G  MA T+ +R F    RW FTLNPGPFNIKEHV+IT+ AN     G G  Y+I  +
Sbjct  113  VPLGHLMARTITDRVFFKGRRWEFTLNPGPFNIKEHVLITIFANS----GAGSVYAIHVV  168

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            T +K +Y++ ++F   L++VLTTQ++G+GWAG+ RRYLV+P  MWWP  L++
Sbjct  169  TAVKIFYRRHITFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPYNLVQ  220


 Score =   191 bits (485),  Expect(2) = 9e-101, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 119/172 (69%), Gaps = 2/172 (1%)
 Frame = +1

Query  619   FNLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  795
             +NL QVSLFRALHE E +   G+TR +FF++    SF YY  PGYLF +LT  SW+CW++
Sbjct  216   YNLVQVSLFRALHEKEARPKHGLTRNQFFMVAFICSFSYYVFPGYLFSMLTSLSWICWIF  275

Query  796   PRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPL  975
             PRS+ AQQ+GS  +GLG+G   LDW+ IS+Y GSPL SPW A  NVA GFV+ +Y+I P 
Sbjct  276   PRSVLAQQLGSGLYGLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFVLIMYVITPT  335

Query  976   CYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              YW  N + A+ FPIFS+ LFTSTG +Y+   ++   F L+V AYE    LY
Sbjct  336   AYW-LNLYKAKTFPIFSDDLFTSTGQEYNISSIIDSDFHLDVEAYEKEGPLY  386



>ref|XP_004147543.1| PREDICTED: oligopeptide transporter 4 [Cucumis sativus]
Length=738

 Score =   215 bits (547),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 138/189 (73%), Gaps = 2/189 (1%)
 Frame = +2

Query  74   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
            P +  +  A      P+E+V L V  +DDPTLPV TFR W LG+ SC +L FLN FF YR
Sbjct  8    PLSGSDPAADDDDISPIEQVRLTVTNSDDPTLPVWTFRMWTLGLLSCALLSFLNQFFYYR  67

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMA  427
            T+PL I+ I +Q++ LPIG+FMAA LP  +F    FG   F+LNPGPFN+KEHV+I++ A
Sbjct  68   TEPLIITQITVQVATLPIGQFMAAVLPASRFRLPGFGSRRFSLNPGPFNMKEHVLISIFA  127

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N G + GGG AY++G + I+KA+Y + +SF+   ++++TTQ++GYGWAG+LR+Y+V+P  
Sbjct  128  NAGTAFGGGSAYAVGIVNIIKAFYGRNISFVAAWLLIVTTQVLGYGWAGLLRKYVVEPAH  187

Query  608  MWWPSTLLK  634
            MWWPSTL++
Sbjct  188  MWWPSTLVQ  196


 Score =   180 bits (457),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 122/170 (72%), Gaps = 2/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE E     M+R +FFL+ +  SF +Y +PGYLFP LT  SWVCW +P 
Sbjct  193   TLVQVSLFRALHEKE--DCRMSRGKFFLIALICSFSWYVIPGYLFPTLTSISWVCWAFPN  250

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQ+GS   GLG+G FTLDW+ +S++  SPL+SP+ +I+N+ VG+ + IYI VP+ Y
Sbjct  251   SVTAQQLGSGMKGLGLGAFTLDWSAVSSFLFSPLISPFFSIVNIFVGYTLIIYIAVPIAY  310

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W +N ++A  FPIFS++LFT+ G  Y+   ++  +F+L++  YE + +++
Sbjct  311   WGFNLYNASTFPIFSSKLFTAQGQLYNITAIVNDKFELDLAKYEEHGQIH  360



>ref|XP_008800083.1| PREDICTED: oligopeptide transporter 4-like [Phoenix dactylifera]
Length=748

 Score =   210 bits (534),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 97/200 (49%), Positives = 139/200 (70%), Gaps = 7/200 (4%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGG-----RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCII  220
            E      A+   +  P  G       P+E+V L V  TDDPTLPV TFR WF+GI SC +
Sbjct  7    EREAATKASMDVEAIPGAGVEDEENSPIEQVRLTVLTTDDPTLPVWTFRMWFIGILSCSL  66

Query  221  LIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFN  394
            + FLN FF YRT+PL I  I +Q++ LP+G+F+A  LP  KF    FG   F+LNPGPFN
Sbjct  67   MAFLNQFFSYRTEPLIIGQITIQVASLPVGRFLARVLPATKFRLPGFGDRKFSLNPGPFN  126

Query  395  IKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAG  574
            +KEHV+I++ AN G + G G AY++G + I++A+YK+++SF+   ++++TTQ++GYGWAG
Sbjct  127  MKEHVLISIFANAGCAFGSGSAYAVGIVDIIRAFYKRSISFIASWLLIVTTQVLGYGWAG  186

Query  575  VLRRYLVDPVDMWWPSTLLK  634
            +LR+Y+V+P  MWWP TL++
Sbjct  187  LLRKYVVEPAHMWWPGTLVQ  206


 Score =   186 bits (471),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 122/169 (72%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE E   S M+R +FF++ +  SF++Y +PG+LFP LT  SW+CWV+ +
Sbjct  203   TLVQVSLFRALHEKE--DSRMSRAKFFVIALACSFLWYAVPGFLFPTLTSISWLCWVFSK  260

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQ+GS   GLG+G FTLDW+ +S++  SPLVSP+ AI+NV  G+V+ +YI+ P+ Y
Sbjct  261   SVTAQQLGSGMRGLGIGAFTLDWSAVSSFLFSPLVSPFFAIVNVFFGYVLIVYIVTPVAY  320

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W  + + A+ FPIFS+ LFTS G  YD   ++  +F+++V AYE   K+
Sbjct  321   WGLDLYHAKTFPIFSSHLFTSAGQNYDVHAIVNNKFEIDVQAYEKQGKI  369



>ref|XP_010461766.1| PREDICTED: oligopeptide transporter 4-like [Camelina sativa]
Length=729

 Score =   216 bits (549),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 135/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTRFGLPGCGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             ITI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  134  IITIIKAFYRRNISFVAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  187


 Score =   179 bits (455),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 120/169 (71%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE + +   MTR +FF++ +  SF +Y +PGYLF  LT  SWVCW +PR
Sbjct  184   TLVQVSLFRALHEKDDQK--MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWVCWAFPR  241

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G FTLDW  ++++  SPL+SP+ AI N   G+V+ IYI++P+ Y
Sbjct  242   SVTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANAFFGYVLLIYIVLPIAY  301

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W +++++A +FPIFS+ LFTS G  YD   ++  +F+L++  YE   ++
Sbjct  302   WGFDSYNATRFPIFSSHLFTSVGKTYDIPAIVNDKFELDLAKYEQQGRI  350



>ref|XP_002866614.1| hypothetical protein ARALYDRAFT_496649 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42873.1| hypothetical protein ARALYDRAFT_496649 [Arabidopsis lyrata subsp. 
lyrata]
Length=729

 Score =   214 bits (546),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 102/188 (54%), Positives = 139/188 (74%), Gaps = 4/188 (2%)
 Frame = +2

Query  77   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  256
            ATA E +       P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT
Sbjct  2    ATADEFSDED--TSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRT  59

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMAN  430
            +PL I+ I +Q++ LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN
Sbjct  60   EPLVITQITVQVATLPIGHFLAKVLPKTRFGLPGCGSARFSLNPGPFNMKEHVLISIFAN  119

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
             G + G G AY++G ITI+KA+Y + +SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  M
Sbjct  120  AGSAFGSGSAYAVGIITIIKAFYGRNISFIAGWLLIITTQVLGYGWAGLLRKYVVEPAHM  179

Query  611  WWPSTLLK  634
            WWPSTL++
Sbjct  180  WWPSTLVQ  187


 Score =   180 bits (457),  Expect(2) = 1e-100, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 121/168 (72%), Gaps = 2/168 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE + +   MTR +FF++ +  SF +Y +PGYLF  LT  SWVCW +PRS
Sbjct  185   LVQVSLFRALHEKDDQR--MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWVCWAFPRS  242

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS   GLG+G FTLDW  ++++  SPL+SP+ AI NV VG+V+ IY+++PL YW
Sbjct  243   VTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFVGYVLLIYLVLPLGYW  302

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
              +++++A +FPIFS+ LFTS G  YD   ++   F+L++  YE   ++
Sbjct  303   GFDSYNATRFPIFSSHLFTSFGKTYDIPAIVNDNFELDLAKYEQQGRI  350



>ref|XP_007210345.1| hypothetical protein PRUPE_ppa001827mg [Prunus persica]
 gb|EMJ11544.1| hypothetical protein PRUPE_ppa001827mg [Prunus persica]
Length=760

 Score =   213 bits (541),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 129/174 (74%), Gaps = 4/174 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+VAL VP TDDP+LPVLTFR W LG  SCI+L FLN FF YR +PLSI+AI  QI
Sbjct  49   NSPVEQVALTVPTTDDPSLPVLTFRMWVLGTLSCILLSFLNQFFWYRKEPLSITAISAQI  108

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G+ MA+ +    F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  109  AVVPLGQLMASKITTHAFFKGSRWEFTLNPGPFNVKEHVLITIFANS----GAGTVYAIH  164

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +T++K +YK+ ++F   L+++LTTQ++G+GWAG+ RRYLV+P  MWWP+ L++
Sbjct  165  IVTVVKVFYKKHITFFVSLLVILTTQVLGFGWAGIFRRYLVEPAAMWWPANLVQ  218


 Score =   182 bits (463),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 115/171 (67%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E +   G+TR +FFL+    SF YY  PGYLF +LT  SW+CW++P
Sbjct  215   NLVQVSLFRALHEKEARPKGGVTRTQFFLIAFICSFAYYVFPGYLFEMLTSLSWICWIFP  274

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +S+ AQQ+GS  +GLG+G   +DW+ IS+Y GSPL SPW A  NVA GF + +YI+ P C
Sbjct  275   KSVLAQQLGSGLYGLGIGTVGIDWSTISSYLGSPLASPWFATANVAAGFFLVMYILTPFC  334

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW +N + A+ FPIFS+ +F S G +Y+   ++   F L+  AY     LY
Sbjct  335   YW-FNVYKAKTFPIFSSTMFKSDGEEYNITAIIDSNFHLDSAAYNREGPLY  384



>ref|XP_008378664.1| PREDICTED: oligopeptide transporter 2-like [Malus domestica]
Length=743

 Score =   208 bits (530),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 132/185 (71%), Gaps = 1/185 (1%)
 Frame = +2

Query  80   TAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQ  259
            T  E+         VE+V L V   DD +LPV TFR W +GI SC +L FLNTFF YRT+
Sbjct  16   TEIEEDKNDDDVSSVEQVRLTVSNEDDSSLPVWTFRMWTIGICSCFLLSFLNTFFSYRTE  75

Query  260  PLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGV  439
            PL IS I +Q++ LPIG+FMA TLP RKF   G+ SF+LNPG FNIKEHV+I++ AN G 
Sbjct  76   PLVISMISVQVASLPIGRFMARTLPRRKFWIGGK-SFSLNPGEFNIKEHVLISIFANAGS  134

Query  440  SPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWP  619
              G G AY++G + I+KA+Y + +SF     +V+TTQ++GYGWAG++R+Y+VDP  MWWP
Sbjct  135  GFGNGPAYAVGIVNIIKAFYGRKISFFASWALVITTQVLGYGWAGIIRKYVVDPAAMWWP  194

Query  620  STLLK  634
            S+L++
Sbjct  195  SSLVQ  199


 Score =   186 bits (473),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 121/165 (73%), Gaps = 2/165 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALHE +   + M+R +FFL+ +  SF +Y +PGYLF  L+  SW+CW++P+
Sbjct  196   SLVQVSLFRALHEKD--KNRMSRGKFFLIALVCSFSWYAVPGYLFTTLSIISWICWIYPK  253

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SI AQQIGS Y GLG+G FTLDW+ IS+Y GSPL+SP+ AI N+ VG++  +Y+I+P+ Y
Sbjct  254   SIRAQQIGSGYRGLGLGSFTLDWSVISSYLGSPLISPFFAIANITVGYIAIMYVIIPIAY  313

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYES  1116
             W+ N ++A+ F IFS+ LF S G  Y+   ++  QF +++PAYE 
Sbjct  314   WRLNLYNAKNFAIFSSHLFDSDGQIYNVKGIVNDQFQIDMPAYEK  358



>ref|XP_008806360.1| PREDICTED: oligopeptide transporter 7-like [Phoenix dactylifera]
Length=766

 Score =   207 bits (526),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 126/174 (72%), Gaps = 4/174 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+E+VAL VP  DDP++PVLTFR W LG  SC +L FLN FF YR +PLSI++I  QI
Sbjct  52   NSPIEQVALTVPVGDDPSVPVLTFRMWVLGTISCALLSFLNQFFWYRKEPLSITSISAQI  111

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA T+ +R F    RW FTLNPGPFNIKEHV+IT+ AN     G G  Y+I 
Sbjct  112  AVVPLGHLMARTITDRVFFKGRRWEFTLNPGPFNIKEHVLITIFANS----GAGSVYAIH  167

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +T +K +Y+Q ++F   L++VLTTQ++G+GWAG+ RRYLV+P  MWWP  L++
Sbjct  168  VVTAVKIFYRQHITFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPYNLVQ  221


 Score =   188 bits (477),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 118/172 (69%), Gaps = 2/172 (1%)
 Frame = +1

Query  619   FNLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  795
             +NL QVSLFRALHE E +   G+TR +FF++    SF YY  PGYLF +LT  SW+CW++
Sbjct  217   YNLVQVSLFRALHEKEARPKHGLTRNQFFMVAFICSFGYYVFPGYLFSMLTSLSWICWIF  276

Query  796   PRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPL  975
             PRSI AQQ+GS  +GLG+G   LDW+ IS+Y GSPL SPW A  NVA GFV+ +Y+I P 
Sbjct  277   PRSILAQQLGSGLYGLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFVLIMYVITPT  336

Query  976   CYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              YW  N + A+ FPIFS+ LF+STG  Y+   ++   F L+V AYE    LY
Sbjct  337   AYW-LNLYKAKTFPIFSDGLFSSTGQSYNISSIIDSNFHLDVDAYEKEGPLY  387



>ref|XP_010029951.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
 gb|KCW56909.1| hypothetical protein EUGRSUZ_I02585 [Eucalyptus grandis]
Length=746

 Score =   214 bits (545),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 133/184 (72%), Gaps = 2/184 (1%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            + T       P+EEV L V   DDP+LPV TFR WFLG+ SC +L FLN FF YRT+PL 
Sbjct  21   DGTVDKDDLSPIEEVRLTVSNADDPSLPVWTFRMWFLGLLSCALLSFLNQFFAYRTEPLV  80

Query  269  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            I+ I +Q++ LPIG+FMAA LPE KF     G   F+LNPGPFN+KEHV+I++ AN G +
Sbjct  81   ITQITVQVATLPIGRFMAAALPEAKFQIPGLGPRLFSLNPGPFNMKEHVLISIFANAGSA  140

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G AY +G + I+KA+Y + +SF  G ++++TTQ++GYGWAG+LR+Y+V+P  MWWP 
Sbjct  141  FGSGSAYGVGIVNIIKAFYHRGISFFAGWLLIITTQVLGYGWAGLLRKYVVEPSHMWWPG  200

Query  623  TLLK  634
            TL++
Sbjct  201  TLVQ  204


 Score =   181 bits (458),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 119/169 (70%), Gaps = 2/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHET+ +   M+R +FFL+ +  SF +Y +PGYLF  LT  SWVCW +  S
Sbjct  202   LVQVSLFRALHETDEQR--MSRAKFFLIALICSFTWYAVPGYLFSTLTNISWVCWAFSNS  259

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS   GLG+G  TLDW  ++++  SPL+ P+ AI+NV VG+ + IY+++P  YW
Sbjct  260   VTAQQIGSGMRGLGLGALTLDWTAVASFLFSPLICPFFAIVNVFVGYALIIYVVIPTAYW  319

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              +N + A +FPIFS+ LFT+ G KY+   ++  +F+L++P YE   +++
Sbjct  320   GFNVYSANRFPIFSSHLFTAQGQKYNITAIVNDKFELDIPKYEEQGRIH  368



>ref|XP_008803571.1| PREDICTED: oligopeptide transporter 4-like isoform X1 [Phoenix 
dactylifera]
Length=763

 Score =   212 bits (540),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 140/196 (71%), Gaps = 4/196 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGR--CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            M+    A   EKTA        P+E+V L VP TD+PTLPV TFR WF+GI SC ++ FL
Sbjct  26   MTATVSAMDVEKTAGGDEEEVSPIEQVRLTVPTTDNPTLPVWTFRMWFIGILSCSLMSFL  85

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEH  406
            N FF YRT+PL I+ I +Q++ LP+G F+A  LP  KF    FG   F+LNPGPFN+KEH
Sbjct  86   NQFFSYRTEPLIITQISIQVASLPVGHFLARVLPAAKFRLPGFGDRQFSLNPGPFNMKEH  145

Query  407  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  586
            V+I++ AN G + G G AY +G + I++A+YK+ +SF  G I+++TTQ++GYGWAG++R+
Sbjct  146  VLISIFANAGYAFGNGPAYGVGIVNIIRAFYKRTISFTAGWILIITTQVLGYGWAGLMRK  205

Query  587  YLVDPVDMWWPSTLLK  634
            Y+V+P  MWWP+TL++
Sbjct  206  YVVEPAHMWWPTTLVQ  221


 Score =   182 bits (463),  Expect(2) = 2e-100, Method: Compositional matrix adjust.
 Identities = 85/168 (51%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE E +   MTR +FF++ +  SF +Y +PGYLF  +T  SWVCWV+ +S
Sbjct  219   LVQVSLFRALHEKEDRR--MTRAKFFVIALACSFAWYAVPGYLFSTVTSMSWVCWVFSKS  276

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQ+GS  HGLG+G FTLDW  +S++  SPLV P+ AI NV +G+   +YII P+ YW
Sbjct  277   VTAQQLGSGMHGLGLGAFTLDWTVVSSFLFSPLVCPFFAIANVFIGYAFTVYIITPVAYW  336

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
               N ++A+ FPIFS+ LFTSTG  YD   ++  +F++++ AYE + ++
Sbjct  337   GLNLYNAQTFPIFSSNLFTSTGQPYDITSIVNDKFEIDMEAYEKHGRI  384



>ref|XP_006280078.1| hypothetical protein CARUB_v10025959mg [Capsella rubella]
 gb|EOA12976.1| hypothetical protein CARUB_v10025959mg [Capsella rubella]
Length=729

 Score =   215 bits (547),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 135/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKTRFGLPGCGSARFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             ITI+KA+Y++ +SF+ G ++++TTQ++GYGWAG+LR+Y+++P  MWWPSTL++
Sbjct  134  IITIIKAFYRRNISFIAGWLLIITTQVLGYGWAGLLRKYVIEPAHMWWPSTLVQ  187


 Score =   179 bits (454),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 84/168 (50%), Positives = 121/168 (72%), Gaps = 2/168 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE + +   MTR +FF++ +  SF +Y +PGYLF  LT  SWVCW +PRS
Sbjct  185   LVQVSLFRALHEKDDQR--MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWVCWAFPRS  242

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS   GLG+G FTLDW  ++++  SPL+SP+ AI NV  G+V+ IYI++P+ YW
Sbjct  243   VTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFFGYVLLIYIVLPIGYW  302

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
              +++++A +FPIFS+ LFTS G+ YD   ++   F+L++  YE   ++
Sbjct  303   GFDSYNATRFPIFSSHLFTSVGNTYDIPAIVNDNFELDLVKYEQQGRI  350



>emb|CDY19030.1| BnaC01g20380D [Brassica napus]
Length=735

 Score =   208 bits (529),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 130/174 (75%), Gaps = 4/174 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC V EV L VP+TDDP+LPVLTFR WFLGI++CI+L F+N FF YRT PLSI+ I  QI
Sbjct  17   RCVVPEVELTVPKTDDPSLPVLTFRMWFLGISACIVLSFINQFFWYRTMPLSITGISAQI  76

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA  LP R+F    R+ FTLNPG FN+KEHV+IT+ AN     G G  Y+  
Sbjct  77   AVVPLGHLMARVLPSRRFLEGTRFQFTLNPGAFNVKEHVLITIFANS----GAGSVYATH  132

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             ++ +K YYK++L FL   ++++TTQ++G+GWAG+ R++LV+P +MWWPS L++
Sbjct  133  ILSAIKLYYKRSLPFLPAFLVMITTQILGFGWAGLFRKHLVEPGEMWWPSNLVQ  186


 Score =   186 bits (473),  Expect(2) = 3e-100, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 116/166 (70%), Gaps = 2/166 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLF ALHE E KS G M+R +FFL+V+ ASF YY LPGYLF +LT  SWVCW  P
Sbjct  183   NLVQVSLFGALHEKEKKSKGHMSRTQFFLIVLVASFAYYILPGYLFTMLTSISWVCWFNP  242

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +SI   Q+GS  HGLGVG    DW  ISAY GSPL SP  A +NVA+GFV+ +YI+ P+C
Sbjct  243   KSILVNQLGSGEHGLGVGSIGFDWVTISAYLGSPLASPLFASVNVAIGFVLVMYIVTPIC  302

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYES  1116
             YW  N ++A+ FPIFS+QLF + G +YD   ++  +F L+   Y +
Sbjct  303   YW-LNIYEAKTFPIFSSQLFMANGSRYDVLSIIDSKFHLDRAVYSN  347



>ref|XP_006351838.1| PREDICTED: oligopeptide transporter 4-like [Solanum tuberosum]
Length=738

 Score =   217 bits (552),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 135/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  23   PIEEVRLTVTNTDDPTLPVWTFRMWFLGLFSCCLLSFLNQFFSYRTEPLVITQITVQVAT  82

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP+ KF    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  83   LPIGHFLATILPKTKFRLPGFGPRLFSLNPGPFNMKEHVLISIFANAGSAFGNGSAYAVG  142

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +TI+KA+Y++ +SFL G I+++TTQ++GYGWAG+LR+Y+V+P  MWWP TL++
Sbjct  143  IVTIIKAFYRRNISFLAGWILIITTQVLGYGWAGLLRKYVVEPAHMWWPGTLVQ  196


 Score =   177 bits (448),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 120/169 (71%), Gaps = 2/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE + +   M+R +FFL+ +  SF +Y +PGYLF  LT  SW+CW + +S
Sbjct  194   LVQVSLFRALHEKDDRR--MSRAKFFLIALICSFCWYLVPGYLFSTLTSISWICWAFSKS  251

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS   GLGVG  TLDW+ ++++  SPL+ P+ AI+N+  G+++ IY+++P+ YW
Sbjct  252   VTAQQIGSGMRGLGVGAITLDWSAVASFLFSPLICPFFAIVNIFAGYMLIIYMVIPIAYW  311

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              ++ + A KFPIFS+ LFTS G KYD   ++  +F+L++  YE   +++
Sbjct  312   GFDLYGASKFPIFSSHLFTSQGQKYDISAIVNDKFELDIGKYEEQGRIH  360



>dbj|BAJ85948.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=755

 Score =   209 bits (531),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = +2

Query  92   KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSI  271
            +   S    P+E+VAL VP  DDP  PVLTFR W LG+ SC +L FLN FF YR +PL++
Sbjct  33   RDEASEENSPIEQVALTVPVGDDPDTPVLTFRMWVLGMASCAVLSFLNQFFWYRKEPLTV  92

Query  272  SAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGG  451
            +AI  QI+V+P+G+ MAA LPER F P   + FTLNPGPFN+KEHV+IT+ AN     G 
Sbjct  93   TAISAQIAVVPLGRLMAAALPERAFFPDRPYEFTLNPGPFNVKEHVLITIFANA----GA  148

Query  452  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLL  631
            G  Y+I  +T ++ +Y + L+F   L++VLTTQ++G+GWAG+ RRYLV+P  MWWPS L+
Sbjct  149  GTVYAIHVVTAVRVFYGKNLTFFVSLLVVLTTQVLGFGWAGIFRRYLVEPAAMWWPSNLV  208

Query  632  K  634
            +
Sbjct  209  Q  209


 Score =   185 bits (469),  Expect(2) = 4e-100, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 115/171 (67%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E +  G  TR +FFL+    SF YY  PGYLF +LT  SW+CWV+P
Sbjct  206   NLVQVSLFRALHEKEGRQKGGFTRNQFFLVAFTCSFTYYVFPGYLFQMLTSLSWICWVFP  265

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+ AQQ+GS   GLG+G   LDWA +S+Y GSPLVSPW A +NVA GF + +Y+I P+ 
Sbjct  266   HSVLAQQLGSGLRGLGIGAIGLDWASVSSYLGSPLVSPWFATVNVAAGFFIIMYVITPIG  325

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW +N ++A  FPIFS  LFTSTG KY+   ++   F  +  AYE    LY
Sbjct  326   YW-FNFYNAWTFPIFSADLFTSTGQKYNISAIVDDHFRFDTEAYERNGPLY  375



>ref|XP_009612437.1| PREDICTED: oligopeptide transporter 4 [Nicotiana tomentosiformis]
Length=737

 Score =   217 bits (553),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 134/176 (76%), Gaps = 2/176 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q+
Sbjct  20   ESPIEEVRLTVTNTDDPTLPVWTFRMWFLGLFSCCLLSFLNQFFSYRTEPLVITQITVQV  79

Query  293  SVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  466
            + LPIG F+A  LP  KF    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY+
Sbjct  80   ATLPIGHFLATVLPTTKFRLPGFGSRLFSLNPGPFNMKEHVLISIFANAGSAFGNGSAYA  139

Query  467  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            +G +TI+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  140  VGIVTIIKAFYHRNISFLAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  195


 Score =   176 bits (447),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 121/169 (72%), Gaps = 2/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE + +   M+R +FFL+ +  SF +Y +PGYLF  LT  SW+CW + +S
Sbjct  193   LVQVSLFRALHEKDDRR--MSRAKFFLIALVCSFCWYLVPGYLFSTLTSISWICWAFSKS  250

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS   GLG+G  TLDW+ ++++  SPL+ P+ AI+NV  G+++ IY+++P+ YW
Sbjct  251   VTAQQIGSGMRGLGLGAITLDWSAVASFLFSPLICPFFAIVNVFAGYMLIIYMVIPIAYW  310

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              ++ + A+KFPIFS+ LFT+ G KYD   ++  +F+L++  YE   +++
Sbjct  311   GFDLYGAKKFPIFSSHLFTAQGQKYDISAIVNDKFELDIGKYEEQGRIH  359



>ref|XP_009391956.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009391957.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009391958.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009391959.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
Length=761

 Score =   202 bits (515),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 126/174 (72%), Gaps = 4/174 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+E+VAL VP  DDP  PVLTFR W LG  SC++L FLN FF YR +PLSI++I  QI
Sbjct  48   NSPIEQVALTVPVNDDPATPVLTFRMWVLGTASCVLLAFLNQFFWYRKEPLSITSISAQI  107

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA+T+ +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  108  AVVPLGHLMASTITDRVFFRGSRWEFTLNPGPFNMKEHVLITIFANS----GAGSVYAIH  163

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             ++ ++ +Y++ ++F   L++V+TTQ++G+GWAG+ RRYLV+P  MWWP  L++
Sbjct  164  IVSAVRIFYQKHITFFVSLLVVITTQVLGFGWAGMFRRYLVEPAAMWWPQNLVQ  217


 Score =   191 bits (484),  Expect(2) = 5e-100, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 117/171 (68%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E +   GMTR +FF++    SF YY LPG+LF +LT  SW+CW++P
Sbjct  214   NLVQVSLFRALHEKEGRPKGGMTRNQFFMVAFFCSFAYYVLPGHLFSVLTSLSWMCWIFP  273

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             RS+ AQQ+GS  HGLG+G   LDWA IS+Y  SPL SPW A  NVA GF + +Y+I P  
Sbjct  274   RSVLAQQLGSGLHGLGIGAIGLDWATISSYLSSPLASPWFATANVAAGFALIMYVITPAA  333

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW  N ++A+ FPIFS+ LFTSTG  Y+   ++ P F L++  YE    LY
Sbjct  334   YW-LNLYNAKTFPIFSDGLFTSTGQSYNISGIIDPNFHLDIKTYEKNGPLY  383



>gb|KJB32170.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=754

 Score =   228 bits (580),  Expect(2) = 6e-100, Method: Compositional matrix adjust.
 Identities = 106/191 (55%), Positives = 142/191 (74%), Gaps = 3/191 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGR-CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            N A  GE  A       P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF 
Sbjct  19   NHAIKGENAAADDDELSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCALLSFLNQFFA  78

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITV  421
            YRT+PL I+ I +Q++ LPIG+FMAA LP R+F     G   F+LNPGPFN+KEHV+I++
Sbjct  79   YRTEPLIITQITVQVATLPIGQFMAAVLPRRQFKLPGVGSRKFSLNPGPFNMKEHVLISI  138

Query  422  MANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDP  601
             AN G + G G AY++G +TI+KA+Y++ +SFL G ++++TTQ++GYGWAG+LR+Y+V+P
Sbjct  139  FANAGSAFGSGSAYAVGIVTIIKAFYQRKISFLAGWLLIITTQVLGYGWAGLLRKYVVEP  198

Query  602  VDMWWPSTLLK  634
              MWWPSTL++
Sbjct  199  AHMWWPSTLVQ  209


 Score =   165 bits (418),  Expect(2) = 6e-100, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 124/169 (73%), Gaps = 1/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             L QVSLFRALHE + K+   MTR +FFL+++  SFV+Y +PGYLF  LT  SW+CW++ +
Sbjct  207   LVQVSLFRALHEKDDKNDRRMTRAKFFLIILICSFVWYLVPGYLFTTLTSISWICWIFSK  266

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G FTLDW+ ++++  SPL+SP+ AI NV VG+V+ IYI +P+ Y
Sbjct  267   SVTAQQIGSGLRGLGLGAFTLDWSAVASFLFSPLISPFFAIANVFVGYVLIIYIAIPVAY  326

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W  + ++A +FPIFS+ LFT+ G KY+   ++  +F++++  YE   ++
Sbjct  327   WGLDLYNASRFPIFSSHLFTAQGQKYNITAIVNDKFEIDLAKYEEQGRI  375



>emb|CDP01884.1| unnamed protein product [Coffea canephora]
Length=762

 Score =   206 bits (525),  Expect(2) = 6e-100, Method: Compositional matrix adjust.
 Identities = 98/186 (53%), Positives = 133/186 (72%), Gaps = 5/186 (3%)
 Frame = +2

Query  80   TAGEKTAPSGGR-CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  256
            T+     P G    PVE+VAL VP TDD TLPV+TFR W LG  +CI+L FLN FF +R 
Sbjct  31   TSSPSCEPFGDENSPVEQVALTVPVTDDRTLPVVTFRMWVLGALACIVLSFLNQFFWFRR  90

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCG  436
            +PLSIS+I  QI+V+P+G  MA+ L  R F    +W FTLNPGPFN+KEHV+IT+ AN G
Sbjct  91   EPLSISSISAQIAVVPLGHLMASALTSRVFFKGQKWEFTLNPGPFNMKEHVLITIFANSG  150

Query  437  VSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWW  616
             +    + YSI  ++ +K +Y+Q L+F   L++V+TTQ++G+GWAG+LRRYLV+P +MWW
Sbjct  151  AA----NPYSIHIVSAVKVFYRQRLTFWVALVVVITTQVLGFGWAGILRRYLVEPAEMWW  206

Query  617  PSTLLK  634
            P  L++
Sbjct  207  PQNLVQ  212


 Score =   186 bits (473),  Expect(2) = 6e-100, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 120/171 (70%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRAL E E +  G ++R +FFL+    SF YY LPGYLFP+LT  SW+CW++P
Sbjct  209   NLVQVSLFRALDEKEQRIKGRLSRNQFFLIAFICSFAYYVLPGYLFPMLTSLSWICWIFP  268

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+ AQQ+GS  HGLG+G   LDW+ IS+Y GSPL SPW A  N+AVG+ + +Y+I P+ 
Sbjct  269   NSVLAQQLGSGLHGLGIGAIGLDWSSISSYIGSPLASPWFATANLAVGYFLMMYVITPIA  328

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW +N + A+ FPI+S+ LFTS G  Y+   ++   F +++ AYE+  +LY
Sbjct  329   YW-FNIYKAKTFPIYSDGLFTSKGQNYNISAIIDSNFHIDLTAYENEGRLY  378



>ref|XP_009413226.1| PREDICTED: oligopeptide transporter 4-like [Musa acuminata subsp. 
malaccensis]
Length=746

 Score =   205 bits (521),  Expect(2) = 6e-100, Method: Compositional matrix adjust.
 Identities = 90/174 (52%), Positives = 133/174 (76%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+V L V  TDDPTLPV TFR WFLG+ S  ++ FLN FF YR++PL I+ I +Q++ 
Sbjct  29   PIEQVRLTVRNTDDPTLPVWTFRMWFLGLASVCLMSFLNQFFSYRSEPLVITQITVQVAS  88

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LP+G F+A  LP  +F     G+  F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  89   LPLGHFLARVLPTWRFRLPGLGQREFSLNPGPFNMKEHVLISIFANAGCAFGNGSAYAVG  148

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I++A+YK+++S + G ++++TTQ++GYGWAG++RRY+V+P  MWWPSTL++
Sbjct  149  IVNIIRAFYKRSVSLIAGWLLIITTQVLGYGWAGLMRRYVVEPAHMWWPSTLVQ  202


 Score =   188 bits (477),  Expect(2) = 6e-100, Method: Compositional matrix adjust.
 Identities = 85/169 (50%), Positives = 127/169 (75%), Gaps = 1/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEV-KSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             L QVSLFRALHE E  +   ++R +FF++V+  SF +YT+PGY FP +T  SWVCW++  
Sbjct  200   LVQVSLFRALHEKEDGRIRRISRAKFFVIVLICSFCWYTVPGYFFPTITSMSWVCWLFSN  259

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQ+GS  +GL +G FTLDW+ + ++ GSPLVSP+ AI+NV +GFV+F+YI +P+ Y
Sbjct  260   SVTAQQLGSGLNGLAIGAFTLDWSTVVSFLGSPLVSPFFAIVNVFIGFVIFVYIAIPVAY  319

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W  N+FDA+ FPIFS++LF +TG KY+   ++  +F++++ AYE   ++
Sbjct  320   WGLNSFDAKTFPIFSSELFAATGRKYNITAIVNDRFEIDMAAYEKQGRI  368



>ref|XP_004238028.1| PREDICTED: oligopeptide transporter 4-like [Solanum lycopersicum]
Length=755

 Score =   220 bits (560),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 136/184 (74%), Gaps = 2/184 (1%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E+        P+EEV L VP TDDPTLPV TFR W LG+ SC++L FLN FF YR +PL 
Sbjct  17   EEEINEDELSPIEEVRLTVPNTDDPTLPVWTFRMWILGVFSCVLLSFLNQFFSYRKEPLI  76

Query  269  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            I+ I +Q++ LPIG+FMAA LP  KF    FG   F+LNPGPFN+KEHV+IT+ AN G +
Sbjct  77   ITQITVQVATLPIGRFMAAVLPTTKFRILGFGSREFSLNPGPFNMKEHVLITIFANAGFA  136

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G AY++G + I+KA+Y++ +SF    ++++TTQ++GYGWAG+LR+Y+V+P  MWWPS
Sbjct  137  FGNGSAYAVGIVNIIKAFYRRNISFAASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPS  196

Query  623  TLLK  634
            TL++
Sbjct  197  TLVQ  200


 Score =   172 bits (437),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 80/179 (45%), Positives = 123/179 (69%), Gaps = 11/179 (6%)
 Frame = +1

Query  625   LAQVSLFRALHETE-------VKSSG----MTRMRFFLLVMGASFVYYTLPGYLFPILTF  771
             L Q+SLFRALHE E       V ++G    M+R +FF++ +  SF +Y  PGYLF  L+ 
Sbjct  198   LVQISLFRALHEQEDDDDNETVNANGNKRPMSRAKFFVIALVCSFSWYIFPGYLFQALSS  257

Query  772   FSWVCWVWPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVM  951
              SWVCW +P+S+TAQQIGS  +GLGVG FTLDWA ++++  SPL+ P+ AI NV VG+ +
Sbjct  258   ISWVCWAYPKSVTAQQIGSGLNGLGVGAFTLDWATVASFLFSPLIYPFFAIANVFVGYAL  317

Query  952   FIYIIVPLCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
              +Y+++P+ YW +N ++A+KFP++S+ LFT+ G +Y+   ++  QF L+   Y+   ++
Sbjct  318   ILYVVIPISYWGFNVYNAKKFPLYSSDLFTAQGQEYNISLIVNNQFKLDQAEYDKQGRI  376



>ref|XP_004288878.1| PREDICTED: oligopeptide transporter 2-like [Fragaria vesca subsp. 
vesca]
Length=746

 Score =   216 bits (550),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 101/172 (59%), Positives = 133/172 (77%), Gaps = 1/172 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+V L V   DDP+LPV TFR W +G+ SC++L F+NTFF YRT+PL IS I +Q++ 
Sbjct  34   PIEQVRLTVSNDDDPSLPVWTFRMWSIGLLSCVLLSFVNTFFSYRTEPLVISMITIQVAS  93

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            LPIGKFMA TLP RKF   G   F+LNPG FNIKEHV+I++ AN G   G G AY+IG +
Sbjct  94   LPIGKFMARTLPTRKFR-IGSKEFSLNPGEFNIKEHVLISIFANTGAGFGSGPAYAIGIV  152

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            TI+KA+Y + +SFL   I+V+TTQ++GYGWAG+LR+Y+VDP  MWWPS+L++
Sbjct  153  TIVKAFYGRRISFLASWILVITTQVLGYGWAGILRKYVVDPATMWWPSSLVQ  204


 Score =   177 bits (448),  Expect(2) = 7e-100, Method: Compositional matrix adjust.
 Identities = 78/165 (47%), Positives = 120/165 (73%), Gaps = 2/165 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALHE +  ++ M+R +FFL+ +  SF +Y +PGYLF  +   SW+CW++P+
Sbjct  201   SLVQVSLFRALHEKD--NNRMSRGKFFLIALVCSFSFYIVPGYLFMTIGTISWICWLYPK  258

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS   GLG+G  TLDW+ I++Y GSPL+SP+ AI+N+ VGF++ +Y+++P  Y
Sbjct  259   SITAQQIGSGMRGLGIGSLTLDWSVIASYLGSPLISPFFAIVNITVGFMLIMYVVLPTAY  318

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYES  1116
             W +N ++A+ F IFS  LF   G  Y+   ++  +F++++PAY+ 
Sbjct  319   WGFNLYNAKNFAIFSKNLFDDNGQIYNVTAIVNDKFEIDMPAYKQ  363



>ref|XP_008454451.1| PREDICTED: oligopeptide transporter 4 [Cucumis melo]
Length=738

 Score =   212 bits (539),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 134/174 (77%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+V L V  +DDPTLPV TFR W LG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  23   PIEQVRLTVTNSDDPTLPVWTFRMWTLGLLSCALLSFLNQFFYYRTEPLIITQITVQVAT  82

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG+FMAA LP  +F    FG   F+LNPGPFN+KEHV+I++ AN G + GGG AY++G
Sbjct  83   LPIGQFMAAVLPATRFRLPGFGSRRFSLNPGPFNMKEHVLISIFANAGTAFGGGSAYAVG  142

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I+KA+Y + +SF+   ++++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  143  IVNIIKAFYGRNISFVAAWLLIVTTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  196


 Score =   181 bits (458),  Expect(2) = 1e-99, Method: Compositional matrix adjust.
 Identities = 83/170 (49%), Positives = 122/170 (72%), Gaps = 2/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE E     M+R +FFL+ +  SF +Y +PGYLFP LT  SWVCW +P 
Sbjct  193   TLVQVSLFRALHEKE--DCRMSRGKFFLIALICSFSWYVIPGYLFPTLTSISWVCWAFPN  250

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQ+GS   GLG+G FTLDW+ +S++  SPL+SP+ +I+N+ VG+ + IYI VP+ Y
Sbjct  251   SVTAQQLGSGMKGLGLGAFTLDWSAVSSFLFSPLISPFFSIVNIFVGYTLIIYIAVPIAY  310

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W +N ++A  FPIFS++LFT+ G  Y+   ++  +F+L++  YE + +++
Sbjct  311   WGFNLYNASTFPIFSSKLFTAQGQLYNVTAIVNDKFELDLAKYEEHGQIH  360



>ref|XP_006364982.1| PREDICTED: oligopeptide transporter 4-like [Solanum tuberosum]
Length=755

 Score =   220 bits (561),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 136/184 (74%), Gaps = 2/184 (1%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E+        P+EEV L VP TDDPTLPV TFR W LG+ SC++L FLN FF YR +PL 
Sbjct  17   EEEINEDELSPIEEVRLTVPNTDDPTLPVWTFRMWILGVFSCVLLSFLNQFFSYRKEPLI  76

Query  269  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            I+ I +Q++ LPIG+FMAA LP  KF    FG   F+LNPGPFN+KEHV+IT+ AN G +
Sbjct  77   ITQITVQVATLPIGRFMAAVLPTTKFRILGFGSREFSLNPGPFNMKEHVLITIFANAGFA  136

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G AY++G + I+KA+Y + +SF+   ++++TTQ++GYGWAG+LR+Y+V+P  MWWPS
Sbjct  137  FGNGSAYAVGIVNIIKAFYHRNISFVASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPS  196

Query  623  TLLK  634
            TL++
Sbjct  197  TLVQ  200


 Score =   171 bits (433),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 79/179 (44%), Positives = 122/179 (68%), Gaps = 11/179 (6%)
 Frame = +1

Query  625   LAQVSLFRALHETE-------VKSSG----MTRMRFFLLVMGASFVYYTLPGYLFPILTF  771
             L Q+SLFRALHE E       V ++G    M+R +FF++ +  SF +Y  PGYLF  L+ 
Sbjct  198   LVQISLFRALHEKEDDDDNEIVNANGNKRPMSRAKFFVIALVCSFSWYIFPGYLFQTLSS  257

Query  772   FSWVCWVWPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVM  951
              SWVCW +P+S+TAQQIGS  +GLG+G FTLDWA ++++  SPL+ P+ AI NV VG+ +
Sbjct  258   ISWVCWAYPKSVTAQQIGSGLNGLGIGAFTLDWATVASFLFSPLIYPFFAIANVFVGYAL  317

Query  952   FIYIIVPLCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
              +Y+++P+ YW +N ++A+KFP++S+ LFT+ G  Y+   ++  QF L+   Y+   ++
Sbjct  318   ILYVVIPISYWGFNVYNAKKFPLYSSDLFTAQGQVYNISLIVNNQFKLDEAEYDKQGRI  376



>ref|XP_011078828.1| PREDICTED: oligopeptide transporter 7-like isoform X1 [Sesamum 
indicum]
Length=751

 Score =   207 bits (527),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 128/188 (68%), Gaps = 4/188 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             P  +   T+      PVE+VAL VP TDDPTLPV+TFR W LG  +C++L FLN FF Y
Sbjct  23   QPQASAASTSEEEENSPVEQVALTVPPTDDPTLPVVTFRMWTLGAAACVMLSFLNQFFWY  82

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            R +PLSI+AI  QI+V+P+G  MAA LP R F    +W F+ NPG FN+KEHV+IT+ AN
Sbjct  83   RREPLSITAISAQIAVVPLGHLMAAALPRRVFFEGQKWEFSFNPGKFNVKEHVLITIFAN  142

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
                 G  + YSI  ++ +K +Y Q L+F   L +VLTTQ++G+GWAG+ RRYLV+P  M
Sbjct  143  A----GAANPYSIHIVSAVKIFYGQKLTFWVALGVVLTTQVLGFGWAGLFRRYLVEPASM  198

Query  611  WWPSTLLK  634
            WWP  L++
Sbjct  199  WWPQNLVQ  206


 Score =   184 bits (466),  Expect(2) = 2e-99, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 118/171 (69%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE EV+  G +TR +FFL+    SF YY  PGYLFP LT  SW+CW++ 
Sbjct  203   NLVQVSLFRALHEKEVRDRGALTRNQFFLIAFLCSFAYYVFPGYLFPKLTSVSWLCWIFS  262

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+  QQ+GS  HGLG+G   LDW+ IS+Y GSPL SPW A  N+AVG+ + +Y + P+ 
Sbjct  263   SSVLFQQLGSGLHGLGIGAIGLDWSSISSYLGSPLASPWFATANIAVGYFICMYAVTPIM  322

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW  N ++A+ FPIFS+ L+TS G KY+   ++ P F +++ +YE   +LY
Sbjct  323   YW-LNVYNAKTFPIFSDGLYTSEGQKYNISAIVDPNFHIDLQSYEREGRLY  372



>ref|XP_011078837.1| PREDICTED: oligopeptide transporter 7-like isoform X2 [Sesamum 
indicum]
Length=744

 Score =   207 bits (528),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 99/199 (50%), Positives = 132/199 (66%), Gaps = 4/199 (2%)
 Frame = +2

Query  38   SEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCI  217
             E I   +    P  +   T+      PVE+VAL VP TDDPTLPV+TFR W LG  +C+
Sbjct  5    EEEISAPLIIHQPQASAASTSEEEENSPVEQVALTVPPTDDPTLPVVTFRMWTLGAAACV  64

Query  218  ILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNI  397
            +L FLN FF YR +PLSI+AI  QI+V+P+G  MAA LP R F    +W F+ NPG FN+
Sbjct  65   MLSFLNQFFWYRREPLSITAISAQIAVVPLGHLMAAALPRRVFFEGQKWEFSFNPGKFNV  124

Query  398  KEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGV  577
            KEHV+IT+ AN G +    + YSI  ++ +K +Y Q L+F   L +VLTTQ++G+GWAG+
Sbjct  125  KEHVLITIFANAGAA----NPYSIHIVSAVKIFYGQKLTFWVALGVVLTTQVLGFGWAGL  180

