BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2269

Length=689
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010907549.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  50.8    3e-12   Elaeis guineensis
ref|XP_010907551.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  50.8    3e-12   Elaeis guineensis
ref|XP_010907550.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  50.8    3e-12   Elaeis guineensis
gb|ABV02019.1|  2-C-methyl-D-erythritol 4-phosphate cytidyltransf...  61.2    9e-08   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_009804918.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  60.5    2e-07   Nicotiana sylvestris
ref|XP_009607716.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  60.5    2e-07   Nicotiana tomentosiformis
ref|XP_006358470.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  59.7    3e-07   Solanum tuberosum [potatoes]
ref|XP_004300034.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  58.9    6e-07   Fragaria vesca subsp. vesca
ref|XP_010314187.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  58.9    6e-07   Solanum lycopersicum
gb|AFI71456.1|  2-C-methyl-D-erythritol 4-phosphatecytidyltransfe...  58.5    8e-07   Rauvolfia verticillata
ref|XP_007023792.1|  Nucleotide-diphospho-sugar transferases supe...  58.2    1e-06   
ref|XP_007225800.1|  hypothetical protein PRUPE_ppa011267mg           55.8    3e-06   
ref|XP_009129141.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  56.2    5e-06   Brassica rapa
emb|CDY09365.1|  BnaA02g26450D                                        55.8    6e-06   Brassica napus [oilseed rape]
gb|AFS28674.1|  putative 2-C-methyl-D-erythritol 2,4-cyclodiphosp...  55.8    7e-06   Olea europaea
gb|AFS28673.1|  putative 2-C-methyl-D-erythritol 2,4-cyclodiphosp...  55.5    7e-06   Olea europaea
ref|XP_010314195.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  55.8    7e-06   Solanum lycopersicum
emb|CDY15838.1|  BnaC02g34570D                                        55.8    7e-06   Brassica napus [oilseed rape]
ref|XP_010523433.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  54.7    8e-06   Tarenaya hassleriana [spider flower]
gb|ACD70398.1|  putative chloroplast 2-C-methyl-D-erythritol 4-ph...  55.1    8e-06   Populus trichocarpa [western balsam poplar]
gb|KHF99643.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...  55.5    8e-06   Gossypium arboreum [tree cotton]
ref|XP_006385101.1|  hypothetical protein POPTR_0004s23930g           55.5    1e-05   Populus trichocarpa [western balsam poplar]
gb|KJB66272.1|  hypothetical protein B456_010G134700                  55.5    1e-05   Gossypium raimondii
gb|KJB66274.1|  hypothetical protein B456_010G134700                  55.5    1e-05   Gossypium raimondii
gb|KJB66273.1|  hypothetical protein B456_010G134700                  55.5    1e-05   Gossypium raimondii
ref|XP_011028435.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  55.5    1e-05   Populus euphratica
gb|KHF99642.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...  55.1    1e-05   Gossypium arboreum [tree cotton]
ref|XP_011028436.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  54.7    2e-05   Populus euphratica
ref|XP_007154106.1|  hypothetical protein PHAVU_003G0909001g          52.0    2e-05   Phaseolus vulgaris [French bean]
gb|ACI16377.1|  4-diphosphocytidyl-methylerythritol 2-phosphate s...  54.3    2e-05   Catharanthus roseus [chatas]
ref|XP_010523431.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  54.3    2e-05   Tarenaya hassleriana [spider flower]
ref|XP_006292733.1|  hypothetical protein CARUB_v10018977mg           53.9    3e-05   Capsella rubella
ref|XP_008218627.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  53.5    4e-05   Prunus mume [ume]
ref|XP_008218628.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  53.5    4e-05   Prunus mume [ume]
gb|KJB66276.1|  hypothetical protein B456_010G134700                  52.8    7e-05   Gossypium raimondii
gb|KJB66275.1|  hypothetical protein B456_010G134700                  52.8    8e-05   Gossypium raimondii
ref|XP_002268908.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  52.8    8e-05   Vitis vinifera
emb|CAN80766.1|  hypothetical protein VITISV_013863                   52.4    9e-05   Vitis vinifera
gb|KHN03574.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...  52.4    1e-04   Glycine soja [wild soybean]
ref|XP_009355454.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  52.4    1e-04   Pyrus x bretschneideri [bai li]
gb|KCW57180.1|  hypothetical protein EUGRSUZ_I02806                   51.6    1e-04   Eucalyptus grandis [rose gum]
ref|XP_006600264.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  52.4    1e-04   Glycine max [soybeans]
ref|NP_001172686.1|  Os01g0887000                                     48.9    1e-04   
ref|XP_006600265.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  52.4    1e-04   Glycine max [soybeans]
ref|XP_004507643.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  49.3    1e-04   
ref|XP_011087605.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  52.0    1e-04   Sesamum indicum [beniseed]
gb|KDP32436.1|  hypothetical protein JCGZ_13361                       52.0    1e-04   Jatropha curcas
ref|XP_011087603.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  52.0    1e-04   Sesamum indicum [beniseed]
ref|XP_011087604.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  52.0    1e-04   Sesamum indicum [beniseed]
ref|XP_012078830.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  52.0    1e-04   Jatropha curcas
ref|XP_010425029.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  52.0    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010514024.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  51.6    2e-04   Camelina sativa [gold-of-pleasure]
ref|XP_002876821.1|  predicted protein                                51.6    2e-04   Arabidopsis lyrata subsp. lyrata
ref|XP_010502265.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  51.6    2e-04   Camelina sativa [gold-of-pleasure]
gb|EYU33225.1|  hypothetical protein MIMGU_mgv1a010477mg              51.6    2e-04   Erythranthe guttata [common monkey flower]
gb|AFM93780.1|  plastid 2-C-methyl-D-erythritol 4-phosphate cytid...  51.2    2e-04   Picrorhiza kurrooa
gb|KCW57181.1|  hypothetical protein EUGRSUZ_I02806                   51.2    2e-04   Eucalyptus grandis [rose gum]
ref|XP_010030242.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  51.2    2e-04   Eucalyptus grandis [rose gum]
gb|AID51430.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...  51.2    2e-04   Astragalus membranaceus
ref|XP_010088695.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...  50.8    3e-04   
ref|XP_006395779.1|  hypothetical protein EUTSA_v10004647mg           50.8    3e-04   
gb|ACN40114.1|  unknown                                               50.8    4e-04   Picea sitchensis
dbj|BAF98292.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltra...  50.8    4e-04   Hevea brasiliensis [jebe]
ref|XP_004499358.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  50.8    4e-04   Cicer arietinum [garbanzo]
dbj|BAF98291.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltra...  50.8    4e-04   Hevea brasiliensis [jebe]
gb|EPS72731.1|  4-diphosphocytidyl-methylerythritol 2-phosphate s...  50.4    4e-04   Genlisea aurea
gb|ABB88837.2|  4-diphosphocytidyl-2-C-methyl-D-erythritol synthase   50.4    4e-04   Stevia rebaudiana
dbj|BAJ91237.1|  predicted protein                                    50.4    4e-04   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM85383.1|  unnamed protein product                              50.1    5e-04   Triticum aestivum [Canadian hard winter wheat]
gb|AEZ55666.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...  50.1    5e-04   Salvia miltiorrhiza [Chinese salvia]
gb|AFK34060.1|  unknown                                               50.1    6e-04   Lotus japonicus
gb|KCW57178.1|  hypothetical protein EUGRSUZ_I02806                   50.1    6e-04   Eucalyptus grandis [rose gum]
gb|KDO41351.1|  hypothetical protein CISIN_1g022657mg                 49.7    6e-04   Citrus sinensis [apfelsine]
gb|KDO41350.1|  hypothetical protein CISIN_1g022657mg                 49.3    6e-04   Citrus sinensis [apfelsine]
dbj|BAF52631.1|  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythrito...  49.3    7e-04   Oryza sativa Japonica Group [Japonica rice]
gb|AEM42975.1|  2-C-methyl-D-erythritol 4-phosphate cytidylyltran...  49.7    8e-04   Siraitia grosvenorii [arhat fruit]
ref|XP_004133739.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  49.7    8e-04   Cucumis sativus [cucumbers]
ref|XP_006836933.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  49.7    8e-04   Amborella trichopoda
gb|ABU48538.1|  2-C-methyl-D-erythritol 4-phosphate cytidyltransf...  49.7    8e-04   Taxus x media [hybrid yew]
gb|AGP04988.1|  2-C-methyl-D-erythritol 4-phosphate cytidyltransf...  49.7    8e-04   Taxus wallichiana var. chinensis [Chinese yew]
ref|XP_011650586.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  49.3    8e-04   Cucumis sativus [cucumbers]
ref|XP_008452187.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  49.7    8e-04   Cucumis melo [Oriental melon]
ref|XP_009410727.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  49.7    9e-04   
ref|XP_008452188.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  49.3    9e-04   Cucumis melo [Oriental melon]
ref|XP_006395780.1|  hypothetical protein EUTSA_v10004647mg           49.7    9e-04   Eutrema salsugineum [saltwater cress]
ref|XP_006470808.1|  PREDICTED: 2-C-methyl-D-erythritol 4-phospha...  49.7    9e-04   Citrus sinensis [apfelsine]
ref|XP_006431390.1|  hypothetical protein CICLE_v10002035mg           49.3    0.001   Citrus clementina [clementine]
sp|Q5N8G1.1|ISPD_ORYSJ  RecName: Full=2-C-methyl-D-erythritol 4-p...  49.3    0.001   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002519366.1|  2-C-methyl-D-erythritol 4-phosphate cytidyly...  49.3    0.001   