Query  578  LRRYLVDPVDMWWPSTLLK  634
             RRYLV+P  MWWP  L++
Sbjct  181  FRRYLVEPASMWWPQNLVQ  199


 Score =   184 bits (466),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 118/171 (69%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE EV+  G +TR +FFL+    SF YY  PGYLFP LT  SW+CW++ 
Sbjct  196   NLVQVSLFRALHEKEVRDRGALTRNQFFLIAFLCSFAYYVFPGYLFPKLTSVSWLCWIFS  255

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+  QQ+GS  HGLG+G   LDW+ IS+Y GSPL SPW A  N+AVG+ + +Y + P+ 
Sbjct  256   SSVLFQQLGSGLHGLGIGAIGLDWSSISSYLGSPLASPWFATANIAVGYFICMYAVTPIM  315

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW  N ++A+ FPIFS+ L+TS G KY+   ++ P F +++ +YE   +LY
Sbjct  316   YW-LNVYNAKTFPIFSDGLYTSEGQKYNISAIVDPNFHIDLQSYEREGRLY  365



>gb|KFK28135.1| hypothetical protein AALP_AA8G476800 [Arabis alpina]
Length=990

 Score =   210 bits (535),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 133/174 (76%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDD TLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  14   PIEEVRLTVTNTDDHTLPVWTFRMWFLGLISCSLLSFLNQFFSYRTEPLVITQITVQVAT  73

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG F+A  LP+ +F     G   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  74   LPIGHFLAKVLPKNQFGLPGCGSTRFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +TI+KA+Y + +SF+ G ++++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  134  IVTIIKAFYGRNISFVAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  187


 Score =   181 bits (458),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 123/168 (73%), Gaps = 2/168 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE + +   MTR +FF++ +  SF +Y +PGYLF  LT  SW+CW +P+ 
Sbjct  185   LVQVSLFRALHEKDEQR--MTRAKFFVIALVCSFGWYIVPGYLFTTLTSISWICWAFPKL  242

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS   GLG+G FTLDW  ++++  SPL+SP+ AI NV +G+V+ IY+++P+ YW
Sbjct  243   VTAQQIGSGMRGLGLGAFTLDWTAVASFLFSPLISPFFAIANVFIGYVLLIYMVLPVAYW  302

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
              +++++A++FPIFS+ LFTS G KYD   ++  +F+L++  Y+   ++
Sbjct  303   GFDSYNAQRFPIFSSHLFTSVGQKYDIPAIVNDKFELDIAKYDQQGRI  350



>ref|XP_003564333.1| PREDICTED: oligopeptide transporter 7-like [Brachypodium distachyon]
Length=772

 Score =   207 bits (527),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 130/188 (69%), Gaps = 4/188 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             P  + +    S    P+E+VAL VP  DDPT PVLTFR W LG  SC++L FLN FF Y
Sbjct  43   KPPPSPQGLGASEENSPIEQVALTVPVGDDPTTPVLTFRMWVLGTASCVVLSFLNQFFWY  102

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            R +PL+I+AI  QI+V+P+G+ MAA LP R F     + FTLNPGPFN+KEHV+IT+ AN
Sbjct  103  RKEPLTITAISAQIAVVPMGRLMAALLPSRPFFSGTSYEFTLNPGPFNVKEHVLITIFAN  162

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
                 G G  Y+I  +T ++ +Y + L+F   LI+VLTTQ++G+GWAG+ RRYLV+P  M
Sbjct  163  A----GAGSVYAIHVVTAVRVFYGKELTFFVSLIVVLTTQVLGFGWAGIFRRYLVEPAAM  218

Query  611  WWPSTLLK  634
            WWP+ L++
Sbjct  219  WWPTNLVQ  226


 Score =   184 bits (466),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 115/171 (67%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETE-VKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E +   G+TR +FF++    SF YY  PGYLF +LT  SW+CW++P
Sbjct  223   NLVQVSLFRALHEKEKLSKGGLTRSQFFVVAFVCSFAYYVFPGYLFQMLTSLSWICWLYP  282

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+ AQQ+GS   GLG+G   LDWA +S+Y GSPL SPW A  N+AVGF+  +Y+  P+ 
Sbjct  283   NSVFAQQLGSGLKGLGIGTIGLDWASVSSYLGSPLASPWFATANIAVGFLTIMYVFTPIA  342

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW +N + AR FPIFS+ LFT +GHKY+   ++   F  +  AYE    LY
Sbjct  343   YW-FNFYKARNFPIFSSGLFTESGHKYNITTIVDEHFHFDTEAYEKNGPLY  392



>ref|XP_010934487.1| PREDICTED: oligopeptide transporter 7 [Elaeis guineensis]
Length=765

 Score =   202 bits (515),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 126/174 (72%), Gaps = 4/174 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+E+VAL VP  DDP++PVLTFR W LG  SC +L FLN FF YR +PLSI++I  QI
Sbjct  51   NSPIEQVALTVPVGDDPSVPVLTFRMWVLGTVSCALLSFLNQFFWYRKEPLSITSISAQI  110

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA T+ +R F    RW FTLNPGPFN+KEHV+IT+ AN     G G  Y+I 
Sbjct  111  AVVPLGHLMARTITDRVFFKGRRWEFTLNPGPFNMKEHVLITIFANS----GAGSVYAIH  166

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +T +K +Y+Q ++F   L++VLTTQ++G+GWAG+ R++LV+P  MWWP  L++
Sbjct  167  VVTAVKIFYRQHITFFVSLLVVLTTQVLGFGWAGIFRQHLVEPAAMWWPYNLVQ  220


 Score =   188 bits (478),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 118/172 (69%), Gaps = 2/172 (1%)
 Frame = +1

Query  619   FNLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  795
             +NL QVSLFRALHE EV+   G+TR +FF++    SF YY  PGYLF +LT  SW+CW++
Sbjct  216   YNLVQVSLFRALHEKEVRPKHGLTRNQFFMVAFVCSFAYYVFPGYLFSMLTSLSWICWIF  275

Query  796   PRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPL  975
             P S+ AQQ+GS  +GLG+G   LDW+ IS+Y GSPL SPW A  NVA GFV+ +Y+I P 
Sbjct  276   PGSVLAQQLGSGLYGLGIGAIGLDWSTISSYLGSPLASPWFATANVAAGFVIIMYVITPT  335

Query  976   CYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              YW  N + A+ FPIFS+ LFTSTG  Y+   ++   F L+V AYE    LY
Sbjct  336   AYW-LNLYKAKTFPIFSDGLFTSTGQSYNISSIIDSDFHLDVEAYEKEGPLY  386



>ref|XP_010065750.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
 gb|KCW63397.1| hypothetical protein EUGRSUZ_G01043 [Eucalyptus grandis]
Length=752

 Score =   217 bits (553),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 137/190 (72%), Gaps = 2/190 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             PA   +         P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  21   KPAAPNDVDDAEDDLSPIEEVRLTVTNTDDPTLPVWTFRMWFLGVLSCALLSFLNQFFAY  80

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q++ LPIG+FMAA LP  KF     G  +F+LNPGPFN+KEHV+I++ 
Sbjct  81   RTEPLVITQITVQVATLPIGRFMAAVLPTAKFRIPGLGPRTFSLNPGPFNMKEHVLISIF  140

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY++  + I+KA+Y +++SF  G ++++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  141  ANAGSAFGSGSAYAVSIVNIIKAFYVRSISFFAGWLLIITTQVLGYGWAGLLRKYVVEPA  200

Query  605  DMWWPSTLLK  634
             MWWPSTL++
Sbjct  201  HMWWPSTLVQ  210


 Score =   173 bits (439),  Expect(2) = 3e-99, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 117/169 (69%), Gaps = 2/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE + +   M+R +FF++ +  SF +Y +PGYLFP LT  SWVCW++ +S
Sbjct  208   LVQVSLFRALHEKDDQR--MSRAKFFVIALTCSFSWYVVPGYLFPTLTSISWVCWIFSKS  265

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS   GLG+G  TLDW  ++++  SPL+ P+ AI+N+ VG+ + +Y+ +PL YW
Sbjct  266   VTAQQIGSGMKGLGLGATTLDWTVVASFLFSPLICPFFAIMNIFVGYALVVYVAIPLAYW  325

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              +N + A +FPIFS+ LFT  G  Y+   ++   F+L+V  YE   ++Y
Sbjct  326   GFNWYGADRFPIFSSHLFTKQGQTYNITAIVNSNFELDVAKYEEQGRIY  374



>gb|KFK29294.1| hypothetical protein AALP_AA7G114600 [Arabis alpina]
Length=735

 Score =   204 bits (519),  Expect(2) = 4e-99, Method: Compositional matrix adjust.
 Identities = 99/186 (53%), Positives = 131/186 (70%), Gaps = 6/186 (3%)
 Frame = +2

Query  83   AGEKTA--PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  256
            A E TA      RC V EV L VP+TDDPTLPVLTFR W LGI +CI+L F+N FF YRT
Sbjct  5    AAEFTAAMEDDDRCVVPEVELTVPKTDDPTLPVLTFRMWVLGIGACIVLSFINQFFWYRT  64

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCG  436
             PLSI+ I  QI+V+P+G  MA  LP R+F    R  FTLNPG FN+KEHV+IT+ AN  
Sbjct  65   MPLSITGISAQIAVVPLGHLMARVLPTRRFCQGTRLEFTLNPGDFNVKEHVLITIFANS-  123

Query  437  VSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWW  616
               G G  Y+   ++ +K YYK++L FL   ++++TTQ++G+GWAG+ R++LV+P +MWW
Sbjct  124  ---GAGSVYATHILSAIKLYYKRSLPFLPAFLVMITTQILGFGWAGLFRKHLVEPGEMWW  180

Query  617  PSTLLK  634
            PS L++
Sbjct  181  PSNLVQ  186


 Score =   186 bits (472),  Expect(2) = 4e-99, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 116/165 (70%), Gaps = 2/165 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLF ALHE E KS G M+R +FFL+V+ ASF YY LPGYLF +LT  SWVCW+ P
Sbjct  183   NLVQVSLFGALHEREKKSKGDMSRTQFFLIVLVASFAYYILPGYLFTMLTSISWVCWLNP  242

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +SI   Q+GS  HGLG+G    DW  ISAY GSPL SP  A +NVA+GFV+ +YI+ P+C
Sbjct  243   KSILVNQLGSGEHGLGIGSIGFDWVTISAYLGSPLASPLFASINVAIGFVLVMYIVTPIC  302

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYE  1113
             YW  N ++A+ FPIFS+QLF + G +YD   ++  +F L+   Y 
Sbjct  303   YW-LNIYEAKTFPIFSSQLFMANGSRYDVLSIIDSKFHLDRVVYS  346



>ref|XP_004953567.1| PREDICTED: oligopeptide transporter 4-like isoform X1 [Setaria 
italica]
Length=797

 Score =   207 bits (528),  Expect(2) = 4e-99, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 137/188 (73%), Gaps = 11/188 (6%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
            GE+   S    PVE+V L VP TDDP+LPV TFR W +G+ SC ++ FLN FF+YRT+PL
Sbjct  24   GEEEESS----PVEQVRLTVPSTDDPSLPVWTFRMWSIGLLSCALMSFLNQFFVYRTEPL  79

Query  266  SISAILMQISVLPIGKFMAATLPE-RKFAPF----GRWSFTLNPGPFNIKEHVIITVMAN  430
             ++ I +Q++ LP+G FMA  LP  R  AP     G WS  LNPGPFN+KEHV+I++ AN
Sbjct  80   VVTQITVQVASLPVGHFMARVLPRTRHRAPKLLGGGEWS--LNPGPFNMKEHVLISIFAN  137

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
             G + GGG AY++G I I++A+Y + +SF    ++V+TTQ++GYGWAG++R+Y+V+P  M
Sbjct  138  AGFAFGGGSAYAVGIIDIIRAFYHRHISFFTAWLLVITTQVLGYGWAGLMRKYVVEPAHM  197

Query  611  WWPSTLLK  634
            WWPSTL++
Sbjct  198  WWPSTLVQ  205


 Score =   182 bits (463),  Expect(2) = 4e-99, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 122/172 (71%), Gaps = 3/172 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG---MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  792
              L QVSLFRALHE +  S G   ++R +FFL+ +  SF +Y +PGYLFP LT  SWVCWV
Sbjct  202   TLVQVSLFRALHEKDEASKGSRQISRSKFFLVALACSFAWYAVPGYLFPALTSISWVCWV  261

Query  793   WPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVP  972
             + +S+TAQQ+GS   GLG+G FTLDW+ +S++  SPL+SP+ A +N+  G+V F+Y+I+P
Sbjct  262   FSKSVTAQQLGSGMKGLGLGAFTLDWSTVSSFLFSPLISPFFATVNIFFGYVFFVYLIMP  321

Query  973   LCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             + YW +N ++A+ FPIFS+ LF S G KYD   ++  QF+L+  AY    ++
Sbjct  322   IAYWGFNLYNAKTFPIFSSHLFMSNGTKYDIPSIVNSQFELDKDAYNQRGRV  373



>ref|XP_004953566.1| PREDICTED: oligopeptide transporter 4-like [Setaria italica]
Length=762

 Score =   203 bits (516),  Expect(2) = 5e-99, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 132/177 (75%), Gaps = 7/177 (4%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+V L VP TDDP+LPV TFR W +GI SC ++ FLN FF YR +PL ++ I +Q++ 
Sbjct  39   PIEQVRLTVPSTDDPSLPVWTFRMWSIGILSCALMSFLNQFFSYRAEPLIVTQITVQVAS  98

Query  299  LPIGKFMAATLPERKF-APF----GRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAY  463
            LP+G FMA  LP  +F AP     G WS  LNPGPFN+KEHV+I++ AN G + G G+AY
Sbjct  99   LPVGHFMARVLPRARFRAPRVLGGGEWS--LNPGPFNMKEHVLISIFANAGFAFGAGNAY  156

Query  464  SIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            ++G + I++A+Y + +SF  G ++V+TTQ++GYGWAG++R+Y+V+P  MWWP TL++
Sbjct  157  AVGIVNIIRAFYHRHISFFTGWLLVITTQVLGYGWAGLMRKYVVEPAHMWWPGTLVQ  213


 Score =   187 bits (474),  Expect(2) = 5e-99, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 119/171 (70%), Gaps = 3/171 (2%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSG---MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  795
             L QVSLFRALHE E    G   +TR +FF + +  SF +Y +PGYLFP+LT  SWVCWV+
Sbjct  211   LVQVSLFRALHEKEEFPKGSRQITRSKFFAVALACSFAWYAVPGYLFPLLTSISWVCWVF  270

Query  796   PRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPL  975
             P+S+TAQQ+GS   GLG+G FTLDWA +SAY  SPL+SP+ A +N+  G+V+F+Y+I+P 
Sbjct  271   PKSVTAQQLGSGMLGLGIGAFTLDWATVSAYLFSPLISPFFATVNIFFGYVLFVYVIIPT  330

Query  976   CYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
              YW +N ++A+ FPIFSN LF S G  YD   ++  QF +N   Y    K+
Sbjct  331   AYWGFNLYNAKTFPIFSNDLFVSNGTSYDITSIVNDQFVINKDEYNKLGKV  381



>ref|XP_004953568.1| PREDICTED: oligopeptide transporter 4-like isoform X2 [Setaria 
italica]
Length=754

 Score =   207 bits (528),  Expect(2) = 5e-99, Method: Compositional matrix adjust.
 Identities = 98/188 (52%), Positives = 137/188 (73%), Gaps = 11/188 (6%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
            GE+   S    PVE+V L VP TDDP+LPV TFR W +G+ SC ++ FLN FF+YRT+PL
Sbjct  24   GEEEESS----PVEQVRLTVPSTDDPSLPVWTFRMWSIGLLSCALMSFLNQFFVYRTEPL  79

Query  266  SISAILMQISVLPIGKFMAATLPE-RKFAPF----GRWSFTLNPGPFNIKEHVIITVMAN  430
             ++ I +Q++ LP+G FMA  LP  R  AP     G WS  LNPGPFN+KEHV+I++ AN
Sbjct  80   VVTQITVQVASLPVGHFMARVLPRTRHRAPKLLGGGEWS--LNPGPFNMKEHVLISIFAN  137

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
             G + GGG AY++G I I++A+Y + +SF    ++V+TTQ++GYGWAG++R+Y+V+P  M
Sbjct  138  AGFAFGGGSAYAVGIIDIIRAFYHRHISFFTAWLLVITTQVLGYGWAGLMRKYVVEPAHM  197

Query  611  WWPSTLLK  634
            WWPSTL++
Sbjct  198  WWPSTLVQ  205


 Score =   182 bits (463),  Expect(2) = 5e-99, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 122/172 (71%), Gaps = 3/172 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG---MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  792
              L QVSLFRALHE +  S G   ++R +FFL+ +  SF +Y +PGYLFP LT  SWVCWV
Sbjct  202   TLVQVSLFRALHEKDEASKGSRQISRSKFFLVALACSFAWYAVPGYLFPALTSISWVCWV  261

Query  793   WPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVP  972
             + +S+TAQQ+GS   GLG+G FTLDW+ +S++  SPL+SP+ A +N+  G+V F+Y+I+P
Sbjct  262   FSKSVTAQQLGSGMKGLGLGAFTLDWSTVSSFLFSPLISPFFATVNIFFGYVFFVYLIMP  321

Query  973   LCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             + YW +N ++A+ FPIFS+ LF S G KYD   ++  QF+L+  AY    ++
Sbjct  322   IAYWGFNLYNAKTFPIFSSHLFMSNGTKYDIPSIVNSQFELDKDAYNQRGRV  373



>ref|XP_004231372.1| PREDICTED: oligopeptide transporter 4 [Solanum lycopersicum]
Length=735

 Score =   217 bits (552),  Expect(2) = 5e-99, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 136/179 (76%), Gaps = 2/179 (1%)
 Frame = +2

Query  104  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  283
            S    P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I 
Sbjct  15   SDDVSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLFSCCLLSFLNQFFSYRTEPLVITQIT  74

Query  284  MQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGD  457
            +Q++ LPIG F+A  LP  KF    FG   F+LNPGPFN+KEHV+I++ AN G + G G 
Sbjct  75   VQVATLPIGHFLATILPATKFRLPGFGPRLFSLNPGPFNMKEHVLISIFANAGSAFGNGS  134

Query  458  AYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            AY++G +TI+KA+Y++ +SFL G I+++TTQ++GYGWAG+LR+Y+V+P  MWWP+TL++
Sbjct  135  AYAVGIVTIIKAFYRRNISFLAGWILIITTQVLGYGWAGLLRKYVVEPAHMWWPATLVQ  193


 Score =   173 bits (438),  Expect(2) = 5e-99, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 119/169 (70%), Gaps = 2/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE + +    +R +FFL+ +  SF +Y +PGYLF  LT  SW+CW + +S
Sbjct  191   LVQVSLFRALHEKDDRRP--SRAKFFLIALICSFCWYLVPGYLFSTLTSISWICWAFSKS  248

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS   GLG+G  TLDW+ ++++  SPL+ P+ AI+N+  G+++ IY+++P+ YW
Sbjct  249   VTAQQIGSGMRGLGLGAVTLDWSAVASFLFSPLICPFFAIVNIFAGYMLIIYMVIPIAYW  308

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              ++ + A KFPIFS+ LFTS G KYD   ++  +F+L++  YE   +++
Sbjct  309   GFDLYGASKFPIFSSHLFTSQGQKYDISAIVNDKFELDIGKYEEQGRIH  357



>ref|XP_011078507.1| PREDICTED: oligopeptide transporter 4-like [Sesamum indicum]
Length=754

 Score =   224 bits (570),  Expect(2) = 6e-99, Method: Compositional matrix adjust.
 Identities = 105/190 (55%), Positives = 142/190 (75%), Gaps = 7/190 (4%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             PA   E+        PVE+V L VP  DDPTLPV TFR WFLG+ SC++L FLNTFF Y
Sbjct  28   EPAVDDEEEV-----SPVEQVRLTVPNEDDPTLPVWTFRMWFLGLFSCMLLSFLNTFFSY  82

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            R++PL I+ I +Q++ LPIG+FMA  LP  KF    FG   F+LNPGPFN+KEHV+I++ 
Sbjct  83   RSEPLIITMISVQVATLPIGRFMANVLPTTKFRLPGFGSREFSLNPGPFNMKEHVLISIF  142

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + GGG AY++G + I+KA+YK+ +SFL   I+V+TTQ++GYGWAG+LR+Y+V+P 
Sbjct  143  ANAGSAFGGGSAYAVGIVDIIKAFYKRNISFLASWILVITTQVLGYGWAGILRKYVVEPA  202

Query  605  DMWWPSTLLK  634
            +MWWPS+L++
Sbjct  203  EMWWPSSLVQ  212


 Score =   166 bits (420),  Expect(2) = 6e-99, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 118/169 (70%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALHE +  S   +R RFFL+ +  SF++Y +PGYLF  L+  S +C ++P+
Sbjct  209   SLVQVSLFRALHERD--SGKHSRARFFLIALACSFLWYIVPGYLFSTLSNLSLLCLIFPK  266

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+   T DW+ ++++ GSPL++P+ AI+NV VG+   +Y+++P+ Y
Sbjct  267   SVTAQQIGSGMRGLGIASLTFDWSVVASFLGSPLITPFFAIVNVFVGYFAVVYVMIPIAY  326

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W  + + A+ FPIFS+ LFT  G  Y+   ++  +F++++PAYE   ++
Sbjct  327   WGLDVYHAKTFPIFSSHLFTRNGQIYNVSAIVNDKFEIDLPAYEQQGRI  375



>ref|XP_009143920.1| PREDICTED: oligopeptide transporter 6 [Brassica rapa]
Length=735

 Score =   203 bits (517),  Expect(2) = 6e-99, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 128/174 (74%), Gaps = 4/174 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC V EV L VP+TDDP+LPVLTFR W LGI +CI+L F+N FF YRT PLSI+ I  QI
Sbjct  17   RCVVPEVELTVPKTDDPSLPVLTFRMWVLGIGACIVLSFINQFFWYRTMPLSITGISAQI  76

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA  LP R+F    R+ FTLNPG FN+KEHV+IT+ AN     G G  Y+  
Sbjct  77   AVVPLGHLMARVLPTRRFLEGTRFQFTLNPGAFNVKEHVLITIFANS----GAGSVYATH  132

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             ++ +K YYK++L FL   ++++TTQ++G+GWAG+ R++LV+P +MWWPS L++
Sbjct  133  ILSAIKLYYKRSLPFLPAFLVMITTQILGFGWAGLFRKHLVEPGEMWWPSNLVQ  186


 Score =   186 bits (473),  Expect(2) = 6e-99, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 116/166 (70%), Gaps = 2/166 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLF ALHE E KS G M+R +FFL+V+ ASF YY LPGYLF +LT  SWVCW  P
Sbjct  183   NLVQVSLFGALHEKEKKSKGHMSRTQFFLIVLVASFAYYILPGYLFTMLTSISWVCWFNP  242

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +SI   Q+GS  HGLGVG    DW  ISAY GSPL SP  A +NVA+GFV+ +YI+ P+C
Sbjct  243   KSILVNQLGSGEHGLGVGSIGFDWVTISAYLGSPLASPLFASVNVAIGFVLVMYIVTPIC  302

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYES  1116
             YW  N ++A+ FPIFS+QLF + G +YD   ++  +F L+   Y +
Sbjct  303   YW-LNIYEAKTFPIFSSQLFMANGSRYDVLSIIDSKFHLDRAVYSN  347



>ref|XP_006417516.1| hypothetical protein EUTSA_v10009349mg [Eutrema salsugineum]
 gb|ESQ35869.1| hypothetical protein EUTSA_v10009349mg [Eutrema salsugineum]
Length=731

 Score =   218 bits (554),  Expect(2) = 6e-99, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 130/174 (75%), Gaps = 1/174 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVEEV L V   DDP+LPV TFR WFLG+ SC++L FLNTFF YRTQPL IS I +Q+
Sbjct  16   ESPVEEVRLTVSNDDDPSLPVWTFRMWFLGLISCVMLSFLNTFFGYRTQPLMISMISVQV  75

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
              LPIGK MA  LPE K+   G W F+ NPGPFN+KEHV+I++ AN G   G G AY++G
Sbjct  76   VTLPIGKLMARVLPETKYR-IGSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAYAVG  134

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +VDP  MWWP+++L+
Sbjct  135  IVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQ  188


 Score =   172 bits (435),  Expect(2) = 6e-99, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 117/167 (70%), Gaps = 2/167 (1%)
 Frame = +1

Query  631   QVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRSIT  810
             QVSLFRALHE +  ++ M+R +FF++    SF +Y  P YLF  L+  SWVCW +P+SIT
Sbjct  188   QVSLFRALHEKD--NARMSRGKFFVIAFVCSFAWYIFPAYLFLTLSSISWVCWAFPKSIT  245

Query  811   AQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYWKY  990
             AQQIGS   GLG+G   LDW+ I++Y GSPLV+P+ AI+NV VG+V+ +Y+++P+ YW  
Sbjct  246   AQQIGSGMSGLGIGSLALDWSVIASYLGSPLVTPFFAIVNVIVGYVLIMYMVIPISYWGM  305

Query  991   NTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             N ++A KFPIFS+ LF S G  Y+   ++  +F+L+   Y+   ++Y
Sbjct  306   NVYEANKFPIFSSDLFDSRGQLYNISTIVNDKFELDEGMYQREGRVY  352



>ref|XP_002892535.1| ATOPT2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68794.1| ATOPT2 [Arabidopsis lyrata subsp. lyrata]
Length=734

 Score =   216 bits (551),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 130/174 (75%), Gaps = 1/174 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVEEV L V   DDP+LPV TFR WFLG+ SCI+L FLNTFF YRTQPL I+ I +Q+
Sbjct  19   ESPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCILLSFLNTFFGYRTQPLMITMISVQV  78

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
              LP+GK MA  LPE K+   G W F+ NPGPFN+KEHV+I++ AN G   G G AY++G
Sbjct  79   VTLPLGKLMARVLPETKYK-IGSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAYAVG  137

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +VDP  MWWP+++L+
Sbjct  138  IVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQ  191


 Score =   172 bits (437),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 118/167 (71%), Gaps = 2/167 (1%)
 Frame = +1

Query  631   QVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRSIT  810
             QVSLFRALHE +   + M+R +FF++    SF +Y  P YLF  L+  SWVCW +P+SIT
Sbjct  191   QVSLFRALHEKD--HARMSRGKFFVIAFVCSFAWYIFPAYLFLTLSSISWVCWAFPKSIT  248

Query  811   AQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYWKY  990
             AQQ+GS   GLG+G F LDW+ I++Y GSPLV+P+ AI+NV VG+V+ +Y+++P+ YW  
Sbjct  249   AQQLGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAIVNVLVGYVLVMYMVIPISYWGM  308

Query  991   NTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             N ++A KFPIFS+ LF   G  Y+   ++  +F+L++ +Y+   ++Y
Sbjct  309   NVYEAHKFPIFSSDLFDKQGQLYNISTIVNNKFELDMESYQQEGRVY  355



>ref|XP_009615073.1| PREDICTED: oligopeptide transporter 4-like [Nicotiana tomentosiformis]
Length=753

 Score =   216 bits (551),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 135/184 (73%), Gaps = 2/184 (1%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E+         +EEV L VP TDDPTLPV TFR W LG+ SCI+L FLN FF YR +PL 
Sbjct  15   EEDVNEDELSSIEEVRLTVPNTDDPTLPVWTFRMWILGLLSCILLSFLNQFFSYRKEPLI  74

Query  269  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            I+ I +Q++ LPIG+FMAA LP  KF    FG   F+LNPGPFN+KEHV+IT+ AN G +
Sbjct  75   ITQITVQVATLPIGRFMAAVLPTTKFRILGFGSKEFSLNPGPFNMKEHVLITIFANAGSA  134

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G AY++G + I+KA+Y +++SF    ++++TTQ++GYGWAG+LR+Y+V+P  MWWPS
Sbjct  135  FGNGSAYAVGIVNIIKAFYGRSISFGASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPS  194

Query  623  TLLK  634
            TL++
Sbjct  195  TLVQ  198


 Score =   172 bits (436),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 77/179 (43%), Positives = 119/179 (66%), Gaps = 11/179 (6%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSG-----------MTRMRFFLLVMGASFVYYTLPGYLFPILTF  771
             L Q+SLFRALHE E +              M+R +FF++ +  SF +Y  PGY F  L+ 
Sbjct  196   LVQISLFRALHEKEDEDDNEIVNGKGNKRPMSRAKFFVIALVCSFSWYLFPGYFFQALSS  255

Query  772   FSWVCWVWPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVM  951
              SWVCW +P S+TAQQIGS  +GLGVG FTLDWA ++++  SPL+ P+ AI NV VG+ +
Sbjct  256   ISWVCWAYPNSVTAQQIGSGLNGLGVGAFTLDWATVASFLFSPLICPFFAIANVFVGYAL  315

Query  952   FIYIIVPLCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
              +Y+++P+ YW +N ++A+ FP++S+ LFT+ G +Y+   ++  QF+L++  YE   ++
Sbjct  316   IMYVVIPISYWGFNVYNAKNFPLYSSDLFTAQGQEYNISLIVNKQFNLDLAEYEKQGRI  374



>ref|XP_007200086.1| hypothetical protein PRUPE_ppa021086mg [Prunus persica]
 gb|EMJ01285.1| hypothetical protein PRUPE_ppa021086mg [Prunus persica]
Length=743

 Score =   218 bits (556),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 101/184 (55%), Positives = 135/184 (73%), Gaps = 2/184 (1%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            +  A      P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL 
Sbjct  19   DSDAEDDDVSPIEQVRLTVTNTDDPTLPVWTFRMWFLGLLSCALLSFLNQFFSYRTEPLI  78

Query  269  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            I+ I +Q+S LPIG FMA  LP  KF    FG  SF+LNPGPFNIKEHV+IT+ AN G +
Sbjct  79   ITQITVQVSTLPIGNFMAKVLPTNKFHIPGFGSRSFSLNPGPFNIKEHVLITIFANAGSA  138

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
             G G AY++G + I+KA+Y++ +S L   ++++TTQ++GYGWAG+LR+Y+V+P  MWWP+
Sbjct  139  FGLGSAYAVGIVNIIKAFYRRKISLLASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPN  198

Query  623  TLLK  634
            TL++
Sbjct  199  TLVQ  202


 Score =   170 bits (431),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 116/169 (69%), Gaps = 2/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE + +   M+R +FFL+ +  SF +Y  PGYLF  LT  SWVCW++ +S
Sbjct  200   LVQVSLFRALHEKDEQR--MSRAKFFLIALVCSFTWYAFPGYLFTTLTNISWVCWLFSKS  257

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS   GLGVG  TLDW+ ++++  SPL+SP+  I+NV  G+ + +Y  +P+ YW
Sbjct  258   VTAQQIGSGMRGLGVGALTLDWSAVASFLFSPLISPFFVIVNVFAGYALILYFAIPIAYW  317

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
               + + A++FPIFS+ LFT+ G  Y+   ++   F+L++P Y+   +++
Sbjct  318   GLDLYTAQRFPIFSSHLFTAQGQDYNITAIVNENFELDIPKYKEQGRIH  366



>ref|XP_002283680.1| PREDICTED: oligopeptide transporter 4 [Vitis vinifera]
Length=757

 Score =   224 bits (572),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 104/198 (53%), Positives = 144/198 (73%), Gaps = 4/198 (2%)
 Frame = +2

Query  53   VEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            VE+      T  ++        P+EEV L VP  DDP+LPV TFR WFLG+ SC +L FL
Sbjct  4    VEIEAPIIKTRTDEDVKEDELSPIEEVRLTVPNDDDPSLPVWTFRMWFLGLISCALLSFL  63

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAP----FGRWSFTLNPGPFNIK  400
            N FF YR +PL IS I +Q++ LPIG+FMA+ LP+ KF      FG+   +LNPGPFN+K
Sbjct  64   NQFFSYRKEPLVISQITVQVATLPIGRFMASVLPDIKFHVHIPFFGKKELSLNPGPFNMK  123

Query  401  EHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVL  580
            EHV+I++ AN G + GGG AY++G +TI+KA+YK+ +S+L G I+++TTQ++GYGWAG+L
Sbjct  124  EHVLISIFANAGSAFGGGSAYAVGIVTIIKAFYKRNISYLAGWILIITTQVLGYGWAGLL  183

Query  581  RRYLVDPVDMWWPSTLLK  634
            R+Y+V+P  MWWPSTL++
Sbjct  184  RKYVVEPAHMWWPSTLVQ  201


 Score =   164 bits (415),  Expect(2) = 1e-98, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 117/177 (66%), Gaps = 10/177 (6%)
 Frame = +1

Query  625   LAQVSLFRALH---------ETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFS  777
             L Q+SLFR LH         ETEV+    +R +FFL+ M  SF++Y +PGYLF  L   +
Sbjct  199   LVQISLFRTLHGKENEVDEQETEVQQR-TSRSKFFLIAMLCSFLWYMVPGYLFQSLQSIA  257

Query  778   WVCWVWPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFI  957
             WVCW +P S+TA QIGS + GLG G  TLDW  ++++  SPLV P+ AI+NV +G+V+ I
Sbjct  258   WVCWAFPNSVTAHQIGSGFRGLGFGALTLDWTVVASFLFSPLVCPFFAIVNVFIGYVLII  317

Query  958   YIIVPLCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             YI++P+ YW  N ++AR FPIFS+ LFT+ G  Y+   ++  +F++++  Y+   +L
Sbjct  318   YIVMPISYWGLNVYNARTFPIFSSHLFTAQGQSYNITAIVNDKFEIDLAQYDIQGRL  374



>ref|XP_009368318.1| PREDICTED: oligopeptide transporter 4 [Pyrus x bretschneideri]
Length=750

 Score =   217 bits (552),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 135/190 (71%), Gaps = 2/190 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             P  + E         P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  20   KPTHSLEPDTEDDDVSPIEQVRLTVTNTDDPTLPVWTFRMWFLGLVSCALLSFLNQFFSY  79

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q+S LPIG FMA  LP + F    FG  +F+LNPGPFNIKEHV+IT+ 
Sbjct  80   RTEPLIITQITVQVSTLPIGYFMAKVLPTKTFHIPGFGSRTFSLNPGPFNIKEHVLITIF  139

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY++G + I+KA+Y + +S L   ++++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  140  ANAGSAFGAGSAYAVGIVNIIKAFYHRKISLLASWLLIITTQVLGYGWAGLLRKYVVEPA  199

Query  605  DMWWPSTLLK  634
             MWWP+TL++
Sbjct  200  HMWWPNTLVQ  209


 Score =   171 bits (434),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 117/169 (69%), Gaps = 2/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE + +   M+R +FFL+ +  SF +Y  PGYLF  LT  SWVCW++ +S
Sbjct  207   LVQVSLFRALHEKDEQR--MSRAKFFLITLVCSFTWYAFPGYLFTTLTNISWVCWLFSKS  264

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS   GLGVG  TLDW+ ++++  SPL+ P+  I+NV  G+ + +Y+++P+ YW
Sbjct  265   VTAQQIGSGMRGLGVGALTLDWSAVASFLFSPLICPFFVIVNVFAGYALILYLVIPMAYW  324

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
               +++ A+KFPIFS+ LFT+ G  Y+   ++  +F L++  YE   +++
Sbjct  325   GLDSYSAQKFPIFSSHLFTAEGQDYNITAIVNDKFQLDISKYEEQGRIH  373



>gb|EYU33488.1| hypothetical protein MIMGU_mgv1a0023121mg, partial [Erythranthe 
guttata]
Length=548

 Score =   218 bits (556),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 99/178 (56%), Positives = 132/178 (74%), Gaps = 4/178 (2%)
 Frame = +2

Query  104  SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAIL  283
            +G   P+E+VAL V   DDP+LPVLTFR WFLG  SC++L FLN FF YRT+PLSI+AI 
Sbjct  35   NGENSPIEQVALTVSTADDPSLPVLTFRMWFLGTLSCVLLSFLNQFFWYRTEPLSITAIS  94

Query  284  MQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAY  463
             QI+V+P+G+ MAA + +R F    R+ FTLNPGPFN+KEHV+IT+ AN     G G  Y
Sbjct  95   AQIAVVPLGQLMAARITDRSFFRGSRFEFTLNPGPFNVKEHVLITIFANS----GAGTVY  150

Query  464  SIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLKC  637
            +I  +T +K +YKQ +SF   LI+V+TTQ++G+GWAG+ RRYLV+P  MWWP+ L++ 
Sbjct  151  AIHVVTAVKIFYKQHISFFVSLIVVITTQVLGFGWAGIYRRYLVEPAAMWWPANLVQV  208


 Score =   170 bits (430),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 118/171 (69%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE + ++ G +TR +FF++    SF YY  PGYLF +LT  SW+CWV+P
Sbjct  204   NLVQVSLFRALHEKDERAKGGVTRTQFFIIAFITSFAYYIFPGYLFEMLTSLSWICWVFP  263

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +S+ AQQ+GS   GLG+G   LDW+ IS+Y GSPL SPW A  NVAVGF   +Y++ PL 
Sbjct  264   KSVLAQQLGSGLSGLGIGAIGLDWSTISSYLGSPLASPWFATANVAVGFFFVMYVVTPLS  323

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW +N +DA+ FPIFS+ LFTS+G  YD   ++   F L+  AYE    L+
Sbjct  324   YW-FNIYDAKTFPIFSDDLFTSSGQIYDISSIVDSNFHLDNAAYEREGPLH  373



>ref|XP_006472993.1| PREDICTED: oligopeptide transporter 2-like [Citrus sinensis]
Length=742

 Score =   204 bits (518),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 136/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V   DDPTLPV TFR WFLG+ SC++L FLNTFF YRT+PL ++ I +Q++ 
Sbjct  27   PIEEVRLTVSNEDDPTLPVYTFRMWFLGVISCVLLSFLNTFFAYRTEPLLVTMISVQVAT  86

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG+FMA  LPE+KF    FG   F+LNPGPFN+KEHV+I++ AN G   G G AY+I 
Sbjct  87   LPIGRFMARLLPEKKFRVPGFGEKEFSLNPGPFNVKEHVLISIFANAGAGFGSGAAYAIS  146

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I+KA+Y++ +SFL   I+V+TTQ++GYGWAG+LR+++VDP +MWWPS+L++
Sbjct  147  IVDIIKAFYRRNISFLAAWILVITTQVLGYGWAGILRKFVVDPAEMWWPSSLVQ  200


 Score =   184 bits (467),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 85/170 (50%), Positives = 122/170 (72%), Gaps = 2/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALHE +  +S M+R +FFL+V+  SF +Y  PGYLFP LT  SWVCW +P 
Sbjct  197   SLVQVSLFRALHEKD--NSRMSRGKFFLIVLVCSFSWYIFPGYLFPTLTTVSWVCWAFPS  254

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITA Q+GS   GLG+G F LDW+ I++Y GSPL++P+ AI+NV VG+++ +Y++ P+ Y
Sbjct  255   SITAHQLGSGMKGLGLGAFALDWSVIASYLGSPLITPFFAIVNVFVGYIIVMYVLTPIAY  314

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W +N +DA+ FPIFS+ LF S G  Y+   ++   F+L++P YE    ++
Sbjct  315   WGFNLYDAKTFPIFSSHLFNSKGQIYNISAIVNENFELDIPMYERQGPMH  364



>ref|XP_012074813.1| PREDICTED: oligopeptide transporter 1-like [Jatropha curcas]
Length=747

 Score =   211 bits (537),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 103/203 (51%), Positives = 142/203 (70%), Gaps = 11/203 (5%)
 Frame = +2

Query  41   EHIVVEMSGLNPATAGEK----TAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGIT  208
            EH  VE +G++ + +G+      A      PV++V L VP TDDPTLP LTFR W LGI 
Sbjct  2    EH--VETNGIHLSDSGKSLNQFDAEEENDSPVDQVRLTVPVTDDPTLPCLTFRTWVLGIL  59

Query  209  SCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKF-APFGRWSFTLNPG  385
            SC +L F+N FF+YR  PL IS++ +QI+VLPIGK MAA+LP++    P  +WSF+LNPG
Sbjct  60   SCALLAFVNQFFVYRQNPLYISSVAVQIAVLPIGKLMAASLPDKLIRVPGTKWSFSLNPG  119

Query  386  PFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYG  565
            PFN+KEHV+IT+ AN G +P     Y++  ITI+KA+Y + +  L   ++ LTTQ++GYG
Sbjct  120  PFNLKEHVLITIFANSGSNP----VYAVNIITIVKAFYHRKIHALAAFLLTLTTQMLGYG  175

Query  566  WAGVLRRYLVDPVDMWWPSTLLK  634
            WAGV R++LVD   MWWP+ L++
Sbjct  176  WAGVFRKFLVDSPYMWWPANLVQ  198


 Score =   177 bits (448),  Expect(2) = 2e-98, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E +   G++R++FFLLV+ +SF YY +P YLF  +T  S+VCW+W 
Sbjct  195   NLVQVSLFRALHEDETRPKGGLSRLQFFLLVLVSSFAYYIVPNYLFQSITALSFVCWIWK  254

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              SITAQQIGS   GLG+G F LDW+ IS++ GSPL +P  A++N+  GF++ +YI++P+ 
Sbjct  255   DSITAQQIGSGRRGLGIGSFGLDWSTISSFLGSPLATPGFAVMNLLAGFIIILYIMLPIT  314

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVL-TPQFDLNVPAYESYSKLY  1131
             YW  N+++A++FP+ S+ +F + G  YD   VL +  F  +  AY+SYSK++
Sbjct  315   YWT-NSYEAKRFPLVSSHVFDAMGQPYDVNLVLNSSTFSFDEQAYDSYSKVH  365



>gb|ABE65610.1| oligopeptide transporter OPT family protein [Arabidopsis thaliana]
Length=734

 Score =   215 bits (547),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 130/174 (75%), Gaps = 1/174 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+V L V   DDP+LPV TFR WFLG+ SCI+L FLNTFF YRTQPL I+ I +Q+
Sbjct  19   ESPVEQVRLTVSNHDDPSLPVWTFRMWFLGLLSCILLSFLNTFFGYRTQPLMITMISVQV  78

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
              LP+GK MA  LPE K+   G W F+ NPGPFN+KEHV+I++ AN G   G G AY++G
Sbjct  79   VTLPLGKLMARVLPETKYK-IGSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAYAVG  137

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +VDP  MWWP+++L+
Sbjct  138  IVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQ  191


 Score =   172 bits (437),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 118/167 (71%), Gaps = 2/167 (1%)
 Frame = +1

Query  631   QVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRSIT  810
             QVSLFRALHE +  ++ M+R +FF++    SF +Y  P YLF  L+  SWVCW +P+SIT
Sbjct  191   QVSLFRALHEKD--NARMSRGKFFVIAFVCSFAWYIFPAYLFLTLSSISWVCWAFPKSIT  248

Query  811   AQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYWKY  990
             AQQ+GS   GLG+G F LDW+ I++Y GSPLV+P+ AI+NV VG+V+ +Y+++P+ YW  
Sbjct  249   AQQLGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAIVNVLVGYVLVMYMVIPISYWGM  308

Query  991   NTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             N ++A KFPIFS+ LF   G  Y+   ++  +F+L++  Y+   ++Y
Sbjct  309   NVYEANKFPIFSSDLFDKQGQLYNISTIVNNKFELDMENYQQQGRVY  355



>ref|NP_172464.1| oligopeptide transporter 2 [Arabidopsis thaliana]
 sp|O04514.2|OPT2_ARATH RecName: Full=Oligopeptide transporter 2; Short=AtOPT2 [Arabidopsis 
thaliana]
 gb|AEE28515.1| oligopeptide transporter 2 [Arabidopsis thaliana]
Length=734

 Score =   215 bits (547),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 130/174 (75%), Gaps = 1/174 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+V L V   DDP+LPV TFR WFLG+ SCI+L FLNTFF YRTQPL I+ I +Q+
Sbjct  19   ESPVEQVRLTVSNHDDPSLPVWTFRMWFLGLLSCILLSFLNTFFGYRTQPLMITMISVQV  78

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
              LP+GK MA  LPE K+   G W F+ NPGPFN+KEHV+I++ AN G   G G AY++G
Sbjct  79   VTLPLGKLMARVLPETKYK-IGSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAYAVG  137

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +VDP  MWWP+++L+
Sbjct  138  IVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQ  191


 Score =   172 bits (437),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 118/167 (71%), Gaps = 2/167 (1%)
 Frame = +1

Query  631   QVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRSIT  810
             QVSLFRALHE +  ++ M+R +FF++    SF +Y  P YLF  L+  SWVCW +P+SIT
Sbjct  191   QVSLFRALHEKD--NARMSRGKFFVIAFVCSFAWYIFPAYLFLTLSSISWVCWAFPKSIT  248

Query  811   AQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYWKY  990
             AQQ+GS   GLG+G F LDW+ I++Y GSPLV+P+ AI+NV VG+V+ +Y+++P+ YW  
Sbjct  249   AQQLGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAIVNVLVGYVLVMYMVIPISYWGM  308

Query  991   NTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             N ++A KFPIFS+ LF   G  Y+   ++  +F+L++  Y+   ++Y
Sbjct  309   NVYEANKFPIFSSDLFDKQGQLYNISTIVNNKFELDMENYQQQGRVY  355



>ref|XP_008237085.1| PREDICTED: oligopeptide transporter 4-like [Prunus mume]
Length=747

 Score =   215 bits (547),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 133/181 (73%), Gaps = 2/181 (1%)
 Frame = +2

Query  98   APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISA  277
            A      P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ 
Sbjct  26   AEDDDVSPIEQVRLTVTNTDDPTLPVWTFRMWFLGLLSCALLSFLNQFFSYRTEPLIITQ  85

Query  278  ILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGG  451
            I +Q+S LPIG FMA  LP  KF    FG  SF+LNPGPFNIKEHV++T+ AN G + G 
Sbjct  86   ITVQVSALPIGHFMAKVLPTNKFHIPGFGSRSFSLNPGPFNIKEHVLVTIFANAGSAFGV  145