>ref|XP_010907549.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X1 [Elaeis guineensis]
Length=316

 Score = 50.8 bits (120),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+LLAERILN
Sbjct  281  HPVYITEGSYTNIKVTTPDDLLLAERILN  309


 Score = 48.1 bits (113),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/119 (35%), Positives = 57/119 (48%), Gaps = 33/119 (28%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   GF     +S+    ++CI       L++  D    ++VLKD WL GAAVLG 
Sbjct  166  ERQDSVFNGFQEIEGSSE----LVCIHDS-ARPLVTSGD---IKKVLKDAWLNGAAVLGV  217

Query  352  PAKSTIKE-----------------------VIKPELLK-GFALINRYNPLLICDVFSM  248
            P K+TIKE                       VIKP LL+ GF L+NR N L + D  S+
Sbjct  218  PVKATIKEANSDSFVVKTLDRKTLWEMHTPQVIKPHLLRDGFELVNR-NGLEVTDDVSI  275



>ref|XP_010907551.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X3 [Elaeis guineensis]
Length=256

 Score = 50.8 bits (120),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+LLAERILN
Sbjct  221  HPVYITEGSYTNIKVTTPDDLLLAERILN  249


 Score = 48.1 bits (113),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 55/119 (46%), Gaps = 33/119 (28%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   GF     +S+    ++CI       + S       ++VLKD WL GAAVLG 
Sbjct  106  ERQDSVFNGFQEIEGSSE----LVCIHDSARPLVTS----GDIKKVLKDAWLNGAAVLGV  157

Query  352  PAKSTIKE-----------------------VIKPELLK-GFALINRYNPLLICDVFSM  248
            P K+TIKE                       VIKP LL+ GF L+NR N L + D  S+
Sbjct  158  PVKATIKEANSDSFVVKTLDRKTLWEMHTPQVIKPHLLRDGFELVNR-NGLEVTDDVSI  215



>ref|XP_010907550.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X2 [Elaeis guineensis]
Length=299

 Score = 50.8 bits (120),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+LLAERILN
Sbjct  264  HPVYITEGSYTNIKVTTPDDLLLAERILN  292


 Score = 47.8 bits (112),  Expect(2) = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 40/76 (53%), Gaps = 25/76 (33%)
 Frame = -2

Query  403  ERVLKDGWLVGAAVLGFPAKSTIKE-----------------------VIKPELLK-GFA  296
            ++VLKD WL GAAVLG P K+TIKE                       VIKP LL+ GF 
Sbjct  184  KKVLKDAWLNGAAVLGVPVKATIKEANSDSFVVKTLDRKTLWEMHTPQVIKPHLLRDGFE  243

Query  295  LINRYNPLLICDVFSM  248
            L+NR N L + D  S+
Sbjct  244  LVNR-NGLEVTDDVSI  258



>gb|ABV02019.1| 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase [Nicotiana 
langsdorffii x Nicotiana sanderae]
Length=306

 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 55/107 (51%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L   D I K++CI       L+  ED    E+VLKDGW+VGAAVLG 
Sbjct  162  ERQDSVYSG----LQEVDSISKLVCIHDS-ARPLVWTED---IEKVLKDGWVVGAAVLGV  213

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            PAK+TIKE                       VIKPELL KGF L+NR
Sbjct  214  PAKATIKEANSESFVVKTLDRKTLWEMQTPQVIKPELLKKGFELVNR  260


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+LLAERILN
Sbjct  277  HPVYITEGSYTNIKVTTPDDLLLAERILN  305



>ref|XP_009804918.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Nicotiana sylvestris]
Length=309

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 54/107 (50%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G     S S    K++CI       L+  ED    E+VLKDGWLVGAAVLG 
Sbjct  162  ERQDSVYSGLQEVDSNS----KLVCIHDS-ARPLVWTED---VEKVLKDGWLVGAAVLGV  213

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            PAK+TIKE                       VIKPELL KGF L+NR
Sbjct  214  PAKATIKEANSESFVVKTLDRKTLWEMQTPQVIKPELLKKGFELVNR  260


 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILNT  45
            + VYIT  SY NIKVTTPDD+LLAERILNT
Sbjct  277  HPVYITEGSYTNIKVTTPDDLLLAERILNT  306



>ref|XP_009607716.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Nicotiana tomentosiformis]
Length=309

 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 54/107 (50%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G     S S    K++CI       L+  ED    E+VLKDGWLVGAAVLG 
Sbjct  162  ERQDSVYSGLQEVDSNS----KLVCIHDS-ARPLVWTED---VEKVLKDGWLVGAAVLGV  213

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            PAK+TIKE                       VIKPELL KGF L+NR
Sbjct  214  PAKATIKEANSESFVVKTLDRKTLWEMQTPQVIKPELLKKGFELVNR  260


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILNT  45
            + VYIT  SY NIKVTTPDD+LLAERILN+
Sbjct  277  HPVYITDGSYTNIKVTTPDDLLLAERILNS  306



>ref|XP_006358470.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like [Solanum tuberosum]
Length=307

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 53/107 (50%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G     S S    K+ CI       L+  ED    E+VLKDGWLVGAAVLG 
Sbjct  160  ERQDSVYSGLQEVDSNS----KLACIHDS-ARPLVQTED---VEKVLKDGWLVGAAVLGV  211

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            PAK+TIKE                       +IKPELL KGF L+NR
Sbjct  212  PAKATIKEANSESFVVKTLDRKTLWEMQTPQIIKPELLKKGFELVNR  258


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+LLAERILN
Sbjct  275  HPVYITEGSYTNIKVTTPDDLLLAERILN  303



>ref|XP_004300034.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like [Fragaria vesca subsp. vesca]
Length=303

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 54/107 (50%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L A D   +++CI       L+S E+    E+VLKDGWL GAAVLG 
Sbjct  152  ERQDSVYSG----LQAIDLTSELVCIHDS-ARPLVSSEN---VEKVLKDGWLNGAAVLGV  203

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            P K+TIKE                       VIKPELL KGF L+NR
Sbjct  204  PVKATIKEANNESFVVRTLDRRTLWEMQTPQVIKPELLKKGFELVNR  250



>ref|XP_010314187.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X1 [Solanum lycopersicum]
Length=307

 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 53/107 (50%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G     S S    K+ CI       L+  ED    E+VLKDGWLVGAAVLG 
Sbjct  160  ERQDSVYSGLQEVDSNS----KLACIHDS-ARPLVQIED---VEKVLKDGWLVGAAVLGV  211

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            PAK+TIKE                       +IKPELL KGF L+NR
Sbjct  212  PAKATIKEANSESFVVKTLDRKTLWEMQTPQIIKPELLKKGFELVNR  258


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+LLAERILN
Sbjct  275  HPVYITEGSYTNIKVTTPDDLLLAERILN  303



>gb|AFI71456.1| 2-C-methyl-D-erythritol 4-phosphatecytidyltransferase [Rauvolfia 
verticillata]
 gb|AFO10121.1| chloroplast 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase 
[Rauvolfia verticillata]
Length=314

 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 59/116 (51%), Gaps = 32/116 (28%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    + A D   +++CI       L+  ED   AE+VLKDG L+GAAVLG 
Sbjct  164  ERQDSVYSG----VQAVDLSAELVCIHD-TARPLVLAED---AEKVLKDGLLIGAAVLGV  215