Query  452  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLL  631
            G AY++G +TI+K +Y + +S L   ++++TTQ++GYGWAG+LR+Y+V+P  MWWP+TL+
Sbjct  146  GSAYAVGIVTIIKVFYGRKISLLASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPNTLV  205

Query  632  K  634
            +
Sbjct  206  Q  206


 Score =   172 bits (436),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 77/169 (46%), Positives = 117/169 (69%), Gaps = 2/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE + +   M+R +FFL+ +  SF +Y  PGYLF  LT  SWVCW++ +S
Sbjct  204   LVQVSLFRALHEKDEQR--MSRAKFFLIALVCSFTWYAFPGYLFTTLTNISWVCWLFSKS  261

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS   GLGVG  TLDW+ ++++  SPL+SP+  I+NV  G+ + +Y  +P+ YW
Sbjct  262   VTAQQIGSGMRGLGVGALTLDWSAVASFLFSPLISPFFVIVNVFAGYALILYFAIPIAYW  321

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
               + + A++FPIFS+ LFT+ G  Y+   ++  +F+L++P YE   +++
Sbjct  322   GLDLYTAQRFPIFSSHLFTAQGQDYNITAIVNDKFELDIPKYEEQGRIH  370



>ref|XP_006304646.1| hypothetical protein CARUB_v10011782mg [Capsella rubella]
 gb|EOA37544.1| hypothetical protein CARUB_v10011782mg [Capsella rubella]
Length=735

 Score =   216 bits (550),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 130/174 (75%), Gaps = 1/174 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVEEV L V   DDP+LPV TFR WFLG+ SC++L FLNTFF YRTQPL I+ I +Q+
Sbjct  20   ESPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRTQPLMITMISVQV  79

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
              LP+GK MA  LPE K+   G W F+ NPGPFN+KEHV+I++ AN G   G G AY++G
Sbjct  80   VTLPLGKLMARVLPETKYK-IGSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAYAVG  138

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +VDP  MWWP+++L+
Sbjct  139  IVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQ  192


 Score =   171 bits (434),  Expect(2) = 3e-98, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 118/167 (71%), Gaps = 2/167 (1%)
 Frame = +1

Query  631   QVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRSIT  810
             QVSLFRALHE +  ++ M+R +FF++    SF +Y  P YLF  L+  SWVCW +P+SIT
Sbjct  192   QVSLFRALHEKD--NARMSRGKFFVIAFVCSFAWYIFPAYLFLTLSSISWVCWAFPKSIT  249

Query  811   AQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYWKY  990
             AQQ+GS   GLG+G F LDW+ I++Y GSPLV+P+ AI+NV VG+++ +Y+++P+ YW  
Sbjct  250   AQQLGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAIVNVLVGYILVMYMVIPISYWGM  309

Query  991   NTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             N ++A KFPIFS+ LF   G  Y+   ++  +F+L++  Y+   ++Y
Sbjct  310   NVYEANKFPIFSSDLFDKQGELYNISTIVNNKFELDMGNYQQEGRVY  356



>ref|XP_010438561.1| PREDICTED: oligopeptide transporter 6 [Camelina sativa]
Length=735

 Score =   200 bits (509),  Expect(2) = 4e-98, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 127/174 (73%), Gaps = 4/174 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC V EV L VP+TDD +LPVLTFR W LGI +CI+L F+N FF YRT PLSI+ I  QI
Sbjct  17   RCVVPEVELTVPKTDDSSLPVLTFRMWVLGIGACIVLSFINQFFWYRTMPLSITGISAQI  76

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA  LP R+F    R+ FTLNPG FN+KEHV+IT+ AN     G G  Y+  
Sbjct  77   AVVPLGHLMARVLPTRRFLEGTRFQFTLNPGAFNVKEHVLITIFANS----GAGSVYATH  132

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             ++ +K YYK++L FL   ++++TTQ++G+GWAG+ R++LV+P +MWWPS L++
Sbjct  133  ILSAIKLYYKRSLPFLPAFLVMITTQILGFGWAGLFRKHLVEPGEMWWPSNLVQ  186


 Score =   187 bits (474),  Expect(2) = 4e-98, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 115/165 (70%), Gaps = 2/165 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKS-SGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLF ALHE E KS  GM+R +FFL+V+ ASF YY  PGYLF +LT  SWVCW  P
Sbjct  183   NLVQVSLFGALHEKEKKSRGGMSRTQFFLIVLVASFAYYIFPGYLFTMLTSISWVCWFNP  242

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +SI   Q+GS  HGLG+G    DW  ISAY GSPL SP  A +NVA+GFV+ +YI+ P+C
Sbjct  243   KSILVNQLGSGEHGLGIGSIGFDWVTISAYLGSPLASPLFASVNVAIGFVLVMYIVTPIC  302

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYE  1113
             YW +N +DA+ FPIFS+QLF + G +YD   ++  +F L+   Y 
Sbjct  303   YW-FNIYDAKTFPIFSSQLFMANGSRYDVLSIIDSKFHLDRAVYS  346



>gb|KGN53886.1| hypothetical protein Csa_4G179700 [Cucumis sativus]
Length=738

 Score =   215 bits (547),  Expect(2) = 4e-98, Method: Compositional matrix adjust.
 Identities = 98/189 (52%), Positives = 138/189 (73%), Gaps = 2/189 (1%)
 Frame = +2

Query  74   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
            P +  +  A      P+E+V L V  +DDPTLPV TFR W LG+ SC +L FLN FF YR
Sbjct  8    PLSGSDPAADDDDISPIEQVRLTVTNSDDPTLPVWTFRMWTLGLLSCALLSFLNQFFYYR  67

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMA  427
            T+PL I+ I +Q++ LPIG+FMAA LP  +F    FG   F+LNPGPFN+KEHV+I++ A
Sbjct  68   TEPLIITQITVQVATLPIGQFMAAVLPASRFRLPGFGSRRFSLNPGPFNMKEHVLISIFA  127

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N G + GGG AY++G + I+KA+Y + +SF+   ++++TTQ++GYGWAG+LR+Y+V+P  
Sbjct  128  NAGTAFGGGSAYAVGIVNIIKAFYGRNISFVAAWLLIVTTQVLGYGWAGLLRKYVVEPAH  187

Query  608  MWWPSTLLK  634
            MWWPSTL++
Sbjct  188  MWWPSTLVQ  196


 Score =   172 bits (436),  Expect(2) = 4e-98, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 120/170 (71%), Gaps = 2/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L Q+ ++ ALHE E     M+R +FFL+ +  SF +Y +PGYLFP LT  SWVCW +P 
Sbjct  193   TLVQIYIYMALHEKE--DCRMSRGKFFLIALICSFSWYVIPGYLFPTLTSISWVCWAFPN  250

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQ+GS   GLG+G FTLDW+ +S++  SPL+SP+ +I+N+ VG+ + IYI VP+ Y
Sbjct  251   SVTAQQLGSGMKGLGLGAFTLDWSAVSSFLFSPLISPFFSIVNIFVGYTLIIYIAVPIAY  310

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W +N ++A  FPIFS++LFT+ G  Y+   ++  +F+L++  YE + +++
Sbjct  311   WGFNLYNASTFPIFSSKLFTAQGQLYNITAIVNDKFELDLAKYEEHGQIH  360



>ref|XP_007224505.1| hypothetical protein PRUPE_ppa022679mg [Prunus persica]
 gb|EMJ25704.1| hypothetical protein PRUPE_ppa022679mg [Prunus persica]
Length=731

 Score =   202 bits (513),  Expect(2) = 4e-98, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 129/172 (75%), Gaps = 1/172 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V   DD +LPV TFR W +G+ SCI+L FLNTFF +RT+PL I+ I +Q++ 
Sbjct  18   PIEEVRLTVLNEDDTSLPVWTFRMWTIGLFSCILLSFLNTFFSFRTEPLVITMISVQVAS  77

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            LPIG+FMA TLP  K    G+ SF+LNPG FNIKEHV+I++ AN G   G G AY++  +
Sbjct  78   LPIGRFMARTLPRTKVWVGGK-SFSLNPGEFNIKEHVLISIFANAGAGFGSGPAYAVDIV  136

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            TI+KA+Y + +SF     +V+TTQ++GYGWAG+LR+Y+VDP  MWWPS+L++
Sbjct  137  TIIKAFYGRKISFFASWALVITTQVLGYGWAGILRKYVVDPAAMWWPSSLVQ  188


 Score =   185 bits (470),  Expect(2) = 4e-98, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 124/166 (75%), Gaps = 2/166 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALHE +  S+ M+R +FFL+ +  SF +Y +PGYLF  L+  SW+CW+ P+
Sbjct  185   SLVQVSLFRALHEND--SNRMSRSKFFLIALICSFSWYVMPGYLFTTLSTISWICWLSPK  242

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS + GLG+G  TLDW+ I++Y GSPL+SP+ AI N+AVG+++ +Y+I+P+ Y
Sbjct  243   SITAQQIGSGFRGLGLGAVTLDWSVIASYLGSPLISPFFAIANIAVGYIITMYVIIPIAY  302

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESY  1119
             WK N ++A  F IFS+ LF S G  YD   ++  +F++++P+YE +
Sbjct  303   WKLNLYNASNFAIFSSHLFDSQGQIYDVKAIVNDKFEIDMPSYEKH  348



>gb|KJB32172.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=493

 Score =   221 bits (562),  Expect(2) = 4e-98, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 137/190 (72%), Gaps = 2/190 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +  + G          P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  19   DATSGGNHDVEDDEISPIEQVRLTVTNTDDPTLPVWTFRMWFLGLFSCALLSFLNQFFSY  78

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q+S LPIG FMA+ LP+ +F    FG   F+LNPGPFN+KEHV+I + 
Sbjct  79   RTEPLIITQITVQVSTLPIGHFMASVLPKTQFGIPGFGSKRFSLNPGPFNMKEHVLICIF  138

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY+IG + I+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  139  ANAGSAFGNGSAYAIGIVNIIKAFYGRNISFLAGWLLIITTQVLGYGWAGLLRKYVVEPA  198

Query  605  DMWWPSTLLK  634
             MWWPSTL++
Sbjct  199  HMWWPSTLVQ  208


 Score =   166 bits (420),  Expect(2) = 4e-98, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 124/169 (73%), Gaps = 1/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             L QVSLFRALHE + K+   MTR +FFL+++  SFV+Y +PGYLF  LT  SW+CW++ +
Sbjct  206   LVQVSLFRALHEKDDKNDRRMTRAKFFLIILICSFVWYLVPGYLFTTLTSISWICWIFSK  265

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G FTLDW+ ++++  SPL+SP+ AI NV VG+V+ IYI +P+ Y
Sbjct  266   SVTAQQIGSGLRGLGLGAFTLDWSAVASFLFSPLISPFFAIANVFVGYVLIIYIAIPVAY  325

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W  + ++A +FPIFS+ LFT+ G KY+   ++  +F++++  YE   ++
Sbjct  326   WGLDLYNASRFPIFSSHLFTAQGQKYNITAIVNDKFEIDLAKYEEQGRI  374



>ref|XP_006433764.1| hypothetical protein CICLE_v10003491mg [Citrus clementina]
 gb|ESR47004.1| hypothetical protein CICLE_v10003491mg [Citrus clementina]
Length=742

 Score =   203 bits (517),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 136/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V   DDPTLPV TFR WFLG+ SC++L FLNTFF YRT+PL ++ I +Q++ 
Sbjct  27   PIEEVRLTVSNEDDPTLPVYTFRMWFLGVISCVLLSFLNTFFAYRTEPLLVTMISVQVAT  86

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG+FMA  LPE+KF    FG   F+LNPGPFN+KEHV+I++ AN G   G G AY+I 
Sbjct  87   LPIGRFMARLLPEKKFRVPGFGEKEFSLNPGPFNVKEHVLISIFANAGAGFGSGAAYAIS  146

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I+KA+Y++ +SFL   I+V+TTQ++GYGWAG+LR+++VDP +MWWPS+L++
Sbjct  147  IVDIIKAFYRRNISFLAAWILVITTQVLGYGWAGILRKFVVDPAEMWWPSSLVQ  200


 Score =   183 bits (465),  Expect(2) = 5e-98, Method: Compositional matrix adjust.
 Identities = 84/170 (49%), Positives = 122/170 (72%), Gaps = 2/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALHE +  ++ M+R +FFL+V+  SF +Y  PGYLFP LT  SWVCW +P 
Sbjct  197   SLVQVSLFRALHEKD--NNRMSRGKFFLIVLVCSFSWYIFPGYLFPTLTTVSWVCWAFPS  254

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITA Q+GS   GLG+G F LDW+ I++Y GSPL++P+ AI+NV VG+++ +Y++ P+ Y
Sbjct  255   SITAHQLGSGMKGLGLGAFALDWSVIASYLGSPLITPFFAIVNVFVGYIIVMYVLTPIAY  314

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W +N +DA+ FPIFS+ LF S G  Y+   ++   F+L++P YE    ++
Sbjct  315   WGFNLYDAKTFPIFSSHLFNSKGQIYNISAIVNENFELDIPMYERQGPMH  364



>gb|KDO78545.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=388

 Score =   308 bits (790),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E KS G+TRM+FFL+V+ ASF YY+LPGYLFPILTFFSWVCW WP 
Sbjct  190   NLAQVSLFRALHEKESKSKGLTRMQFFLIVLAASFAYYSLPGYLFPILTFFSWVCWAWPH  249

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLG+G FTLDWAGISAYHGSPLV+PWT+ILNV +GFVMFIYIIVPLCY
Sbjct  250   SITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVTPWTSILNVGIGFVMFIYIIVPLCY  309

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK++TFDARKFPIFSNQLFTS+GHKYDT  +LTPQ+DLN+PAY SY KLY
Sbjct  310   WKFDTFDARKFPIFSNQLFTSSGHKYDTTKILTPQYDLNIPAYNSYGKLY  359


 Score =   300 bits (767),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 170/203 (84%), Gaps = 9/203 (4%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            N    G+ T     RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +
Sbjct  10   NENPNGDSTEE---RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTF  66

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQI+VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  67   RTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFAN  125

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDPV+M
Sbjct  126  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPVEM  185

Query  611  WWPS-----TLLKCLYSEHSMKR  664
            WWPS     +L + L+ + S  +
Sbjct  186  WWPSNLAQVSLFRALHEKESKSK  208



>ref|XP_009366375.1| PREDICTED: oligopeptide transporter 2-like [Pyrus x bretschneideri]
Length=743

 Score =   201 bits (510),  Expect(2) = 7e-98, Method: Compositional matrix adjust.
 Identities = 94/185 (51%), Positives = 132/185 (71%), Gaps = 1/185 (1%)
 Frame = +2

Query  80   TAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQ  259
            T  +++        VE+V L V   DD +LPV TFR W +G+ SCI+L FLNTFF YRT+
Sbjct  16   TKLDESENDDDVSSVEQVRLTVSNEDDSSLPVWTFRMWTIGMLSCILLSFLNTFFSYRTE  75

Query  260  PLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGV  439
            PL IS I +Q++ LPIG+FMA  LP RK    G+ S++LNPG FN+KEHV+I++ AN G 
Sbjct  76   PLVISMISVQVASLPIGRFMARALPRRKVWIRGK-SYSLNPGEFNVKEHVLISIFANAGA  134

Query  440  SPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWP  619
              G G AY++  +TI+KA+Y + +SF     +V+TTQ++GYGWAG++R+Y+VDP  MWWP
Sbjct  135  GFGSGPAYAVNIVTIIKAFYGRKISFFASWALVITTQVLGYGWAGIIRKYVVDPGAMWWP  194

Query  620  STLLK  634
            S+L++
Sbjct  195  SSLVQ  199


 Score =   186 bits (471),  Expect(2) = 7e-98, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 123/165 (75%), Gaps = 2/165 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALHE +  +  M+R +FFL+ +  SF +Y +PGYLF  L+  SW+CW++PR
Sbjct  196   SLVQVSLFRALHEND--NHRMSRGKFFLIALVCSFSWYLVPGYLFTTLSIISWICWIYPR  253

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SI AQQIGS + GLGVG FTLDW+ IS+Y GSPL+SP+ AI+N+ VG+++ +Y+++P+ Y
Sbjct  254   SIRAQQIGSGFRGLGVGAFTLDWSVISSYLGSPLISPFFAIVNITVGYIIIMYVVIPISY  313

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYES  1116
             WK N ++A+ F IFS+ LF S G  Y+   ++  +F +++PAY+ 
Sbjct  314   WKLNLYNAKNFAIFSSHLFDSDGQIYNVKGIVNDRFQIDMPAYKK  358



>ref|XP_011626075.1| PREDICTED: oligopeptide transporter 7 [Amborella trichopoda]
Length=745

 Score =   217 bits (553),  Expect(2) = 7e-98, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 135/188 (72%), Gaps = 4/188 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            + +T  E+   S    P+E+VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF Y
Sbjct  17   SSSTTIEEPNTSPENSPIEQVALTVPVTDDPSLPVLTFRMWFLGGLSCVVLSFLNQFFWY  76

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RT+PLSI+++  QI+V+P+G  MAA LP R F    RW FTLNPGPFN+KEHV+IT+ AN
Sbjct  77   RTEPLSITSVSAQIAVVPLGHLMAAVLPTRPFFKGKRWEFTLNPGPFNVKEHVLITIFAN  136

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
                 G G  Y+I  ++ +K +YK+ LSF    ++V+TTQ++G+GWAG+ R+YLV+P  M
Sbjct  137  S----GAGSVYAIHIVSAVKIFYKETLSFFVAFLVVITTQVLGFGWAGIFRKYLVEPAAM  192

Query  611  WWPSTLLK  634
            WWP  L++
Sbjct  193  WWPYNLVQ  200


 Score =   169 bits (428),  Expect(2) = 7e-98, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = +1

Query  619   FNLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  795
             +NL QVSLF ALHE E +  G +TR +FFL+ +  SF YY LPGYLFP+LT  SW+CW++
Sbjct  196   YNLVQVSLFGALHEKEERRKGSLTRNQFFLIALMCSFAYYVLPGYLFPMLTSLSWICWIF  255

Query  796   PRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPL  975
             P+S+ AQQ+GS  +GLG+G   LDW+ IS+Y GSPL SPW A  NVA GF + +Y+I PL
Sbjct  256   PKSVLAQQLGSGLYGLGLGAIGLDWSTISSYLGSPLASPWFATANVAAGFFIVMYVITPL  315

Query  976   CYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              YW  + + A++FPIFS  LFT +G +Y+   ++   F++++ AYE   KLY
Sbjct  316   SYW-LDLYHAKRFPIFSEDLFTYSGQEYNITAIIDSNFNIDLEAYEKEGKLY  366



>gb|ERN13351.1| hypothetical protein AMTR_s00041p00121000 [Amborella trichopoda]
Length=734

 Score =   217 bits (553),  Expect(2) = 8e-98, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 135/188 (72%), Gaps = 4/188 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            + +T  E+   S    P+E+VAL VP TDDP+LPVLTFR WFLG  SC++L FLN FF Y
Sbjct  6    SSSTTIEEPNTSPENSPIEQVALTVPVTDDPSLPVLTFRMWFLGGLSCVVLSFLNQFFWY  65

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RT+PLSI+++  QI+V+P+G  MAA LP R F    RW FTLNPGPFN+KEHV+IT+ AN
Sbjct  66   RTEPLSITSVSAQIAVVPLGHLMAAVLPTRPFFKGKRWEFTLNPGPFNVKEHVLITIFAN  125

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
                 G G  Y+I  ++ +K +YK+ LSF    ++V+TTQ++G+GWAG+ R+YLV+P  M
Sbjct  126  S----GAGSVYAIHIVSAVKIFYKETLSFFVAFLVVITTQVLGFGWAGIFRKYLVEPAAM  181

Query  611  WWPSTLLK  634
            WWP  L++
Sbjct  182  WWPYNLVQ  189


 Score =   169 bits (427),  Expect(2) = 8e-98, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 122/172 (71%), Gaps = 2/172 (1%)
 Frame = +1

Query  619   FNLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  795
             +NL QVSLF ALHE E +  G +TR +FFL+ +  SF YY LPGYLFP+LT  SW+CW++
Sbjct  185   YNLVQVSLFGALHEKEERRKGSLTRNQFFLIALMCSFAYYVLPGYLFPMLTSLSWICWIF  244

Query  796   PRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPL  975
             P+S+ AQQ+GS  +GLG+G   LDW+ IS+Y GSPL SPW A  NVA GF + +Y+I PL
Sbjct  245   PKSVLAQQLGSGLYGLGLGAIGLDWSTISSYLGSPLASPWFATANVAAGFFIVMYVITPL  304

Query  976   CYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              YW  + + A++FPIFS  LFT +G +Y+   ++   F++++ AYE   KLY
Sbjct  305   SYW-LDLYHAKRFPIFSEDLFTYSGQEYNITAIIDSNFNIDLEAYEKEGKLY  355



>ref|XP_008361590.1| PREDICTED: oligopeptide transporter 2-like, partial [Malus domestica]
Length=564

 Score =   224 bits (572),  Expect(2) = 9e-98, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 139/189 (74%), Gaps = 5/189 (3%)
 Frame = +2

Query  68   LNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            + PAT  ++   S    PVEEV L V   DDPTLPV TFR W LG+ SC +L FLNTFF 
Sbjct  7    IEPATKHDENDVS----PVEEVRLTVSNDDDPTLPVWTFRMWTLGLASCALLSFLNTFFS  62

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            YRT+PL IS I +Q++ LPIG+FMA  LP+RKF   G   F+LNPGPFN+KEHV+I++ A
Sbjct  63   YRTEPLXISXISVQVATLPIGRFMARXLPKRKFQ-IGXKEFSLNPGPFNMKEHVLISIFA  121

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N G   G G AY+I  + I+KA+Y + +SFL   I+V+TTQ++GYGWAG+LRRY+VDP +
Sbjct  122  NAGSGFGSGTAYAISIVDIIKAFYHRKISFLASWILVITTQVLGYGWAGILRRYVVDPAE  181

Query  608  MWWPSTLLK  634
            MWWPS+L++
Sbjct  182  MWWPSSLVQ  190


 Score =   161 bits (408),  Expect(2) = 9e-98, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 124/169 (73%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALHE +  ++ M+R +FF + +  SF ++ +PGYLFP L+  SWVCW++P+
Sbjct  187   SLVQVSLFRALHEKD--NNRMSRGKFFFIALXCSFAWFVVPGYLFPTLSTISWVCWIYPK  244

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G F+LDW  I++Y  SPL+SP+ AI+NVA G+V+ +Y+++P+ Y
Sbjct  245   SVTAQQIGSGMGGLGIGAFSLDWTVIASYLYSPLISPFFAIVNVAAGYVLVMYMLLPIAY  304

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W  N ++A+ F IFS+ LF + G  Y+   ++  +F++++PAYE   ++
Sbjct  305   WGVNLYNAKNFAIFSSHLFDAGGQIYNVSALVNNKFEIDMPAYERQGRI  353



>ref|XP_010501399.1| PREDICTED: oligopeptide transporter 2 [Camelina sativa]
Length=735

 Score =   217 bits (553),  Expect(2) = 9e-98, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 131/174 (75%), Gaps = 1/174 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVEEV L V   DDP+LPV TFR WFLG+ SC++L FLNTFF YRTQPL I+ I +Q+
Sbjct  20   ESPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRTQPLMITMISVQV  79

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
              LP+GK MA  LPE K+   G W F+LNPGPFN+KEHV+I++ AN G   G G AY++G
Sbjct  80   VTLPLGKLMARVLPETKYK-IGSWEFSLNPGPFNVKEHVLISMFANAGAGFGSGTAYAVG  138

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +VDP  MWWP+++L+
Sbjct  139  IVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQ  192


 Score =   169 bits (427),  Expect(2) = 9e-98, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 119/167 (71%), Gaps = 2/167 (1%)
 Frame = +1

Query  631   QVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRSIT  810
             QVSLFRALHE +  ++ M+R +FF++    SF +Y  P YLF  L+  SWVCW +P+SIT
Sbjct  192   QVSLFRALHEKD--NARMSRGKFFVIAFVCSFAWYIFPAYLFLTLSSISWVCWAFPKSIT  249

Query  811   AQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYWKY  990
             AQQ+GS   GLG+G F LDW+ I++Y GSPLV+P+ AI+NV VG+++ +Y+++P+ Y+  
Sbjct  250   AQQLGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAIVNVFVGYILVMYMVIPISYYGM  309

Query  991   NTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             N ++A KFPIFS+ LF   G  Y+   ++  +F+L++ +Y+   ++Y
Sbjct  310   NMYEANKFPIFSSDLFDKQGQLYNISTIVNDKFELDMGSYQQEGRVY  356



>ref|XP_010475851.1| PREDICTED: oligopeptide transporter 2-like [Camelina sativa]
Length=735

 Score =   217 bits (553),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 131/174 (75%), Gaps = 1/174 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVEEV L V   DDP+LPV TFR WFLG+ SC++L FLNTFF YRTQPL I+ I +Q+
Sbjct  20   ESPVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRTQPLMITMISVQV  79

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
              LP+GK MA  LPE K+   G W F+LNPGPFN+KEHV+I++ AN G   G G AY++G
Sbjct  80   VTLPLGKLMARVLPETKYK-IGSWEFSLNPGPFNVKEHVLISMFANAGAGFGSGTAYAVG  138

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +VDP  MWWP+++L+
Sbjct  139  IVDIIMAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQ  192


 Score =   168 bits (426),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 117/167 (70%), Gaps = 2/167 (1%)
 Frame = +1

Query  631   QVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRSIT  810
             QVSLFRALHE +   + M+R +FF++    SF +Y  P YLF  L+  SWVCW +P+SIT
Sbjct  192   QVSLFRALHEKD--KARMSRGKFFVIAFVCSFAWYIFPAYLFLTLSSISWVCWAFPKSIT  249

Query  811   AQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYWKY  990
             AQQ+GS   GLG+G F LDW+ I++Y GSPLV+P+ AI+NV VG+++ +Y+++P+ Y+  
Sbjct  250   AQQLGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAIVNVLVGYILIMYMVIPISYYGM  309

Query  991   NTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             N ++A KFPIFS+ LF   G  Y+   ++  +F+L++  Y+   ++Y
Sbjct  310   NMYEANKFPIFSSDLFDKQGQLYNISTIVNDKFELDMGNYQQEGRVY  356



>ref|XP_002867483.1| ATOPT6 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH43742.1| ATOPT6 [Arabidopsis lyrata subsp. lyrata]
Length=735

 Score =   200 bits (509),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 128/186 (69%), Gaps = 4/186 (2%)
 Frame = +2

Query  77   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  256
            AT          RC V EV L VP+TDD +LPVLTFR W LGI +CI+L F+N FF YRT
Sbjct  5    ATDFTAVMDDDDRCVVPEVELTVPKTDDSSLPVLTFRMWVLGIGACIVLSFINQFFWYRT  64

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCG  436
             PLS++ I  QI+V+PIG  MA  LP R+F    R+ FTLNPG FN+KEHV+IT+ AN  
Sbjct  65   MPLSVTGICAQIAVVPIGHLMARVLPTRRFLEGTRFQFTLNPGAFNVKEHVLITIFANS-  123

Query  437  VSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWW  616
               G G  Y+   ++ +K YYK+ L FL   ++++TTQ++G+GWAG+ R++LV+P +MWW
Sbjct  124  ---GAGSVYATHILSAIKLYYKRPLPFLPAFLVMITTQILGFGWAGLFRKHLVEPGEMWW  180

Query  617  PSTLLK  634
            PS L++
Sbjct  181  PSNLVQ  186


 Score =   186 bits (471),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 114/165 (69%), Gaps = 2/165 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKS-SGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLF ALHE E KS  GM+R +FFL+V+ ASF YY  PGYLF +LT  SWVCW+ P
Sbjct  183   NLVQVSLFGALHEKEKKSRGGMSRTQFFLIVLVASFAYYIFPGYLFTMLTSISWVCWLNP  242

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +SI   Q+GS  HGLG+G    DW  ISAY GSPL SP  A +NVA+GFV+ +YI+ P+C
Sbjct  243   KSILVNQLGSGEHGLGIGSIGFDWVTISAYLGSPLASPLFASVNVAIGFVLVMYIVTPVC  302

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYE  1113
             YW  N +DA+ FPIFS+QLF   G +YD   ++  +F L+   Y 
Sbjct  303   YW-LNIYDAKTFPIFSSQLFMGNGSRYDVLSIIDSKFHLDRAVYS  346



>ref|XP_009590288.1| PREDICTED: oligopeptide transporter 3 [Nicotiana tomentosiformis]
Length=751

 Score =   318 bits (815),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/207 (74%), Positives = 176/207 (85%), Gaps = 8/207 (4%)
 Frame = +2

Query  68   LNPATAGEKTAP---SGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            L P+ AG+          RCPVEEVALVVPETDDPTLPV+TFRAWFLG+TSC +LIFLNT
Sbjct  14   LPPSAAGKLNGEPPADHERCPVEEVALVVPETDDPTLPVMTFRAWFLGLTSCTLLIFLNT  73

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FFIYRTQPL+ISAILMQI+VLPIGKFMAATLP++ +  FGRW F+LNPGPFNIKEHVIIT
Sbjct  74   FFIYRTQPLTISAILMQIAVLPIGKFMAATLPKKNYTLFGRWGFSLNPGPFNIKEHVIIT  133

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            VMANCGVS GGGDAYSIGAIT+MKAYYKQ+L+FLC L+IVLTTQ++GYGWAG+LRRYLVD
Sbjct  134  VMANCGVSIGGGDAYSIGAITVMKAYYKQSLNFLCALLIVLTTQIVGYGWAGMLRRYLVD  193

Query  599  PVDMWWPS-----TLLKCLYSEHSMKR  664
            PVDMWWPS     +L + L+ +    R
Sbjct  194  PVDMWWPSNLAQVSLFRALHEKEQKTR  220


 Score =   308 bits (788),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E K+ G+TRM+FFL+ M ASF YY  PGYLFPILTFFSWVCW WPR
Sbjct  202   NLAQVSLFRALHEKEQKTRGLTRMQFFLVFMAASFAYYAFPGYLFPILTFFSWVCWAWPR  261

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLGVG FTLDWAGISAYHGSPLV+PW++ILNV +GF+MFIYII+PLCY
Sbjct  262   SITAQQIGSGYHGLGVGAFTLDWAGISAYHGSPLVAPWSSILNVGIGFIMFIYIIIPLCY  321

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WKYNTFDARKFPIFSNQLFTS+GHKYDT  +LTPQFDLN+ AYESYSKLY
Sbjct  322   WKYNTFDARKFPIFSNQLFTSSGHKYDTTKILTPQFDLNIAAYESYSKLY  371



>ref|XP_010520694.1| PREDICTED: oligopeptide transporter 4 [Tarenaya hassleriana]
Length=756

 Score =   209 bits (531),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 131/174 (75%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            PVE+V L V  TDDPT PV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  41   PVEQVRLTVTNTDDPTQPVWTFRMWFLGLLSCALLSFLNQFFAYRTEPLIITQITVQVAT  100

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LP+G F+A  LP  +F    FG    TLNPGPFN+KEHV+I++ AN G + G G A+++ 
Sbjct  101  LPMGHFLAKVLPTTRFTIPGFGSNRLTLNPGPFNMKEHVLISIFANAGSAFGSGSAFAVS  160

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +TI+KA+Y++ +SFL   ++++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  161  IVTIIKAFYRRNISFLAAWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  214


 Score =   176 bits (447),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 120/168 (71%), Gaps = 2/168 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE + +   MTR +FF++ +  SF +Y +PGYLF  LT  SW+CWV+P+S
Sbjct  212   LVQVSLFRALHEKDEQR--MTRAKFFVIALICSFAWYLVPGYLFSTLTSISWICWVFPKS  269

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQ+GS   GLG+G  TLDW  ++++  SPL+SP+ AI NV +G+ + +Y+IVP+ YW
Sbjct  270   VTAQQLGSGMRGLGLGAITLDWTAVASFLFSPLISPFFAIANVFIGYALILYVIVPVAYW  329

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
               +++ A++FPIFS+ LFTS G KYD   ++   F+L++  Y+   ++
Sbjct  330   GMDSYHAKRFPIFSSTLFTSDGQKYDIPAMVNENFELDLVKYQQQGRI  377



>ref|NP_194503.1| oligopeptide transporter [Arabidopsis thaliana]
 sp|Q9T095.1|OPT6_ARATH RecName: Full=Oligopeptide transporter 6; Short=AtOPT6 [Arabidopsis 
thaliana]
 emb|CAB38285.1| putative protein [Arabidopsis thaliana]
 emb|CAB81423.1| putative protein [Arabidopsis thaliana]
 gb|AAN13068.1| unknown protein [Arabidopsis thaliana]
 gb|AEE85386.1| oligopeptide transporter [Arabidopsis thaliana]
Length=736

 Score =   200 bits (509),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 93/174 (53%), Positives = 127/174 (73%), Gaps = 4/174 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC V EV L VP+TDD TLPVLTFR W LGI +CI+L F+N FF YRT PLSI+ I  QI
Sbjct  18   RCVVPEVELTVPKTDDSTLPVLTFRMWVLGIGACIVLSFINQFFWYRTMPLSITGISAQI  77

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA  LP ++F    R+ FTLNPG FN+KEHV+IT+ AN     G G  Y+  
Sbjct  78   AVVPLGHLMARVLPTKRFLEGTRFQFTLNPGAFNVKEHVLITIFANS----GAGSVYATH  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             ++ +K YYK++L FL   ++++TTQ++G+GWAG+ R++LV+P +MWWPS L++
Sbjct  134  ILSAIKLYYKRSLPFLPAFLVMITTQILGFGWAGLFRKHLVEPGEMWWPSNLVQ  187


 Score =   185 bits (469),  Expect(2) = 1e-97, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 114/165 (69%), Gaps = 2/165 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKS-SGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLF ALHE E KS  GM+R +FFL+V+ ASF YY  PGYLF +LT  SWVCW+ P
Sbjct  184   NLVQVSLFGALHEKEKKSRGGMSRTQFFLIVLVASFAYYIFPGYLFTMLTSISWVCWLNP  243

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +SI   Q+GS  HGLG+G    DW  ISAY GSPL SP  A +NVA+GFV+ +YI+ P+C
Sbjct  244   KSILVNQLGSGEHGLGIGSIGFDWVTISAYLGSPLASPLFASVNVAIGFVLVMYIVTPVC  303

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYE  1113
             YW  N +DA+ FPIFS+QLF   G +YD   ++  +F L+   Y 
Sbjct  304   YW-LNIYDAKTFPIFSSQLFMGNGSRYDVLSIIDSKFHLDRVVYS  347



>ref|XP_010246854.1| PREDICTED: oligopeptide transporter 7-like [Nelumbo nucifera]
Length=757

 Score =   209 bits (532),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 130/172 (76%), Gaps = 4/172 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+VAL VP TDDPTLP+LTFR W LG  +C +L FLN FF YR +PLSI++I  QI+V
Sbjct  45   PIEQVALTVPITDDPTLPILTFRMWVLGTLACALLSFLNQFFWYRKEPLSITSISAQIAV  104

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            +P+G  MA+T+ +R F    RW FTLNPGPFNIKEHV+IT+ AN     G G+ Y+I  +
Sbjct  105  VPLGHLMASTITDRVFFKKSRWEFTLNPGPFNIKEHVLITIFANS----GAGNVYAIHIV  160

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            + +K +YK+ L+FL  L++V+T+Q++G+GWAG+ RRYLV+P  MWWP  L++
Sbjct  161  SAVKLFYKKNLTFLVSLLVVITSQVLGFGWAGLFRRYLVEPAAMWWPHNLVQ  212


 Score =   175 bits (444),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 119/171 (70%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E K   G+TR +FFL+    SF YY  PGYLFP+LT  SW+CW++P
Sbjct  209   NLVQVSLFRALHEKEQKPKGGLTRNQFFLVAFMCSFAYYVFPGYLFPMLTSLSWICWIFP  268

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              SI AQQ+GS  HGLG+G    DW+ IS+Y GSPL SPW A  NVA+GFV+  Y+I P+ 
Sbjct  269   ASILAQQLGSGLHGLGLGALGFDWSSISSYLGSPLASPWFATANVAMGFVLITYVITPIA  328

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW  N + ++ FP+FS+ LFTSTG +Y+   ++ P F L++ AYE    LY
Sbjct  329   YW-LNLYKSKSFPVFSDNLFTSTGQRYNISAIIDPNFQLDIKAYEREGPLY  378



>ref|XP_010244695.1| PREDICTED: oligopeptide transporter 4-like [Nelumbo nucifera]
Length=743

 Score =   213 bits (541),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 136/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDP+LPV TFR WF+G+ SC +L FLN FF YRT+P+ I+ I +QI+ 
Sbjct  28   PIEEVRLTVANTDDPSLPVWTFRMWFMGLLSCGLLSFLNQFFAYRTEPIIITQITVQIAT  87

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG+FMA+ LP  KF    FG   F+LNPGPFN+KEHV+I++ AN G + GGG AY++G
Sbjct  88   LPIGRFMASVLPRTKFRLPGFGSREFSLNPGPFNMKEHVLISIFANAGSAFGGGSAYAVG  147

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I+KA+Y++ +SF  G I+V+TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  148  IVNIIKAFYRRNISFFAGWILVITTQVLGYGWAGILRKYVVEPAHMWWPSTLVQ  201


 Score =   172 bits (435),  Expect(2) = 2e-97, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 121/170 (71%), Gaps = 2/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE + +   M+R +FFL+ +  SF +YT+PGYLFP L+  SW+CW + +
Sbjct  198   TLVQVSLFRALHEKDDQR--MSRGKFFLIALICSFCWYTVPGYLFPTLSSISWICWAFSK  255

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TA Q+GS   GLG+G  TLDW+ +S++  SPL+SP+ AI NV VG+V+ +YI++P+ Y
Sbjct  256   SVTAHQLGSGMDGLGIGALTLDWSVVSSFLFSPLMSPFFAIANVFVGYVVVMYIVIPISY  315

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W  + ++A+ FPIFS+ LFTS G  Y+   ++  +F++++  YE   +++
Sbjct  316   WGVDLYNAKTFPIFSSHLFTSHGQTYNVSAIVNDKFEIDIANYEEQGRIH  365



>ref|XP_010458316.1| PREDICTED: oligopeptide transporter 2-like [Camelina sativa]
Length=736

 Score =   216 bits (551),  Expect(2) = 3e-97, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 131/172 (76%), Gaps = 1/172 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            PVEEV L V   DDP+LPV TFR WFLG+ SC++L FLNTFF YRTQPL I+ I +Q+  
Sbjct  23   PVEEVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRTQPLMITMISVQVVT  82

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            LP+GK MA  LPE K+   G W F+LNPGPFN+KEHV+I++ AN G   G G AY++G +
Sbjct  83   LPLGKLMARVLPETKYK-IGSWEFSLNPGPFNVKEHVLISMFANAGAGFGSGTAYAVGIV  141

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             I+ A+YK+ +SFL   I+V+TTQ++GYGWAG++R+ +VDP  MWWP+++L+
Sbjct  142  DIIVAFYKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQ  193


 Score =   167 bits (424),  Expect(2) = 3e-97, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 118/167 (71%), Gaps = 2/167 (1%)
 Frame = +1

Query  631   QVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRSIT  810
             QVSLFRALHE +  ++ M+R +FF++    SF +Y  P YLF  L+  SWVCW +P+SIT
Sbjct  193   QVSLFRALHEKD--NARMSRGKFFVIAFVCSFAWYIFPAYLFLTLSSISWVCWAFPKSIT  250

Query  811   AQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYWKY  990
             AQQ+GS   GLG+G F LDW+ I++Y GSPLV+P+ AI+NV VG+++ +Y+++P+ Y+  
Sbjct  251   AQQLGSGMSGLGIGAFALDWSVIASYLGSPLVTPFFAIVNVFVGYILVMYMVIPISYYGM  310

Query  991   NTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             N ++A KFPIFS+ LF   G  Y+   ++  +F+L++  Y+   ++Y
Sbjct  311   NMYEANKFPIFSSDLFDKQGQLYNISTIVNDKFELDMGNYQQEGRVY  357



>gb|KDP35526.1| hypothetical protein JCGZ_08964 [Jatropha curcas]
Length=745

 Score =   202 bits (515),  Expect(2) = 3e-97, Method: Compositional matrix adjust.
 Identities = 97/193 (50%), Positives = 133/193 (69%), Gaps = 6/193 (3%)
 Frame = +2

Query  62   SGLNPATAGEKTAPSG-GRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            +G++P+       P      P+++V L VP TDDPTLP LTFR W LG+ SC +L F+N 
Sbjct  8    NGIHPSDEPNILEPEEENDSPIDQVRLTVPITDDPTLPCLTFRTWVLGLISCAVLAFVNQ  67

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKF-APFGRWSFTLNPGPFNIKEHVII  415
            FF YR  PL +S++  QI VLPIGK MAA+LPE+    P  +WSF+LNPGPFN+KEHV+I
Sbjct  68   FFQYRQNPLYVSSVAAQIVVLPIGKLMAASLPEKLIQVPGTKWSFSLNPGPFNLKEHVLI  127

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ AN G +P     Y++  ITI+KA+Y + +  L   ++ LTTQ++GYGWAGV R++LV
Sbjct  128  TIFANSGSNP----VYAVNIITIVKAFYHRKIHALAAFLLTLTTQMLGYGWAGVFRKFLV  183

Query  596  DPVDMWWPSTLLK  634
            D   MWWP+ L++
Sbjct  184  DSPYMWWPANLVQ  196


 Score =   181 bits (460),  Expect(2) = 3e-97, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 125/172 (73%), Gaps = 3/172 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E +   G++R++FFL+V+ +SF YY +P YLF  +T  S+VCW+W 
Sbjct  193   NLVQVSLFRALHEDEARPKGGLSRLQFFLIVLVSSFAYYIVPNYLFQSITALSFVCWIWK  252

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              SITAQQIGS  +GLG+G F  DW+ IS++ GSPL +P  A++N+  GFV+ +YI++P+ 
Sbjct  253   DSITAQQIGSGLYGLGIGSFAFDWSTISSFLGSPLATPGFAVMNLLAGFVIILYIMIPVA  312

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVL-TPQFDLNVPAYESYSKLY  1131
             YW  N+++A++FP+FS  +F +TG  YD   VL +  F  N  AY+SYSK++
Sbjct  313   YWT-NSYEAKRFPLFSPHVFNATGQPYDVNLVLNSSTFSFNEQAYDSYSKVH  363



>gb|KJB32171.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=951

 Score =   219 bits (557),  Expect(2) = 3e-97, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 137/190 (72%), Gaps = 2/190 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +  + G          P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  217  DATSGGNHDVEDDEISPIEQVRLTVTNTDDPTLPVWTFRMWFLGLFSCALLSFLNQFFSY  276

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q+S LPIG FMA+ LP+ +F    FG   F+LNPGPFN+KEHV+I + 
Sbjct  277  RTEPLIITQITVQVSTLPIGHFMASVLPKTQFGIPGFGSKRFSLNPGPFNMKEHVLICIF  336

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY+IG + I+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  337  ANAGSAFGNGSAYAIGIVNIIKAFYGRNISFLAGWLLIITTQVLGYGWAGLLRKYVVEPA  396

Query  605  DMWWPSTLLK  634
             MWWPSTL++
Sbjct  397  HMWWPSTLVQ  406


 Score =   165 bits (418),  Expect(2) = 3e-97, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 124/169 (73%), Gaps = 1/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             L QVSLFRALHE + K+   MTR +FFL+++  SFV+Y +PGYLF  LT  SW+CW++ +
Sbjct  404   LVQVSLFRALHEKDDKNDRRMTRAKFFLIILICSFVWYLVPGYLFTTLTSISWICWIFSK  463

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G FTLDW+ ++++  SPL+SP+ AI NV VG+V+ IYI +P+ Y
Sbjct  464   SVTAQQIGSGLRGLGLGAFTLDWSAVASFLFSPLISPFFAIANVFVGYVLIIYIAIPVAY  523

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W  + ++A +FPIFS+ LFT+ G KY+   ++  +F++++  YE   ++
Sbjct  524   WGLDLYNASRFPIFSSHLFTAQGQKYNITAIVNDKFEIDLAKYEEQGRI  572


 Score =   183 bits (464),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 117/164 (71%), Gaps = 3/164 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGR-CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            N A  GE  A       P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF 
Sbjct  19   NHAIKGENAAADDDELSPIEEVRLTVTNTDDPTLPVWTFRMWFLGLISCALLSFLNQFFA  78

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITV  421
            YRT+PL I+ I +Q++ LPIG+FMAA LP R+F     G   F+LNPGPFN+KEHV+I++
Sbjct  79   YRTEPLIITQITVQVATLPIGQFMAAVLPRRQFKLPGVGSRKFSLNPGPFNMKEHVLISI  138

Query  422  MANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQL  553
             AN G + G G AY++G +TI+KA+Y++ +SFL G ++++TTQL
Sbjct  139  FANAGSAFGSGSAYAVGIVTIIKAFYQRKISFLAGWLLIITTQL  182



>gb|KJB32169.1| hypothetical protein B456_005G227300 [Gossypium raimondii]
Length=753

 Score =   219 bits (557),  Expect(2) = 3e-97, Method: Compositional matrix adjust.
 Identities = 101/190 (53%), Positives = 137/190 (72%), Gaps = 2/190 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +  + G          P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  19   DATSGGNHDVEDDEISPIEQVRLTVTNTDDPTLPVWTFRMWFLGLFSCALLSFLNQFFSY  78

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q+S LPIG FMA+ LP+ +F    FG   F+LNPGPFN+KEHV+I + 
Sbjct  79   RTEPLIITQITVQVSTLPIGHFMASVLPKTQFGIPGFGSKRFSLNPGPFNMKEHVLICIF  138

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY+IG + I+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  139  ANAGSAFGNGSAYAIGIVNIIKAFYGRNISFLAGWLLIITTQVLGYGWAGLLRKYVVEPA  198