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINRYNPLLICDV  257
            PAK+TIKE                       VIKP+LL KGF L+NR N  +  DV
Sbjct  216  PAKATIKEADSKFFVVRTLDRKKLWEMQTPQVIKPDLLKKGFELVNRENLEVTDDV  271


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+LLAERILN
Sbjct  279  HPVYITEGSYTNIKVTTPDDLLLAERILN  307



>ref|XP_007023792.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
 gb|EOY26414.1| Nucleotide-diphospho-sugar transferases superfamily protein isoform 
1 [Theobroma cacao]
Length=308

 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 54/107 (50%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L A D   +++CI       L++  D    E+VLKDGWLVGAAVLG 
Sbjct  157  ERQDSVYSG----LQAVDSNCELVCIHDS-ARPLVTSGD---VEKVLKDGWLVGAAVLGV  208

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            P K+TIKE                       VIKPELL KGF L+NR
Sbjct  209  PVKATIKEANSHSYVVRTLERKTLWEMQTPQVIKPELLRKGFELVNR  255


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+LLAERILN
Sbjct  272  HPVYITEGSYTNIKVTTPDDLLLAERILN  300



>ref|XP_007225800.1| hypothetical protein PRUPE_ppa011267mg [Prunus persica]
 gb|EMJ26999.1| hypothetical protein PRUPE_ppa011267mg [Prunus persica]
Length=216

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 53/107 (50%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L A D   +++CI       L+S  D    E+VLKDGWL GAAVLG 
Sbjct  65   ERQDSVYSG----LQAIDLSSELVCIHDS-ARPLVSSGD---VEKVLKDGWLNGAAVLGV  116

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            P K+TIKE                       VIKP+LL KGF L+NR
Sbjct  117  PVKATIKEANSESFVVKTLDRRTLWEMQTPQVIKPQLLRKGFELVNR  163



>ref|XP_009129141.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Brassica rapa]
 ref|XP_009129142.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Brassica rapa]
Length=310

 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 52/107 (49%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L   D   +++CI       L+  ED    E+VLKDGW VGAAVLG 
Sbjct  164  ERQDSVHSG----LQEIDVNAELVCIHDS-ARPLVDTED---VEKVLKDGWAVGAAVLGV  215

Query  352  PAKSTIKE-----------------------VIKPELLK-GFALINR  284
            PAK+TIKE                       VIKPELLK GF L+ R
Sbjct  216  PAKATIKEVNSDSLVVKTLDRKTLWEMQTPQVIKPELLKRGFELVKR  262



>emb|CDY09365.1| BnaA02g26450D [Brassica napus]
Length=308

 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 52/107 (49%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L   D   +++CI       L+  ED    E+VLKDGW VGAAVLG 
Sbjct  162  ERQDSVHSG----LQEIDVNAELVCIHDS-ARPLVDTED---VEKVLKDGWAVGAAVLGV  213

Query  352  PAKSTIKE-----------------------VIKPELLK-GFALINR  284
            PAK+TIKE                       VIKPELLK GF L+ R
Sbjct  214  PAKATIKEVNSDSLVVKTLDRKTLWEMQTPQVIKPELLKRGFELVKR  260



>gb|AFS28674.1| putative 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, 
partial [Olea europaea]
Length=277

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 58/118 (49%), Gaps = 36/118 (31%)
 Frame = -2

Query  553  HVSIAF----YERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKD  386
            HV + F     ER ++   G    L   D   +++CI       +L+ ED     +VLKD
Sbjct  115  HVDLKFALPGKERQDSVYSG----LQEIDLNSELVCIHDSARPLVLA-ED---VAKVLKD  166

Query  385  GWLVGAAVLGFPAKSTIKE-----------------------VIKPELL-KGFALINR  284
            GWL+GAAVLG PAK+TIKE                       VIKP+LL KGF L+NR
Sbjct  167  GWLIGAAVLGVPAKATIKEANGESFVVKTLDRKMLWEMQTPQVIKPDLLKKGFELVNR  224


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+LLAERILN
Sbjct  241  HPVYITEGSYTNIKVTTPDDLLLAERILN  269



>gb|AFS28673.1| putative 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase, 
partial [Olea europaea]
Length=277

 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 58/118 (49%), Gaps = 36/118 (31%)
 Frame = -2

Query  553  HVSIAF----YERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKD  386
            HV + F     ER ++   G    L   D   +++CI       +L+ ED     +VLKD
Sbjct  115  HVDLKFALPGKERQDSVYSG----LQEIDLNSELVCIHDSARPLVLA-ED---VAKVLKD  166

Query  385  GWLVGAAVLGFPAKSTIKE-----------------------VIKPELL-KGFALINR  284
            GWL+GAAVLG PAK+TIKE                       VIKP+LL KGF L+NR
Sbjct  167  GWLIGAAVLGVPAKATIKEANGESFVVKTLDRKTLWEMQTPQVIKPDLLKKGFELVNR  224


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+LLAERILN
Sbjct  241  HPVYITEGSYTNIKVTTPDDLLLAERILN  269



>ref|XP_010314195.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X2 [Solanum lycopersicum]
Length=281

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 37/63 (59%), Gaps = 24/63 (38%)
 Frame = -2

Query  400  RVLKDGWLVGAAVLGFPAKSTIKE-----------------------VIKPELL-KGFAL  293
            +VLKDGWLVGAAVLG PAK+TIKE                       +IKPELL KGF L
Sbjct  170  QVLKDGWLVGAAVLGVPAKATIKEANSESFVVKTLDRKTLWEMQTPQIIKPELLKKGFEL  229

Query  292  INR  284
            +NR
Sbjct  230  VNR  232


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+LLAERILN
Sbjct  249  HPVYITEGSYTNIKVTTPDDLLLAERILN  277



>emb|CDY15838.1| BnaC02g34570D [Brassica napus]
Length=309

 Score = 55.8 bits (133),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 37/69 (54%), Gaps = 24/69 (35%)
 Frame = -2

Query  418  DRSHAERVLKDGWLVGAAVLGFPAKSTIKE-----------------------VIKPELL  308
            D    E+VLKDGW VGAAVLG PAK+TIKE                       VIKPELL
Sbjct  193  DTEDVEKVLKDGWAVGAAVLGVPAKATIKEVNADSLVVKTLDRKTLWEMQTPQVIKPELL  252

Query  307  K-GFALINR  284
            K GF L+ R
Sbjct  253  KRGFELVKR  261



>ref|XP_010523433.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X2 [Tarenaya hassleriana]
 ref|XP_010523434.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X2 [Tarenaya hassleriana]
Length=211

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 54/107 (50%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L   D   +++CI       L++ ED    E+VLKDG +VGAAVLG 
Sbjct  65   ERQDSVYNG----LQEVDLNSELVCIHDS-ARPLVTTED---VEKVLKDGSVVGAAVLGV  116

Query  352  PAKSTIKE-----------------------VIKPELLK-GFALINR  284
            PAK+TIKE                       VIKPELLK GF L+N+
Sbjct  117  PAKATIKEANSESFVVKTLDRKTLWEMQTPQVIKPELLKRGFELVNK  163



>gb|ACD70398.1| putative chloroplast 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Populus trichocarpa]
Length=240

 Score = 55.1 bits (131),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 53/107 (50%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L   D   +++CI       +LS ED    E+VLKDGW+ GAAVLG 
Sbjct  94   ERQDSVYSG----LQEVDLNSELVCIHDSARPLVLS-ED---VEKVLKDGWINGAAVLGV  145

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            P K+TIKE                       V+KPELL KGF L+NR
Sbjct  146  PVKATIKEADGESFVVRTLDRKTLWEMQTPQVMKPELLKKGFELVNR  192


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILNT  45
            + VYIT  SY NIKVTTPDD+LLAERIL+T
Sbjct  209  HPVYITEGSYTNIKVTTPDDLLLAERILST  238



>gb|KHF99643.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplastic 
[Gossypium arboreum]
Length=314

 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 53/108 (49%), Gaps = 34/108 (31%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRS-HAERVLKDGWLVGAAVLG  356
            ER ++   G    L A D   +++CI          P  RS   E+VLKDGWL+GAAVLG
Sbjct  163  ERQDSVYSG----LQAVDLNSELVCIH-----DSARPLVRSGDVEKVLKDGWLIGAAVLG  213