Query  605  DMWWPSTLLK  634
             MWWPSTL++
Sbjct  199  HMWWPSTLVQ  208


 Score =   165 bits (417),  Expect(2) = 3e-97, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 124/169 (73%), Gaps = 1/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             L QVSLFRALHE + K+   MTR +FFL+++  SFV+Y +PGYLF  LT  SW+CW++ +
Sbjct  206   LVQVSLFRALHEKDDKNDRRMTRAKFFLIILICSFVWYLVPGYLFTTLTSISWICWIFSK  265

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G FTLDW+ ++++  SPL+SP+ AI NV VG+V+ IYI +P+ Y
Sbjct  266   SVTAQQIGSGLRGLGLGAFTLDWSAVASFLFSPLISPFFAIANVFVGYVLIIYIAIPVAY  325

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W  + ++A +FPIFS+ LFT+ G KY+   ++  +F++++  YE   ++
Sbjct  326   WGLDLYNASRFPIFSSHLFTAQGQKYNITAIVNDKFEIDLAKYEEQGRI  374



>ref|XP_008338986.1| PREDICTED: oligopeptide transporter 2-like [Malus domestica]
Length=733

 Score =   223 bits (568),  Expect(2) = 4e-97, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 139/189 (74%), Gaps = 5/189 (3%)
 Frame = +2

Query  68   LNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            + PAT  ++   S    PVEEV L V   DDPTLPV TFR W LG+ SC +L FLNTFF 
Sbjct  7    IEPATKHDENDVS----PVEEVRLTVSNDDDPTLPVWTFRMWTLGLASCALLSFLNTFFS  62

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            YRT+PL IS I +Q++ LPIG+FMA  LP+RKF   G   F+LNPGPFN+KEHV+I++ A
Sbjct  63   YRTEPLXISXISVQVATLPIGRFMARXLPKRKFQ-IGXKEFSLNPGPFNMKEHVLISIFA  121

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N G   G G AY+I  + I+KA+Y + +SFL   I+V+TTQ++GYGWAG+LRRY+VDP +
Sbjct  122  NAGSGFGSGTAYAISIVDIIKAFYHRKISFLASWILVITTQVLGYGWAGILRRYVVDPAE  181

Query  608  MWWPSTLLK  634
            MWWPS+L++
Sbjct  182  MWWPSSLVQ  190


 Score =   160 bits (406),  Expect(2) = 4e-97, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 124/169 (73%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALHE +  ++ M+R +FF + +  SF ++ +PGYLFP L+  SWVCW++P+
Sbjct  187   SLVQVSLFRALHEKD--NNRMSRGKFFFIALXCSFAWFVVPGYLFPTLSTISWVCWIYPK  244

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G F+LDW  I++Y  SPL+SP+ AI+NVA G+V+ +Y+++P+ Y
Sbjct  245   SVTAQQIGSGMGGLGIGAFSLDWTVIASYLYSPLISPFFAIVNVAAGYVLVMYMLLPIAY  304

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W  N ++A+ F IFS+ LF + G  Y+   ++  +F++++PAYE   ++
Sbjct  305   WGVNLYNAKNFAIFSSHLFDAGGQIYNVSALVNNKFEIDMPAYERQGRI  353



>ref|XP_006285678.1| hypothetical protein CARUB_v10007142mg [Capsella rubella]
 gb|EOA18576.1| hypothetical protein CARUB_v10007142mg [Capsella rubella]
Length=736

 Score =   201 bits (511),  Expect(2) = 4e-97, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 126/174 (72%), Gaps = 4/174 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC V EV L VP+TDD TLPVLTFR W LGI +CI+L F+N FF YRT PLSI+ I  QI
Sbjct  18   RCVVPEVELTVPKTDDSTLPVLTFRMWVLGIGACIVLSFINQFFWYRTMPLSITGISAQI  77

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA  LP R F    R+ FTLNPG FN+KEHV+IT+ AN     G G  Y+  
Sbjct  78   AVVPLGHLMARVLPTRSFLEGSRFQFTLNPGAFNVKEHVLITIFANS----GAGSVYATH  133

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             ++ +K YYK++L FL   ++++TTQ++G+GWAG+ R++LV+P +MWWPS L++
Sbjct  134  ILSAIKLYYKRSLPFLPAFLVMITTQILGFGWAGLFRKHLVEPGEMWWPSNLVQ  187


 Score =   182 bits (463),  Expect(2) = 4e-97, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 114/165 (69%), Gaps = 2/165 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKS-SGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLF ALHE E K+  GM+R +FFL+V+ ASF YY  PGYLF +LT  SWVCW  P
Sbjct  184   NLVQVSLFGALHEKEKKARGGMSRTQFFLIVLVASFAYYIFPGYLFTMLTSISWVCWFNP  243

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +SI   Q+GS  HGLG+G    DW  ISAY GSPL SP  A +NVA+GFV+ +YI+ P+C
Sbjct  244   KSILVNQLGSGEHGLGIGSIGFDWVTISAYLGSPLASPLFASVNVAIGFVLVMYIVTPVC  303

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYE  1113
             YW  N +DA+ FPIFS+QLF + G +YD   ++  +F L+   Y 
Sbjct  304   YW-LNIYDAKTFPIFSSQLFMANGSRYDVLSIIDNKFHLDRLVYS  347



>gb|KHG09371.1| Oligopeptide transporter 4 -like protein [Gossypium arboreum]
Length=753

 Score =   218 bits (556),  Expect(2) = 4e-97, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 137/190 (72%), Gaps = 2/190 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +  + G          P+E+V L V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  19   DATSGGNHDVEDDEISPIEQVRLTVTNTDDPTLPVWTFRMWFLGLFSCALLSFLNQFFSY  78

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q+S LPIG FMA+ LP+ +F    FG   F+LNPGPFN+KEHV+I + 
Sbjct  79   RTEPLIITQITVQVSTLPIGHFMASVLPKTQFGIPGFGSKRFSLNPGPFNMKEHVLICIF  138

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY++G + I+KA+Y + +SFL G ++++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  139  ANAGSAFGNGSAYAVGIVNIIKAFYGRNISFLAGWLLIITTQVLGYGWAGLLRKYVVEPA  198

Query  605  DMWWPSTLLK  634
             MWWPSTL++
Sbjct  199  HMWWPSTLVQ  208


 Score =   165 bits (418),  Expect(2) = 4e-97, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 124/169 (73%), Gaps = 1/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             L QVSLFRALHE + K+   MTR +FFL+++  SFV+Y +PGYLF  LT  SW+CW++ +
Sbjct  206   LVQVSLFRALHEKDDKNDRRMTRAKFFLIILICSFVWYLVPGYLFTTLTSISWICWIFSK  265

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G FTLDW+ ++++  SPL+SP+ AI NV VG+V+ IYI +P+ Y
Sbjct  266   SVTAQQIGSGLKGLGLGAFTLDWSAVASFLFSPLISPFFAIANVFVGYVLIIYIAIPVAY  325

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W  + ++A +FPIFS+ LFT+ G KY+   ++  +F++++  YE   ++
Sbjct  326   WGLDLYNASRFPIFSSHLFTAQGQKYNITAIVNDKFEIDLAKYEEQGRI  374



>ref|XP_009366376.1| PREDICTED: oligopeptide transporter 2-like [Pyrus x bretschneideri]
Length=734

 Score =   223 bits (567),  Expect(2) = 5e-97, Method: Compositional matrix adjust.
 Identities = 107/189 (57%), Positives = 139/189 (74%), Gaps = 5/189 (3%)
 Frame = +2

Query  68   LNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            + PAT  ++   S    PVEEV L V   DDPTLPV TFR W LG+ SC +L FLNTFF 
Sbjct  8    IEPATKHDENDVS----PVEEVRLTVSNDDDPTLPVWTFRMWTLGLASCALLSFLNTFFS  63

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            YRT+PL IS I +Q++ LPIG+FMA  LP+RKF   G   F+LNPGPFN+KEHV+I++ A
Sbjct  64   YRTEPLIISMISVQVATLPIGRFMARALPKRKFQ-IGSKEFSLNPGPFNMKEHVLISIFA  122

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            N G   G G AY+I  + I+KA+Y + +SFL   I+V+TTQ++GYGWAG+LRRY+VDP +
Sbjct  123  NAGSGFGSGTAYAISIVDIIKAFYHRKISFLASWILVITTQVLGYGWAGILRRYVVDPAE  182

Query  608  MWWPSTLLK  634
            MWWPS+L++
Sbjct  183  MWWPSSLVQ  191


 Score =   161 bits (407),  Expect(2) = 5e-97, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 125/169 (74%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALHE +  ++ M+R +FF + +  SF ++ +PGYLFP L+  SWVCW++P+
Sbjct  188   SLVQVSLFRALHEKD--NNRMSRGKFFFIALICSFAWFVVPGYLFPTLSTISWVCWIYPK  245

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G F+LDW  I++Y  SPL+SP+ AI+NVA G+V+ +Y+++P+ Y
Sbjct  246   SVTAQQIGSGMGGLGIGAFSLDWTVIASYLYSPLISPFFAIVNVAAGYVLVMYMLLPIAY  305

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W  N ++A+ F IFS+ LF ++G  Y+   ++  +F++++PAYE   ++
Sbjct  306   WGVNLYNAKNFAIFSSHLFDASGQIYNVSALVNNKFEIDMPAYERQGRI  354



>gb|EYU45286.1| hypothetical protein MIMGU_mgv1a0020142mg, partial [Erythranthe 
guttata]
Length=521

 Score =   203 bits (517),  Expect(2) = 7e-97, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 130/174 (75%), Gaps = 4/174 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
             CP+++V + VP+TDDPT+PV TFR WFLGIT+C++L F+N FF YR++PL I +I  QI
Sbjct  10   ECPIKQVEVTVPKTDDPTVPVYTFRMWFLGITACLLLSFVNQFFWYRSEPLVIGSISAQI  69

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA  L +R F    R+ F+LNPGPFN+KEHV+IT++AN     G G  Y+  
Sbjct  70   AVVPLGHLMARILTKRVFLQGTRFEFSLNPGPFNMKEHVMITMLANA----GAGSVYATH  125

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             ++ +K YYK++  FL   I+++T+QL+GYGWAG+ R++LV+P +MWWPS L++
Sbjct  126  ILSAVKLYYKKSFGFLPAFIVMMTSQLLGYGWAGIFRKHLVEPAEMWWPSNLVQ  179


 Score =   179 bits (455),  Expect(2) = 7e-97, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 114/171 (67%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMT-RMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E +  G T R +FFL+ +  SF YY  PGY+F +LT  SW+CW+ P
Sbjct  176   NLVQVSLFRALHEKETRPKGGTSRTQFFLIALVCSFAYYIFPGYIFQMLTSLSWICWLAP  235

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +S+  QQ+GS   GLG+G   LDW+ IS+Y GSPL SPW A  N AVGF + +Y+IVPL 
Sbjct  236   KSVLVQQLGSGLQGLGIGSIGLDWSTISSYLGSPLASPWFASANAAVGFFLMMYVIVPLG  295

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW  N ++A+ FPI+S+ LF   G KY+T  ++   F+L+  AY     LY
Sbjct  296   YW-LNIYNAKNFPIYSSNLFQFDGSKYNTTAIINSNFNLDKAAYNESGPLY  345



>ref|XP_010030910.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
 gb|KCW56910.1| hypothetical protein EUGRSUZ_I02586 [Eucalyptus grandis]
Length=742

 Score =   202 bits (514),  Expect(2) = 7e-97, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 129/174 (74%), Gaps = 7/174 (4%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L VP TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I + ++ 
Sbjct  32   PIEEVHLTVPNTDDPTLPVWTFRMWFLGLLSCALLSFLNQFFSYRTEPLFITQITVVVAT  91

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG+FMAA LPE KF     G   F+LNPGPFN+KEHV+I++ AN  VS     AY + 
Sbjct  92   LPIGRFMAAMLPEAKFRIPGLGPRLFSLNPGPFNMKEHVLISIFANAAVS-----AYGVR  146

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I+KA+Y + +SF  G ++++TTQ++GYGWAG+LR+Y+V+P  MWWP+ L++
Sbjct  147  IVNIIKAFYHRRISFRAGWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPANLVQ  200


 Score =   180 bits (457),  Expect(2) = 7e-97, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 117/170 (69%), Gaps = 2/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NL QVSLFRALHE + K   M+R +FFL+ +  SF +Y +PGYLF  ++  SWVCW +  
Sbjct  197   NLVQVSLFRALHERDEKH--MSRAKFFLIALICSFSWYVVPGYLFSTVSNISWVCWAFSN  254

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLGVG  TLDW  +S+Y GSPL+SP  A +NV  G+   +Y+++P  Y
Sbjct  255   SVTAQQIGSGMKGLGVGALTLDWTVVSSYLGSPLISPLFATVNVFAGYTFIVYVVIPTAY  314

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W +N + A +FPIFS+QLFT+ G +Y    ++  +F+L++P YE   +++
Sbjct  315   WGFNLYSANRFPIFSSQLFTAQGQRYKITAIVNDKFELDIPKYEEQGRIH  364



>ref|XP_010065749.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=756

 Score =   215 bits (548),  Expect(2) = 8e-97, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 138/190 (73%), Gaps = 2/190 (1%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             P    +         P+E+V L+V  TDDPTLPV TFR WFLG+ SC +L FLN FF Y
Sbjct  25   KPVAPNDVDDAEDDLSPIEQVRLIVTNTDDPTLPVWTFRMWFLGVLSCALLSFLNQFFAY  84

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFG--RWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q++ LPIG+FMAA LP  +F   G  R +F+LNPGPFN+KEHV+I++ 
Sbjct  85   RTEPLVITQITVQVATLPIGRFMAAVLPTAEFRIPGLRRRTFSLNPGPFNMKEHVLISIF  144

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY++G + I+KA+Y +++SF  G ++++TTQ++GYGWAG+LR+Y V+P 
Sbjct  145  ANAGSAFGSGPAYAVGIVNIIKAFYLRSISFFAGWLLIITTQVLGYGWAGLLRKYAVEPA  204

Query  605  DMWWPSTLLK  634
             MWWPSTL++
Sbjct  205  HMWWPSTLVQ  214


 Score =   167 bits (423),  Expect(2) = 8e-97, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 115/169 (68%), Gaps = 2/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE + +   M+R +FF++ +  SF +Y +PGYLF  LT  SW+CW++ +S
Sbjct  212   LVQVSLFRALHEKDDQR--MSRAKFFIIALICSFSWYVVPGYLFSTLTNISWICWIFSKS  269

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS   GLG+G  TLDW  ++++  SPL+ P+ AI+N+  G+ + +Y+ +PL YW
Sbjct  270   VTAQQIGSGMKGLGLGALTLDWTVVASFLFSPLICPFFAIMNIFAGYALVVYVAIPLAYW  329

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              +N + A +FPIFS+ LFT  G  Y+   ++   F+L++  YE   +++
Sbjct  330   GFNLYGADRFPIFSSNLFTKQGQAYNITAIVNSNFELDLAKYEDQGRIH  378



>gb|KCW63396.1| hypothetical protein EUGRSUZ_G01042, partial [Eucalyptus grandis]
Length=720

 Score =   215 bits (548),  Expect(2) = 9e-97, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 136/174 (78%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+V L+V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  5    PIEQVRLIVTNTDDPTLPVWTFRMWFLGVLSCALLSFLNQFFAYRTEPLVITQITVQVAT  64

Query  299  LPIGKFMAATLPERKFAPFG--RWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG+FMAA LP  +F   G  R +F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  65   LPIGRFMAAVLPTAEFRIPGLRRRTFSLNPGPFNMKEHVLISIFANAGSAFGSGPAYAVG  124

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I+KA+Y +++SF  G ++++TTQ++GYGWAG+LR+Y V+P  MWWPSTL++
Sbjct  125  IVNIIKAFYLRSISFFAGWLLIITTQVLGYGWAGLLRKYAVEPAHMWWPSTLVQ  178


 Score =   167 bits (423),  Expect(2) = 9e-97, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 115/169 (68%), Gaps = 2/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE + +   M+R +FF++ +  SF +Y +PGYLF  LT  SW+CW++ +S
Sbjct  176   LVQVSLFRALHEKDDQR--MSRAKFFIIALICSFSWYVVPGYLFSTLTNISWICWIFSKS  233

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS   GLG+G  TLDW  ++++  SPL+ P+ AI+N+  G+ + +Y+ +PL YW
Sbjct  234   VTAQQIGSGMKGLGLGALTLDWTVVASFLFSPLICPFFAIMNIFAGYALVVYVAIPLAYW  293

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              +N + A +FPIFS+ LFT  G  Y+   ++   F+L++  YE   +++
Sbjct  294   GFNLYGADRFPIFSSNLFTKQGQAYNITAIVNSNFELDLAKYEDQGRIH  342



>ref|XP_010112260.1| Oligopeptide transporter 4 [Morus notabilis]
 gb|EXC33016.1| Oligopeptide transporter 4 [Morus notabilis]
Length=742

 Score =   209 bits (532),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 101/175 (58%), Positives = 136/175 (78%), Gaps = 2/175 (1%)
 Frame = +2

Query  116  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  295
             P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRTQPL I+ I +Q++
Sbjct  26   SPIEEVRLTVTNTDDPTLPVWTFRMWFLGLLSCGLLSFLNQFFAYRTQPLVITQITVQVA  85

Query  296  VLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSI  469
             LPIG FMA TLP+ +F    FG   F++NPGPFNIKEHV+I++ AN G + G G AY++
Sbjct  86   TLPIGHFMARTLPKTRFRLPGFGERRFSVNPGPFNIKEHVLISIFANAGSAFGSGSAYAV  145

Query  470  GAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            G +TI+KA+Y++++SF    I+++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  146  GIVTIIKAFYRRSISFWASWILIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  200


 Score =   173 bits (438),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 79/170 (46%), Positives = 119/170 (70%), Gaps = 2/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE + +   M++ +FFL+ +  SF +Y  PGYLF  LT  SW+CWV+ +
Sbjct  197   TLVQVSLFRALHEKDEQR--MSQAKFFLIALICSFSWYVFPGYLFSTLTNISWICWVFSK  254

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G FTLDW+ ++++  SPL+SP+ AI+NV +G+V+ IY+ +P+ Y
Sbjct  255   SVTAQQIGSGMRGLGLGSFTLDWSAVASFLFSPLISPFFAIVNVFLGYVLLIYVAIPIAY  314

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W  + + A KFPIFS+ LFT+ G  YD   ++  +F+L++  Y    +++
Sbjct  315   WGVDLYGASKFPIFSSHLFTAKGQTYDITAIVNDKFELDIEKYAEQGRIH  364



>ref|XP_003603705.1| Oligopeptide transporter [Medicago truncatula]
 gb|AES73956.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=726

 Score =   209 bits (533),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 132/174 (76%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV  VV   DD  LP+ TFR W +GI S ++L ++NTFFIYRTQPL+++ I +Q++ 
Sbjct  12   PIEEVRAVVSNEDDQNLPIWTFRMWTMGIISVVLLSYINTFFIYRTQPLTVTMITIQVAT  71

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG+FMA  LP +KF    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++ 
Sbjct  72   LPIGRFMAKVLPTKKFRIIGFGEREFSLNPGPFNVKEHVLISMFANAGAAFGSGTAYALS  131

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I++ +Y + ++FL   I+VLTTQ++GYGWAG++R+Y+VDP +MWWPSTL++
Sbjct  132  IVDIIRVFYYRKITFLTSWILVLTTQVLGYGWAGIMRKYVVDPAEMWWPSTLMQ  185


 Score =   172 bits (437),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 74/164 (45%), Positives = 120/164 (73%), Gaps = 2/164 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFR LHE +   + M++ +FFL+ +  SF +Y +PGYLF  L+  SWVCW++P S
Sbjct  183   LMQVSLFRTLHEKD--ENRMSKGKFFLIALMCSFAWYVVPGYLFATLSIISWVCWIFPNS  240

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TA QIGS  +GLG+G F+LDW  I+++ G+PLV+P  A +N+ VG+++ IYI++P  YW
Sbjct  241   VTAHQIGSGKNGLGLGSFSLDWTTIASFLGNPLVTPIFATVNILVGYILLIYILIPTAYW  300

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYES  1116
              +N ++A+ FPI+SN+LF++ G +Y+   ++  +F++++ AY +
Sbjct  301   GFNLYNAKNFPIYSNELFSAQGVRYNVTAIVNNKFEIDMDAYNN  344



>gb|EPS60835.1| hypothetical protein M569_13965 [Genlisea aurea]
Length=743

 Score =   214 bits (545),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 133/188 (71%), Gaps = 6/188 (3%)
 Frame = +2

Query  74   PATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
            P +A +   P     P+EEV L VP TDDP+LP LTFR WFLGI SC  L +LN FF YR
Sbjct  12   PESAAKNDEPLND-SPIEEVRLTVPTTDDPSLPCLTFRTWFLGIISCAALSYLNQFFSYR  70

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFA-PFGRWSFTLNPGPFNIKEHVIITVMAN  430
              PLSI+++  QI VLP+GKFMAATLPER+F  P   WSF+LNPGPFN+KEH +IT+ AN
Sbjct  71   RNPLSITSVSAQILVLPVGKFMAATLPERRFRFPGTNWSFSLNPGPFNMKEHCLITIFAN  130

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
             G S      Y+IG +TI+KA+Y + L  L  +I+  +TQL+GYGWAG+ R++LVD   M
Sbjct  131  AGAS----GVYAIGIVTIVKAFYHRKLHPLAAMILTHSTQLLGYGWAGIFRKFLVDSPYM  186

Query  611  WWPSTLLK  634
            WWPS L++
Sbjct  187  WWPSNLVQ  194


 Score =   168 bits (425),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 125/171 (73%), Gaps = 3/171 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALH+ EV+   G+TR++FF +V+ +SF YY +PGYLFP +T  S+VCW+W 
Sbjct  191   NLVQVSLFRALHDVEVRRKGGLTRLQFFAIVLVSSFSYYVVPGYLFPSITALSFVCWIWK  250

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+TAQQIGS  +GLG+G F  DWA   ++ GSPL +P  A++N+ VGFV+ +Y+ +PL 
Sbjct  251   DSVTAQQIGSGLNGLGLGSFAFDWATTVSFIGSPLATPGFAMINILVGFVLTVYVFLPLA  310

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQ-FDLNVPAYESYSKL  1128
             YW  N +DA+KFPI S+ +F STGH Y+   +LT + F+ N   Y+SYSK+
Sbjct  311   YWT-NLYDAKKFPIISSHVFDSTGHPYNVSKILTGRSFEFNREGYDSYSKI  360



>ref|XP_009775420.1| PREDICTED: oligopeptide transporter 2-like [Nicotiana sylvestris]
Length=733

 Score =   219 bits (559),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 102/171 (60%), Positives = 131/171 (77%), Gaps = 5/171 (3%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V   DDP+LPV TFR WFLGI SC IL FLNTFF YRTQPLSIS I +QI+ 
Sbjct  26   PIEEVRLTVSNEDDPSLPVWTFRMWFLGILSCGILAFLNTFFSYRTQPLSISMITVQIAA  85

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            LP+GK MA  LP RKF   G W F+ NPGPFN+KEHV+I++ ANC    G G AY++  +
Sbjct  86   LPLGKIMARVLPTRKFK-IGSWEFSFNPGPFNMKEHVLISIFANC----GSGTAYAVSIV  140

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLL  631
            TI+KA+Y + +SF+ G I+V+TTQ++GYGWAG++R+Y+VDP +MWWP  ++
Sbjct  141  TIIKAFYLRNISFVAGWILVVTTQVLGYGWAGIMRKYVVDPAEMWWPGNMV  191


 Score =   162 bits (410),  Expect(2) = 1e-96, Method: Compositional matrix adjust.
 Identities = 75/169 (44%), Positives = 113/169 (67%), Gaps = 1/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             N+  VSLFRALHE +      +R +FFL+V+  SF +Y +PG+LFP L+  S +C  +P+
Sbjct  189   NMVLVSLFRALHEKDADGKS-SRGKFFLVVLACSFTWYIVPGFLFPTLSNISLLCLFYPK  247

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+ AQQIGS   GLG+  FT DW+ +++Y GSPLV P  AI+NV VG+V  +YI++P+ Y
Sbjct  248   SVLAQQIGSGMKGLGILSFTFDWSVVASYLGSPLVCPLFAIINVIVGYVAVVYILIPISY  307

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W +N ++AR FP+ S+ LF + G  YD   ++  +F+L+  AY    ++
Sbjct  308   WGFNIYNARTFPLLSSHLFNAQGQTYDITAIVNDKFELDEMAYAKEGRI  356



>gb|KDO78543.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=490

 Score =   308 bits (789),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E KS G+TRM+FFL+V+ ASF YY+LPGYLFPILTFFSWVCW WP 
Sbjct  190   NLAQVSLFRALHEKESKSKGLTRMQFFLIVLAASFAYYSLPGYLFPILTFFSWVCWAWPH  249

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLG+G FTLDWAGISAYHGSPLV+PWT+ILNV +GFVMFIYIIVPLCY
Sbjct  250   SITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVTPWTSILNVGIGFVMFIYIIVPLCY  309

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK++TFDARKFPIFSNQLFTS+GHKYDT  +LTPQ+DLN+PAY SY KLY
Sbjct  310   WKFDTFDARKFPIFSNQLFTSSGHKYDTTKILTPQYDLNIPAYNSYGKLY  359


 Score =   300 bits (769),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 170/203 (84%), Gaps = 9/203 (4%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            N    G+ T     RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +
Sbjct  10   NENPNGDSTEE---RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTF  66

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQI+VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  67   RTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFAN  125

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDPV+M
Sbjct  126  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPVEM  185

Query  611  WWPS-----TLLKCLYSEHSMKR  664
            WWPS     +L + L+ + S  +
Sbjct  186  WWPSNLAQVSLFRALHEKESKSK  208



>ref|XP_002306519.1| hypothetical protein POPTR_0005s19410g [Populus trichocarpa]
 gb|EEE93515.1| hypothetical protein POPTR_0005s19410g [Populus trichocarpa]
Length=747

 Score =   211 bits (536),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 133/176 (76%), Gaps = 4/176 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+V L VP TDDP+LPV TFR WFLGI SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  23   PIEQVRLTVPNTDDPSLPVWTFRMWFLGILSCCLLSFLNQFFAYRTEPLIITQITVQVAT  82

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG+F+A  LP+ KF    FG   F+ NPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  83   LPIGRFLATVLPKTKFNILGFGSREFSFNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  142

Query  473  AITIM--KAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I+  KA+Y + +SF    ++++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  143  IVNIIKSKAFYGRNISFFSAWVLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  198


 Score =   171 bits (432),  Expect(2) = 2e-96, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 121/170 (71%), Gaps = 1/170 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             L Q+SLFR LHE E K+   ++R++FF++ M  SF++Y LPGYLF  L   +W+C+ +P 
Sbjct  196   LVQISLFRTLHEKEDKNEHRISRVKFFVIAMTCSFLWYLLPGYLFQTLQSIAWICYAFPH  255

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G  TLDW+ +++Y  SPL++P+ AI+NV VG+ + +Y+++P+ Y
Sbjct  256   SVTAQQIGSGMRGLGIGALTLDWSTVASYLYSPLLTPFFAIVNVFVGYALIMYVVIPISY  315

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W  N +DA+ FPIFS+ LF + G  Y+   V+  +F+L++  Y+ + +++
Sbjct  316   WGLNVYDAKTFPIFSSHLFDARGASYNITEVVNDKFELDLAQYDKHGRVH  365



>gb|KDO78544.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=554

 Score =   309 bits (791),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E KS G+TRM+FFL+V+ ASF YY+LPGYLFPILTFFSWVCW WP 
Sbjct  190   NLAQVSLFRALHEKESKSKGLTRMQFFLIVLAASFAYYSLPGYLFPILTFFSWVCWAWPH  249

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLG+G FTLDWAGISAYHGSPLV+PWT+ILNV +GFVMFIYIIVPLCY
Sbjct  250   SITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVTPWTSILNVGIGFVMFIYIIVPLCY  309

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK++TFDARKFPIFSNQLFTS+GHKYDT  +LTPQ+DLN+PAY SY KLY
Sbjct  310   WKFDTFDARKFPIFSNQLFTSSGHKYDTTKILTPQYDLNIPAYNSYGKLY  359


 Score =   300 bits (769),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 170/203 (84%), Gaps = 9/203 (4%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            N    G+ T     RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +
Sbjct  10   NENPNGDSTEE---RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTF  66

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQI+VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  67   RTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFAN  125

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDPV+M
Sbjct  126  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPVEM  185

Query  611  WWPS-----TLLKCLYSEHSMKR  664
            WWPS     +L + L+ + S  +
Sbjct  186  WWPSNLAQVSLFRALHEKESKSK  208



>ref|XP_010052485.1| PREDICTED: oligopeptide transporter 1-like [Eucalyptus grandis]
Length=754

 Score =   197 bits (501),  Expect(2) = 7e-96, Method: Compositional matrix adjust.
 Identities = 93/190 (49%), Positives = 129/190 (68%), Gaps = 5/190 (3%)
 Frame = +2

Query  68   LNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            L P      ++     CP+E+V L V   DDPTLP LT R W LGIT+C  L FLN FF 
Sbjct  19   LQPDDHSFDSSDEVNDCPIEQVRLTVSIKDDPTLPCLTIRTWILGITACTTLAFLNQFFG  78

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPER-KFAPFGRWSFTLNPGPFNIKEHVIITVM  424
            YR   LS++++  QI VLP+GKFMAA LP++    P  +WSF+LNPGPFN+KEHV+IT+ 
Sbjct  79   YRQNALSLTSVSAQIVVLPLGKFMAAVLPKKVVHVPGTKWSFSLNPGPFNLKEHVLITIF  138

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G +    + Y++  ITI+ A+Y + + FL  +++ LTTQ++GYGWAG+ R++LVD  
Sbjct  139  ANTGST----NVYAMNIITIVMAFYHRHIHFLAAMLLTLTTQMLGYGWAGIFRKFLVDSP  194

Query  605  DMWWPSTLLK  634
             MWWP+ L++
Sbjct  195  YMWWPANLVQ  204


 Score =   182 bits (462),  Expect(2) = 7e-96, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 123/172 (72%), Gaps = 3/172 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE EV+   G+ R++FFL+V+ +SF YY +P YLFP +T  S+VCW+W 
Sbjct  201   NLVQVSLFRALHEEEVRPKGGLMRLQFFLIVLISSFAYYVVPNYLFPSITALSFVCWIWK  260

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+TAQQIGS   GLG+G F LDWA ++A+ GSPL +P  A++N+++GF + +Y+++P+ 
Sbjct  261   DSVTAQQIGSGRRGLGIGSFALDWATVAAFIGSPLATPGFALINISIGFFLMLYVLIPIA  320

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTP-QFDLNVPAYESYSKLY  1131
             YW  N F+A++FPI S+ +F + G KY+   VL    F  N   Y+ YSK++
Sbjct  321   YWT-NAFEAKRFPIISSHVFDANGGKYNVGLVLNETTFQFNQQGYDDYSKVH  371



>ref|XP_003570148.1| PREDICTED: oligopeptide transporter 4-like [Brachypodium distachyon]
Length=753

 Score =   201 bits (511),  Expect(2) = 8e-96, Method: Compositional matrix adjust.
 Identities = 90/200 (45%), Positives = 138/200 (69%), Gaps = 3/200 (2%)
 Frame = +2

Query  44   HIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIIL  223
             I  +  GL  A    +        P+EEV L VP  DD +LPV TFR W +G+ SC ++
Sbjct  3    EIAADERGLGAAVGKGEEEEEEETSPIEEVRLTVPSGDDASLPVWTFRMWSIGLVSCALM  62

Query  224  IFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKF---APFGRWSFTLNPGPFN  394
             FLN FF YRT+PL ++ I +Q++ LP+G F+A  LP RKF   A  G   ++LNPGPFN
Sbjct  63   SFLNQFFSYRTEPLIVTQITVQVASLPMGHFLARVLPARKFPVPALLGGGEWSLNPGPFN  122

Query  395  IKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAG  574
            +KEHV+I++ AN G + G G+AY++  + I++A+Y++++SF+   ++++TTQ++GYGWAG
Sbjct  123  MKEHVLISIFANAGYAFGNGNAYAVMIVDIIRAFYRRSISFVAAWLLIMTTQVLGYGWAG  182

Query  575  VLRRYLVDPVDMWWPSTLLK  634
            ++R+Y+V+P  MWWP TL++
Sbjct  183  LMRKYVVEPAHMWWPGTLVQ  202


 Score =   178 bits (452),  Expect(2) = 8e-96, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 119/171 (70%), Gaps = 3/171 (2%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSG---MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  795
             L QVSLFRALHE E    G   ++R +FFL+ +  SF +Y +PGYLFP LT  SWVCWV+
Sbjct  200   LVQVSLFRALHEKEEFPRGSRQISRSKFFLVALICSFGWYAVPGYLFPSLTSISWVCWVF  259

Query  796   PRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPL  975
              +S+TAQQ+GS   GLG+G FTLDW+ +S++  SPL+SP+ A  N+ VG+VMF+Y+IVP 
Sbjct  260   SKSVTAQQLGSGMKGLGLGAFTLDWSAVSSFLFSPLISPFFATANIFVGYVMFLYVIVPT  319

Query  976   CYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
              YW  N ++A+ FPIFS+ LFTS G  Y    ++  QF L+  AY+   ++
Sbjct  320   AYWGVNLYNAKTFPIFSSHLFTSNGSAYQINDIVNQQFQLDRDAYDKIGRI  370



>gb|KCW76554.1| hypothetical protein EUGRSUZ_D00943 [Eucalyptus grandis]
Length=732

 Score =   197 bits (501),  Expect(2) = 8e-96, Method: Compositional matrix adjust.
 Identities = 93/183 (51%), Positives = 128/183 (70%), Gaps = 5/183 (3%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E +A     CP+E+V L V   DDPTLP LT R W LGIT+C  L FLN FF YR   LS
Sbjct  4    EISADEVNDCPIEQVRLTVSIKDDPTLPCLTIRTWILGITACTTLAFLNQFFGYRQNALS  63

Query  269  ISAILMQISVLPIGKFMAATLPER-KFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  445
            ++++  QI VLP+GKFMAA LP++    P  +WSF+LNPGPFN+KEHV+IT+ AN G + 
Sbjct  64   LTSVSAQIVVLPLGKFMAAVLPKKVVHVPGTKWSFSLNPGPFNLKEHVLITIFANTGST-  122

Query  446  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPST  625
               + Y++  ITI+ A+Y + + FL  +++ LTTQ++GYGWAG+ R++LVD   MWWP+ 
Sbjct  123  ---NVYAMNIITIVMAFYHRHIHFLAAMLLTLTTQMLGYGWAGIFRKFLVDSPYMWWPAN  179

Query  626  LLK  634
            L++
Sbjct  180  LVQ  182


 Score =   182 bits (462),  Expect(2) = 8e-96, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 123/172 (72%), Gaps = 3/172 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE EV+   G+ R++FFL+V+ +SF YY +P YLFP +T  S+VCW+W 
Sbjct  179   NLVQVSLFRALHEEEVRPKGGLMRLQFFLIVLISSFAYYVVPNYLFPSITALSFVCWIWK  238

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+TAQQIGS   GLG+G F LDWA ++A+ GSPL +P  A++N+++GF + +Y+++P+ 
Sbjct  239   DSVTAQQIGSGRRGLGIGSFALDWATVAAFIGSPLATPGFALINISIGFFLMLYVLIPIA  298

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTP-QFDLNVPAYESYSKLY  1131
             YW  N F+A++FPI S+ +F + G KY+   VL    F  N   Y+ YSK++
Sbjct  299   YWT-NAFEAKRFPIISSHVFDANGGKYNVGLVLNETTFQFNQQGYDDYSKVH  349



>ref|XP_006486776.1| PREDICTED: oligopeptide transporter 4-like [Citrus sinensis]
Length=736

 Score =   207 bits (528),  Expect(2) = 9e-96, Method: Compositional matrix adjust.
 Identities = 98/194 (51%), Positives = 138/194 (71%), Gaps = 2/194 (1%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M+  N  +A           PVEEV L V  +DDP+LPV TFR WFLG+ SC +L FLN 
Sbjct  1    MAPTNVTSATAADIDGDELSPVEEVRLTVLNSDDPSLPVWTFRMWFLGLLSCALLSFLNQ  60

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWS--FTLNPGPFNIKEHVI  412
            FF YRT+PL I+ I +Q++ LPIG+F+AATLPE +F   G  S  F+LN GPFN+KEHV+
Sbjct  61   FFAYRTEPLIITQITVQVATLPIGRFLAATLPETRFRIPGCGSRLFSLNSGPFNVKEHVL  120

Query  413  ITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYL  592
            I++ AN G + G G  +++  + I+KA+Y + +SFL   ++++TTQ++GYGWAG+LR+Y+
Sbjct  121  ISIFANAGSAFGAGSTFAVSIVNIIKAFYHRKISFLASWLLIITTQVLGYGWAGLLRKYV  180

Query  593  VDPVDMWWPSTLLK  634
            V+P  MWWPSTL++
Sbjct  181  VEPAHMWWPSTLVQ  194


 Score =   171 bits (434),  Expect(2) = 9e-96, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 119/170 (70%), Gaps = 2/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE + +   M+R +FF++ +  SF +Y +PGYL P L+  SWVCW + +
Sbjct  191   TLVQVSLFRALHEKDDQR--MSRAKFFVIALICSFSWYLVPGYLVPTLSSISWVCWAFSK  248

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQ+GS   GLG+G  TLDW+ ++++  SPL+SP+ AI+NV  G+V+ IY+++P+ Y
Sbjct  249   SVTAQQLGSGMRGLGLGALTLDWSVVASFLFSPLISPFFAIVNVFAGYVLIIYVVIPIAY  308

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W  + + A KFPIFS+ LFTS G KYD   ++  +F+L+   Y+   +++
Sbjct  309   WGLDLYSAHKFPIFSSHLFTSQGKKYDISAIVNDKFELDQDKYQEQGRIH  358



>gb|EPS62495.1| hypothetical protein M569_12295, partial [Genlisea aurea]
Length=719

 Score =   204 bits (518),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 92/174 (53%), Positives = 127/174 (73%), Gaps = 4/174 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+VAL VP TDDPT+P +TFR W LG  +C++L FLN FF YR +PLSI+ I  QI
Sbjct  6    NSPVEQVALTVPPTDDPTIPAVTFRTWVLGSVACVLLSFLNQFFFYRREPLSITGISAQI  65

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MAAT+ +R F    +W F+LNPG FN+KEHV+IT++AN G +    + YSI 
Sbjct  66   AVVPLGHLMAATVTKRVFYRGTKWEFSLNPGGFNLKEHVLITILANAGAA----NPYSIH  121

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             ++++K +Y+Q L+F     +VLTTQ++GYGWAG+ RRYLV+P  MWWP  L++
Sbjct  122  IVSVVKVFYRQKLAFWVAFAVVLTTQILGYGWAGLYRRYLVEPAAMWWPENLVQ  175


 Score =   175 bits (444),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 85/171 (50%), Positives = 115/171 (67%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E    G +TR +FFL+    SF YY  PGYLFP LT  SW+CW++ 
Sbjct  172   NLVQVSLFRALHEKEAPVKGRLTRNKFFLISFICSFAYYIFPGYLFPKLTSISWLCWIFS  231

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+ AQQ+GS  HGLG+G   LDW+ IS+Y GSPL SPW A  N+A G+ + +Y+I PL 
Sbjct  232   SSVLAQQLGSGLHGLGIGAIGLDWSSISSYLGSPLASPWFATANIAFGYFVCMYVITPLM  291

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW  + ++A+ FPIFS+ +FTS G KY+   ++   F +++ AY+    L+
Sbjct  292   YW-LDIYNAKTFPIFSDGMFTSEGQKYNISAIVDGNFHIDLQAYDRVGPLH  341



>ref|XP_011015796.1| PREDICTED: oligopeptide transporter 4-like [Populus euphratica]
Length=747

 Score =   210 bits (535),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 96/176 (55%), Positives = 132/176 (75%), Gaps = 4/176 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+V L VP TDDP+LPV TFR WFLGI SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  23   PIEQVRLTVPNTDDPSLPVWTFRMWFLGILSCCLLSFLNQFFAYRTEPLIITQITVQVAT  82

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG+F+A  LPE KF     G   F+ NPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  83   LPIGRFLATVLPETKFNIPGLGSREFSFNPGPFNMKEHVLISIFANAGSAFGSGSAYAVG  142

Query  473  AITIM--KAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I+  KA+Y + +SF    ++++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  143  IVNIIKSKAFYGRNISFFSAWVLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  198


 Score =   169 bits (427),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 74/170 (44%), Positives = 121/170 (71%), Gaps = 1/170 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             L Q+SLFR LHE E K+   ++R++FF++ M  SF++Y LPGYLF  L   +W+C+ +P 
Sbjct  196   LVQISLFRTLHEKEDKNEHRISRVKFFVIAMTCSFLWYLLPGYLFQTLQSIAWICYAFPH  255

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G  TLDW+ +++Y  SPL++P+ AI+NV VG+ + +Y+++P+ Y
Sbjct  256   SVTAQQIGSGMRGLGIGALTLDWSTVASYLYSPLLTPFFAIVNVFVGYALIMYVVIPISY  315

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W  N ++A+ FPIFS+ LF + G  Y+   V+  +F+L++  Y+ + +++
Sbjct  316   WGLNVYNAKTFPIFSSHLFDARGATYNITEVVNDKFELDLAQYDKHGRVH  365



>gb|KHG27446.1| Oligopeptide transporter 4 -like protein [Gossypium arboreum]
Length=755

 Score =   216 bits (550),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 104/212 (49%), Positives = 146/212 (69%), Gaps = 14/212 (7%)
 Frame = +2

Query  5    KLSQTVPAQ*LSEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTF  184
            ++  TVP   L+E +V E   ++               P+E+V L VP TDDP+LPV TF
Sbjct  5    EIEATVPK--LAEEVVKEEGEMDEIEV----------SPIEQVRLTVPNTDDPSLPVWTF  52

Query  185  RAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFG  358
            R WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ LPIG+FMA+ LP  KF    FG
Sbjct  53   RMWFLGLFSCALLSFLNQFFGYRTEPLVITQITVQVATLPIGRFMASALPATKFRIPGFG  112

Query  359  RWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIV  538
               F+LNPGPFN+KEHV+IT+ AN G   G G  Y++  +TI+KA+Y +++SF    +++
Sbjct  113  SKEFSLNPGPFNMKEHVLITIFANAGSGFGNGTVYAVSIVTIIKAFYGRSISFFSSWLLI  172

Query  539  LTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            +TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  173  MTTQVMGYGWAGILRKYVVEPAHMWWPSTLVQ  204


 Score =   162 bits (411),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 116/173 (67%), Gaps = 3/173 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG---MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  792
              L Q+SLF  LHE E    G   + R++FF++ + +SF +Y  PGYLF  L   S  C V
Sbjct  201   TLVQISLFTTLHEKEENKDGKRPIARVKFFVIALVSSFCWYVFPGYLFQTLQSISLACLV  260

Query  793   WPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVP  972
             +P S+TA QIGS  +GLG+G FTLDW  ++++  SPLVSP+ AI+NV +G+ + IY+++P
Sbjct  261   FPHSVTAHQIGSGMNGLGIGAFTLDWTTVASFLFSPLVSPFFAIVNVFIGYALIIYLVMP  320

Query  973   LCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             + YW  N F+A+ FPI+S+ LFT+ G +Y+   ++  +F+++ P YE   +++
Sbjct  321   VSYWGLNLFNAKTFPIYSSDLFTAQGQEYNVSLIVNKKFEIDFPEYEKLGRVH  373



>ref|XP_011074283.1| PREDICTED: oligopeptide transporter 4-like [Sesamum indicum]
Length=762

 Score =   206 bits (525),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 97/190 (51%), Positives = 136/190 (72%), Gaps = 4/190 (2%)
 Frame = +2

Query  77   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  256
            +  G+  A      P+EEV L VP TDDP+LPV TFR W LG+ SC++L FLN FF YR 
Sbjct  18   SENGDGDADEDEISPIEEVRLTVPVTDDPSLPVWTFRMWVLGLLSCVLLSFLNQFFTYRR  77

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFA----PFGRWSFTLNPGPFNIKEHVIITVM  424
            +PL I+ I + ++ LPIG+FMAA LP  K+       G   F+LNPGPFNIKEHV+I++ 
Sbjct  78   EPLIITQITVLVASLPIGRFMAAVLPTTKWTVRVPGLGIREFSLNPGPFNIKEHVLISIF  137

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY++  + I+ A+Y++ +SFL G ++++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  138  ANAGSAFGNGPAYAVMIVDIIIAFYRRKISFLAGWLLIITTQVLGYGWAGLLRKYVVEPA  197

Query  605  DMWWPSTLLK  634
             MWWPSTL++
Sbjct  198  HMWWPSTLVQ  207


 Score =   172 bits (436),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 79/180 (44%), Positives = 119/180 (66%), Gaps = 11/180 (6%)
 Frame = +1

Query  625   LAQVSLFRALHETE-----------VKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTF  771
             L Q+SLFR LHE +            K   M+R +FFL+ +  SF++Y  PGYLF  L  
Sbjct  205   LVQISLFRTLHEKDNEGAIENGDGSSKKRQMSRSKFFLIALTCSFLWYLFPGYLFQSLQS  264

Query  772   FSWVCWVWPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVM  951
              SWVCWV+P S+TA QIGS  +GLG+G  TLDWA ++++  SPL+SP+ AI NV VG+ +
Sbjct  265   ISWVCWVFPHSVTAHQIGSGLNGLGIGALTLDWAAVASFLFSPLISPFFAIANVFVGYFI  324

Query  952   FIYIIVPLCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              +YI++P+ YW  N ++A+ FPI+S  LFT+ G +Y+   +++PQF+L+   Y+   +++
Sbjct  325   IMYIVIPISYWGLNVYNAKNFPIYSADLFTANGQEYNISAIVSPQFELDREQYQKQGRIH  384



>emb|CCO06497.1| oligopeptide transporter [Arabis alpina]
Length=754

 Score =   199 bits (505),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 125/173 (72%), Gaps = 5/173 (3%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L VP TDDP+LPVLTFR WFLG+ SCI+L F+N FF +R+ PL +S++  QI  
Sbjct  34   PIEEVRLTVPITDDPSLPVLTFRTWFLGLLSCIVLSFVNQFFGFRSNPLWVSSVAAQILT  93

Query  299  LPIGKFMAATLPERKFA-PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  475
            LP+GKFMAATLP +KF  P   W ++ NPGPFN+KEHV+IT+ AN     G    Y+   
Sbjct  94   LPLGKFMAATLPTKKFGVPGTNWMWSFNPGPFNMKEHVLITIFANT----GAAGVYATNI  149

Query  476  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            ITI+KA+Y + L+    +++  TTQL+GYGWAG+ R++LVD   MWWPS L++
Sbjct  150  ITIVKAFYHRQLNVTAAMLLTQTTQLLGYGWAGLFRKFLVDSPYMWWPSNLVQ  202


 Score =   180 bits (456),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 121/172 (70%), Gaps = 3/172 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETE-VKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E V++   TR+RFF++V   S  YY +PGYLFP ++  S+VCW+W 
Sbjct  199   NLVQVSLFRALHEKEDVQNGQQTRLRFFIIVFSISLAYYIIPGYLFPSISAISFVCWIWK  258

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+TAQ +GS  +GLG+G F LDWA ++ + GSPL  P+ AI NV  GF +F+YI++P+ 
Sbjct  259   SSVTAQIVGSGLNGLGIGSFGLDWATVAGFLGSPLAVPFFAIANVFCGFFIFLYIVLPIF  318

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQ-FDLNVPAYESYSKLY  1131
             YW  N +DA+KFP +++  F  TG +Y+   +L  + FD+N+ AY  YSKLY
Sbjct  319   YWT-NAYDAQKFPFYTSHTFDQTGQRYNITRILNEKDFDINLDAYNDYSKLY  369



>emb|CDY69955.1| BnaCnng66090D [Brassica napus]
Length=732

 Score =   205 bits (522),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 125/166 (75%), Gaps = 1/166 (1%)
 Frame = +2

Query  137  LVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKF  316
            L V   DDP+LPV TFR WFLG+ SC++L FLNTFF YRTQPL I+ I +Q+  LP+GK 
Sbjct  25   LTVSNEDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRTQPLMITMISVQVVTLPLGKI  84

Query  317  MAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAY  496
            MA  LPE K+   G W F+ NPGPFN+KEHV+I++ AN G   G G AY++G + I+ A+
Sbjct  85   MARILPETKYR-IGSWEFSFNPGPFNVKEHVLISMFANAGAGFGSGTAYAVGIVDIIMAF  143

Query  497  YKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            YK+ +SFL   I+V+TTQ++GYGWAG++R+ +VDP  MWWP+++L+
Sbjct  144  YKRKISFLASWILVITTQILGYGWAGIMRKLVVDPAQMWWPTSVLQ  189


 Score =   173 bits (438),  Expect(2) = 1e-95, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 117/167 (70%), Gaps = 2/167 (1%)
 Frame = +1

Query  631   QVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRSIT  810
             QVSLFRALHE +   + M+R +FF++    SF +Y  P YLF  L+  SWVCW +P+SIT
Sbjct  189   QVSLFRALHEKD--KARMSRGKFFVIAFVCSFAWYIFPAYLFLTLSSISWVCWAFPKSIT  246

Query  811   AQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYWKY  990
             AQQIGS   GLGVG F LDW+ I++Y GSPLV+P+ AI+NV VG+V+ +Y+++P+ YW  
Sbjct  247   AQQIGSGMSGLGVGSFALDWSVIASYLGSPLVTPFFAIVNVLVGYVLIMYMVIPVSYWGM  306

Query  991   NTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             N ++A KFPIFS+ LF S G  Y+   ++  +F+L+   Y+   ++Y
Sbjct  307   NVYEAHKFPIFSSDLFDSQGQLYNISTIVNDKFELDEVMYQREGRVY  353



>dbj|BAJ90957.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=749

 Score =   201 bits (512),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 130/172 (76%), Gaps = 0/172 (0%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L VP  DDPTLPV TFR W +G+ SC ++ FLN FF YRT+PL ++ I +Q++ 
Sbjct  28   PIEEVRLTVPPGDDPTLPVWTFRMWSIGLLSCALMSFLNQFFSYRTEPLIVTQITVQVAS  87

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            LP+G F+A  LP R F   G   ++LNPGPFN+KEHV+I++ AN G + G G+AY++  +
Sbjct  88   LPMGHFLARVLPRRTFRAPGGGEWSLNPGPFNMKEHVLISIFANAGYAFGNGNAYAVMIV  147

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             I++A+Y +++SF+   +++ TTQ++GYGWAG++R+Y+V+P  MWWPSTL++
Sbjct  148  DIIRAFYGRSISFIAAWLLITTTQVLGYGWAGLMRKYVVEPAHMWWPSTLVQ  199


 Score =   177 bits (448),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 116/172 (67%), Gaps = 3/172 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG---MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  792
              L QVSLFRALHE E  S G   ++R +FFL  +  SF +Y +PGYLFP LT  SWVCWV
Sbjct  196   TLVQVSLFRALHEKEESSKGSRQISRSKFFLAALICSFAWYVVPGYLFPALTSISWVCWV  255

Query  793   WPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVP  972
             + +S+TAQQ+GS   GLG+G FTLDW+ +S++  SPL+SP+ A  N+ VG+V F+Y++VP
Sbjct  256   FSKSVTAQQLGSGMKGLGLGAFTLDWSAVSSFLFSPLISPFFATANIFVGYVCFLYVLVP  315

Query  973   LCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
               YW  N ++A+ FPIFS+ LF S G  Y    ++  QF L+  AY    ++
Sbjct  316   TAYWGMNLYNAKTFPIFSSHLFMSNGSAYQITDIVNQQFQLDTEAYARLGRI  367



>gb|KJB58808.1| hypothetical protein B456_009G227000 [Gossypium raimondii]
Length=754

 Score =   216 bits (550),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 143/202 (71%), Gaps = 12/202 (6%)
 Frame = +2

Query  35   LSEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSC  214
            L+E +V E   ++ +             P+E+V L VP+TDDP+LPV TFR WFLG+ SC
Sbjct  12   LAEEVVKEEGEMDESEV----------SPIEQVRLTVPDTDDPSLPVWTFRMWFLGLFSC  61

Query  215  IILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGP  388
             +L FLN FF YRT+PL I+ I +Q++ LPIG+FMA+ LP  KF    FG   F+LNPGP
Sbjct  62   ALLSFLNQFFGYRTEPLVITQITVQVATLPIGRFMASALPATKFRIPGFGSKEFSLNPGP  121

Query  389  FNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGW  568
            FN+KEHV+IT+ AN G   G G  Y++  +TI+KA+Y +++SF    ++++TTQ++GYGW
Sbjct  122  FNMKEHVLITIFANAGSGFGNGTVYAVSIVTIIKAFYGRSISFFSSWLLIMTTQVMGYGW  181

Query  569  AGVLRRYLVDPVDMWWPSTLLK  634
            AG+LR+Y+V+P  MWWPSTL++
Sbjct  182  AGILRKYVVEPAHMWWPSTLVQ  203


 Score =   162 bits (410),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 115/173 (66%), Gaps = 3/173 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG---MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  792
              L Q+SLF  LHE E    G   + R++FF++ +  SF +Y  PGYLF  L   S  C V
Sbjct  200   TLVQISLFTTLHEKEENKDGKRPIARVKFFVIALVCSFCWYVFPGYLFQTLQSISLACLV  259

Query  793   WPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVP  972
             +P S+TA QIGS  +GLG+G FTLDW  ++++  SPLVSP+ AI+NV +G+ + IY+++P
Sbjct  260   FPHSVTAHQIGSGMNGLGIGAFTLDWTTVASFLFSPLVSPFFAIVNVFIGYALIIYLVMP  319

Query  973   LCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             + YW  N F+A+ FPI+S+ LFT+ G +Y+   ++  +F+++ P YE   +++
Sbjct  320   VSYWGLNLFNAKTFPIYSSDLFTAQGQEYNVSLIVNKKFEIDFPEYEKLGRVH  372



>gb|KJB58807.1| hypothetical protein B456_009G227000 [Gossypium raimondii]
Length=754

 Score =   216 bits (550),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 101/202 (50%), Positives = 143/202 (71%), Gaps = 12/202 (6%)
 Frame = +2

Query  35   LSEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSC  214
            L+E +V E   ++ +             P+E+V L VP+TDDP+LPV TFR WFLG+ SC
Sbjct  12   LAEEVVKEEGEMDESEVS----------PIEQVRLTVPDTDDPSLPVWTFRMWFLGLFSC  61

Query  215  IILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGP  388
             +L FLN FF YRT+PL I+ I +Q++ LPIG+FMA+ LP  KF    FG   F+LNPGP
Sbjct  62   ALLSFLNQFFGYRTEPLVITQITVQVATLPIGRFMASALPATKFRIPGFGSKEFSLNPGP  121

Query  389  FNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGW  568
            FN+KEHV+IT+ AN G   G G  Y++  +TI+KA+Y +++SF    ++++TTQ++GYGW
Sbjct  122  FNMKEHVLITIFANAGSGFGNGTVYAVSIVTIIKAFYGRSISFFSSWLLIMTTQVMGYGW  181

Query  569  AGVLRRYLVDPVDMWWPSTLLK  634
            AG+LR+Y+V+P  MWWPSTL++
Sbjct  182  AGILRKYVVEPAHMWWPSTLVQ  203


 Score =   162 bits (410),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 74/173 (43%), Positives = 115/173 (66%), Gaps = 3/173 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG---MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  792
              L Q+SLF  LHE E    G   + R++FF++ +  SF +Y  PGYLF  L   S  C V
Sbjct  200   TLVQISLFTTLHEKEENKDGKRPIARVKFFVIALVCSFCWYVFPGYLFQTLQSISLACLV  259

Query  793   WPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVP  972
             +P S+TA QIGS  +GLG+G FTLDW  ++++  SPLVSP+ AI+NV +G+ + IY+++P
Sbjct  260   FPHSVTAHQIGSGMNGLGIGAFTLDWTTVASFLFSPLVSPFFAIVNVFIGYALIIYLVMP  319

Query  973   LCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             + YW  N F+A+ FPI+S+ LFT+ G +Y+   ++  +F+++ P YE   +++
Sbjct  320   VSYWGLNLFNAKTFPIYSSDLFTAQGQEYNVSLIVNKKFEIDFPEYEKLGRVH  372



>gb|KFK27168.1| hypothetical protein AALP_AA8G344300 [Arabis alpina]
Length=754

 Score =   198 bits (504),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 125/173 (72%), Gaps = 5/173 (3%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L VP TDDP+LPVLTFR WFLG+ SCI+L F+N FF +R+ PL +S++  QI  
Sbjct  34   PIEEVRLTVPITDDPSLPVLTFRTWFLGLLSCIVLSFVNQFFGFRSNPLWVSSVAAQILT  93

Query  299  LPIGKFMAATLPERKFA-PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  475
            LP+GKFMAATLP +KF  P   W ++ NPGPFN+KEHV+IT+ AN     G    Y+   
Sbjct  94   LPLGKFMAATLPTKKFGVPGTNWMWSFNPGPFNMKEHVLITIFANT----GAAGVYATNI  149

Query  476  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            ITI+KA+Y + L+    +++  TTQL+GYGWAG+ R++LVD   MWWPS L++
Sbjct  150  ITIVKAFYHRQLNVTAAMLLTQTTQLLGYGWAGLFRKFLVDSPYMWWPSNLVQ  202


 Score =   180 bits (456),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 121/172 (70%), Gaps = 3/172 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETE-VKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E V++   TR+RFF++V   S  YY +PGYLFP ++  S+VCW+W 
Sbjct  199   NLVQVSLFRALHEKEDVQNGQQTRLRFFIIVFSISLAYYIIPGYLFPSISAISFVCWIWK  258

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+TAQ +GS  +GLG+G F LDWA ++ + GSPL  P+ AI NV  GF +F+YI++P+ 
Sbjct  259   SSVTAQIVGSGLNGLGIGSFGLDWATVAGFLGSPLAVPFFAIANVFCGFFIFLYIVLPIF  318

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQ-FDLNVPAYESYSKLY  1131
             YW  N +DA+KFP +++  F  TG +Y+   +L  + FD+N+ AY  YSKLY
Sbjct  319   YWT-NAYDAQKFPFYTSHTFDQTGQRYNITRILNEKDFDINLDAYNDYSKLY  369



>ref|XP_006422648.1| hypothetical protein CICLE_v10027887mg [Citrus clementina]
 gb|ESR35888.1| hypothetical protein CICLE_v10027887mg [Citrus clementina]
Length=736

 Score =   206 bits (524),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 97/194 (50%), Positives = 137/194 (71%), Gaps = 2/194 (1%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M+  N  +A           PVEEV L V  +DDP+LPV TFR WFLG+ SC +L FLN 
Sbjct  1    MAPTNVTSATAADIDRDELSPVEEVRLTVLNSDDPSLPVWTFRMWFLGLLSCALLSFLNQ  60

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWS--FTLNPGPFNIKEHVI  412
            FF YRT+PL I+ I +Q++ LPIG+F+ ATLPE +F   G  S  F+LN GPFN+KEHV+
Sbjct  61   FFAYRTEPLIITQITVQVATLPIGRFLEATLPETRFRIPGCGSRLFSLNSGPFNVKEHVL  120

Query  413  ITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYL  592
            I++ AN G + G G  +++  + I+KA+Y + +SFL   ++++TTQ++GYGWAG+LR+Y+
Sbjct  121  ISIFANAGSAFGAGSTFAVSIVNIIKAFYHRKISFLASWLLIITTQVLGYGWAGLLRKYV  180

Query  593  VDPVDMWWPSTLLK  634
            V+P  MWWPSTL++
Sbjct  181  VEPAHMWWPSTLVQ  194


 Score =   172 bits (435),  Expect(2) = 2e-95, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 119/170 (70%), Gaps = 2/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE + +   M+R +FF++ +  SF +Y +PGYL P L+  SWVCW + +
Sbjct  191   TLVQVSLFRALHEKDDQR--MSRAKFFVIALICSFSWYLVPGYLVPTLSSISWVCWAFSK  248

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQ+GS   GLG+G  TLDW+ ++++  SPL+SP+ AI+NV  G+V+ IY+++P+ Y
Sbjct  249   SVTAQQLGSGMRGLGLGALTLDWSVVASFLFSPLISPFFAIVNVFAGYVLIIYVVIPIAY  308

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W  + + A KFPIFS+ LFTS G KYD   ++  +F+L+   Y+   +++
Sbjct  309   WGLDLYSAHKFPIFSSHLFTSEGQKYDISAIVNDKFELDQDKYQEQGRIH  358



>gb|EEC79904.1| hypothetical protein OsI_21444 [Oryza sativa Indica Group]
 gb|EEE65007.1| hypothetical protein OsJ_19952 [Oryza sativa Japonica Group]
Length=758

 Score =   209 bits (533),  Expect(2) = 3e-95, Method: Compositional matrix adjust.
 Identities = 100/190 (53%), Positives = 132/190 (69%), Gaps = 5/190 (3%)
 Frame = +2

Query  68   LNPATA-GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFF  244
            L P+T+ G          P+E+VAL VP +D+P  PVLTFR W LG  SC +L FLN FF
Sbjct  27   LRPSTSRGSPELEEEENSPIEQVALTVPVSDEPETPVLTFRMWVLGTASCAVLSFLNQFF  86

Query  245  IYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVM  424
             YR +PL+I+AI  QI+V+P+G+ MAA LPER F     W FTLNPGPFN+KEHV+IT+ 
Sbjct  87   WYRKEPLTITAISAQIAVVPLGRLMAAALPERAFFRGRPWEFTLNPGPFNVKEHVLITIF  146

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN     G G  Y+I  IT ++ +Y + +SF   L++VLTTQ++G+GWAG+ RRYLV+P 
Sbjct  147  ANS----GAGTVYAIHVITAVRVFYGKHISFFVSLLVVLTTQVLGFGWAGIFRRYLVEPA  202

Query  605  DMWWPSTLLK  634
             MWWPS L++
Sbjct  203  AMWWPSNLVQ  212


 Score =   168 bits (425),  Expect(2) = 3e-95, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 115/171 (67%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E +S G +TR +FFL+    SF YY  PGYLF +LT  SW+CWV+P
Sbjct  209   NLVQVSLFRALHEKEARSKGGLTRNQFFLVAFICSFAYYIFPGYLFQMLTSLSWICWVFP  268

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+ AQQ+GS   GLG+G   LDW+ +S+Y GSPL SPW A  NVA GF   +YII P+ 
Sbjct  269   HSVLAQQLGSGLSGLGIGAIGLDWSTVSSYLGSPLASPWFATANVAAGFFFIMYIITPIA  328

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW +N + A+ FPIFS+ LFTSTG KY+   ++   F  +  AYE    LY
Sbjct  329   YW-FNFYKAQNFPIFSDGLFTSTGQKYNISSIVDSHFHFDTKAYEKNGPLY  378



>ref|XP_006364985.1| PREDICTED: oligopeptide transporter 2-like isoform X2 [Solanum 
tuberosum]
Length=726

 Score =   218 bits (554),  Expect(2) = 5e-95, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 134/182 (74%), Gaps = 1/182 (1%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            +         P+E+V L V   DDP+LPV TFR WFLG+ SC +L FLNTFF YR +PL 
Sbjct  3    QNLKEEDDESPIEQVRLTVSNDDDPSLPVWTFRMWFLGLLSCALLSFLNTFFSYRAEPLV  62

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            IS I +Q++ LPIG+ MA  LP+RKF     W F+LNPGPFN+KEHV+I++ AN G + G
Sbjct  63   ISMITVQVATLPIGRLMAKVLPKRKFT-IKSWEFSLNPGPFNVKEHVLISIFANAGSAFG  121

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTL  628
             G AY++G + I+KA+Y + ++FL G I+V+ TQ++GYGWAG++R+Y+VDP +MWWPS+L
Sbjct  122  NGPAYAVGIVDIIKAFYFRNITFLAGWILVVATQVLGYGWAGIMRKYVVDPAEMWWPSSL  181

Query  629  LK  634
            ++
Sbjct  182  VQ  183


 Score =   159 bits (402),  Expect(2) = 5e-95, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 118/170 (69%), Gaps = 1/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALH+ E +    +R +FFL+V+  SF++Y +PG+LFP L+  S +C  +P+
Sbjct  180   SLVQVSLFRALHDKEGEGK-TSRGKFFLVVLACSFIWYIVPGFLFPTLSNLSLLCLAYPK  238

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+ AQQ+GS   GLG+  FT DWA I++Y GSPLV P+  I+NV VG++  +YI++P  Y
Sbjct  239   SVVAQQLGSGMKGLGILSFTFDWAVIASYLGSPLVYPFFVIVNVIVGYIGVVYILIPASY  298

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W  N ++A+ FP+FS++LF + G  Y+   ++  +F+++  +Y  + +++
Sbjct  299   WGLNLYNAKNFPLFSSELFDAQGQIYNVTQIVNDKFEIDKVSYAQHGRIH  348



>ref|XP_011087976.1| PREDICTED: oligopeptide transporter 4 [Sesamum indicum]
Length=744

 Score =   221 bits (564),  Expect(2) = 5e-95, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 136/174 (78%), Gaps = 1/174 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q+
Sbjct  30   ESPIEEVRLTVTNTDDPTLPVWTFRMWFLGLLSCALLSFLNQFFAYRTEPLLITQITVQV  89

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            + LPIG F+AA LPE KF  FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  90   ATLPIGHFLAAVLPETKFR-FGGRVFSLNPGPFNMKEHVLISIFANAGSAFGNGSAYAVG  148

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +TI+KA+Y++ +SFL G ++++TTQ++GYGWAG+LR+Y+++P  MWWP TL++
Sbjct  149  IVTIVKAFYRRNISFLAGWLLIITTQVLGYGWAGLLRKYVIEPAHMWWPGTLVQ  202


 Score =   155 bits (392),  Expect(2) = 5e-95, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 120/170 (71%), Gaps = 2/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE + +   M+R +FFL+ +  SF +Y +PGYLFP LT  SWVCW + +
Sbjct  199   TLVQVSLFRALHEKDDQR--MSRAKFFLIALICSFSWYLVPGYLFPTLTSISWVCWTFSK  256

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G  TLDW  ++++  SPL+ P+ AI+NV  G+ + IY+++P+ Y
Sbjct  257   SVTAQQIGSGLRGLGLGALTLDWTVVASFLLSPLICPFFAIMNVLAGYALIIYLVLPIAY  316

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W ++ + ARKFPIFS+ LFT+ G KY+   ++  +F+L++  YE   +++
Sbjct  317   WGFDLYGARKFPIFSSHLFTAQGQKYNISAIVNDKFELDLKKYEEQGRIH  366



>ref|XP_002452706.1| hypothetical protein SORBIDRAFT_04g031070 [Sorghum bicolor]
 gb|EES05682.1| hypothetical protein SORBIDRAFT_04g031070 [Sorghum bicolor]
Length=760

 Score =   204 bits (518),  Expect(2) = 5e-95, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 131/175 (75%), Gaps = 3/175 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L VP TDDP+LPV TFR W +G+ SC ++ FLN FF YRT+PL ++ I +Q++ 
Sbjct  38   PIEEVRLTVPTTDDPSLPVWTFRMWSIGLFSCALMSFLNQFFSYRTEPLVVTGITVQVAS  97

Query  299  LPIGKFMAATLPERKF---APFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSI  469
            LP+G FMA  LP  +F   A  G   ++LNPGPFNIKEHV+I++ AN G + GGG AY++
Sbjct  98   LPVGHFMARVLPRTRFRVPALLGGGEWSLNPGPFNIKEHVLISIFANAGFAFGGGSAYAV  157

Query  470  GAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
              I I++A+Y + +SF+   ++V+TTQ++GYGWAG++R+Y+V+P  MWWP TL++
Sbjct  158  SIINIIRAFYGRHISFITAWLLVITTQVLGYGWAGLIRKYVVEPAHMWWPGTLVQ  212


 Score =   173 bits (438),  Expect(2) = 5e-95, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 118/168 (70%), Gaps = 3/168 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVK---SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  792
              L QVSLF+ALHE +     S  ++R +FF++V+  SF +Y +PGYLFP LT  SWVCW+
Sbjct  209   TLVQVSLFQALHEKDESAKASRQISRSKFFVVVLTCSFAWYAVPGYLFPTLTSISWVCWI  268

Query  793   WPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVP  972
             + +S+TAQQ+GS  +GLG+G FTLDW+ +S++  SPL+SP+ A  N+  G+  F+YII+P
Sbjct  269   FSKSVTAQQLGSGMNGLGIGAFTLDWSAVSSFLFSPLISPFFATANIFFGYTFFLYIIMP  328

Query  973   LCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYES  1116
             + YW ++ ++A+ FPIFS+ LF S G  YD   ++  QF+L+  AY  
Sbjct  329   IAYWGFDLYNAKTFPIFSSHLFMSNGTNYDVQSIVNNQFELDQEAYRK  376



>ref|XP_002529653.1| Oligopeptide transporter, putative [Ricinus communis]
 gb|EEF32740.1| Oligopeptide transporter, putative [Ricinus communis]
Length=763

 Score =   204 bits (519),  Expect(2) = 6e-95, Method: Compositional matrix adjust.
 Identities = 95/186 (51%), Positives = 131/186 (70%), Gaps = 4/186 (2%)
 Frame = +2

Query  77   ATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRT  256
            AT+      S    P+E+VAL VP TDDP LP +TFR W LG  +CI+L FLN FF YR 
Sbjct  36   ATSALDDVNSEENSPIEQVALTVPITDDPMLPAVTFRTWTLGTLACILLSFLNQFFWYRR  95

Query  257  QPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCG  436
            +PL+I++I  QI+VLP+G  MA+ + ++ F    +  FTLNPGPFN+KEHV+IT+ AN  
Sbjct  96   EPLAITSIFAQIAVLPLGHLMASAITDKVFFRGTKLEFTLNPGPFNVKEHVLITIFANS-  154

Query  437  VSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWW  616
               G G+ Y+I  ++ +K +YK+ LSFL  L++V+TTQ++G+GWAGV RRYLV+P  MWW
Sbjct  155  ---GAGNVYAIHIVSAVKIFYKKELSFLVALLVVITTQVLGFGWAGVFRRYLVEPAAMWW  211

Query  617  PSTLLK  634
            P  L++
Sbjct  212  PQNLVQ  217


 Score =   172 bits (437),  Expect(2) = 6e-95, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 110/171 (64%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E +  G +TR +FF+     SF YY  PGY+ P LT  SW+C ++P
Sbjct  214   NLVQVSLFRALHEKEERHKGRLTRNQFFIAAFICSFAYYVFPGYIIPKLTSVSWICLIFP  273

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              SI A Q+GS  HGLG+G    DWA  S+Y GSPL SPW A  NVA GF + +Y+I P+ 
Sbjct  274   ASILAHQLGSGLHGLGIGAIGFDWATTSSYLGSPLASPWFATANVAAGFALIMYVITPIA  333

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             Y   N + A  FPIFS+ LFTS+G +Y+   ++ P+F +++ AY     LY
Sbjct  334   Y-CLNIYKANTFPIFSDGLFTSSGRRYNVSAIIDPKFHIDMDAYNRQGPLY  383



>gb|EYU19483.1| hypothetical protein MIMGU_mgv1a023929mg [Erythranthe guttata]
Length=707

 Score =   192 bits (487),  Expect(2) = 7e-95, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 118/166 (71%), Gaps = 4/166 (2%)
 Frame = +2

Query  137  LVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKF  316
            + VP TDDPTLPV+TFR W LG  +C++L FLN FF YR +PLSI+AI  QI+V+P+G  
Sbjct  1    MTVPPTDDPTLPVVTFRMWTLGAAACVLLSFLNQFFWYRREPLSITAISAQIAVVPLGHL  60

Query  317  MAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAY  496
            MAA L  R F    RW F LNPG FN+KEHV+IT+ AN     G  + YSI  ++ +K +
Sbjct  61   MAAALTRRVFFEGRRWEFCLNPGRFNVKEHVLITIFAN----SGAANPYSIHIVSAVKIF  116

Query  497  YKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            YKQ L+F   L +VLTTQ++G+GWAG+ RRYLV+P  MWWP  L++
Sbjct  117  YKQRLTFWVALGVVLTTQILGFGWAGLFRRYLVEPAAMWWPQNLVQ  162


 Score =   184 bits (467),  Expect(2) = 7e-95, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 117/171 (68%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE EV++ G +TR +FFL+    SF YY  PGYLFP LT  SW+CW++ 
Sbjct  159   NLVQVSLFRALHEKEVRAKGGVTRNQFFLIAFLCSFTYYVFPGYLFPKLTSISWLCWIFS  218

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+   Q+GS  HGLGVG   LDW+ IS+Y GSPL SPW A  N+AVG+ + +Y+I P  
Sbjct  219   SSVLVHQLGSGLHGLGVGAIGLDWSSISSYLGSPLASPWFATANIAVGYFVCVYVIAPTM  278

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW  N ++A+ FPIFS+ LFTS G KY+   ++   F +++ AY+   +LY
Sbjct  279   YW-LNVYEAKTFPIFSDDLFTSNGQKYNISAIIDSNFHIDLDAYDREGRLY  328



>gb|EYU30413.1| hypothetical protein MIMGU_mgv1a002159mg [Erythranthe guttata]
Length=707

 Score =   192 bits (487),  Expect(2) = 7e-95, Method: Compositional matrix adjust.
 Identities = 91/166 (55%), Positives = 118/166 (71%), Gaps = 4/166 (2%)
 Frame = +2

Query  137  LVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKF  316
            + VP TDDPTLPV+TFR W LG  +C++L FLN FF YR +PLSI+AI  QI+V+P+G  
Sbjct  1    MTVPPTDDPTLPVVTFRMWTLGAAACVLLSFLNQFFWYRREPLSITAISAQIAVVPLGHL  60

Query  317  MAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAY  496
            MAA L  R F    RW F LNPG FN+KEHV+IT+ AN     G  + YSI  ++ +K +
Sbjct  61   MAAALTRRVFFEGRRWEFCLNPGRFNVKEHVLITIFAN----SGAANPYSIHIVSAVKIF  116

Query  497  YKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            YKQ L+F   L +VLTTQ++G+GWAG+ RRYLV+P  MWWP  L++
Sbjct  117  YKQRLTFWVALGVVLTTQILGFGWAGLFRRYLVEPAAMWWPQNLVQ  162


 Score =   184 bits (467),  Expect(2) = 7e-95, Method: Compositional matrix adjust.
 Identities = 88/171 (51%), Positives = 117/171 (68%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE EV++ G +TR +FFL+    SF YY  PGYLFP LT  SW+CW++ 
Sbjct  159   NLVQVSLFRALHEKEVRAKGGVTRNQFFLIAFLCSFTYYVFPGYLFPKLTSISWLCWIFS  218

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+   Q+GS  HGLGVG   LDW+ IS+Y GSPL SPW A  N+AVG+ + +Y+I P  
Sbjct  219   SSVLVHQLGSGLHGLGVGAIGLDWSSISSYLGSPLASPWFATANIAVGYFVCVYVIAPTM  278

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW  N ++A+ FPIFS+ LFTS G KY+   ++   F +++ AY+   +LY
Sbjct  279   YW-LNVYEAKTFPIFSDDLFTSNGQKYNISAIIDSNFHIDLDAYDREGRLY  328



>ref|XP_006364984.1| PREDICTED: oligopeptide transporter 2-like isoform X1 [Solanum 
tuberosum]
Length=737

 Score =   217 bits (552),  Expect(2) = 8e-95, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 133/172 (77%), Gaps = 1/172 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+V L V   DDP+LPV TFR WFLG+ SC +L FLNTFF YR +PL IS I +Q++ 
Sbjct  24   PIEQVRLTVSNDDDPSLPVWTFRMWFLGLLSCALLSFLNTFFSYRAEPLVISMITVQVAT  83

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            LPIG+ MA  LP+RKF     W F+LNPGPFN+KEHV+I++ AN G + G G AY++G +
Sbjct  84   LPIGRLMAKVLPKRKFT-IKSWEFSLNPGPFNVKEHVLISIFANAGSAFGNGPAYAVGIV  142

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             I+KA+Y + ++FL G I+V+ TQ++GYGWAG++R+Y+VDP +MWWPS+L++
Sbjct  143  DIIKAFYFRNITFLAGWILVVATQVLGYGWAGIMRKYVVDPAEMWWPSSLVQ  194


 Score =   159 bits (402),  Expect(2) = 8e-95, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 118/170 (69%), Gaps = 1/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALH+ E +    +R +FFL+V+  SF++Y +PG+LFP L+  S +C  +P+
Sbjct  191   SLVQVSLFRALHDKEGEGK-TSRGKFFLVVLACSFIWYIVPGFLFPTLSNLSLLCLAYPK  249

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+ AQQ+GS   GLG+  FT DWA I++Y GSPLV P+  I+NV VG++  +YI++P  Y
Sbjct  250   SVVAQQLGSGMKGLGILSFTFDWAVIASYLGSPLVYPFFVIVNVIVGYIGVVYILIPASY  309

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W  N ++A+ FP+FS++LF + G  Y+   ++  +F+++  +Y  + +++
Sbjct  310   WGLNLYNAKNFPLFSSELFDAQGQIYNVTQIVNDKFEIDKVSYAQHGRIH  359



>ref|XP_006401399.1| hypothetical protein EUTSA_v10012759mg [Eutrema salsugineum]
 gb|ESQ42852.1| hypothetical protein EUTSA_v10012759mg [Eutrema salsugineum]
Length=756

 Score =   199 bits (506),  Expect(2) = 8e-95, Method: Compositional matrix adjust.
 Identities = 95/173 (55%), Positives = 126/173 (73%), Gaps = 5/173 (3%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L VP TDDPTLPVLTFR WFLG+ SCI+L F+N FF +R+  L +S++  QI  
Sbjct  36   PIEEVRLTVPITDDPTLPVLTFRTWFLGLLSCILLAFVNQFFSFRSNQLWVSSVAAQIVT  95

Query  299  LPIGKFMAATLPERKFA-PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  475
            LP+GK MAATLP +KF  P   WS++ NPGPFN+KEHV+IT+ AN     G G AY+   
Sbjct  96   LPLGKLMAATLPTKKFGFPGTNWSWSFNPGPFNMKEHVLITIFANT----GAGGAYATSI  151

Query  476  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            ITI+KA+Y + L+    +++  TTQL+GYGWAG+ R++LV+   MWWPS L++
Sbjct  152  ITIVKAFYHRQLNVAAAMLLTQTTQLLGYGWAGLFRKFLVESPYMWWPSNLVQ  204


 Score =   177 bits (449),  Expect(2) = 8e-95, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 119/172 (69%), Gaps = 3/172 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETE-VKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E  +    TR+RFFL+V G SF YY +PGYLFP ++  S+VCW+W 
Sbjct  201   NLVQVSLFRALHEKEDPEKKQQTRLRFFLIVFGISFAYYIIPGYLFPSISAISFVCWIWK  260

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+TAQ +GS   GLGVG F LDW+ ++ + GSPL  P+ AI N   GF +F+YI++P+ 
Sbjct  261   SSVTAQIVGSGLKGLGVGSFGLDWSTVAGFLGSPLAVPFFAIANFFGGFFIFLYIVLPIF  320

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQ-FDLNVPAYESYSKLY  1131
             YW  N +DA+KFP +++Q F  TG+ Y+   +L  + FD+N+ AY  Y KLY
Sbjct  321   YWT-NAYDAQKFPFYTSQTFDQTGNSYNITRILNEKNFDINLDAYNGYGKLY  371



>ref|XP_011626108.1| PREDICTED: oligopeptide transporter 7 [Amborella trichopoda]
Length=813

 Score =   213 bits (542),  Expect(2) = 8e-95, Method: Compositional matrix adjust.
 Identities = 96/188 (51%), Positives = 135/188 (72%), Gaps = 4/188 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            + +T  E+   S    P+E+VAL VP TDDP+LPV+TFR WFLG  SC+I+ FLN FF +
Sbjct  85   SSSTTTEEPNTSPENSPIEQVALTVPVTDDPSLPVITFRMWFLGCLSCVIISFLNQFFWF  144

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RT+PL+I+++  QI+V+P+G  MAA LP R F    RW FTLNPGPFN+KEHV+IT+ AN
Sbjct  145  RTEPLTITSVSAQIAVVPLGHLMAAVLPTRPFFKGKRWEFTLNPGPFNVKEHVLITIFAN  204

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
                 G G  ++I  ++ +K +YK+ LSF    ++V+TTQ++G+GWAG+ R+YLV+P  M
Sbjct  205  S----GAGSVFAIHIVSSVKVFYKETLSFFVAFLVVITTQVMGFGWAGMFRKYLVEPAAM  260

Query  611  WWPSTLLK  634
            WWP  L++
Sbjct  261  WWPYNLVQ  268


 Score =   163 bits (412),  Expect(2) = 8e-95, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = +1

Query  619   FNLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  795
             +NL QVS+F ALHE E +    +TR +FFL+ +  SF YY LPGYLFP+LT  SW+CW++
Sbjct  264   YNLVQVSIFGALHEKEERPKESLTRNQFFLVALICSFAYYALPGYLFPMLTSLSWICWIF  323

Query  796   PRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPL  975
             P+S+ A Q+GS  HGLG+G   LDW+ IS+Y  SPL SPW A  NVA GF +F Y+IVPL
Sbjct  324   PKSVLAHQLGSGLHGLGLGAIGLDWSSISSYLDSPLASPWFATANVAAGFFLFTYVIVPL  383

Query  976   CYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              YW  + ++A++FPIFS +LF  +G +Y+   ++   F++++ AYE   KLY
Sbjct  384   AYW-LDLYNAKRFPIFSEKLFAYSGGEYNITAIVDSNFNIDLEAYEKGGKLY  434



>dbj|BAD08158.1| putative sexual differentiation process protein isp4 [Oryza sativa 
Japonica Group]
Length=751

 Score =   196 bits (497),  Expect(2) = 8e-95, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 130/175 (74%), Gaps = 3/175 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L VP  DD  LPV TFR W +G+ SC +L FLN FF YRT+PL ++ I +Q++ 
Sbjct  25   PIEEVRLTVPAGDDTALPVWTFRMWSIGLLSCALLSFLNQFFSYRTEPLIVTQITVQVAS  84

Query  299  LPIGKFMAATLPERKF---APFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSI  469
            LP+G F+A  LP R F   A  G   ++LNPGPFN+KEHV+I++ AN G + G G+AY++
Sbjct  85   LPVGHFLARVLPRRAFRAPALLGGGEWSLNPGPFNMKEHVLISIFANAGCAFGNGNAYAV  144

Query  470  GAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
              + I++A+YK+++SF+   ++++TTQ++GYGWAG++R+++V+P  MWWP TL++
Sbjct  145  MIVDIIRAFYKRSISFVAAWLLIITTQVLGYGWAGLMRKFVVEPAHMWWPGTLVQ  199


 Score =   180 bits (457),  Expect(2) = 8e-95, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 121/172 (70%), Gaps = 3/172 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG---MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  792
              L QVSLFRALHE +    G   ++R +FFL+ +  SF +Y +PGYLFP LT  SWVCWV
Sbjct  196   TLVQVSLFRALHEKDELPHGSRQISRSKFFLVALICSFAWYAVPGYLFPTLTSISWVCWV  255

Query  793   WPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVP  972
             + +S+TAQQ+GS   GLGVG F+LDW  IS++  SPL+SP+ A  N+ VGFV+F+Y++VP
Sbjct  256   FSKSVTAQQLGSGLKGLGVGAFSLDWTAISSFLFSPLISPFFATANIFVGFVLFLYVLVP  315

Query  973   LCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             + YW ++ ++A+ FPIFS+ LF S G  YD   ++  +F+L++ AY    ++
Sbjct  316   IAYWGFDLYNAKTFPIFSSHLFMSNGTSYDITAIVNDKFELDIDAYNKLGRI  367



>ref|XP_008339039.1| PREDICTED: oligopeptide transporter 2-like [Malus domestica]
Length=743

 Score =   202 bits (514),  Expect(2) = 9e-95, Method: Compositional matrix adjust.
 Identities = 95/185 (51%), Positives = 133/185 (72%), Gaps = 1/185 (1%)
 Frame = +2

Query  80   TAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQ  259
            T  +++        VE+V L V   DD +LPV TFR W +G+ SCI+L FLNTFF YRT+
Sbjct  16   TKLDESENDDDVSSVEQVRLTVSNEDDSSLPVWTFRMWTIGMLSCILLSFLNTFFSYRTE  75

Query  260  PLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGV  439
            PL IS I +Q++ LPIG+FMA TLP RK    G+ S++LNPG FN+KEHV+I++ AN G 
Sbjct  76   PLVISMISVQVASLPIGRFMARTLPRRKVWIRGK-SYSLNPGEFNVKEHVLISIFANAGA  134

Query  440  SPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWP  619
              G G AY++  +TI+KA+Y + +SF     +V+TTQ++GYGWAG++R+Y+VDP  MWWP
Sbjct  135  GFGSGPAYAVNIVTIIKAFYGRKISFFASWALVITTQVLGYGWAGIIRKYVVDPGAMWWP  194

Query  620  STLLK  634
            S+L++
Sbjct  195  SSLVQ  199


 Score =   173 bits (439),  Expect(2) = 9e-95, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 124/165 (75%), Gaps = 2/165 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALHE +  ++ M+R +FFL+ +  SF +Y +PGYLF  L+  SW+CW++P+
Sbjct  196   SLVQVSLFRALHEKD--NNRMSRGKFFLIALVCSFSWYLVPGYLFTTLSIISWICWIYPK  253

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SI AQQIGS + GLGVG FTLDW+ IS+Y GSPL+SP+ AI+N+ VG+++ +Y+I+P+ Y
Sbjct  254   SIRAQQIGSGFRGLGVGAFTLDWSVISSYLGSPLISPFFAIVNITVGYIIIMYVIIPISY  313

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYES  1116
             WK N ++AR F IFS+ LF S G  Y+   ++  +F +++PAYE 
Sbjct  314   WKLNLYNARNFAIFSSHLFDSDGQIYNVKGIVNDRFQIDMPAYEK  358



>gb|ERN13358.1| hypothetical protein AMTR_s00041p00133990 [Amborella trichopoda]
Length=800

 Score =   213 bits (542),  Expect(2) = 9e-95, Method: Compositional matrix adjust.
 Identities = 97/192 (51%), Positives = 136/192 (71%), Gaps = 4/192 (2%)
 Frame = +2

Query  59   MSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNT  238
            M   + +T  E+   S    P+E+VAL VP TDDP+LPV+TFR WFLG  SC+I+ FLN 
Sbjct  68   MDKPSSSTTTEEPNTSPENSPIEQVALTVPVTDDPSLPVITFRMWFLGCLSCVIISFLNQ  127

Query  239  FFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIIT  418
            FF +RT+PL+I+++  QI+V+P+G  MAA LP R F    RW FTLNPGPFN+KEHV+IT
Sbjct  128  FFWFRTEPLTITSVSAQIAVVPLGHLMAAVLPTRPFFKGKRWEFTLNPGPFNVKEHVLIT  187

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            + AN     G G  ++I  ++ +K +YK+ LSF    ++V+TTQ++G+GWAG+ R+YLV+
Sbjct  188  IFANS----GAGSVFAIHIVSSVKVFYKETLSFFVAFLVVITTQVMGFGWAGMFRKYLVE  243

Query  599  PVDMWWPSTLLK  634
            P  MWWP  L++
Sbjct  244  PAAMWWPYNLVQ  255


 Score =   162 bits (411),  Expect(2) = 9e-95, Method: Compositional matrix adjust.
 Identities = 87/172 (51%), Positives = 121/172 (70%), Gaps = 2/172 (1%)
 Frame = +1

Query  619   FNLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  795
             +NL QVS+F ALHE E +    +TR +FFL+ +  SF YY LPGYLFP+LT  SW+CW++
Sbjct  251   YNLVQVSIFGALHEKEERPKESLTRNQFFLVALICSFAYYALPGYLFPMLTSLSWICWIF  310

Query  796   PRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPL  975
             P+S+ A Q+GS  HGLG+G   LDW+ IS+Y  SPL SPW A  NVA GF +F Y+IVPL
Sbjct  311   PKSVLAHQLGSGLHGLGLGAIGLDWSSISSYLDSPLASPWFATANVAAGFFLFTYVIVPL  370

Query  976   CYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              YW  + ++A++FPIFS +LF  +G +Y+   ++   F++++ AYE   KLY
Sbjct  371   AYW-LDLYNAKRFPIFSEKLFAYSGGEYNITAIVDSNFNIDLEAYEKGGKLY  421



>gb|EEE57620.1| hypothetical protein OsJ_08019 [Oryza sativa Japonica Group]
Length=748

 Score =   196 bits (497),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 130/175 (74%), Gaps = 3/175 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L VP  DD  LPV TFR W +G+ SC +L FLN FF YRT+PL ++ I +Q++ 
Sbjct  25   PIEEVRLTVPAGDDTALPVWTFRMWSIGLLSCALLSFLNQFFSYRTEPLIVTQITVQVAS  84

Query  299  LPIGKFMAATLPERKF---APFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSI  469
            LP+G F+A  LP R F   A  G   ++LNPGPFN+KEHV+I++ AN G + G G+AY++
Sbjct  85   LPVGHFLARVLPRRAFRAPALLGGGEWSLNPGPFNMKEHVLISIFANAGCAFGNGNAYAV  144

Query  470  GAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
              + I++A+YK+++SF+   ++++TTQ++GYGWAG++R+++V+P  MWWP TL++
Sbjct  145  MIVDIIRAFYKRSISFVAAWLLIITTQVLGYGWAGLMRKFVVEPAHMWWPGTLVQ  199


 Score =   180 bits (456),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 121/172 (70%), Gaps = 3/172 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG---MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  792
              L QVSLFRALHE +    G   ++R +FFL+ +  SF +Y +PGYLFP LT  SWVCWV
Sbjct  196   TLVQVSLFRALHEKDELPHGSRQISRSKFFLVALICSFAWYAVPGYLFPTLTSISWVCWV  255

Query  793   WPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVP  972
             + +S+TAQQ+GS   GLGVG F+LDW  IS++  SPL+SP+ A  N+ VGFV+F+Y++VP
Sbjct  256   FSKSVTAQQLGSGLKGLGVGAFSLDWTAISSFLFSPLISPFFATANIFVGFVLFLYVLVP  315

Query  973   LCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             + YW ++ ++A+ FPIFS+ LF S G  YD   ++  +F+L++ AY    ++
Sbjct  316   IAYWGFDLYNAKTFPIFSSHLFMSNGTSYDITAIVNDKFELDIDAYNKLGRI  367



>ref|XP_007225210.1| hypothetical protein PRUPE_ppa002011mg [Prunus persica]
 gb|EMJ26409.1| hypothetical protein PRUPE_ppa002011mg [Prunus persica]
Length=729

 Score =   199 bits (506),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 134/181 (74%), Gaps = 1/181 (1%)
 Frame = +2

Query  92   KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSI  271
             + P     PVEEV L V   DDPTLPV TFR W LG+ SC++L FLNTFF YRT+PL I
Sbjct  7    HSLPDDDVSPVEEVRLTVSNDDDPTLPVWTFRMWALGLLSCVLLSFLNTFFAYRTEPLVI  66

Query  272  SAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGG  451
            S I +Q++ LPIG+FMA TLP +KF   G   F+LNPGPFN+KEHV+I++ AN G   G 
Sbjct  67   SMISVQVATLPIGRFMARTLPTKKFR-VGLREFSLNPGPFNMKEHVLISIFANAGAGFGS  125

Query  452  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLL  631
            G AY+I  + I+KA+Y + +SF    I+V+TTQ++GYGWAG+LR+Y+VDP +MWWPS+L+
Sbjct  126  GAAYAISIVNIIKAFYHRNISFWASWILVITTQVLGYGWAGILRKYVVDPAEMWWPSSLV  185

Query  632  K  634
            +
Sbjct  186  Q  186


 Score =   176 bits (447),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 121/169 (72%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALHE + K   M+R +FFL+ +  SF ++ +PGYLFP L+  SWVCWV+P 
Sbjct  183   SLVQVSLFRALHEKDSKR--MSRGKFFLIALICSFSWFVVPGYLFPTLSTISWVCWVYPN  240

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G F+LDW  I++Y GSPL+SP+ AI+NVA G+++ +Y+ +P+ Y
Sbjct  241   SVTAQQIGSGMRGLGLGAFSLDWTVIASYLGSPLISPFFAIVNVAAGYLLVMYVGLPIAY  300

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W  N + A+ FPIFS+ LF   G  Y+   ++  +F++++ +Y+   ++
Sbjct  301   WGVNLYSAKNFPIFSSHLFDHRGQIYNVSAIVNDKFEIDMDSYDKQGRI  349



>emb|CDP04526.1| unnamed protein product [Coffea canephora]
Length=755

 Score =   311 bits (796),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 150/202 (74%), Positives = 173/202 (86%), Gaps = 7/202 (3%)
 Frame = +2

Query  80   TAGEKTAPSG--GRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYR  253
              G+  AP+    RC VEEVALVVPETDDPTLPV+TFRAWFLG+TSC ILIFLNTFFIYR
Sbjct  23   NGGDAPAPTDHKDRCAVEEVALVVPETDDPTLPVMTFRAWFLGLTSCTILIFLNTFFIYR  82

Query  254  TQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANC  433
            TQPL+ISAILMQI+VLPIGKFMA+ LP + +  FGRWSF+LNPGPFNIKEHVIITVMANC
Sbjct  83   TQPLTISAILMQIAVLPIGKFMASALPTKTYTLFGRWSFSLNPGPFNIKEHVIITVMANC  142

Query  434  GVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMW  613
            GVS GGGDAYSIGAIT+M+AYYKQ LSFLC L+IVLTTQ++GYGWAG+LR+YLVDPV+MW
Sbjct  143  GVSIGGGDAYSIGAITVMRAYYKQTLSFLCALLIVLTTQILGYGWAGMLRKYLVDPVEMW  202

Query  614  WPS-----TLLKCLYSEHSMKR  664
            WPS     +L + L+ + S  +
Sbjct  203  WPSNLAQVSLFRALHEKESKSQ  224


 Score =   306 bits (784),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E KS GMTRM+FFL+ + ASF YY LPGYLFPILTFFSWVCW WPR
Sbjct  206   NLAQVSLFRALHEKESKSQGMTRMQFFLIFLAASFAYYALPGYLFPILTFFSWVCWAWPR  265

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLG+G FTLDWAGISAYHGSPLV+PW++ILNVAVGFVMFIYIIVPLCY
Sbjct  266   SITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVTPWSSILNVAVGFVMFIYIIVPLCY  325

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK+NTFDA KFPIFSNQLFTSTGHKYDT  +LTP ++L++PAYE YSKLY
Sbjct  326   WKFNTFDAHKFPIFSNQLFTSTGHKYDTTKILTPNYELDIPAYEKYSKLY  375



>ref|XP_009407958.1| PREDICTED: oligopeptide transporter 7-like [Musa acuminata subsp. 
malaccensis]
Length=759

 Score =   208 bits (529),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 127/174 (73%), Gaps = 4/174 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+E+VAL VP  DDPT+PVLTFR W LG  SC++L FLN FF YR +PLSI++I  QI
Sbjct  45   NSPIEQVALTVPVEDDPTMPVLTFRMWVLGTASCVLLSFLNQFFWYRKEPLSITSISAQI  104

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA+T+ +R F    RW FTLNPGPFNIKEHV+IT+ AN     G G  Y+I 
Sbjct  105  AVVPLGHLMASTITDRVFFKGSRWEFTLNPGPFNIKEHVLITIFANS----GAGSVYAIH  160

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +T +K +Y + ++F   L++V+TTQ++G+GWAG+ RRYLV+P  MWWP  L++
Sbjct  161  VVTAVKIFYGKHITFFVSLLVVITTQVLGFGWAGIFRRYLVEPAAMWWPYNLVQ  214


 Score =   167 bits (423),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 119/172 (69%), Gaps = 2/172 (1%)
 Frame = +1

Query  619   FNLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  795
             +NL QVSLFRALHE E ++ G MTR +FF++    SF YY  PGYLF +LT  SW+CW++
Sbjct  210   YNLVQVSLFRALHEREDRAKGGMTRNQFFMMAFICSFAYYVFPGYLFSMLTSLSWICWIF  269

Query  796   PRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPL  975
             P SI AQQ+GS  +GLG+G   LDW+ IS+Y GSPL SPW A  NVA GFV+ +Y++ P 
Sbjct  270   PHSILAQQLGSGLYGLGLGAIGLDWSTISSYLGSPLASPWFATANVAAGFVLIMYVVTPT  329

Query  976   CYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              YW  + +DA+ FPIFS+ LFTSTG  Y+   ++   F L++ AY+    LY
Sbjct  330   AYW-LDLYDAKTFPIFSDGLFTSTGQSYNISSIIDSNFHLDIEAYDKNGPLY  380



>ref|XP_008219191.1| PREDICTED: oligopeptide transporter 2-like [Prunus mume]
Length=729

 Score =   201 bits (510),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 102/181 (56%), Positives = 134/181 (74%), Gaps = 1/181 (1%)
 Frame = +2

Query  92   KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSI  271
             + P     PVEEV L V   DDPTLPV TFR W LG+ SC++L FLNTFF YRT+PL I
Sbjct  7    HSLPDDDASPVEEVRLTVSNDDDPTLPVWTFRMWALGLLSCVLLSFLNTFFAYRTEPLVI  66

Query  272  SAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGG  451
            S I +Q++ LPIG+FMA TLP +KF    R  F+LNPGPFN+KEHV+I++ AN G   G 
Sbjct  67   SMISVQVATLPIGRFMARTLPTKKFRVGSR-EFSLNPGPFNMKEHVLISIFANAGAGFGS  125

Query  452  GDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLL  631
            G AY+I  + I+KA+Y + +SF    I+V+TTQ++GYGWAG+LR+Y+VDP +MWWPS+L+
Sbjct  126  GAAYAISIVNIIKAFYHRNISFWASWILVITTQVLGYGWAGILRKYVVDPAEMWWPSSLV  185

Query  632  K  634
            +
Sbjct  186  Q  186


 Score =   175 bits (443),  Expect(2) = 1e-94, Method: Compositional matrix adjust.
 Identities = 80/169 (47%), Positives = 120/169 (71%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALHE + K   M+R +FFL+ +  SF +  +PGYLFP L+  SWVCWV+P 
Sbjct  183   SLVQVSLFRALHEKDSKR--MSRGKFFLIALICSFSWSVVPGYLFPTLSTISWVCWVYPN  240

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   GLG+G F+LDW  I++Y GSPL+SP+ AI+NVA G+++ +Y+ +P+ Y
Sbjct  241   SVTAQQIGSGMRGLGLGAFSLDWTVIASYLGSPLISPFFAIVNVAAGYLLVMYVGLPIAY  300

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W  N + A+ FPIFS+ LF   G  Y+   ++  +F++++ +Y+   ++
Sbjct  301   WGVNLYSAKNFPIFSSHLFDHRGQIYNVSAIVNDKFEIDMASYDKQGRI  349



>ref|XP_007018304.1| Oligopeptide transporter 2 [Theobroma cacao]
 gb|EOY15529.1| Oligopeptide transporter 2 [Theobroma cacao]
Length=738

 Score =   192 bits (488),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 98/174 (56%), Positives = 132/174 (76%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            PVEEV L V   DD TLPV TFR WFLG+ SC +L FLNTFF YRT+PL ++ I +Q++ 
Sbjct  23   PVEEVRLTVSNDDDTTLPVWTFRMWFLGLFSCCLLSFLNTFFSYRTEPLQVTMISIQVAS  82

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LP GKF+A  LP  KF    FG   FTLNPGPFN+KEHV+I++ AN G + GGG AY+IG
Sbjct  83   LPAGKFLARVLPTTKFKIPGFGNREFTLNPGPFNVKEHVLISIFANAGAAFGGGTAYAIG  142

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I++A+Y + +SFL   I+V+TTQ++GYGWAG++R+++V+P  MWWPS+L++
Sbjct  143  IVNIIRAFYHKKISFLASWILVITTQVLGYGWAGIMRKFVVEPAQMWWPSSLVQ  196


 Score =   182 bits (463),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 122/169 (72%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRA+HE + K   M+R +FFL+ +  SF +Y  PGYLFP L+  SWVCW +P+
Sbjct  193   SLVQVSLFRAMHEKDSKR--MSRGKFFLIALICSFSWYVFPGYLFPTLSAISWVCWAFPK  250

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   G+G+G F +DW+ I+++ GSPLV+P+ AI+N+ VG+ +F+YII+P+ Y
Sbjct  251   SVTAQQIGSGMDGIGIGSFAIDWSVIASFLGSPLVTPFFAIVNIFVGYALFMYIILPIAY  310

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W  N ++A+ FPIFS+ LF   G  Y+   ++  +F++ +PAYE   ++
Sbjct  311   WGVNVYNAKNFPIFSSHLFNHKGEPYNVSGIVNDKFEIELPAYEQQGRV  359



>ref|XP_010064240.1| PREDICTED: oligopeptide transporter 4-like [Eucalyptus grandis]
Length=748

 Score =   204 bits (518),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 97/196 (49%), Positives = 135/196 (69%), Gaps = 2/196 (1%)
 Frame = +2

Query  53   VEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            +E+ G       +         PVEEV L VP TDDP LPV TFR W LG+ SC +L FL
Sbjct  1    MEVQGPPKLPPEDPPVDESELSPVEEVRLTVPNTDDPNLPVWTFRMWTLGLISCALLSFL  60

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRW--SFTLNPGPFNIKEH  406
            N FF YR +PL I+ I +Q++ LP+G+ MA+ LP  KF   G     F+LNPGPFN+KEH
Sbjct  61   NQFFSYRREPLIITQITVQVATLPLGRLMASILPTAKFHLPGLSGSEFSLNPGPFNMKEH  120

Query  407  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  586
            V+I++ AN G + G G AY++G + I+KA+Y +++SF    I+++TTQ++GYGWAG+LR+
Sbjct  121  VLISIFANAGSAFGNGSAYAVGIVNIIKAFYDRSISFGASWILIITTQVLGYGWAGLLRK  180

Query  587  YLVDPVDMWWPSTLLK  634
            Y+V+P  MWWPSTL++
Sbjct  181  YVVEPGQMWWPSTLVQ  196


 Score =   171 bits (433),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 76/173 (44%), Positives = 120/173 (69%), Gaps = 4/173 (2%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSS----GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWV  792
             L Q+SLFR LHE E +       ++R++FF++ M  SF++Y +PG+LF  L+  SWVCW 
Sbjct  194   LVQISLFRTLHEKETEEDKAQYSVSRVKFFVMAMVFSFMWYLVPGFLFQSLSSISWVCWA  253

Query  793   WPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVP  972
             +P S+TAQQIGS  +GLGVG  TLDW+ ++++  SPL+ P+ AI+NV VGF + +Y+++P
Sbjct  254   FPNSVTAQQIGSGLNGLGVGALTLDWSTVASFLFSPLICPFFAIVNVFVGFAVIMYVVIP  313

Query  973   LCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             + YW+ N ++A+ FPIFS+ LFT+ G +Y+   ++   F+L+   Y    K++
Sbjct  314   IAYWRLNAYNAKTFPIFSSDLFTAQGQEYNITLIVNKNFELDKAEYSQLGKIH  366



>ref|XP_007148333.1| hypothetical protein PHAVU_006G200000g [Phaseolus vulgaris]
 gb|ESW20327.1| hypothetical protein PHAVU_006G200000g [Phaseolus vulgaris]
Length=738

 Score =   198 bits (503),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 102/190 (54%), Positives = 136/190 (72%), Gaps = 4/190 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             P T+ E         P+EEV L V  TDDPT PV TFR W LG+ SC +L FLN FF Y
Sbjct  9    KPVTSQEDD--DDDVSPIEEVRLTVANTDDPTRPVWTFRMWLLGLLSCSLLSFLNQFFAY  66

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            RT+PL I+ I +Q++ LPIG FMAA LPE KF    FG  SF+LNPGPFN+KEHV+IT+ 
Sbjct  67   RTEPLIITQITIQVATLPIGHFMAAVLPETKFTLPGFGSKSFSLNPGPFNMKEHVLITIF  126

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G  Y++G + I+KA+Y +++SF    ++++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  127  ANAGSAFGSGSPYAVGIVNIIKAFYGRSISFFASWLLIITTQVLGYGWAGLLRKYVVEPA  186

Query  605  DMWWPSTLLK  634
             MWWPSTL++
Sbjct  187  HMWWPSTLVQ  196


 Score =   177 bits (448),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 79/169 (47%), Positives = 121/169 (72%), Gaps = 2/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE + +   ++R +FF + +  SFV+Y +PGYLF  LT  SWVCW++ +S
Sbjct  194   LVQVSLFRALHEKDDQR--LSRAKFFFIALLCSFVWYVIPGYLFTTLTNISWVCWIFSKS  251

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS   GLGVG  TLDWA ++++  SPL+SP+ AI+N+ VG+ + +Y ++P+ YW
Sbjct  252   VTAQQIGSGMRGLGVGALTLDWAAVASFLFSPLISPFFAIVNIFVGYALIVYAVIPIAYW  311

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
               N ++A++FPIFS+ LFT+ G +Y+   ++   F+L+V  YE   +++
Sbjct  312   GLNVYNAKRFPIFSSHLFTAQGQRYNIPAIVDDHFELSVAEYEKQGRIH  360



>ref|XP_006433763.1| hypothetical protein CICLE_v10003230mg [Citrus clementina]
 gb|ESR47003.1| hypothetical protein CICLE_v10003230mg [Citrus clementina]
Length=728

 Score =   212 bits (540),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 132/174 (76%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+V L VP TDD +LPV TFR WFLG+ SC +L FLN FF YR +PL I+ I +Q++ 
Sbjct  3    PIEQVRLTVPTTDDASLPVWTFRMWFLGLFSCALLSFLNQFFSYRQEPLIITQITVQVAT  62

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG+FMA  LP+ KF    FG   F+LNPGPFN+KEHV+IT+ AN G + G G AY++G
Sbjct  63   LPIGRFMATLLPQAKFRIPGFGSREFSLNPGPFNMKEHVLITIFANAGSAFGSGSAYAVG  122

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I+KA+Y + +SF    I+++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  123  IVNIIKAFYVKNISFYSAWILIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  176


 Score =   162 bits (411),  Expect(2) = 2e-94, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 116/172 (67%), Gaps = 3/172 (2%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSG---MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  795
             L Q+SLFR LHETE    G   ++R++FF++ +  SF ++  PGY F  L   SWVCW +
Sbjct  174   LVQISLFRTLHETEDNVGGKRHLSRVKFFVIALVCSFCWHLFPGYFFQSLQSISWVCWAF  233

Query  796   PRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPL  975
             P S+ A QIGS  +GLGVG  TLDW  ++++  SPL+ P+ AI NV VG+   IY+++P+
Sbjct  234   PNSVAAHQIGSGLNGLGVGALTLDWTAVASFLFSPLICPFFAIANVFVGYAFIIYVVIPV  293

Query  976   CYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              YW  N ++A+ FPIFS+ L+T+ G +Y+   ++  +F+L++ +Y+ + +++
Sbjct  294   AYWGLNLYNAKTFPIFSSHLYTAQGPEYNITLIVNDKFELDLASYKQHGRIH  345



>ref|XP_010320236.1| PREDICTED: oligopeptide transporter 2-like [Solanum lycopersicum]
Length=737

 Score =   209 bits (533),  Expect(2) = 3e-94, Method: Compositional matrix adjust.
 Identities = 93/169 (55%), Positives = 129/169 (76%), Gaps = 1/169 (1%)
 Frame = +2

Query  128  EVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPI  307
            +V L V   DDP+LPV TFR WFLG+ SC +L FLNTFF YR +PL IS I +Q++ LPI
Sbjct  27   QVRLTVSNDDDPSLPVWTFRMWFLGLLSCALLSFLNTFFSYRAEPLVISMITVQVATLPI  86

Query  308  GKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIM  487
            G+ MA  LP+RKF     W F+ NPGPFN+KEHV+I++ AN G + G G AY++G + I+
Sbjct  87   GRLMAKVLPKRKFT-IKSWEFSFNPGPFNVKEHVLISIFANAGSAFGNGPAYAVGIVDII  145

Query  488  KAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            KA+Y + ++FL G I+V+ TQ++GYGWAG++R+Y+VDP +MWWPS+L++
Sbjct  146  KAFYFRNITFLAGWILVVATQVLGYGWAGIMRKYVVDPAEMWWPSSLVQ  194


 Score =   164 bits (416),  Expect(2) = 3e-94, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 120/170 (71%), Gaps = 1/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALH+ EV+    +R +FFL+V+  SF++YT+PG+LFP L+  S +C  +P+
Sbjct  191   SLVQVSLFRALHDKEVEGK-TSRGKFFLVVLACSFIWYTVPGFLFPTLSNLSLLCLAYPK  249

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+ AQQIGS   GLG+  FT DWA I++Y GSPLV P+  I+NV VG++  +YI++P  Y
Sbjct  250   SVIAQQIGSGMKGLGILSFTFDWAVIASYLGSPLVYPFFVIVNVIVGYIGVVYILIPASY  309

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W  N ++A+ FP+FS++LF + G  Y+   ++  +F+++  +Y  + +++
Sbjct  310   WGLNLYNAKNFPLFSSELFDARGQIYNVTAIVNDKFEIDKVSYAQHGRIH  359



>ref|XP_009773627.1| PREDICTED: oligopeptide transporter 3 [Nicotiana sylvestris]
Length=751

 Score =   309 bits (792),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E K+ G+TRM+FFL+ M ASF YY  PGYLFPILTFFSWVCW WPR
Sbjct  202   NLAQVSLFRALHEKEQKTRGLTRMKFFLVFMAASFAYYAFPGYLFPILTFFSWVCWAWPR  261

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLGVG FTLDWAGISAYHGSPLV+PWT+ILNV +GF+MFIYII+PLCY
Sbjct  262   SITAQQIGSGYHGLGVGAFTLDWAGISAYHGSPLVTPWTSILNVGIGFIMFIYIIIPLCY  321

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WKYNTFDARKFPIFSNQLFTS+GHKYDT  +LTPQFDLN+ AYESYSKLY
Sbjct  322   WKYNTFDARKFPIFSNQLFTSSGHKYDTTKILTPQFDLNIAAYESYSKLY  371


 Score =   300 bits (769),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 150/189 (79%), Positives = 170/189 (90%), Gaps = 5/189 (3%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCPVEEVALVVPETDDPTLPV+TFRAWFLG+TSC +LIFLNTFFIYRTQPL+ISAILMQI
Sbjct  32   RCPVEEVALVVPETDDPTLPVMTFRAWFLGLTSCTLLIFLNTFFIYRTQPLTISAILMQI  91

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIGKFMAATLP++ +  FGRW F+LNPGPFNIKEHVIITVMANCGVS GGGDAYSIG
Sbjct  92   AVLPIGKFMAATLPKKSYTLFGRWGFSLNPGPFNIKEHVIITVMANCGVSIGGGDAYSIG  151

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS-----TLLKC  637
            AIT+MKAYYKQ+L+FLC L++VLTTQL+GYGWAG+LRRYLVDPVDMWWPS     +L + 
Sbjct  152  AITVMKAYYKQSLNFLCALLLVLTTQLVGYGWAGMLRRYLVDPVDMWWPSNLAQVSLFRA  211

Query  638  LYSEHSMKR  664
            L+ +    R
Sbjct  212  LHEKEQKTR  220



>ref|XP_012071040.1| PREDICTED: oligopeptide transporter 1-like [Jatropha curcas]
Length=760

 Score =   198 bits (503),  Expect(2) = 3e-94, Method: Compositional matrix adjust.
 Identities = 92/173 (53%), Positives = 125/173 (72%), Gaps = 5/173 (3%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L VP TDDPT P LTFR W LGI SC +L F+N FF YRT  L+++A+  QI V
Sbjct  40   PIEEVRLTVPITDDPTEPALTFRTWVLGIASCALLAFVNQFFSYRTNQLTVTAVAAQIVV  99

Query  299  LPIGKFMAATLPERKFA-PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  475
            LP+GK MA  +P ++   P  +WSF+LNPGPF +KEHV+IT+ A+C    G G  Y++  
Sbjct  100  LPLGKLMARVIPNKQIKIPLTKWSFSLNPGPFTLKEHVLITIFASC----GAGGVYAVNI  155

Query  476  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            IT +KA+Y++ L+ +  +++V TTQL+GYGWAG+ R+YLVD   MWWPS L++
Sbjct  156  ITAVKAFYRRPLNPVAAMLLVQTTQLLGYGWAGIFRKYLVDSPYMWWPSNLVQ  208


 Score =   176 bits (446),  Expect(2) = 3e-94, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 120/172 (70%), Gaps = 3/172 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRAL+E E +  G +TR++FF +V  +S+ YY +PGYLFP L+  S++CW+W 
Sbjct  205   NLVQVSLFRALNEKEKRPKGRLTRLQFFTIVFISSYAYYIIPGYLFPSLSTISFICWIWK  264

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+TAQQIGS  +GLG+  F LDW+ ++ + G+PL  P+ AI N   GF +  YIIVP+ 
Sbjct  265   DSVTAQQIGSGQNGLGIASFGLDWSTVAGFLGTPLAVPFFAIANTLAGFFLVQYIIVPIS  324

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQ-FDLNVPAYESYSKLY  1131
             YW  N +DA+KFPI+S+  F S G  Y+   +L  + FD+N+ AY +YSKLY
Sbjct  325   YWT-NMYDAKKFPIYSSHTFDSDGQTYNISRILNQKNFDINLDAYNNYSKLY  375



>ref|XP_007156166.1| hypothetical protein PHAVU_003G263700g [Phaseolus vulgaris]
 gb|ESW28160.1| hypothetical protein PHAVU_003G263700g [Phaseolus vulgaris]
Length=753

 Score =   194 bits (492),  Expect(2) = 5e-94, Method: Compositional matrix adjust.
 Identities = 87/190 (46%), Positives = 127/190 (67%), Gaps = 4/190 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            N A +  + +P+    P+E+VAL VP +DDP+LP  TFR W LG  +C++L FLN FF +
Sbjct  19   NDAISEAEKSPAAENSPIEQVALTVPVSDDPSLPSFTFRTWILGTLACVLLSFLNQFFGF  78

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            R +PLS++AI  QI+V+P G  MAA +  R F    +W FTLNPG FN+KEHV+IT+ A 
Sbjct  79   RREPLSVTAISAQIAVVPAGHLMAAAVTRRVFMKGTKWEFTLNPGKFNVKEHVLITIFA-  137

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
               S G    Y+I  ++ +K +Y++ L+ L  L++V+T+Q++G+GWAG+ R+YLV+P  M
Sbjct  138  ---SSGAASVYAIYFVSAVKLFYRKDLTILTALLVVITSQVLGFGWAGIFRKYLVEPAAM  194

Query  611  WWPSTLLKCL  640
            WWP      L
Sbjct  195  WWPQNFFSGL  204


 Score =   179 bits (455),  Expect(2) = 5e-94, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 111/168 (66%), Gaps = 2/168 (1%)
 Frame = +1

Query  631   QVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRSI  807
             Q+  FRALHE E +   G+TR +FFL+    SF YY  PGYLFP LT  SW+CW++P S+
Sbjct  207   QLCYFRALHEKEERRKGGLTRNQFFLIAFLCSFAYYVFPGYLFPSLTSISWICWMFPTSV  266

Query  808   TAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYWK  987
              A Q+GS  HGLGVG    DW+ I +Y GSPL SPW A  NVA GF +FIY IVP+ Y  
Sbjct  267   IAHQLGSGLHGLGVGAIGFDWSSICSYLGSPLASPWFATANVAAGFAIFIYAIVPIAY-S  325

Query  988   YNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              N ++AR+FPIFS++LF S G KY+   ++   F L++ AYE    LY
Sbjct  326   TNLYNARRFPIFSDELFMSNGQKYNISAIIDSNFHLDMEAYEREGPLY  373



>emb|CAN81605.1| hypothetical protein VITISV_025060 [Vitis vinifera]
Length=739

 Score =   219 bits (558),  Expect(2) = 5e-94, Method: Compositional matrix adjust.
 Identities = 98/176 (56%), Positives = 134/176 (76%), Gaps = 2/176 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+EEV L VP  DD +L V TFR WFLG+ SC +L FLN FF YR +PL I+ I +Q+
Sbjct  9    ESPIEEVRLTVPNDDDSSLSVWTFRMWFLGVLSCTLLSFLNQFFSYRREPLVITQITVQV  68

Query  293  SVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  466
            + LPIG+FMAA LPE KF    FG+  F+ NPGPFN+KEHV+I++ AN G + G G AY+
Sbjct  69   ATLPIGRFMAAVLPETKFHIPGFGKREFSFNPGPFNMKEHVLISIFANAGSAFGNGSAYA  128

Query  467  IGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            +G +TI+KA+Y  ++SFL G ++++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  129  VGIVTIIKAFYNSSISFLAGWLLIVTTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  184


 Score =   154 bits (389),  Expect(2) = 5e-94, Method: Compositional matrix adjust.
 Identities = 74/179 (41%), Positives = 113/179 (63%), Gaps = 11/179 (6%)
 Frame = +1

Query  625   LAQVSLFRAL-----------HETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTF  771
             L Q+SLFR L           +      +  +R +FFL+ M  SF++Y +PGYLF  L  
Sbjct  182   LVQISLFRGLVIKAKFAIGSRYLLNQGCNRTSRSKFFLIAMLCSFLWYMVPGYLFQSLQS  241

Query  772   FSWVCWVWPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVM  951
              +WVCW +P S+TA QIGS + GLG G  TLDW  ++++  SPLV P+ AI+NV +G+V+
Sbjct  242   IAWVCWAFPNSVTAHQIGSGFRGLGFGALTLDWTVVASFLFSPLVCPFFAIVNVFIGYVL  301

Query  952   FIYIIVPLCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
              IYI++P+ YW  N ++AR FPIFS+ LFT+ G  Y+   ++  +F++++  Y+   +L
Sbjct  302   IIYIVMPISYWGLNVYNARTFPIFSSHLFTAQGQSYNITAIVNDKFEIDLAQYDIQGRL  360



>ref|XP_007042780.1| Oligopeptide transporter 4 [Theobroma cacao]
 gb|EOX98611.1| Oligopeptide transporter 4 [Theobroma cacao]
Length=941

 Score =   211 bits (537),  Expect(2) = 5e-94, Method: Compositional matrix adjust.
 Identities = 95/174 (55%), Positives = 133/174 (76%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+V L V  TDDPTLPV TFR WFLGI SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  226  PIEQVRLTVANTDDPTLPVWTFRMWFLGILSCALLSFLNQFFSYRTEPLIITQITVQVAT  285

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LP+G FMA+ LP+ +F    FG   F+LNPG FN+KEHV+I + AN G + G G AY++G
Sbjct  286  LPVGHFMASALPKTQFKIPGFGSKMFSLNPGSFNMKEHVLICIFANAGSAFGNGSAYAVG  345

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I+KA+Y +++SFL   ++++TTQ++GYGWAG+LR+Y+V+P  MWWP+TL++
Sbjct  346  IVNIIKAFYGRSISFLASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPNTLVQ  399


 Score =   162 bits (410),  Expect(2) = 5e-94, Method: Compositional matrix adjust.
 Identities = 82/168 (49%), Positives = 121/168 (72%), Gaps = 2/168 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE + +   MTR +FFL+V+  SF +Y +PGYLF  LT  SWVCW++P+S
Sbjct  397   LVQVSLFRALHEKDDRR--MTRAKFFLIVLICSFSWYLVPGYLFTTLTSISWVCWIFPKS  454

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS   GLG+G  TLDW+ ++++  SPL+SP+ AI NV  G+V+ IYI +P+ YW
Sbjct  455   VTAQQIGSGLKGLGLGAVTLDWSAVASFLFSPLISPFFAIANVFAGYVLIIYIAIPVAYW  514

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
               + ++A +FPIFS+ LFT+ G KY+   ++  +F++++  YE   ++
Sbjct  515   GLDLYNASRFPIFSSHLFTAKGQKYNITAIVNDKFEIDLAKYEELGRI  562


 Score =   177 bits (448),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 119/170 (70%), Gaps = 7/170 (4%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            E S +N A + +         P+EEV L V  TDDPTLPV TFR WFLG+ SC +L FLN
Sbjct  17   EKSVINGANSDDDEL-----SPIEEVRLTVTNTDDPTLPVWTFRMWFLGLLSCALLSFLN  71

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHV  409
             FF YRT+PL I+ I +Q++ LPIG+FMAA LP  +F     G   F+LNPGPFN+KEHV
Sbjct  72   QFFSYRTEPLIITQITVQVATLPIGRFMAAVLPRAQFKLPGLGSRKFSLNPGPFNMKEHV  131

Query  410  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIG  559
            +I++ AN G + G G AY++G +TI+KA+Y +++SFL G ++++TTQ+I 
Sbjct  132  LISIFANAGSAFGSGSAYAVGIVTIIKAFYARSISFLAGWLLIITTQVIN  181



>ref|XP_008219210.1| PREDICTED: oligopeptide transporter 2-like [Prunus mume]
Length=730

 Score =   202 bits (514),  Expect(2) = 7e-94, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 129/172 (75%), Gaps = 1/172 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V   DD +LPV TFR W +G+ SCI+L FLNTFF +RT+PL I+ I +Q++ 
Sbjct  18   PIEEVRLTVLNEDDTSLPVWTFRMWTIGLFSCILLSFLNTFFSFRTEPLVITMISVQVAS  77

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            LPIG+FMA TLP  K    G+ SF+LNPG FNIKEHV+I++ AN G   G G AY++  +
Sbjct  78   LPIGRFMARTLPRTKVWVGGK-SFSLNPGEFNIKEHVLISIFANAGAGFGSGPAYAVDIV  136

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            TI+KA+Y + +SF     +V+TTQ++GYGWAG+LR+Y+VDP  MWWPS+L++
Sbjct  137  TIIKAFYGRKISFFASWALVITTQVLGYGWAGILRKYVVDPAAMWWPSSLVQ  188


 Score =   171 bits (432),  Expect(2) = 7e-94, Method: Compositional matrix adjust.
 Identities = 84/166 (51%), Positives = 124/166 (75%), Gaps = 2/166 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALHE +  S+ M+R +FFL+ +  SF +Y +PGYLF  L+  SW+CW+ P+
Sbjct  185   SLVQVSLFRALHEND--SNRMSRGKFFLIALICSFSWYVMPGYLFTTLSTISWICWLSPK  242

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS + GLG+G  TLDW+ I++Y GSPL+SP+ AI N+AVG+++ +Y+I+P+ Y
Sbjct  243   SITAQQIGSGFRGLGLGAVTLDWSVIASYLGSPLISPFFAIANIAVGYIIIMYVIIPIAY  302

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESY  1119
             WK N ++A  F IFS+ LF S G  YD   ++  +F++++P+YE +
Sbjct  303   WKLNLYNASNFAIFSSHLFDSQGQIYDVKAIVNDKFEIDMPSYEKH  348



>ref|XP_006472404.1| PREDICTED: oligopeptide transporter 4-like [Citrus sinensis]
Length=755

 Score =   209 bits (533),  Expect(2) = 8e-94, Method: Compositional matrix adjust.
 Identities = 99/190 (52%), Positives = 137/190 (72%), Gaps = 8/190 (4%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            +PA   E+ +P      +E+V L VP TDD +LPV TFR WFLG+ SC +L FLN FF Y
Sbjct  20   DPAIEEEEMSP------IEQVRLTVPTTDDASLPVWTFRMWFLGLFSCALLSFLNQFFSY  73

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
            R +PL I+ I +Q++ LPIG+FMA  L + KF    FG   F+LNPGPFN+KEHV+IT+ 
Sbjct  74   RQEPLIITQITVQVATLPIGRFMATLLSQAKFRIPGFGSREFSLNPGPFNMKEHVLITIF  133

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G AY++G + I+KA+Y + +SF    I+++TTQ++GYGWAG+LR+Y+V+P 
Sbjct  134  ANAGSAFGSGSAYAVGIVNIIKAFYVKNISFYSAWILIITTQVLGYGWAGLLRKYVVEPA  193

Query  605  DMWWPSTLLK  634
             MWWPSTL++
Sbjct  194  HMWWPSTLVQ  203


 Score =   163 bits (412),  Expect(2) = 8e-94, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 116/172 (67%), Gaps = 3/172 (2%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSG---MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  795
             L Q+SLFR LHETE    G   ++R++FF++ +  SF ++  PGY F  L   SWVCW +
Sbjct  201   LVQISLFRTLHETEDNVGGKRHLSRVKFFMIALVCSFCWHLFPGYFFQSLQSISWVCWAF  260

Query  796   PRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPL  975
             P S+ A QIGS  +GLGVG  TLDW  ++++  SPL+ P+ AI NV VG+   IY+++P+
Sbjct  261   PNSVAAHQIGSGLNGLGVGALTLDWTAVASFLFSPLICPFFAIANVFVGYAFIIYVVIPV  320

Query  976   CYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              YW  N ++A+ FPIFS+ L+T+ G +Y+   ++  +F+L++ +Y+ + +++
Sbjct  321   AYWGLNLYNAKTFPIFSSHLYTAQGPEYNITLIVNDKFELDLASYKQHGRIH  372



>ref|XP_003593303.1| Oligopeptide transporter [Medicago truncatula]
 gb|ABN05713.1| Peptidase aspartic, active site; Oligopeptide transporter OPT 
superfamily [Medicago truncatula]
 gb|AES63554.1| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=729

 Score =   201 bits (512),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 94/170 (55%), Positives = 126/170 (74%), Gaps = 2/170 (1%)
 Frame = +2

Query  131  VALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIG  310
            V L V  TDDPT PV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ LPIG
Sbjct  17   VRLTVTNTDDPTQPVWTFRMWFLGLISCSLLSFLNQFFAYRTEPLIITLITVQVATLPIG  76

Query  311  KFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITI  484
             FMAA LP  KF    FG    +LNPGPFN+KEHV+IT+ AN G + G G  Y++G + I
Sbjct  77   HFMAAILPTTKFRIPGFGTKKLSLNPGPFNMKEHVLITIFANAGSAFGSGSPYAVGIVNI  136

Query  485  MKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            +KA+Y +++SF    ++++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  137  IKAFYGRSISFHAAWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  186


 Score =   171 bits (433),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 117/170 (69%), Gaps = 1/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVSLFRALHE +     ++R +FF + +  SF +Y +PGYLF  LT  SWVCWV+ +
Sbjct  183   TLVQVSLFRALHEKD-DDHRISRAKFFFIALVCSFSWYVIPGYLFTTLTSISWVCWVFTK  241

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQ+GS   GLG+G  TLDW  ++++  SPL+SP+ AI+NV VG+V+ IY +VP+ Y
Sbjct  242   SVTAQQLGSGMKGLGIGAITLDWTAVASFLFSPLISPFFAIVNVFVGYVLIIYAVVPIAY  301

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W  N ++A+ FP+FS+ LFT+ G KY+   ++  +F+L+   Y    +++
Sbjct  302   WGLNAYNAKTFPLFSSHLFTAQGQKYNISAIVNDKFELDEAKYAEQGRIH  351



>ref|XP_009616769.1| PREDICTED: oligopeptide transporter 2-like [Nicotiana tomentosiformis]
Length=738

 Score =   215 bits (547),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 96/174 (55%), Positives = 131/174 (75%), Gaps = 1/174 (1%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              P+E+V L V   DDP+LPV TFR WFLG+ SC +L FLNTFF YR +PL I+ I +Q+
Sbjct  26   ESPIEQVRLTVSNDDDPSLPVWTFRMWFLGLLSCALLSFLNTFFSYRAEPLVITMITVQV  85

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            + LP+G+ MA  LP RKF     W FTLNPGPFN+KEHV+I++ AN G + G G AY++G
Sbjct  86   ATLPLGRIMARVLPTRKFK-IRSWEFTLNPGPFNMKEHVLISIFANAGSAFGNGPAYAVG  144

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I KA+Y + +SFL G I+V+ TQ++GYGWAG++R+Y+VDP +MWWPS+L++
Sbjct  145  IVDITKAFYFRNISFLAGWILVIATQVLGYGWAGIMRKYVVDPAEMWWPSSLVQ  198


 Score =   157 bits (397),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 118/170 (69%), Gaps = 2/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALHE E   S  +R +FFL+V+  SF++Y +PG+LFP L+  S +C  +P+
Sbjct  195   SLVQVSLFRALHEKEEGKS--SRGKFFLVVLACSFIWYIVPGFLFPTLSSLSLLCLAFPK  252

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+ AQQIGS  HGLG+  FT DWA I++Y GSPLV P  +I+NV VG+V  +YI++P+ Y
Sbjct  253   SVLAQQIGSGMHGLGIFSFTFDWATIASYLGSPLVYPLFSIVNVIVGYVAIVYILIPISY  312

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W  N ++A+ FP+FS+ LF + G  Y+   ++  +F+L+  +Y  +  ++
Sbjct  313   WGLNLYNAKNFPLFSSDLFNAQGQVYNITAIVNDKFELDKVSYAKHGHIH  362



>dbj|BAD67732.1| putative sexual differentiation process protein isp4 [Oryza sativa 
Japonica Group]
Length=763

 Score =   204 bits (518),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 100/195 (51%), Positives = 132/195 (68%), Gaps = 10/195 (5%)
 Frame = +2

Query  68   LNPATA-GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFF  244
            L P+T+ G          P+E+VAL VP +D+P  PVLTFR W LG  SC +L FLN FF
Sbjct  27   LRPSTSRGSPELEEEENSPIEQVALTVPVSDEPETPVLTFRMWVLGTASCAVLSFLNQFF  86

Query  245  IYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVM  424
             YR +PL+I+AI  QI+V+P+G+ MAA LPER F     W FTLNPGPFN+KEHV+IT+ 
Sbjct  87   WYRKEPLTITAISAQIAVVPLGRLMAAALPERAFFRGRPWEFTLNPGPFNVKEHVLITIF  146

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLI-----GYGWAGVLRRY  589
            AN     G G  Y+I  IT ++ +Y + +SF   L++VLTTQ++     G+GWAG+ RRY
Sbjct  147  ANS----GAGTVYAIHVITAVRVFYGKHISFFVSLLVVLTTQVVDDQVLGFGWAGIFRRY  202

Query  590  LVDPVDMWWPSTLLK  634
            LV+P  MWWPS L++
Sbjct  203  LVEPAAMWWPSNLVQ  217


 Score =   168 bits (425),  Expect(2) = 1e-93, Method: Compositional matrix adjust.
 Identities = 92/171 (54%), Positives = 115/171 (67%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E +S G +TR +FFL+    SF YY  PGYLF +LT  SW+CWV+P
Sbjct  214   NLVQVSLFRALHEKEARSKGGLTRNQFFLVAFICSFAYYIFPGYLFQMLTSLSWICWVFP  273

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+ AQQ+GS   GLG+G   LDW+ +S+Y GSPL SPW A  NVA GF   +YII P+ 
Sbjct  274   HSVLAQQLGSGLSGLGIGAIGLDWSTVSSYLGSPLASPWFATANVAAGFFFIMYIITPIA  333

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW +N + A+ FPIFS+ LFTSTG KY+   ++   F  +  AYE    LY
Sbjct  334   YW-FNFYKAQNFPIFSDGLFTSTGQKYNISSIVDSHFHFDTKAYEKNGPLY  383



>ref|XP_009398499.1| PREDICTED: oligopeptide transporter 4-like [Musa acuminata subsp. 
malaccensis]
Length=738

 Score =   186 bits (473),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 91/182 (50%), Positives = 133/182 (73%), Gaps = 0/182 (0%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E+        P+E+V L V  +DDP+LPV TFR W LG+ SC +L FLN FF YR+QPL 
Sbjct  15   EREMEEDELSPIEQVRLTVMNSDDPSLPVWTFRMWSLGLLSCCLLSFLNQFFGYRSQPLI  74

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            I+ I +Q++ LP+G F+A  LP  +F   G  + +LNPGPFN+KEHV+I++ AN G + G
Sbjct  75   ITQITVQVASLPLGHFLARVLPTTRFRLPGLGAVSLNPGPFNMKEHVLISIFANAGAAFG  134

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTL  628
             G AY+IG + I+KA+Y +++SF+   ++++TTQ++GYGWAG++RRY+V+P  MWWPSTL
Sbjct  135  NGSAYAIGIVNIIKAFYGRSISFIASWLLIITTQVLGYGWAGLMRRYVVEPAHMWWPSTL  194

Query  629  LK  634
            ++
Sbjct  195  VQ  196


 Score =   185 bits (470),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 83/168 (49%), Positives = 122/168 (73%), Gaps = 2/168 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE E +   M+R +FF++ +  SF +YT+PGY FP +T  SWVCWV+ +S
Sbjct  194   LVQVSLFRALHEKEDRR--MSRAKFFVIALICSFTWYTVPGYFFPTITNISWVCWVFSKS  251

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS   GLGVG FTLDWA ++++  SPL+ P+ AI+NV +G+ + +Y+ +PL YW
Sbjct  252   VTAQQIGSGLQGLGVGAFTLDWAAVASFLFSPLICPFFAIVNVLIGYALLMYVAIPLAYW  311

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
              +N ++A+ FPIFS+ LFT+ G  Y+   ++  QF++N+ AYE   ++
Sbjct  312   GFNLYNAKTFPIFSSDLFTAAGQPYNITAIVNNQFEINMAAYEQQGRI  359



>ref|XP_006401695.1| hypothetical protein EUTSA_v10016096mg [Eutrema salsugineum]
 gb|ESQ43148.1| hypothetical protein EUTSA_v10016096mg [Eutrema salsugineum]
Length=740

 Score =   208 bits (529),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 125/174 (72%), Gaps = 4/174 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC V+EV L VP+TDDPTLPVLTFR W LG+++CIIL F+N FF YR  PL I+ I  QI
Sbjct  22   RCAVDEVELTVPKTDDPTLPVLTFRMWVLGLSACIILSFVNQFFWYRQMPLMITGISAQI  81

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLP+G  MA  LP RK+    RW F +NPGPFN+KEHV+IT+ AN     G G  Y+  
Sbjct  82   AVLPLGHLMARVLPNRKYLEGSRWEFNMNPGPFNVKEHVMITIFANS----GAGTVYATH  137

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             ++ +K YYK+ L FL   ++++TTQ +G+GWAG+ R++LVDP +MWWP  L++
Sbjct  138  ILSAIKLYYKRTLPFLPAFLLMITTQFLGFGWAGLFRKHLVDPGEMWWPGNLVQ  191


 Score =   164 bits (414),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 113/171 (66%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLF ALHE E K  G MTR++FFL+V+  SF YY LPGYLF ++T  SWVCW+ P
Sbjct  188   NLVQVSLFSALHEKEKKKKGGMTRIQFFLIVLVTSFAYYILPGYLFTMITSISWVCWLSP  247

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +S+   Q+GS   GLG+G   +DWA I +Y GSPL SP  A +NVA+GFV  +Y+ +P+C
Sbjct  248   KSVLVNQLGSGERGLGIGAIGIDWATIGSYLGSPLASPIFATINVAIGFVGVMYVAIPVC  307

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW  N ++A+ FPIFS+ LF   G  YD   ++  +F L+   Y     ++
Sbjct  308   YW-LNLYNAKTFPIFSSSLFRGNGSSYDVLSIIDNKFHLDREVYAKTGPIH  357



>emb|CDP00949.1| unnamed protein product [Coffea canephora]
Length=752

 Score =   215 bits (547),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 135/177 (76%), Gaps = 3/177 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
              PVE+V L V   DDP+LPV TFR WFLG+ SC++L FLNTFF YR+QPL+I+ I  Q+
Sbjct  33   ESPVEQVRLTVSNHDDPSLPVWTFRMWFLGLLSCVLLSFLNTFFGYRSQPLTITMISAQV  92

Query  293  SVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYS  466
            + LP+G+FMA  LP++KF    FG   F+LNPGPFN+KEH +I+V AN G S GGG AY+
Sbjct  93   ATLPLGRFMAKVLPKKKFRIPGFGSRQFSLNPGPFNMKEHALISVFANAGSSFGGGTAYA  152

Query  467  IGAITIMKAYYKQALSFLCGLIIVLTT-QLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            I  +TI++A+Y + +SFL   I+V TT Q++GYGWAG++RRY+V+P  MWWPS+L++
Sbjct  153  IDIVTIVRAFYHRRISFLASWILVTTTQQVLGYGWAGIMRRYVVEPAHMWWPSSLVQ  209


 Score =   156 bits (395),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 120/165 (73%), Gaps = 2/165 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALHE +   S M+R +FF++ +  SF +YT PG+L P+LT  S +C V+PR
Sbjct  206   SLVQVSLFRALHEKD--KSRMSRGKFFVIALICSFSWYTFPGFLMPMLTNVSLLCLVFPR  263

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SIT QQIGS   G+G+G F+LDW+ ++++ GSPLVSP+ A LN  VG+V+ +Y+++PL Y
Sbjct  264   SITMQQIGSGLSGIGIGSFSLDWSAVASFLGSPLVSPFFATLNAFVGYVVIVYVLIPLAY  323

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYES  1116
             WK+N +D + +P FS+QL+ + G  Y+   ++T +F L++P YE 
Sbjct  324   WKFNLYDGKTYPFFSSQLYDNQGKHYNISAIVTDKFQLDLPEYEK  368



>ref|XP_003547106.1| PREDICTED: oligopeptide transporter 4-like [Glycine max]
Length=737

 Score =   202 bits (515),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 97/191 (51%), Positives = 133/191 (70%), Gaps = 3/191 (2%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            NPA A E         P+EEV L V  TDDPT PV TFR WFLG+ SC ++ FLN FF Y
Sbjct  7    NPA-ASETEEDDDEVSPIEEVRLSVSNTDDPTRPVWTFRMWFLGLLSCSLVSFLNQFFAY  65

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVM  424
             T+ + I+ I +Q++ LPIG FMAA LP+  F+   FG  SF+ NPGPFN+KEHV+IT+ 
Sbjct  66   HTERIIITQITVQVATLPIGHFMAALLPKTTFSIPGFGSKSFSFNPGPFNMKEHVLITIF  125

Query  425  ANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPV  604
            AN G + G G  Y++G + I+KA+Y +++SF+   ++++TTQ++GYGWAG+L  Y+V P 
Sbjct  126  ANAGSAFGDGSPYAVGIVNIIKAFYGRSVSFVASWLLIVTTQVLGYGWAGLLVEYVVKPA  185

Query  605  DMWWPSTLLKC  637
             MWWPSTL++ 
Sbjct  186  HMWWPSTLVQA  196


 Score =   169 bits (427),  Expect(2) = 2e-93, Method: Compositional matrix adjust.
 Identities = 78/169 (46%), Positives = 115/169 (68%), Gaps = 2/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L Q +LFRALHE +     ++R +FF      S  +Y +PGYLF  LT  SWVCW++ +S
Sbjct  193   LVQAALFRALHEKD--DHRISRTKFFFFAQLFSMSWYVVPGYLFTTLTNISWVCWIFSKS  250

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS   GLGVG  TLDWA ++++  SPL+SP+ AI+NV VG+ + +Y+++P+ YW
Sbjct  251   VTAQQIGSGMRGLGVGALTLDWAAVTSFLFSPLISPFFAIVNVFVGYALTVYVVIPVSYW  310

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
               N ++A +FPIFS+ LFT+ G KY+   ++   F+LNV  YE   +++
Sbjct  311   GLNVYNANRFPIFSSHLFTAQGQKYNIPKIVDNHFELNVAEYEKQGRIH  359



>gb|KDO78542.1| hypothetical protein CISIN_1g004659mg [Citrus sinensis]
Length=739

 Score =   306 bits (785),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 156/170 (92%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E KS G+TRM+FFL+V+ ASF YY+LPGYLFPILTFFSWVCW WP 
Sbjct  190   NLAQVSLFRALHEKESKSKGLTRMQFFLIVLAASFAYYSLPGYLFPILTFFSWVCWAWPH  249

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLG+G FTLDWAGISAYHGSPLV+PWT+ILNV +GFVMFIYIIVPLCY
Sbjct  250   SITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVTPWTSILNVGIGFVMFIYIIVPLCY  309

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK++TFDARKFPIFSNQLFTS+GHKYDT  +LTPQ+DLN+PAY SY KLY
Sbjct  310   WKFDTFDARKFPIFSNQLFTSSGHKYDTTKILTPQYDLNIPAYNSYGKLY  359


 Score =   298 bits (762),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 170/203 (84%), Gaps = 9/203 (4%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            N    G+ T     RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +
Sbjct  10   NENPNGDSTEE---RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTF  66

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQI+VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  67   RTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFAN  125

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDPV+M
Sbjct  126  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPVEM  185

Query  611  WWPS-----TLLKCLYSEHSMKR  664
            WWPS     +L + L+ + S  +
Sbjct  186  WWPSNLAQVSLFRALHEKESKSK  208



>ref|XP_012068073.1| PREDICTED: oligopeptide transporter 4-like [Jatropha curcas]
Length=750

 Score =   214 bits (545),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 132/168 (79%), Gaps = 2/168 (1%)
 Frame = +2

Query  137  LVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKF  316
            L VP TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ LPIG+F
Sbjct  33   LTVPNTDDPTLPVWTFRMWFLGLFSCCLLAFLNQFFAYRTEPLVITQITVQVATLPIGRF  92

Query  317  MAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMK  490
            MAA LP+ KF    FG   F+LNPGPFN+KEHV+I++ AN G + G G AY++G + I+K
Sbjct  93   MAAVLPKTKFQIPGFGSREFSLNPGPFNVKEHVLISIFANAGSAFGNGSAYAVGIVNIIK  152

Query  491  AYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            A+Y++ +SF+   I+++TTQ++GYGWAG+LR+Y+V+P  MWWP+TL++
Sbjct  153  AFYRRNISFVAAWILIITTQVLGYGWAGLLRKYVVEPAHMWWPATLVQ  200


 Score =   157 bits (396),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 118/172 (69%), Gaps = 2/172 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG--MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  795
              L Q+SLF  LHE    S+   ++R++FFL+ +  SF++Y  PGYLF  L   +WVCW +
Sbjct  197   TLVQISLFSTLHEKGDPSNEHRISRVKFFLIALTCSFIWYLFPGYLFQTLQSLAWVCWAF  256

Query  796   PRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPL  975
             P+S+TA QIGS   GLG+G  TLDW+ ++++  SPL+SP+  ++NV VG+V+ +Y++ P+
Sbjct  257   PKSVTANQIGSGMRGLGIGALTLDWSTVASFLYSPLLSPFFVVVNVFVGYVLVMYVLTPV  316

Query  976   CYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             CYW  N +DA+ +P+FS+ LFT  G +Y+   ++  +F+L++  Y+   +++
Sbjct  317   CYWGINLYDAKTYPLFSSHLFTKQGERYNFTAIINEKFELDLAQYDKQGRVH  368



>ref|XP_002864248.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40507.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=739

 Score =   202 bits (514),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 127/171 (74%), Gaps = 4/171 (2%)
 Frame = +2

Query  122  VEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVL  301
            V +V L VP+TDDPT P +TFR W LGI++C++L FLN FF YRT PLSIS++  QI+V+
Sbjct  26   VPQVELTVPKTDDPTSPTVTFRMWVLGISACVLLSFLNQFFWYRTNPLSISSVSAQIAVV  85

Query  302  PIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAIT  481
            PIG  MA  LP R+F    RWSFT+NPGPF+ KEHV+ITV AN     G G  Y+   ++
Sbjct  86   PIGHLMARVLPTRRFFEGTRWSFTMNPGPFSTKEHVLITVFANS----GSGSVYASHILS  141

Query  482  IMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +K YYK+ L FL  L++++TTQ++G+GWAG+ R++LVDP +MWWPS L++
Sbjct  142  AVKLYYKRRLDFLPALLVMITTQVLGFGWAGLYRKHLVDPGEMWWPSNLVQ  192


 Score =   168 bits (426),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 116/166 (70%), Gaps = 2/166 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E KS  G++R +FF++ +  SF YY LPGYLF +LT  SW+CW+ P
Sbjct  189   NLVQVSLFRALHEKENKSKWGISRNQFFVITLITSFSYYLLPGYLFTVLTTVSWLCWISP  248

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +SI   Q+GS   GLG+G F LDW+ I++Y GSPL SP+ A  N+AVGF + +Y+I PLC
Sbjct  249   KSILVNQLGSGSAGLGIGSFGLDWSTIASYLGSPLASPFFASANIAVGFFLVMYVITPLC  308

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYES  1116
             Y+  + ++A+ FPI+S +LF ++G +Y+   ++   F L+  AY  
Sbjct  309   YY-LDFYNAKTFPIYSGKLFVASGKEYNVTSIIDANFRLDRKAYAE  353



>ref|XP_009119900.1| PREDICTED: oligopeptide transporter 9 [Brassica rapa]
Length=741

 Score =   210 bits (534),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 129/182 (71%), Gaps = 4/182 (2%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E+      RC VEEV L VP+TDDPTLPVLTFR W LG+ +CIIL F+N FF YR  PL+
Sbjct  15   EEAVDELDRCAVEEVELTVPKTDDPTLPVLTFRMWVLGLAACIILSFVNQFFWYRQMPLT  74

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            I+ I  QI+V+P+G  MA  LP +K+    RW F +NPGPFNIKEHV+IT+ AN     G
Sbjct  75   ITGISAQIAVVPLGHLMARVLPNKKYLEGSRWEFNMNPGPFNIKEHVMITIFANS----G  130

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTL  628
             G  Y+   ++ +K YYK++L FL   +I++TTQ +G+GWAG+ R++LV+P +MWWPS L
Sbjct  131  AGTVYATHILSAIKLYYKRSLPFLPAFLIMITTQFLGFGWAGLFRKHLVEPGEMWWPSNL  190

Query  629  LK  634
            ++
Sbjct  191  VQ  192


 Score =   160 bits (406),  Expect(2) = 3e-93, Method: Compositional matrix adjust.
 Identities = 82/171 (48%), Positives = 112/171 (65%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLF ALHE E K  G MTR++FF++V+  SF YY LPGYLF ++T  SWVCW+ P
Sbjct  189   NLVQVSLFSALHEKEKKKKGGMTRIQFFIIVLVTSFAYYILPGYLFTMITSISWVCWLSP  248

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +S+ A Q+GS   GLG+G   +DWA I +Y GSPL SP  A +NV +GFV+ +Y+  P+C
Sbjct  249   KSVLANQLGSGEQGLGIGAIGIDWATIGSYLGSPLASPIFATVNVTIGFVIIMYVATPIC  308

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW  N + A+ +PIFS+ LF   G  YD   ++  +F L+   Y     ++
Sbjct  309   YW-LNLYRAKTYPIFSSGLFMGNGSSYDVLSIIDDKFHLDRAVYAKTGPIH  358



>ref|XP_006467278.1| PREDICTED: oligopeptide transporter 3-like [Citrus sinensis]
Length=739

 Score =   306 bits (784),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E KS G+TRM+FFL+ + ASF YYTLPGYLFPILTFFSWVCW WP 
Sbjct  190   NLAQVSLFRALHEKESKSKGLTRMQFFLITLAASFAYYTLPGYLFPILTFFSWVCWAWPH  249

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLG+G FTLDWAGISAYHGSPLV+PWT+ILNV +GFVMFIYIIVPLCY
Sbjct  250   SITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVTPWTSILNVGIGFVMFIYIIVPLCY  309

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK++TFDARKFPIFSNQLFTS+GHKYDT  +LTPQ+DLN+PAY SY KLY
Sbjct  310   WKFDTFDARKFPIFSNQLFTSSGHKYDTTKILTPQYDLNIPAYNSYGKLY  359


 Score =   298 bits (762),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 143/203 (70%), Positives = 170/203 (84%), Gaps = 9/203 (4%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
            N    G+ T     RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +
Sbjct  10   NENPNGDSTEE---RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTF  66

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQI+VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  67   RTQPLTISAILMQIAVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFAN  125

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDPV+M
Sbjct  126  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPVEM  185

Query  611  WWPS-----TLLKCLYSEHSMKR  664
            WWPS     +L + L+ + S  +
Sbjct  186  WWPSNLAQVSLFRALHEKESKSK  208



>ref|XP_008785648.1| PREDICTED: oligopeptide transporter 3-like [Phoenix dactylifera]
Length=730

 Score =   305 bits (782),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 143/198 (72%), Positives = 166/198 (84%), Gaps = 5/198 (3%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
             EK      RCPVEEVALVVPE DDP+LPV+TFRAWFLGITSC +LIFLNTFF YRTQPL
Sbjct  2    AEKQEVEQERCPVEEVALVVPENDDPSLPVMTFRAWFLGITSCTVLIFLNTFFTYRTQPL  61

Query  266  SISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSP  445
            +ISAILMQISVLP+G+ MA+ LP ++   FGRW F LNPGPFN+KEH IITV ANCGVSP
Sbjct  62   TISAILMQISVLPLGRLMASALPNKEVKVFGRWGFNLNPGPFNVKEHTIITVFANCGVSP  121

Query  446  GGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS-  622
            GGGDAYSIGAIT+MKAYY+Q+LSFLCGLIIV+TTQL+GYGWAG+LR++LVDP +MWWPS 
Sbjct  122  GGGDAYSIGAITVMKAYYRQSLSFLCGLIIVITTQLLGYGWAGMLRKFLVDPAEMWWPSS  181

Query  623  ----TLLKCLYSEHSMKR  664
                +L + L+ + S  R
Sbjct  182  LAQVSLFRALHEKDSPSR  199


 Score =   281 bits (719),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +LAQVSLFRALHE +  S G +RM+FFL+    SF+YY LPGYLFPILTFFSWVCWVWP 
Sbjct  181   SLAQVSLFRALHEKDSPSRGPSRMKFFLIFFVGSFLYYVLPGYLFPILTFFSWVCWVWPH  240

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLG+G FTLDWAGISAYHGSPLV+PW +I+N AVGF+MFIYIIVPLCY
Sbjct  241   SITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVTPWFSIINTAVGFIMFIYIIVPLCY  300

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WKYNTFDARKFPIFSNQLFTS G  YDT  VLTPQF+LN  AY+ Y KLY
Sbjct  301   WKYNTFDARKFPIFSNQLFTSKGKNYDTTKVLTPQFELNEAAYDGYGKLY  350



>gb|EEC73829.1| hypothetical protein OsI_08562 [Oryza sativa Indica Group]
Length=757

 Score =   196 bits (497),  Expect(2) = 6e-93, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 130/175 (74%), Gaps = 3/175 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L VP  DD  LPV TFR W +G+ SC +L FLN FF YRT+PL ++ I +Q++ 
Sbjct  25   PIEEVRLTVPAGDDTALPVWTFRMWSIGLLSCALLSFLNQFFSYRTEPLIVTQITVQVAS  84

Query  299  LPIGKFMAATLPERKF---APFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSI  469
            LP+G F+A  LP R F   A  G   ++LNPGPFN+KEHV+I++ AN G + G G+AY++
Sbjct  85   LPVGHFLARVLPRRAFRAPALLGGGEWSLNPGPFNMKEHVLISIFANAGCAFGNGNAYAV  144

Query  470  GAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
              + I++A+YK+++SF+   ++++TTQ++GYGWAG++R+++V+P  MWWP TL++
Sbjct  145  MIVDIIRAFYKRSISFVAAWLLIITTQVLGYGWAGLMRKFVVEPAHMWWPGTLVQ  199


 Score =   174 bits (441),  Expect(2) = 6e-93, Method: Compositional matrix adjust.
 Identities = 85/180 (47%), Positives = 121/180 (67%), Gaps = 12/180 (7%)
 Frame = +1

Query  625   LAQVSLFR---------ALHETEVKSSG---MTRMRFFLLVMGASFVYYTLPGYLFPILT  768
             L QVSLFR         ALHE +    G   ++R +FFL+ +  SF +Y +PGYLFP LT
Sbjct  197   LVQVSLFRGNIVPVRLTALHEKDELPHGSRQISRSKFFLVALICSFAWYAVPGYLFPTLT  256

Query  769   FFSWVCWVWPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFV  948
               SWVCWV+ +S+TAQQ+GS   GLGVG F+LDW  IS++  SPL+SP+ A  N+ VGFV
Sbjct  257   SISWVCWVFSKSVTAQQLGSGLKGLGVGAFSLDWTAISSFLFSPLISPFFATANIFVGFV  316

Query  949   MFIYIIVPLCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             +F+Y++VP+ YW +N ++A+ FPIFS+ LF S G  YD   ++  +F+L++ AY    ++
Sbjct  317   LFLYVLVPIAYWGFNLYNAKTFPIFSSHLFMSNGTSYDITAIVNDKFELDIDAYNKLGRI  376



>gb|EAY75055.1| hypothetical protein OsI_02950 [Oryza sativa Indica Group]
Length=755

 Score =   195 bits (496),  Expect(2) = 6e-93, Method: Compositional matrix adjust.
 Identities = 87/175 (50%), Positives = 128/175 (73%), Gaps = 3/175 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L VP TDDP+LPV TFR W LG+ SC+++ FLN FF YRT+PL ++ I +Q++ 
Sbjct  25   PIEEVRLTVPVTDDPSLPVWTFRMWTLGLLSCVLMSFLNQFFSYRTEPLIVTQITVQVAS  84

Query  299  LPIGKFMAATLPERKF---APFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSI  469
            LP+G  +A  LP RKF   A  G    +LNPGPFN+KEHV++++ AN G + G G AY++
Sbjct  85   LPLGHILARVLPRRKFKAPALLGGGECSLNPGPFNMKEHVLVSIFANAGCAFGSGSAYAV  144

Query  470  GAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
              + I++A+Y +++S     +++ TTQ++GYGWAG++RRY+V+P  MWWP TL++
Sbjct  145  MIVDIIRAFYGRSISLFPAWLLITTTQVLGYGWAGLMRRYVVEPAQMWWPGTLVQ  199


 Score =   174 bits (442),  Expect(2) = 6e-93, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 119/177 (67%), Gaps = 8/177 (5%)
 Frame = +1

Query  622   NLAQVSLFRALHETEV--------KSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFS  777
              L QVSLFRALH               GM++ +FFL+ +  SF++Y +PGYLFP LT  S
Sbjct  196   TLVQVSLFRALHGKGEEKEENKEGSGGGMSQAKFFLIALACSFLWYAVPGYLFPTLTSVS  255

Query  778   WVCWVWPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFI  957
             WVCW++ +S+TAQQ+GS   GLG+G FTLDW  +SA+  SPL+SP+ A  N+  G+V+ +
Sbjct  256   WVCWIFSKSVTAQQLGSGMKGLGLGAFTLDWTAVSAFLYSPLISPFFATANILAGYVLLM  315

Query  958   YIIVPLCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             Y++VP+ YW  + ++AR+FPIFS+ LFT+TG  YD   ++  +F++++  Y    ++
Sbjct  316   YVVVPVSYWGLDLYNARRFPIFSSHLFTATGSTYDITAIVNDRFEIDMDGYHRMGRI  372



>ref|XP_006449924.1| hypothetical protein CICLE_v10014396mg [Citrus clementina]
 gb|ESR63164.1| hypothetical protein CICLE_v10014396mg [Citrus clementina]
Length=739

 Score =   305 bits (782),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 155/170 (91%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E KS G+TRM+FFL+ + ASF YYTLPGYLFPILTFFSWVCW WP 
Sbjct  190   NLAQVSLFRALHEKESKSKGLTRMQFFLIALAASFAYYTLPGYLFPILTFFSWVCWAWPH  249

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLG+G FTLDWAGISAYHGSPLV+PWT+ILNV +GFVMFIYIIVPLCY
Sbjct  250   SITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVTPWTSILNVGIGFVMFIYIIVPLCY  309

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK++TFDARKFPIFSNQLF+S+GHKYDT  +LTPQ+DLN+PAY SY KLY
Sbjct  310   WKFDTFDARKFPIFSNQLFSSSGHKYDTTKILTPQYDLNIPAYNSYGKLY  359


 Score =   298 bits (763),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 140/189 (74%), Positives = 166/189 (88%), Gaps = 6/189 (3%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RCP+EEVAL+VPETDDPT+PV+TFRAWFLG+TSC +LIFLNTFF +RTQPL+ISAILMQI
Sbjct  21   RCPIEEVALIVPETDDPTMPVMTFRAWFLGLTSCTLLIFLNTFFTFRTQPLTISAILMQI  80

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +VLPIGKFMA  LP ++F   G W F+LNPGPFNIKEHVIIT+ ANCGVS GGGDAYSIG
Sbjct  81   AVLPIGKFMARILPNKEFQVLG-WRFSLNPGPFNIKEHVIITIFANCGVSFGGGDAYSIG  139

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS-----TLLKC  637
            AIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDPV+MWWPS     +L + 
Sbjct  140  AITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPVEMWWPSNLAQVSLFRA  199

Query  638  LYSEHSMKR  664
            L+ + S  +
Sbjct  200  LHEKESKSK  208



>gb|AES90550.2| oligopeptide transporter OPT family protein [Medicago truncatula]
Length=718

 Score =   203 bits (516),  Expect(2) = 9e-93, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 127/170 (75%), Gaps = 2/170 (1%)
 Frame = +2

Query  131  VALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIG  310
            V L V +TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ LP+G
Sbjct  27   VRLTVKKTDDPTLPVWTFRMWFLGLLSCALLSFLNQFFAYRTEPLIITQITVQVATLPLG  86

Query  311  KFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITI  484
              MA+ LP + F    FG   F+ NPGPFN+KEHV+IT+ AN G + G G +Y++G + I
Sbjct  87   HLMASVLPSKTFRIPGFGSKRFSFNPGPFNMKEHVLITIFANAGAAFGSGSSYAVGIVNI  146

Query  485  MKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            +KA+Y + +SFL   ++++TTQ++GYGWAG+LR+Y+V+P  MWWP TL++
Sbjct  147  IKAFYGRNISFLAAWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPGTLVQ  196


 Score =   166 bits (420),  Expect(2) = 9e-93, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 115/169 (68%), Gaps = 0/169 (0%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFR LHE +      +R +FF + +  SF +Y +PGYLF  LT  SWVCWV+ +S
Sbjct  194   LVQVSLFRTLHEKDDNPHQFSRAKFFFIALVCSFTWYIVPGYLFTTLTSISWVCWVFSKS  253

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS  +GLG+G  TLDW+ ++++  SPL+SP+ AI+NV VG+ + +Y ++P+ YW
Sbjct  254   VTAQQIGSGMNGLGLGALTLDWSAVASFLFSPLISPFFAIVNVFVGYALLVYAVIPIAYW  313

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              +N + A +F IFS+ L+T+ G  Y+   ++  +F++++  Y    +++
Sbjct  314   GFNVYGANRFSIFSSDLYTAQGQPYNISNIVNDKFEIDLAKYHEQGRIH  362



>ref|XP_002864247.1| ATOPT9 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40506.1| ATOPT9 [Arabidopsis lyrata subsp. lyrata]
Length=741

 Score =   205 bits (522),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 126/174 (72%), Gaps = 4/174 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC VEEV L VP+TDDPTLPVLTFR W LG+ +CIIL F+N FF YR  PL+IS I  QI
Sbjct  23   RCVVEEVELTVPKTDDPTLPVLTFRMWTLGLGACIILSFINQFFWYRQMPLTISGISAQI  82

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA  LP R F    +W F +NPGPFN+KEHV+IT+ AN     G G  Y+  
Sbjct  83   AVVPLGHLMARVLPTRMFLEGSKWEFCMNPGPFNVKEHVLITIFANS----GAGTVYATH  138

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             ++ +K YYK++L FL   ++++TTQ +G+GWAG+ R++LV+P +MWWPS L++
Sbjct  139  VLSAIKLYYKRSLPFLPAFLLMITTQFLGFGWAGLFRKHLVEPGEMWWPSNLVQ  192


 Score =   164 bits (414),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 84/171 (49%), Positives = 113/171 (66%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLF ALHE E K  G MTR++FFL+V+  SF YY LPGYLF ++T  SWVCW+ P
Sbjct  189   NLVQVSLFSALHEKEKKKKGGMTRIQFFLIVLVTSFAYYILPGYLFTMITSISWVCWLSP  248

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +S+ A Q+GS   GLG+G   +DWA IS+Y GSPL SP  A +NV +GFV+ +Y+  P+C
Sbjct  249   KSVLAHQLGSGEQGLGIGAIGIDWATISSYLGSPLASPLFATINVTIGFVVIMYVATPIC  308

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW  N + A+ +PIFS+ LF   G  YD   ++  +F L+   Y     ++
Sbjct  309   YW-LNIYKAKTYPIFSSGLFMGNGSSYDVLSIIDKKFHLDREIYAKTGPIH  358



>emb|CDY35662.1| BnaC09g29840D [Brassica napus]
Length=741

 Score =   210 bits (535),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 96/182 (53%), Positives = 130/182 (71%), Gaps = 4/182 (2%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E+      RC VEEV L VP+TDDPTLPVLTFR W LG+ +CIIL F+N FF YR  PL+
Sbjct  15   EEAVDELDRCAVEEVELTVPKTDDPTLPVLTFRMWVLGLAACIILSFVNQFFWYRQMPLT  74

Query  269  ISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            I+ I  QI+V+P+G  MA  LP +K+    RW F +NPGPFNIKEHV+IT+ AN     G
Sbjct  75   ITGISAQIAVVPLGHLMARVLPNKKYLEGSRWEFNMNPGPFNIKEHVMITIFANS----G  130

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTL  628
             G  Y+   ++ +K YYK++L FL   +I++TTQ +G+GWAG+ R++LV+P +MWWPS+L
Sbjct  131  AGTVYATHILSAIKLYYKRSLPFLPAFLIMITTQFLGFGWAGLFRKHLVEPGEMWWPSSL  190

Query  629  LK  634
            ++
Sbjct  191  VQ  192


 Score =   158 bits (400),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 112/171 (65%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             +L QVSLF ALHE E K  G MTR++FF++V+  SF YY LPGYLF ++T  SWVCW+ P
Sbjct  189   SLVQVSLFSALHEKEKKKKGGMTRIQFFIIVLVTSFAYYILPGYLFTMITSISWVCWLSP  248

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +S+ A Q+GS   GLG+G   +DWA I +Y GSPL SP  A +NV +GFV+ +Y+  P+C
Sbjct  249   KSVLANQLGSGEQGLGIGAIGIDWATIGSYLGSPLASPIFATVNVTIGFVIIMYVATPIC  308

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW  N + A+ +PIFS+ LF   G  YD   ++  +F L+   Y     ++
Sbjct  309   YW-LNLYRAKTYPIFSSGLFMGNGSSYDVLSIIDDKFHLDRAVYAKTGPIH  358



>emb|CDY38751.1| BnaC03g14980D [Brassica napus]
Length=739

 Score =   196 bits (497),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 91/171 (53%), Positives = 125/171 (73%), Gaps = 4/171 (2%)
 Frame = +2

Query  122  VEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVL  301
            V +V L VP+TDDPT P +TFR W LGI +C++L F+N FF YRT PL+IS++  QI+V+
Sbjct  26   VPQVELTVPKTDDPTAPTVTFRMWVLGIAACVLLSFVNQFFWYRTNPLTISSVSAQIAVV  85

Query  302  PIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAIT  481
            PIG  MA  LP R+F    RWSFTLNPGPF+ KEHV+ITV AN     G G  Y+   ++
Sbjct  86   PIGHLMAKVLPTRRFFQGKRWSFTLNPGPFSTKEHVLITVFANS----GSGAVYASHILS  141

Query  482  IMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +K +YK+ L FL  L+I++T Q++G+GWAG+ R++LV+P +MWWPS L++
Sbjct  142  AVKLFYKRRLDFLPALLIMITNQVLGFGWAGLYRKHLVEPGEMWWPSNLVQ  192


 Score =   173 bits (438),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 114/166 (69%), Gaps = 2/166 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE EVKS  G+TR +FF++ +  SF YY LPGYLF +LT  SW+CW+ P
Sbjct  189   NLVQVSLFRALHEKEVKSKWGITRNQFFVIALVTSFSYYILPGYLFSLLTTVSWLCWIRP  248

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +SI   Q+GS   GLG+G F LDWA I++Y GSPL SP+ A  N+AVGF + +Y+I PL 
Sbjct  249   KSILVNQLGSGSVGLGIGAFGLDWATIASYLGSPLASPFFATANIAVGFFLLMYVITPLS  308

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYES  1116
             Y+  + F AR FPI+S +LF S G +Y    ++  +F L+  AY  
Sbjct  309   YY-LDFFHARTFPIYSGKLFVSNGQEYKVRNIINDEFRLDHKAYAE  353



>ref|XP_011627877.1| PREDICTED: oligopeptide transporter 4 isoform X2 [Amborella trichopoda]
Length=547

 Score =   211 bits (536),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 132/173 (76%), Gaps = 1/173 (1%)
 Frame = +2

Query  116  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  295
             P+E+V L V  TDDP+LPV TFR WFLG+ SC  + FLN FF YRT+PL I+ I +Q++
Sbjct  19   SPIEQVRLTVTTTDDPSLPVWTFRMWFLGVLSCAAMSFLNQFFAYRTEPLVITQISVQVA  78

Query  296  VLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  475
             LP G F+AA LP++KF   G   ++LNPGPFN+KEHV+IT+ AN G + G G  Y++G 
Sbjct  79   SLPAGHFLAAVLPKKKFR-LGGSEYSLNPGPFNMKEHVLITIFANAGYAFGSGTPYAVGI  137

Query  476  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            + I+KA+Y++ +SF+   +I++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  138  VNIIKAFYRRKISFIASWLIIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  190


 Score =   158 bits (399),  Expect(2) = 1e-92, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 119/170 (70%), Gaps = 2/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVS+FRALHE + +   ++R +FF++ +  SF YY LPGYLF  LT  SWVCW  P+
Sbjct  187   TLVQVSVFRALHEKDDRR--LSRAKFFVIALVCSFSYYVLPGYLFSTLTTISWVCWAHPK  244

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQ+GS  +GLG+G F LDWA I+A+  SPL+ P+ AI+N+ VG+V+ +Y+ +P+ Y
Sbjct  245   SITAQQLGSGLNGLGLGAFPLDWAAIAAFMFSPLIYPFFAIMNIFVGYVVIVYLAIPIAY  304

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W ++ + A+KFPIFS+ LFT+ G  Y+   ++  QF+L+  AY     ++
Sbjct  305   WGFDLYGAKKFPIFSSDLFTADGQPYNITAIVNGQFELDETAYAQQGPIH  354



>gb|KFK26970.1| hypothetical protein AALP_AA8G317000 [Arabis alpina]
Length=742

 Score =   210 bits (534),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 103/200 (52%), Positives = 136/200 (68%), Gaps = 7/200 (4%)
 Frame = +2

Query  35   LSEHIVVEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSC  214
            ++  IV E +G   A   E       +C VEEV L VP+TDDPTLPVLTFR W LG+ +C
Sbjct  1    MAHEIVEESTG---AMNIEGVVEELDQCVVEEVELTVPKTDDPTLPVLTFRMWVLGLGAC  57

Query  215  IILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFN  394
            IIL F+N FF YR  PL+I+ I  QI+V+P+G  MA  LP RKF    RW F LNPGPFN
Sbjct  58   IILSFVNQFFWYRQMPLTITGISAQIAVVPLGHLMARLLPTRKFLEGSRWEFCLNPGPFN  117

Query  395  IKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAG  574
            IKEHV+IT+ AN     G G  Y+   ++ +K YYK++L FL   +I++TTQ +G+GWAG
Sbjct  118  IKEHVMITIFANS----GAGTVYATHILSAIKLYYKRSLPFLPAFLIMITTQFLGFGWAG  173

Query  575  VLRRYLVDPVDMWWPSTLLK  634
            + R++LV+P +MWWPS L++
Sbjct  174  LFRKHLVEPGEMWWPSNLVQ  193


 Score =   158 bits (400),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 81/171 (47%), Positives = 113/171 (66%), Gaps = 2/171 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLF ALHE E K  G +TR++FFL+V+  SF YY LPGYLF ++T  SWVCW+ P
Sbjct  190   NLVQVSLFSALHEKEKKKKGGITRIQFFLIVLVTSFAYYILPGYLFTMITSISWVCWLSP  249

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +S+ A Q+GS   GLG+G   +DWA I +Y GSPL SP  A +NV +GFV+ +Y+  P+C
Sbjct  250   KSVLANQLGSGEQGLGIGAIGIDWATIGSYLGSPLASPLFATINVTIGFVVVMYVATPIC  309

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             YW  N ++A+ +PIFS+ LF   G  Y+   ++  +F L+   Y     ++
Sbjct  310   YW-LNLYNAKTYPIFSSGLFMGNGSSYNVLGIIDNKFHLDRDIYAKTGPIH  359



>ref|XP_003608353.1| Oligopeptide transporter [Medicago truncatula]
Length=739

 Score =   202 bits (515),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 91/170 (54%), Positives = 127/170 (75%), Gaps = 2/170 (1%)
 Frame = +2

Query  131  VALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIG  310
            V L V +TDDPTLPV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ LP+G
Sbjct  27   VRLTVKKTDDPTLPVWTFRMWFLGLLSCALLSFLNQFFAYRTEPLIITQITVQVATLPLG  86

Query  311  KFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITI  484
              MA+ LP + F    FG   F+ NPGPFN+KEHV+IT+ AN G + G G +Y++G + I
Sbjct  87   HLMASVLPSKTFRIPGFGSKRFSFNPGPFNMKEHVLITIFANAGAAFGSGSSYAVGIVNI  146

Query  485  MKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            +KA+Y + +SFL   ++++TTQ++GYGWAG+LR+Y+V+P  MWWP TL++
Sbjct  147  IKAFYGRNISFLAAWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPGTLVQ  196


 Score =   166 bits (419),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 72/169 (43%), Positives = 115/169 (68%), Gaps = 0/169 (0%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFR LHE +      +R +FF + +  SF +Y +PGYLF  LT  SWVCWV+ +S
Sbjct  194   LVQVSLFRTLHEKDDNPHQFSRAKFFFIALVCSFTWYIVPGYLFTTLTSISWVCWVFSKS  253

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS  +GLG+G  TLDW+ ++++  SPL+SP+ AI+NV VG+ + +Y ++P+ YW
Sbjct  254   VTAQQIGSGMNGLGLGALTLDWSAVASFLFSPLISPFFAIVNVFVGYALLVYAVIPIAYW  313

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
              +N + A +F IFS+ L+T+ G  Y+   ++  +F++++  Y    +++
Sbjct  314   GFNVYGANRFSIFSSDLYTAQGQPYNISNIVNDKFEIDLAKYHEQGRIH  362



>ref|XP_011627878.1| PREDICTED: oligopeptide transporter 4 isoform X3 [Amborella trichopoda]
Length=535

 Score =   211 bits (536),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 93/173 (54%), Positives = 132/173 (76%), Gaps = 1/173 (1%)
 Frame = +2

Query  116  CPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQIS  295
             P+E+V L V  TDDP+LPV TFR WFLG+ SC  + FLN FF YRT+PL I+ I +Q++
Sbjct  19   SPIEQVRLTVTTTDDPSLPVWTFRMWFLGVLSCAAMSFLNQFFAYRTEPLVITQISVQVA  78

Query  296  VLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  475
             LP G F+AA LP++KF   G   ++LNPGPFN+KEHV+IT+ AN G + G G  Y++G 
Sbjct  79   SLPAGHFLAAVLPKKKFR-LGGSEYSLNPGPFNMKEHVLITIFANAGYAFGSGTPYAVGI  137

Query  476  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            + I+KA+Y++ +SF+   +I++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  138  VNIIKAFYRRKISFIASWLIIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  190


 Score =   157 bits (398),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 119/170 (70%), Gaps = 2/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVS+FRALHE + +   ++R +FF++ +  SF YY LPGYLF  LT  SWVCW  P+
Sbjct  187   TLVQVSVFRALHEKDDRR--LSRAKFFVIALVCSFSYYVLPGYLFSTLTTISWVCWAHPK  244

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQ+GS  +GLG+G F LDWA I+A+  SPL+ P+ AI+N+ VG+V+ +Y+ +P+ Y
Sbjct  245   SITAQQLGSGLNGLGLGAFPLDWAAIAAFMFSPLIYPFFAIMNIFVGYVVIVYLAIPIAY  304

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W ++ + A+KFPIFS+ LFT+ G  Y+   ++  QF+L+  AY     ++
Sbjct  305   WGFDLYGAKKFPIFSSDLFTADGQPYNITAIVNGQFELDETAYAQQGPIH  354



>emb|CDY47076.1| BnaA03g12220D [Brassica napus]
Length=739

 Score =   195 bits (496),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 90/171 (53%), Positives = 125/171 (73%), Gaps = 4/171 (2%)
 Frame = +2

Query  122  VEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVL  301
            V +V L VP+TDDPT P +TFR W LGI +C++L F+N FF YRT PL+IS++  QI+V+
Sbjct  26   VPQVELTVPKTDDPTAPTVTFRMWVLGIAACVLLSFVNQFFWYRTNPLTISSVSAQIAVV  85

Query  302  PIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAIT  481
            PIG  MA  LP R+F    RWSFT+NPGPF+ KEHV+ITV AN     G G  Y+   ++
Sbjct  86   PIGHLMAKVLPTRRFFQGTRWSFTMNPGPFSTKEHVLITVFANS----GSGAVYASHILS  141

Query  482  IMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +K +YK+ L F   L+I++TTQ++G+GWAG+ R++LV+P +MWWPS L++
Sbjct  142  AVKLFYKRRLDFFPALLIMITTQVLGFGWAGLYRKHLVEPGEMWWPSNLVQ  192


 Score =   173 bits (438),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 87/166 (52%), Positives = 114/166 (69%), Gaps = 2/166 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE EVKS  G+TR +FF++ +  SF YY LPGYLF +LT  SW+CW+ P
Sbjct  189   NLVQVSLFRALHEKEVKSKWGITRNQFFVIALVTSFSYYILPGYLFSLLTTVSWLCWIRP  248

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +SI   Q+GS   GLG+G F LDWA I++Y GSPL SP+ A  N+AVGF + +Y+I PL 
Sbjct  249   KSILVNQLGSGSVGLGIGAFGLDWATIASYLGSPLASPFFATANIAVGFFLLMYVITPLS  308

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYES  1116
             Y+  + F AR FPI+S +LF S G +Y    ++  +F L+  AY  
Sbjct  309   YY-LDFFHARTFPIYSGKLFVSNGQEYKVRNIINDEFRLDHKAYAE  353



>ref|XP_003545740.1| PREDICTED: oligopeptide transporter 4 [Glycine max]
Length=736

 Score =   191 bits (484),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 97/174 (56%), Positives = 131/174 (75%), Gaps = 2/174 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L V  TDDPT PV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q++ 
Sbjct  21   PIEEVRLTVTNTDDPTRPVWTFRMWFLGLLSCSLLSFLNQFFAYRTEPLIITQITVQVAT  80

Query  299  LPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            LPIG FMAA LP   F+   FG  SF+ NPGPFN+KEHV+IT+ AN G + G G  Y++G
Sbjct  81   LPIGHFMAAFLPTTTFSIPGFGSKSFSFNPGPFNMKEHVLITIFANAGSAFGSGSPYAVG  140

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             + I+KA+Y +++SF    ++++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  141  IVNIIKAFYGRSISFAASWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  194


 Score =   177 bits (449),  Expect(2) = 2e-92, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 119/169 (70%), Gaps = 2/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE +     ++R +FF + +  SF +Y +PGYLF  LT  SWVCW++ +S
Sbjct  192   LVQVSLFRALHEKD--DHRLSRAKFFFIALVCSFSWYVVPGYLFTTLTNISWVCWIFSKS  249

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQIGS   GLGVG  TLDWA ++++  SPL+SP+ AI+NV VG+ + +Y+++P+ YW
Sbjct  250   VTAQQIGSGMRGLGVGALTLDWAAVASFLFSPLISPFFAIVNVFVGYALIVYVVIPVSYW  309

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
               N ++A +FPIFS+ LFT+ G KY+   ++   F+LNV  YE   +++
Sbjct  310   GLNVYNANRFPIFSSHLFTAQGQKYNIPKIVDNHFELNVAEYEKQGRIH  358



>ref|XP_004485624.1| PREDICTED: oligopeptide transporter 4-like [Cicer arietinum]
Length=740

 Score =   198 bits (504),  Expect(2) = 3e-92, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 123/168 (73%), Gaps = 2/168 (1%)
 Frame = +2

Query  137  LVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKF  316
            L V   DDP+ PV TFR WFLG+ SC +L FLN FF YRT+PL I+ I +Q+S LPIG F
Sbjct  30   LTVTNKDDPSQPVWTFRMWFLGLISCSLLSFLNQFFAYRTEPLIITLIAVQVSTLPIGHF  89

Query  317  MAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMK  490
            MA  LP  KF    FG   F+ NPGPFN+KEHV+IT+ AN G + G G  Y++G + I+K
Sbjct  90   MATVLPSTKFGIPGFGSKMFSFNPGPFNMKEHVLITIFANAGSAFGSGSPYAVGIVNIIK  149

Query  491  AYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            A+Y +++SF    ++++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  150  AFYGRSISFHAAWLLIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  197


 Score =   169 bits (428),  Expect(2) = 3e-92, Method: Compositional matrix adjust.
 Identities = 76/169 (45%), Positives = 117/169 (69%), Gaps = 1/169 (1%)
 Frame = +1

Query  625   LAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPRS  804
             L QVSLFRALHE +     ++R +FF + +  SF +Y +PGY F  LT  SWVCWV+ +S
Sbjct  195   LVQVSLFRALHEKD-DGHRISRAKFFFIALVCSFSWYVIPGYFFTTLTSISWVCWVFSKS  253

Query  805   ITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCYW  984
             +TAQQ+GS   GLG+G  TLDW+ ++++  SPL+SP+ AI+NV VG+ + +Y + P+ YW
Sbjct  254   VTAQQLGSGMKGLGIGALTLDWSAVASFLFSPLISPFFAIVNVFVGYAIIVYAVTPIAYW  313

Query  985   KYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
               +T++A++FPIFS+ LFTS G KY+   ++  +F+L+   Y    +++
Sbjct  314   GLDTYNAKRFPIFSSHLFTSQGQKYNISAIVNDKFELDFAKYREQGRIH  362



>ref|XP_010087657.1| Oligopeptide transporter 3 [Morus notabilis]
 gb|EXB29550.1| Oligopeptide transporter 3 [Morus notabilis]
Length=724

 Score =   303 bits (777),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E K  GMTRM+FFL+ MGASF YY LPGYLFPILTFFSWVCW WP 
Sbjct  192   NLAQVSLFRALHEKEDKKKGMTRMKFFLIAMGASFAYYALPGYLFPILTFFSWVCWAWPH  251

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS YHGLG+G FTLDWAGISAYHGSPLV+P+++ILNV VGFVMFIYIIVPLCY
Sbjct  252   SVTAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVTPFSSILNVGVGFVMFIYIIVPLCY  311

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK+NTFD+R FPIFSNQLFT TGHKYDT  +LTPQFDLNV AY SYSKLY
Sbjct  312   WKFNTFDSRNFPIFSNQLFTKTGHKYDTTKILTPQFDLNVDAYNSYSKLY  361


 Score =   296 bits (758),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 171/208 (82%), Gaps = 6/208 (3%)
 Frame = +2

Query  56   EMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLN  235
            + +G    T       S  RC VEEVALVVPETDDP+LPVLTFRAW LG+ SC++LIFLN
Sbjct  4    KTNGQGTETEKPNVESSEERCSVEEVALVVPETDDPSLPVLTFRAWVLGLGSCVLLIFLN  63

Query  236  TFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVII  415
            TFF YRTQPL+ISAILMQISVLPIGKFMAATLP ++++  GR  F+LNPGPFN+KEHVII
Sbjct  64   TFFTYRTQPLTISAILMQISVLPIGKFMAATLPTKEYSLLGR-RFSLNPGPFNMKEHVII  122

Query  416  TVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLV  595
            T+ ANCGVS GGGDAYSIGAIT+MKAYYKQ+++FLC L+IVLTTQ++GYGWAG+LRRYLV
Sbjct  123  TIFANCGVSFGGGDAYSIGAITVMKAYYKQSVNFLCALLIVLTTQILGYGWAGMLRRYLV  182

Query  596  DPVDMWWPS-----TLLKCLYSEHSMKR  664
            DPV+MWWP+     +L + L+ +   K+
Sbjct  183  DPVEMWWPANLAQVSLFRALHEKEDKKK  210



>dbj|BAB89477.1| isp4 protein-like [Oryza sativa Japonica Group]
 gb|EAZ12783.1| hypothetical protein OsJ_02700 [Oryza sativa Japonica Group]
Length=755

 Score =   192 bits (489),  Expect(2) = 4e-92, Method: Compositional matrix adjust.
 Identities = 86/175 (49%), Positives = 127/175 (73%), Gaps = 3/175 (2%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+EEV L VP TDD +LPV TFR W LG+ SC+++ FLN FF YRT+PL ++ I +Q++ 
Sbjct  25   PIEEVRLTVPVTDDSSLPVWTFRMWTLGLLSCVLMSFLNQFFSYRTEPLIVTQITVQVAS  84

Query  299  LPIGKFMAATLPERKF---APFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSI  469
            LP+G  +A  LP RKF   A  G    +LNPGPFN+KEHV++++ AN G + G G AY++
Sbjct  85   LPLGHILARVLPRRKFKAPALLGGGECSLNPGPFNMKEHVLVSIFANAGCAFGSGSAYAV  144

Query  470  GAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
              + I++A+Y +++S     +++ TTQ++GYGWAG++RRY+V+P  MWWP TL++
Sbjct  145  MIVDIIRAFYGRSISLFPAWLLITTTQVLGYGWAGLMRRYVVEPAQMWWPGTLVQ  199


 Score =   175 bits (443),  Expect(2) = 4e-92, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 119/177 (67%), Gaps = 8/177 (5%)
 Frame = +1

Query  622   NLAQVSLFRALHETEV--------KSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFS  777
              L QVSLFRALH               GM++ +FFL+ +  SF++Y +PGYLFP LT  S
Sbjct  196   TLVQVSLFRALHGKGEEKEENKEGSGGGMSQAKFFLIALACSFLWYAVPGYLFPTLTSVS  255

Query  778   WVCWVWPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFI  957
             WVCW++ +S+TAQQ+GS   GLG+G FTLDW  +SA+  SPL+SP+ A  N+  G+V+ +
Sbjct  256   WVCWIFSKSVTAQQLGSGMKGLGLGAFTLDWTAVSAFLYSPLISPFFATANILAGYVLLM  315

Query  958   YIIVPLCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             Y++VP+ YW  + ++AR+FPIFS+ LFT+TG  YD   ++  +F++++  Y    ++
Sbjct  316   YVVVPVSYWGLDLYNARRFPIFSSHLFTATGSTYDITAIVNDRFEIDMDGYHRMGRI  372



>ref|NP_200163.1| oligopeptide transporter 9 [Arabidopsis thaliana]
 sp|Q9FJD2.1|OPT9_ARATH RecName: Full=Oligopeptide transporter 9; Short=AtOPT9 [Arabidopsis 
thaliana]
 dbj|BAB09727.1| isp4 protein [Arabidopsis thaliana]
 gb|AED96371.1| oligopeptide transporter 9 [Arabidopsis thaliana]
Length=741

 Score =   206 bits (523),  Expect(2) = 4e-92, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 127/174 (73%), Gaps = 4/174 (2%)
 Frame = +2

Query  113  RCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQI  292
            RC VEEV L VP+TDDPTLPVLTFR W LG+ +CIIL F+N FF YR  PL+IS I  QI
Sbjct  23   RCVVEEVELTVPKTDDPTLPVLTFRMWTLGLGACIILSFINQFFWYRQMPLTISGISAQI  82

Query  293  SVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIG  472
            +V+P+G  MA  LP R F    +W F++NPGPFN+KEHV+IT+ AN     G G  Y+  
Sbjct  83   AVVPLGHLMAKVLPTRMFLEGSKWEFSMNPGPFNVKEHVLITIFANS----GAGTVYATH  138

Query  473  AITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             ++ +K YYK++L FL   ++++TTQ +G+GWAG+ R++LV+P +MWWPS L++
Sbjct  139  ILSAIKLYYKRSLPFLPAFLLMITTQFLGFGWAGLFRKHLVEPGEMWWPSNLVQ  192


 Score =   161 bits (408),  Expect(2) = 4e-92, Method: Compositional matrix adjust.
 Identities = 82/166 (49%), Positives = 110/166 (66%), Gaps = 2/166 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLF ALHE E K  G MTR++FFL+V+  SF YY LPGYLF ++T  SW+CW+ P
Sbjct  189   NLVQVSLFSALHEKEKKKKGGMTRIQFFLIVLVTSFAYYILPGYLFTMITSISWICWLGP  248

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +S+   Q+GS   GLG+G   +DWA IS+Y GSPL SP  A +NV +GFV+ +Y+  P+C
Sbjct  249   KSVLVHQLGSGEQGLGIGAIGIDWATISSYLGSPLASPLFATINVTIGFVVIMYVATPIC  308

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYES  1116
             YW  N + A+ +PIFS+ LF   G  YD   ++  +F L+   Y  
Sbjct  309   YW-LNIYKAKTYPIFSSGLFMGNGSSYDVLSIIDKKFHLDRDIYAK  353



>ref|NP_200164.1| oligopeptide transporter 8 [Arabidopsis thaliana]
 sp|Q9FJD1.1|OPT8_ARATH RecName: Full=Oligopeptide transporter 8; Short=AtOPT8 [Arabidopsis 
thaliana]
 dbj|BAB09728.1| isp4 protein [Arabidopsis thaliana]
 gb|ABE66245.1| oligopeptide transporter OPT family protein [Arabidopsis thaliana]
 gb|AED96372.1| oligopeptide transporter 8 [Arabidopsis thaliana]
Length=733

 Score =   200 bits (509),  Expect(2) = 4e-92, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 127/171 (74%), Gaps = 4/171 (2%)
 Frame = +2

Query  122  VEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVL  301
            V +V L VP+TDDPT P +TFR W LGIT+C++L FLN FF YRT PL+IS++  QI+V+
Sbjct  20   VPQVELTVPKTDDPTSPTVTFRMWVLGITACVLLSFLNQFFWYRTNPLTISSVSAQIAVV  79

Query  302  PIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAIT  481
            PIG  MA  LP R+F    RWSFT+NPGPF+ KEHV+ITV AN     G G  Y+   ++
Sbjct  80   PIGHLMAKVLPTRRFFEGTRWSFTMNPGPFSTKEHVLITVFANS----GSGAVYATHILS  135

Query  482  IMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             +K YYK+ L FL  L++++TTQ++G+GWAG+ R++LV+P +MWWPS L++
Sbjct  136  AVKLYYKRRLDFLPALLVMITTQVLGFGWAGLYRKHLVEPGEMWWPSNLVQ  186


 Score =   167 bits (422),  Expect(2) = 4e-92, Method: Compositional matrix adjust.
 Identities = 81/166 (49%), Positives = 114/166 (69%), Gaps = 2/166 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSS-GMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E KS  G++R +FF++ +  SF YY LPGYLF +LT  SW+CW+ P
Sbjct  183   NLVQVSLFRALHEKENKSKWGISRNQFFVITLITSFSYYLLPGYLFTVLTTVSWLCWISP  242

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +SI   Q+GS   GLG+G F LDW+ I++Y GSPL SP+ A  N+A GF + +Y+I PLC
Sbjct  243   KSILVNQLGSGSAGLGIGSFGLDWSTIASYLGSPLASPFFASANIAAGFFLVMYVITPLC  302

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYES  1116
             Y+  + ++A+ FPI+S +LF ++G +Y    ++   F L+  AY  
Sbjct  303   YY-LDLYNAKTFPIYSGKLFVASGKEYKVTSIIDANFRLDRQAYAE  347



>ref|XP_011069784.1| PREDICTED: oligopeptide transporter 5-like [Sesamum indicum]
Length=755

 Score =   186 bits (472),  Expect(2) = 5e-92, Method: Compositional matrix adjust.
 Identities = 92/192 (48%), Positives = 127/192 (66%), Gaps = 8/192 (4%)
 Frame = +2

Query  71   NPATAGEKTAPS---GGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTF  241
             PA +G  T  +       P+EEV L VP TDDPTLP LTFR W LGI SC  L FLN F
Sbjct  18   KPAVSGNATLEALDEVNDSPIEEVRLTVPITDDPTLPCLTFRTWVLGIISCATLGFLNQF  77

Query  242  FIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA-PFGRWSFTLNPGPFNIKEHVIIT  418
            F YR   LS++++  QI VLP+GK MA +LP ++   P  +W+F+LNPGPF+IKEH +IT
Sbjct  78   FGYRQNALSVTSVSAQILVLPLGKLMAVSLPRKEIRIPGTKWTFSLNPGPFSIKEHCLIT  137

Query  419  VMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVD  598
            + AN     G    Y++  ITI+KA+Y + L+ +  +++  +TQ++GYGWAG+ R++LVD
Sbjct  138  IFANT----GSNSVYAVNIITIVKAFYHRRLNPVAAMLLTHSTQMLGYGWAGIFRKFLVD  193

Query  599  PVDMWWPSTLLK  634
               MWWP  L++
Sbjct  194  SPYMWWPINLVQ  205


 Score =   181 bits (458),  Expect(2) = 5e-92, Method: Compositional matrix adjust.
 Identities = 86/171 (50%), Positives = 124/171 (73%), Gaps = 3/171 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVK-SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE EV+   G+TR++FF++V+ +SF YY +P YLFP +T  S+VCW+W 
Sbjct  202   NLVQVSLFRALHEVEVRRKGGLTRLQFFIIVLVSSFSYYIVPNYLFPSITALSFVCWIWK  261

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+TAQQIGS  +GLGVG F  DWA ++ + GSPL +P  AI+N+ VGFV+ +Y++ P+ 
Sbjct  262   DSVTAQQIGSGIYGLGVGSFAFDWATVAGFLGSPLATPGFAIINMLVGFVLVLYVVTPIA  321

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQ-FDLNVPAYESYSKL  1128
             YW  N ++A++FPI S  +F + G KY+   +LT + F+ N   Y++YSK+
Sbjct  322   YWN-NFYNAKRFPIISAHVFDANGAKYNISAILTERTFEFNNQGYDNYSKV  371



>gb|KJB58811.1| hypothetical protein B456_009G227200 [Gossypium raimondii]
Length=741

 Score =   189 bits (481),  Expect(2) = 6e-92, Method: Compositional matrix adjust.
 Identities = 95/182 (52%), Positives = 134/182 (74%), Gaps = 1/182 (1%)
 Frame = +2

Query  92   KTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSI  271
              A +    P+EEV L V   DD TLPV TFR WF+G+ SC++L FLNTFF YR++PL +
Sbjct  18   SAADNDDVSPIEEVRLTVSNDDDTTLPVWTFRMWFIGLLSCVLLSFLNTFFSYRSEPLQV  77

Query  272  SAILMQISVLPIGKFMAATLPERKFA-PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPG  448
            + I +Q++ LP+GKFMA  LP  KF  P     FTLNPGPFN+KEHV+I++ AN G + G
Sbjct  78   TMISIQVASLPVGKFMARVLPTTKFKIPVVNKEFTLNPGPFNVKEHVLISIFANAGAAFG  137

Query  449  GGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTL  628
            GG AY+I  + I++A+Y + + FL   I+V+TTQ++GYGWAG++RR++V+P +MWWPS+L
Sbjct  138  GGTAYAISIVDIIRAFYHRKIGFLASWILVITTQVLGYGWAGIMRRFVVEPAEMWWPSSL  197

Query  629  LK  634
            ++
Sbjct  198  VQ  199


 Score =   177 bits (448),  Expect(2) = 6e-92, Method: Compositional matrix adjust.
 Identities = 79/165 (48%), Positives = 118/165 (72%), Gaps = 2/165 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRA+HE +  +S  +R +FFL+ +  SF +Y  PGYLFP L+  SWVCW +P+
Sbjct  196   SLVQVSLFRAMHEKD--NSRKSRGKFFLIALICSFSWYVFPGYLFPTLSAISWVCWAFPK  253

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQIGS   G+G+G F +DW+ I+++ GSPLV+P+ AI+N+ VGF +F+Y+++P  Y
Sbjct  254   SVTAQQIGSGMQGIGIGSFAVDWSVIASFLGSPLVTPFFAIVNIFVGFALFLYVVLPTAY  313

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYES  1116
             W  + + AR FPIFS+ LF   G  Y+   ++   F++++PAYE 
Sbjct  314   WGLDLYQARNFPIFSSHLFNHKGEPYNVSGIVNQNFEIDMPAYEQ  358



>ref|XP_007026363.1| Oligopeptide transporter isoform 2 [Theobroma cacao]
 gb|EOY28985.1| Oligopeptide transporter isoform 2 [Theobroma cacao]
Length=680

 Score =   301 bits (772),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 170/195 (87%), Gaps = 6/195 (3%)
 Frame = +2

Query  95   TAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSIS  274
             A    R PVEEVALVVPETDDPTLPV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+IS
Sbjct  15   NAAEDDRSPVEEVALVVPETDDPTLPVMTFRAWFLGLTSCMLLIFLNTFFTYRTQPLTIS  74

Query  275  AILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGG  454
            AILMQISVLPIGKFMA TLP R+++  GR SF+LNPGPFN+KEHVIIT+ ANCGVS GGG
Sbjct  75   AILMQISVLPIGKFMARTLPTREYSLLGR-SFSLNPGPFNMKEHVIITIFANCGVSFGGG  133

Query  455  DAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS----  622
            DAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDP +MWWPS    
Sbjct  134  DAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPAEMWWPSNLAQ  193

Query  623  -TLLKCLYSEHSMKR  664
             +L + L+ + + K+
Sbjct  194  VSLFRALHEKDTNKK  208


 Score =   291 bits (744),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE +    G+TRM+FFL+ + ASF YY+ PGYLFP+LTFFSWVCWVWP 
Sbjct  190   NLAQVSLFRALHEKDTNKKGLTRMKFFLVALVASFAYYSFPGYLFPVLTFFSWVCWVWPH  249

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLG+G FTLDWAGISAYHGSPLV+PW++ILNV +GFVMFIYIIVPLCY
Sbjct  250   SITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVTPWSSILNVGIGFVMFIYIIVPLCY  309

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK++TFDA KFPIFSNQLFTS+GHKYDT  +LTP++DLN+ AY SY KLY
Sbjct  310   WKFDTFDAGKFPIFSNQLFTSSGHKYDTTKILTPEYDLNISAYNSYGKLY  359



>ref|XP_004507597.1| PREDICTED: oligopeptide transporter 3-like [Cicer arietinum]
Length=739

 Score =   303 bits (775),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 149/218 (68%), Positives = 179/218 (82%), Gaps = 9/218 (4%)
 Frame = +2

Query  59   MSGLNPATAGEKTA---PSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIF  229
            M+  N  T  EK A   P   RCP+EEVALVVPETDDPTLPV+TFR+WFLGI SCI+LIF
Sbjct  1    MAPKNQTTDTEKAANGAPPDDRCPIEEVALVVPETDDPTLPVMTFRSWFLGIASCILLIF  60

Query  230  LNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHV  409
            LNTFF +RTQPL+ISAILMQI+VLPIG+FMA+TLP ++++  G W F+LNPGPFN+KEHV
Sbjct  61   LNTFFTFRTQPLAISAILMQIAVLPIGRFMASTLPTKEYSVLG-WRFSLNPGPFNMKEHV  119

Query  410  IITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRY  589
            IIT+ ANCGVS GGGDAYSIGAITIMKAYYKQ++SFLC L IVLTTQ++GYGWAG+LRRY
Sbjct  120  IITIFANCGVSYGGGDAYSIGAITIMKAYYKQSISFLCALFIVLTTQILGYGWAGILRRY  179

Query  590  LVDPVDMWWPSTLLKCLYSEHSMKRR*NQAA*QGCGFS  703
            LVDPV+MWWPS L     ++ S+ R  ++   +  GF+
Sbjct  180  LVDPVEMWWPSNL-----AQVSLFRALHEKENKSKGFT  212


 Score =   283 bits (725),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 148/170 (87%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E KS G TRM+FFL+ MG SF+YY LPGYL  ILTFFSW+CWVWP 
Sbjct  191   NLAQVSLFRALHEKENKSKGFTRMQFFLIAMGLSFLYYALPGYLLTILTFFSWICWVWPH  250

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             +ITAQQ+GS YHGLG+G FTLDWAGISAYHGSPLV+PW++I+NV +GF+MFIYII+P+CY
Sbjct  251   NITAQQVGSGYHGLGIGAFTLDWAGISAYHGSPLVAPWSSIVNVGIGFIMFIYIILPICY  310

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK+NTFDARKFPIFSNQLFTS+G KYDT  +LT  +DLN+ AY  Y KLY
Sbjct  311   WKFNTFDARKFPIFSNQLFTSSGQKYDTTKILTKDYDLNIDAYNKYGKLY  360



>ref|XP_006856596.1| PREDICTED: oligopeptide transporter 4 isoform X1 [Amborella trichopoda]
 gb|ERN18063.1| hypothetical protein AMTR_s00046p00213370 [Amborella trichopoda]
Length=732

 Score =   209 bits (533),  Expect(2) = 8e-92, Method: Compositional matrix adjust.
 Identities = 93/172 (54%), Positives = 132/172 (77%), Gaps = 1/172 (1%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+V L V  TDDP+LPV TFR WFLG+ SC  + FLN FF YRT+PL I+ I +Q++ 
Sbjct  20   PIEQVRLTVTTTDDPSLPVWTFRMWFLGVLSCAAMSFLNQFFAYRTEPLVITQISVQVAS  79

Query  299  LPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAI  478
            LP G F+AA LP++KF   G   ++LNPGPFN+KEHV+IT+ AN G + G G  Y++G +
Sbjct  80   LPAGHFLAAVLPKKKFR-LGGSEYSLNPGPFNMKEHVLITIFANAGYAFGSGTPYAVGIV  138

Query  479  TIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
             I+KA+Y++ +SF+   +I++TTQ++GYGWAG+LR+Y+V+P  MWWPSTL++
Sbjct  139  NIIKAFYRRKISFIASWLIIITTQVLGYGWAGLLRKYVVEPAHMWWPSTLVQ  190


 Score =   157 bits (396),  Expect(2) = 8e-92, Method: Compositional matrix adjust.
 Identities = 81/170 (48%), Positives = 119/170 (70%), Gaps = 2/170 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
              L QVS+FRALHE + +   ++R +FF++ +  SF YY LPGYLF  LT  SWVCW  P+
Sbjct  187   TLVQVSVFRALHEKDDRR--LSRAKFFVIALVCSFSYYVLPGYLFSTLTTISWVCWAHPK  244

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQ+GS  +GLG+G F LDWA I+A+  SPL+ P+ AI+N+ VG+V+ +Y+ +P+ Y
Sbjct  245   SITAQQLGSGLNGLGLGAFPLDWAAIAAFMFSPLIYPFFAIMNIFVGYVVIVYLAIPIAY  304

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             W ++ + A+KFPIFS+ LFT+ G  Y+   ++  QF+L+  AY     ++
Sbjct  305   WGFDLYGAKKFPIFSSDLFTADGQPYNITAIVNGQFELDETAYAQQGPIH  354



>ref|XP_003572326.1| PREDICTED: oligopeptide transporter 5-like [Brachypodium distachyon]
Length=757

 Score =   198 bits (503),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 101/206 (49%), Positives = 133/206 (65%), Gaps = 10/206 (5%)
 Frame = +2

Query  35   LSEHIVVEMSGLNPATAGEKTAPSG-----GRCPVEEVALVVPETDDPTLPVLTFRAWFL  199
            + E   VE+  L    AG      G       CP+EEV L VP TDDP LP LTFR WFL
Sbjct  1    MEEPPQVELRNLEIQNAGAVDTSDGKTDEVDDCPIEEVRLTVPITDDPALPALTFRTWFL  60

Query  200  GITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFG-RWSFTL  376
            G+ SC +L F N FF YR  PL IS++ +QI VLP+G+ MAA LP       G RWSF+L
Sbjct  61   GLISCALLAFSNQFFGYRQNPLYISSLSVQIVVLPLGRLMAACLPPAIIGVKGTRWSFSL  120

Query  377  NPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLI  556
            NPGPFN+KEHV+IT+ AN G +      Y++G ITI+KA+Y + +  L  +++  TTQL+
Sbjct  121  NPGPFNLKEHVLITIFANTGSN----SVYAVGIITIVKAFYHRDIHPLAAMLLTQTTQLM  176

Query  557  GYGWAGVLRRYLVDPVDMWWPSTLLK  634
            GYGWAG+ R++LV+   MWWP+ L++
Sbjct  177  GYGWAGLFRKFLVESPYMWWPANLVQ  202


 Score =   167 bits (424),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 106/156 (68%), Gaps = 3/156 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVK--SSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVW  795
             NL QVSLFRALHE E K    G TR++FFL V+  SF YY +P YLFP ++  S  C +W
Sbjct  199   NLVQVSLFRALHEKEQKRPKGGTTRLQFFLTVLATSFAYYIVPNYLFPTISTISVACLIW  258

Query  796   PRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPL  975
               SITAQQIGS  HGLGVG F LDWA ++ + G+PL +P  AI NV  GF + +Y+I+P+
Sbjct  259   RNSITAQQIGSGAHGLGVGSFGLDWATVAGFLGTPLSTPAFAIANVMAGFFLVVYVILPV  318

Query  976   CYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTP  1083
              YW  N ++AR+FPI S+ +F + G +YD   VL P
Sbjct  319   AYWS-NAYNARRFPIISSHVFMANGTRYDVARVLDP  353



>gb|KJB68518.1| hypothetical protein B456_010G248000 [Gossypium raimondii]
Length=751

 Score =   192 bits (487),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 121/184 (66%), Gaps = 6/184 (3%)
 Frame = +2

Query  89   EKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLS  268
            E +       P+E+V L VP  DDPTLP LTFR W LGITSC +L FLN FF YR   L 
Sbjct  22   ETSDDEVNDSPIEQVRLTVPIVDDPTLPCLTFRTWVLGITSCAVLSFLNQFFHYRQNSLH  81

Query  269  ISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
            IS++  QI VLP+G  MA  LP R     P  +WSF+LNPGPFNIKEHV+IT+ AN G +
Sbjct  82   ISSLTAQILVLPLGNLMATYLPNRTLVLFPSTKWSFSLNPGPFNIKEHVLITIFANSGST  141

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
                + Y++  ITI+KA+Y   +     L++  TTQ++GYGWAG+ R++LVD   MWWP+
Sbjct  142  ----NVYAVNIITIVKAFYHGQIHPFAALLLAHTTQMLGYGWAGIYRKFLVDSPYMWWPN  197

Query  623  TLLK  634
             L++
Sbjct  198  NLVQ  201


 Score =   174 bits (440),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 119/171 (70%), Gaps = 3/171 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALH+ EV+  G +TR++FFL+V  +S  YY +P YLFP +T  S VCW+W 
Sbjct  198   NLVQVSLFRALHDDEVRQKGGLTRLQFFLMVFISSLAYYIVPNYLFPSITALSLVCWIWK  257

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+TAQ IG+   GLGVG F LDW+ ++++  SPL +P  AI+N+ +GFV+ +YI+ P+ 
Sbjct  258   DSVTAQIIGAGRDGLGVGSFALDWSTVASFLQSPLATPAFAIINIMLGFVIVVYILTPVA  317

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLT-PQFDLNVPAYESYSKL  1128
             YW  N+++AR+FPI S+ +FT  G KYD   +L    ++ N   Y+ YSK+
Sbjct  318   YWT-NSYEARRFPIISSHVFTDDGEKYDVSRILNFTTYEFNQRGYDGYSKI  367



>ref|XP_009142514.1| PREDICTED: oligopeptide transporter 5 [Brassica rapa]
Length=757

 Score =   195 bits (495),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 127/172 (74%), Gaps = 3/172 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E K  G  TR+RFFL+V   SF YY +PGY+FP ++  S+VCW+W 
Sbjct  202   NLVQVSLFRALHEKEEKCEGKQTRLRFFLIVFFVSFAYYIVPGYIFPSISSLSFVCWIWT  261

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             RS+TAQQIGS  HGLG+G F LDW+ ++ + GSPL  P+ AI N   GF+++ YII+P+ 
Sbjct  262   RSVTAQQIGSGLHGLGIGSFGLDWSTVAGFLGSPLAVPFFAIANFFGGFIVYFYIILPIF  321

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQ-FDLNVPAYESYSKLY  1131
             YW  N +DA+KFP +++Q F  TG +++T  +L  + FD+N+PAYESYSKLY
Sbjct  322   YWS-NAYDAKKFPFYTSQTFDFTGQQFNTTRILNQKTFDINLPAYESYSKLY  372


 Score =   170 bits (431),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 126/184 (68%), Gaps = 5/184 (3%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
             ++        P+EEV L VP TDDP+ PVLTFR WFLGI SC++L F+N FF YR+  L
Sbjct  26   ADEDGEEENDSPIEEVRLTVPITDDPSQPVLTFRTWFLGIISCVVLAFVNQFFGYRSNQL  85

Query  266  SISAILMQISVLPIGKFMAATLPERKFA-PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
             +S+++ QI  LP+GK MA  LP RKF  P   WS +LNPGPFN+KEHV+IT+ A+ G  
Sbjct  86   MVSSVVAQIVTLPVGKLMATALPTRKFRLPGTNWSGSLNPGPFNMKEHVLITIFASAGAG  145

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
                 AY+   ITI+KA+Y + L+    ++++ TTQL+GYGWAG+ R++LVD   MWWPS
Sbjct  146  ----GAYATSIITIVKAFYHRNLNPTAAMLLLQTTQLLGYGWAGMFRKFLVDSPYMWWPS  201

Query  623  TLLK  634
             L++
Sbjct  202  NLVQ  205



>ref|XP_002283674.1| PREDICTED: oligopeptide transporter 4-like [Vitis vinifera]
Length=754

 Score =   218 bits (555),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 100/196 (51%), Positives = 137/196 (70%), Gaps = 2/196 (1%)
 Frame = +2

Query  53   VEMSGLNPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFL  232
            VE+      T            P+EEV L VP  DD +L V TFR WFLG+ SC +L FL
Sbjct  4    VEIEAPRVNTLENGNINEDEESPIEEVRLTVPNDDDSSLSVWTFRMWFLGVLSCTLLSFL  63

Query  233  NTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRWSFTLNPGPFNIKEH  406
            N FF YR +PL I+ I +Q++ LPIG+FMAA LPE KF    FG+  F+ NPGPFN+KEH
Sbjct  64   NQFFSYRREPLVITQITVQVATLPIGRFMAAVLPETKFHIPGFGKREFSFNPGPFNMKEH  123

Query  407  VIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRR  586
            V+I++ AN G + G G AY++G +TI+KA+Y  ++SFL G ++++TTQ++GYGWAG+LR+
Sbjct  124  VLISIFANAGSAFGNGSAYAVGIVTIIKAFYNSSISFLAGWLLIVTTQVLGYGWAGLLRK  183

Query  587  YLVDPVDMWWPSTLLK  634
            Y+V+P  MWWP TL++
Sbjct  184  YVVEPAHMWWPGTLVQ  199


 Score =   147 bits (371),  Expect(2) = 1e-91, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 117/175 (67%), Gaps = 7/175 (4%)
 Frame = +1

Query  625   LAQVSLFRALHETEV-------KSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWV  783
             L Q++LFR LHE E            M+R +FF++ M  SF++Y++P + F  L   SWV
Sbjct  197   LVQIALFRTLHEKENGDNTDGDNKKRMSRSKFFVIAMTGSFLWYSVPDFFFQSLQSISWV  256

Query  784   CWVWPRSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYI  963
             CW +P+SITAQQ+GS + GLG G  TLDW+ ++++  SPL+ P+ AI+NV +G+V+ IYI
Sbjct  257   CWAFPKSITAQQLGSGFSGLGFGALTLDWSVVASFLFSPLICPFFAIVNVFIGYVLIIYI  316

Query  964   IVPLCYWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             ++P+ YW  N ++AR FPIFS+ LFT+ G +Y+T  ++T   +++   YE   ++
Sbjct  317   VMPISYWGLNVYNARTFPIFSSHLFTAQGQRYNTSAIVTKNLEIDWVQYEKQGRV  371



>emb|CDX89322.1| BnaA01g15710D [Brassica napus]
Length=757

 Score =   194 bits (494),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 126/172 (73%), Gaps = 3/172 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E K  G  TR+RFFL+V   SF YY +PGY+FP ++  S+VCW+W 
Sbjct  202   NLVQVSLFRALHEKEEKCEGKQTRLRFFLIVFFVSFAYYIVPGYIFPSISSLSFVCWIWT  261

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             RS+TAQQIGS  HGLG+G F LDW+ ++ + GSPL  P+ AI N   GF+++ YII+P+ 
Sbjct  262   RSVTAQQIGSGLHGLGIGSFGLDWSTVAGFLGSPLAVPFFAIANFFGGFIVYFYIILPIF  321

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQ-FDLNVPAYESYSKLY  1131
             YW  N +DA+KFP +++Q F  TG  ++T  +L  + FD+N+PAYESYSKLY
Sbjct  322   YWS-NAYDAKKFPFYTSQTFDHTGQHFNTTRILNQKTFDINLPAYESYSKLY  372


 Score =   170 bits (431),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 126/184 (68%), Gaps = 5/184 (3%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
             ++        P+EEV L VP TDDP+ PVLTFR WFLGI SC++L F+N FF YR+  L
Sbjct  26   ADEEGEEENDSPIEEVRLTVPITDDPSQPVLTFRTWFLGIISCVVLAFVNQFFGYRSNQL  85

Query  266  SISAILMQISVLPIGKFMAATLPERKFA-PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
             +S+++ QI  LP+GK MA  LP RKF  P   WS +LNPGPFN+KEHV+IT+ A+ G  
Sbjct  86   MVSSVVAQIVTLPVGKLMATALPTRKFRLPGTNWSGSLNPGPFNMKEHVLITIFASAGAG  145

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
                 AY+   ITI+KA+Y + L+    ++++ TTQL+GYGWAG+ R++LVD   MWWPS
Sbjct  146  ----GAYATSIITIVKAFYHRNLNPTAAMLLLQTTQLLGYGWAGMFRKFLVDSPYMWWPS  201

Query  623  TLLK  634
             L++
Sbjct  202  NLVQ  205



>emb|CBI35438.3| unnamed protein product [Vitis vinifera]
Length=693

 Score =   185 bits (469),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 119/150 (79%), Gaps = 2/150 (1%)
 Frame = +2

Query  191  WFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPERKFA--PFGRW  364
            WF+G+ SC +L FL+ FF YRT+PL I+ I +Q++ LPIG FMAA LP  +F    FG  
Sbjct  2    WFMGLFSCALLSFLDQFFAYRTEPLIITQITVQVATLPIGHFMAAVLPTTRFRIPGFGSR  61

Query  365  SFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLT  544
            SF+LNPGPFN+KEHV+I++ AN G + G G AY++G +TI+KA+Y++ +SFL G ++++T
Sbjct  62   SFSLNPGPFNMKEHVLISIFANAGSAFGSGSAYAVGIVTIIKAFYQRKISFLSGWLLIIT  121

Query  545  TQLIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            TQ++GYGWAG+LR+Y+V+P  MWWPS+L++
Sbjct  122  TQVLGYGWAGLLRKYVVEPAHMWWPSSLVQ  151


 Score =   180 bits (456),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 120/169 (71%), Gaps = 2/169 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             +L QVSLFRALHE E +   MTR +FF++ +  SF +Y +PGYLF  LT  SWVCW +P+
Sbjct  148   SLVQVSLFRALHEKEEQR--MTRAKFFVIALICSFSWYLIPGYLFSTLTSISWVCWAFPK  205

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             S+TAQQ+GS   GLG+G  TLDW  ++++  SPLVSP+ AILN+ VG+V+ +Y ++PL Y
Sbjct  206   SVTAQQLGSGMRGLGLGALTLDWTVVASFLFSPLVSPFFAILNIFVGYVLLVYAVIPLAY  265

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKL  1128
             W ++ ++A +FPIFS+ LFTS G  YD   ++  +F++N   YE   ++
Sbjct  266   WGFDMYNAHRFPIFSSHLFTSQGQLYDIGAIVNDKFEINRQKYEEQGRI  314



>emb|CDX94308.1| BnaC01g18760D [Brassica napus]
Length=757

 Score =   194 bits (493),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 126/172 (73%), Gaps = 3/172 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRALHE E K  G  TR+RFFL+V   SF YY +PGY+FP ++  S+VCW+W 
Sbjct  202   NLVQVSLFRALHEKEEKCEGKQTRLRFFLIVFFVSFAYYIIPGYIFPSISSLSFVCWIWT  261

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             RS+TAQQIGS  HGLG+G F LDW+ ++ + GSPL  P+ AI N   GF+++ YII+P+ 
Sbjct  262   RSVTAQQIGSGLHGLGIGSFGLDWSTVAGFLGSPLAVPFFAIANFFGGFIVYFYIILPIF  321

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQ-FDLNVPAYESYSKLY  1131
             YW  N +DA+KFP +++Q F  TG  ++T  +L  + FD+N+PAYESYSKLY
Sbjct  322   YWS-NAYDAKKFPFYTSQTFDFTGQHFNTTRILNQKTFDINLPAYESYSKLY  372


 Score =   171 bits (432),  Expect(2) = 2e-91, Method: Compositional matrix adjust.
 Identities = 93/184 (51%), Positives = 126/184 (68%), Gaps = 5/184 (3%)
 Frame = +2

Query  86   GEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPL  265
             ++        P+EEV L VP TDDP+ PVLTFR WFLGI SC++L F+N FF YR+  L
Sbjct  26   ADEEGEEENDSPIEEVRLTVPITDDPSQPVLTFRTWFLGIISCVVLAFVNQFFGYRSNQL  85

Query  266  SISAILMQISVLPIGKFMAATLPERKFA-PFGRWSFTLNPGPFNIKEHVIITVMANCGVS  442
             +S+++ QI  LP+GK MA  LP RKF  P   WS +LNPGPFN+KEHV+IT+ A+ G  
Sbjct  86   MVSSVVAQIVTLPVGKLMATALPTRKFRLPGTNWSGSLNPGPFNMKEHVLITIFASAGAG  145

Query  443  PGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS  622
                 AY+   ITI+KA+Y + L+    ++++ TTQL+GYGWAG+ R++LVD   MWWPS
Sbjct  146  ----GAYATSIITIVKAFYHRNLNPTAAMLLLQTTQLLGYGWAGMFRKFLVDSPYMWWPS  201

Query  623  TLLK  634
             L++
Sbjct  202  NLVQ  205



>gb|KJB67417.1| hypothetical protein B456_010G190300 [Gossypium raimondii]
Length=741

 Score =   301 bits (772),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/203 (73%), Positives = 172/203 (85%), Gaps = 8/203 (4%)
 Frame = +2

Query  71   NPATAGEKTAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIY  250
             P  AG  TA + G  PVEEVALVVPETDDPTLPVLTFRAWFLG+ SC++LIFLNTFF Y
Sbjct  11   KPNAAG--TAENEGMSPVEEVALVVPETDDPTLPVLTFRAWFLGLVSCVLLIFLNTFFTY  68

Query  251  RTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMAN  430
            RTQPL+ISAILMQISVLPIGKFMA TLP  +++  G W F+LNPGPFNIKEHVIIT+ AN
Sbjct  69   RTQPLTISAILMQISVLPIGKFMARTLPTTQYSLLG-WHFSLNPGPFNIKEHVIITIFAN  127

Query  431  CGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDM  610
            CGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCG++IVLTTQ++GYGWAG+LRRYLVDP +M
Sbjct  128  CGVSFGGGDAYSIGAITVMKAYYKQSLNFLCGVLIVLTTQILGYGWAGMLRRYLVDPAEM  187

Query  611  WWPS-----TLLKCLYSEHSMKR  664
            WWPS     +L + L+ + S K+
Sbjct  188  WWPSNLAQVSLFRALHEKDSTKK  210


 Score =   295 bits (754),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE +    G+TRM+FFL VM ASF YY LPGYLFPILTFFSWVCW WP 
Sbjct  192   NLAQVSLFRALHEKDSTKKGLTRMQFFLAVMVASFAYYALPGYLFPILTFFSWVCWAWPH  251

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLG+G FTLDWAGISAYHGSPLV+PW++I+NV +GFVMF+YII+PLCY
Sbjct  252   SITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVTPWSSIVNVGIGFVMFVYIIIPLCY  311

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK+NTFDARKFPIFSNQLFT +GHKYDT  +LTPQ+DLN+ AY SYSKLY
Sbjct  312   WKFNTFDARKFPIFSNQLFTHSGHKYDTTKILTPQYDLNISAYNSYSKLY  361



>ref|XP_002273768.2| PREDICTED: oligopeptide transporter 3 [Vitis vinifera]
Length=748

 Score =   301 bits (772),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 173/204 (85%), Gaps = 8/204 (4%)
 Frame = +2

Query  74   PATAGEKT--APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            P T G++   AP G R PVEEVALVVPETDD TLPV+TFRAWFLGI SC +LIFLNTFF 
Sbjct  15   PTTNGKEATQAPEGERTPVEEVALVVPETDDQTLPVMTFRAWFLGIISCSLLIFLNTFFS  74

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            YRTQPL+ISAILMQI+VLP+GKFMA+TLP R+F  FG W F+LNPGPFN+KEHVIITV A
Sbjct  75   YRTQPLTISAILMQIAVLPVGKFMASTLPRREFKVFG-WGFSLNPGPFNMKEHVIITVFA  133

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            NCGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LR+YLV+P +
Sbjct  134  NCGVSYGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRKYLVEPAE  193

Query  608  MWWPS-----TLLKCLYSEHSMKR  664
            MWWPS     +L + L+ + S  +
Sbjct  194  MWWPSNLAQVSLFRALHEKESKSK  217


 Score =   298 bits (764),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E KS G+TRM+FFLL + ASF YY LPGYLFPILTFFSWVCWVWP 
Sbjct  199   NLAQVSLFRALHEKESKSKGLTRMQFFLLFLMASFFYYALPGYLFPILTFFSWVCWVWPH  258

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLGVG FTLDWAGISAYHGSPLV+PW +ILNV  GF+MFIYIIVP+CY
Sbjct  259   SITAQQIGSGYHGLGVGAFTLDWAGISAYHGSPLVTPWFSILNVGAGFIMFIYIIVPVCY  318

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK+NTFDARKFPIFSNQLFTSTGHKYDT  +LTPQ+DLN+ AY+ Y KLY
Sbjct  319   WKFNTFDARKFPIFSNQLFTSTGHKYDTNKILTPQYDLNIAAYDGYGKLY  368



>emb|CBI18634.3| unnamed protein product [Vitis vinifera]
Length=752

 Score =   301 bits (772),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 147/204 (72%), Positives = 173/204 (85%), Gaps = 8/204 (4%)
 Frame = +2

Query  74   PATAGEKT--APSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFI  247
            P T G++   AP G R PVEEVALVVPETDD TLPV+TFRAWFLGI SC +LIFLNTFF 
Sbjct  15   PTTNGKEATQAPEGERTPVEEVALVVPETDDQTLPVMTFRAWFLGIISCSLLIFLNTFFS  74

Query  248  YRTQPLSISAILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMA  427
            YRTQPL+ISAILMQI+VLP+GKFMA+TLP R+F  FG W F+LNPGPFN+KEHVIITV A
Sbjct  75   YRTQPLTISAILMQIAVLPVGKFMASTLPRREFKVFG-WGFSLNPGPFNMKEHVIITVFA  133

Query  428  NCGVSPGGGDAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVD  607
            NCGVS GGGDAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LR+YLV+P +
Sbjct  134  NCGVSYGGGDAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRKYLVEPAE  193

Query  608  MWWPS-----TLLKCLYSEHSMKR  664
            MWWPS     +L + L+ + S  +
Sbjct  194  MWWPSNLAQVSLFRALHEKESKSK  217


 Score =   298 bits (764),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 152/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE E KS G+TRM+FFLL + ASF YY LPGYLFPILTFFSWVCWVWP 
Sbjct  199   NLAQVSLFRALHEKESKSKGLTRMQFFLLFLMASFFYYALPGYLFPILTFFSWVCWVWPH  258

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLGVG FTLDWAGISAYHGSPLV+PW +ILNV  GF+MFIYIIVP+CY
Sbjct  259   SITAQQIGSGYHGLGVGAFTLDWAGISAYHGSPLVTPWFSILNVGAGFIMFIYIIVPVCY  318

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK+NTFDARKFPIFSNQLFTSTGHKYDT  +LTPQ+DLN+ AY+ Y KLY
Sbjct  319   WKFNTFDARKFPIFSNQLFTSTGHKYDTNKILTPQYDLNIAAYDGYGKLY  368



>ref|XP_012071039.1| PREDICTED: oligopeptide transporter 1-like isoform X2 [Jatropha 
curcas]
Length=732

 Score =   189 bits (480),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 123/174 (71%), Gaps = 5/174 (3%)
 Frame = +2

Query  119  PVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISV  298
            P+E+V L VP TDDPT   LTFR W LGITSC++L F+N FF YR+  L + ++  QI V
Sbjct  39   PIEQVRLTVPITDDPTEAALTFRTWVLGITSCVLLAFVNQFFSYRSNQLYVGSVSAQIVV  98

Query  299  LPIGKFMAATLPERKFA-PFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGA  475
            LP+GK MA  LP ++   P  +WSF+LNPGPF +KEHV+IT+ A+C    G G  Y++  
Sbjct  99   LPLGKLMAKVLPTKQIKIPLTKWSFSLNPGPFTLKEHVLITIFASC----GAGGVYAVNI  154

Query  476  ITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPSTLLKC  637
            IT +KA+Y++ L+ +  +++V TTQL+GYGWAG+ R+YLVD   MW PS L++ 
Sbjct  155  ITAVKAFYRRPLNPVAAMLLVQTTQLLGYGWAGIFRKYLVDSPYMWGPSNLVQV  208


 Score =   175 bits (443),  Expect(2) = 3e-91, Method: Compositional matrix adjust.
 Identities = 85/172 (49%), Positives = 120/172 (70%), Gaps = 3/172 (2%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLFRAL+E E +  G +TR++FF +V  +S+ YY +PGYLFP L+  S++CW+W 
Sbjct  204   NLVQVSLFRALNEKEKRPKGRLTRLQFFTIVFISSYAYYIIPGYLFPSLSTISFICWIWK  263

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
              S+TAQQIGS  +GLG+  F LDW+ ++ + G+PL  P+ AI N   GF +  YIIVP+ 
Sbjct  264   DSVTAQQIGSGQNGLGIASFGLDWSTVAGFLGTPLAVPFFAIANTLAGFFLVQYIIVPIS  323

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQ-FDLNVPAYESYSKLY  1131
             YW  N +DA+KFPI+S+  F S G  Y+   +L  + FD+N+ AY +YSKL+
Sbjct  324   YWT-NMYDAKKFPIYSSHTFDSDGQTYNISRILNQKNFDINLDAYNNYSKLH  374



>ref|XP_007026362.1| Oligopeptide transporter isoform 1 [Theobroma cacao]
 gb|EOY28984.1| Oligopeptide transporter isoform 1 [Theobroma cacao]
Length=739

 Score =   301 bits (770),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 145/195 (74%), Positives = 170/195 (87%), Gaps = 6/195 (3%)
 Frame = +2

Query  95   TAPSGGRCPVEEVALVVPETDDPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSIS  274
             A    R PVEEVALVVPETDDPTLPV+TFRAWFLG+TSC++LIFLNTFF YRTQPL+IS
Sbjct  15   NAAEDDRSPVEEVALVVPETDDPTLPVMTFRAWFLGLTSCMLLIFLNTFFTYRTQPLTIS  74

Query  275  AILMQISVLPIGKFMAATLPERKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGG  454
            AILMQISVLPIGKFMA TLP R+++  GR SF+LNPGPFN+KEHVIIT+ ANCGVS GGG
Sbjct  75   AILMQISVLPIGKFMARTLPTREYSLLGR-SFSLNPGPFNMKEHVIITIFANCGVSFGGG  133

Query  455  DAYSIGAITIMKAYYKQALSFLCGLIIVLTTQLIGYGWAGVLRRYLVDPVDMWWPS----  622
            DAYSIGAIT+MKAYYKQ+L+FLCGL+IVLTTQ++GYGWAG+LRRYLVDP +MWWPS    
Sbjct  134  DAYSIGAITVMKAYYKQSLNFLCGLLIVLTTQILGYGWAGMLRRYLVDPAEMWWPSNLAQ  193

Query  623  -TLLKCLYSEHSMKR  664
             +L + L+ + + K+
Sbjct  194  VSLFRALHEKDTNKK  208


 Score =   290 bits (743),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 151/170 (89%), Gaps = 0/170 (0%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSGMTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWPR  801
             NLAQVSLFRALHE +    G+TRM+FFL+ + ASF YY+ PGYLFP+LTFFSWVCWVWP 
Sbjct  190   NLAQVSLFRALHEKDTNKKGLTRMKFFLVALVASFAYYSFPGYLFPVLTFFSWVCWVWPH  249

Query  802   SITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLCY  981
             SITAQQIGS YHGLG+G FTLDWAGISAYHGSPLV+PW++ILNV +GFVMFIYIIVPLCY
Sbjct  250   SITAQQIGSGYHGLGIGAFTLDWAGISAYHGSPLVTPWSSILNVGIGFVMFIYIIVPLCY  309

Query  982   WKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYESYSKLY  1131
             WK++TFDA KFPIFSNQLFTS+GHKYDT  +LTP++DLN+ AY SY KLY
Sbjct  310   WKFDTFDAGKFPIFSNQLFTSSGHKYDTTKILTPEYDLNISAYNSYGKLY  359



>emb|CDY55351.1| BnaAnng13860D, partial [Brassica napus]
Length=709

 Score =   186 bits (473),  Expect(2) = 4e-91, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 116/166 (70%), Gaps = 2/166 (1%)
 Frame = +1

Query  622   NLAQVSLFRALHETEVKSSG-MTRMRFFLLVMGASFVYYTLPGYLFPILTFFSWVCWVWP  798
             NL QVSLF ALHE E KS G M+R +FFL+V+ ASF YY LPGYLF +LT  SWVCW  P
Sbjct  157   NLVQVSLFGALHEKEKKSKGHMSRTQFFLIVLVASFAYYILPGYLFTMLTSISWVCWFNP  216

Query  799   RSITAQQIGSSYHGLGVGGFTLDWAGISAYHGSPLVSPWTAILNVAVGFVMFIYIIVPLC  978
             +SI   Q+GS  HGLGVG    DW  ISAY GSPL SP  A +NVA+GFV+ +YI+ P+C
Sbjct  217   KSILVNQLGSGEHGLGVGSIGFDWVTISAYLGSPLASPLFASVNVAIGFVLVMYIVTPIC  276

Query  979   YWKYNTFDARKFPIFSNQLFTSTGHKYDTFXVLTPQFDLNVPAYES  1116
             YW  N ++A+ FPIFS+QLF + G +YD   ++  +F L+   Y +
Sbjct  277   YW-LNIYEAKTFPIFSSQLFMANGSRYDVLSIIDSKFHLDRAVYSN  321


 Score =   177 bits (449),  Expect(2) = 4e-91, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 117/164 (71%), Gaps = 9/164 (5%)
 Frame = +2

Query  158  DPTLPVLTFRAWFLGITSCIILIFLNTFFIYRTQPLSISAILMQISVLPIGKFMAATLPE  337
            DP+LPVLTFR W LGI +CI+L F+N FF YRT PLSI+ I  QI+V+P+G  MA  LP 
Sbjct  1    DPSLPVLTFRMWVLGIGACIVLSFINQFFWYRTMPLSITGISAQIAVVPLGHLMARVLPT  60

Query  338  RKFAPFGRWSFTLNPGPFNIKEHVIITVMANCGVSPGGGDAYSIGAITIMKAYYKQALSF  517
            R+F    R+ FTLNPG FN+KEHV+IT+ AN     G G  Y+   ++ +K YYK++L F
Sbjct  61   RRFLEGTRFQFTLNPGAFNVKEHVLITIFANS----GAGSVYATHILSAIKLYYKRSLPF  116

Query  518  LCGLIIVLTTQ-----LIGYGWAGVLRRYLVDPVDMWWPSTLLK  634
            L   ++++TTQ     ++G+GWAG+ R++LV+P +MWWPS L++
Sbjct  117  LPAFLVMITTQAFTSSILGFGWAGLFRKHLVEPGEMWWPSNLVQ  160



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 3059054034320