Query  355  FPAKSTIKE-----------------------VIKPELL-KGFALINR  284
             P K+TIKE                       VIKPELL KGF L++R
Sbjct  214  VPVKATIKEANSDSYVVKTLDRKTLWEMQTPQVIKPELLRKGFELVHR  261



>ref|XP_006385101.1| hypothetical protein POPTR_0004s23930g [Populus trichocarpa]
 gb|ERP62898.1| hypothetical protein POPTR_0004s23930g [Populus trichocarpa]
Length=309

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 53/107 (50%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L   D   +++CI       +LS ED    E+VLKDGW+ GAAVLG 
Sbjct  163  ERQDSVYSG----LQEVDLNSELVCIHDSARPLVLS-ED---VEKVLKDGWINGAAVLGV  214

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            P K+TIKE                       V+KPELL KGF L+NR
Sbjct  215  PVKATIKEADGESFVVRTLDRKTLWEMQTPQVMKPELLKKGFELVNR  261


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILNT  45
            + VYIT  SY NIKVTTPDD+LLAERIL+T
Sbjct  278  HPVYITEGSYTNIKVTTPDDLLLAERILST  307



>gb|KJB66272.1| hypothetical protein B456_010G134700 [Gossypium raimondii]
Length=304

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 53/108 (49%), Gaps = 34/108 (31%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRS-HAERVLKDGWLVGAAVLG  356
            ER ++   G    L A D   +++CI          P  RS   E+VLKDGWL+GAAVLG
Sbjct  153  ERQDSVYSG----LQAVDLNSELVCIH-----DSARPLVRSGDVEKVLKDGWLIGAAVLG  203

Query  355  FPAKSTIKE-----------------------VIKPELL-KGFALINR  284
             P K+TIKE                       VIKPELL KGF L++R
Sbjct  204  VPVKATIKEANSDSYVVKTLDRKTLWEMQTPQVIKPELLRKGFELVHR  251



>gb|KJB66274.1| hypothetical protein B456_010G134700 [Gossypium raimondii]
Length=307

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 53/108 (49%), Gaps = 34/108 (31%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRS-HAERVLKDGWLVGAAVLG  356
            ER ++   G    L A D   +++CI          P  RS   E+VLKDGWL+GAAVLG
Sbjct  156  ERQDSVYSG----LQAVDLNSELVCIH-----DSARPLVRSGDVEKVLKDGWLIGAAVLG  206

Query  355  FPAKSTIKE-----------------------VIKPELL-KGFALINR  284
             P K+TIKE                       VIKPELL KGF L++R
Sbjct  207  VPVKATIKEANSDSYVVKTLDRKTLWEMQTPQVIKPELLRKGFELVHR  254



>gb|KJB66273.1| hypothetical protein B456_010G134700 [Gossypium raimondii]
Length=309

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 53/108 (49%), Gaps = 34/108 (31%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRS-HAERVLKDGWLVGAAVLG  356
            ER ++   G    L A D   +++CI          P  RS   E+VLKDGWL+GAAVLG
Sbjct  158  ERQDSVYSG----LQAVDLNSELVCIH-----DSARPLVRSGDVEKVLKDGWLIGAAVLG  208

Query  355  FPAKSTIKE-----------------------VIKPELL-KGFALINR  284
             P K+TIKE                       VIKPELL KGF L++R
Sbjct  209  VPVKATIKEANSDSYVVKTLDRKTLWEMQTPQVIKPELLRKGFELVHR  256



>ref|XP_011028435.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X1 [Populus euphratica]
Length=309

 Score = 55.5 bits (132),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 53/107 (50%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L   D   +++CI       +LS ED    E+VLKDGW+ GAAVLG 
Sbjct  163  ERQDSVYSG----LQEVDLNSELVCIHDSARPLVLS-ED---VEKVLKDGWINGAAVLGV  214

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            P K+TIKE                       V+KPELL KGF L+NR
Sbjct  215  PVKATIKEADGESFVVRTLDRKTLWEMQTPQVMKPELLKKGFELVNR  261


 Score = 50.4 bits (119),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILNT  45
            + VYIT  SY NIKVTTPDD+LLAERIL+T
Sbjct  278  HPVYITEGSYTNIKVTTPDDLLLAERILST  307



>gb|KHF99642.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplastic 
[Gossypium arboreum]
Length=335

 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 53/108 (49%), Gaps = 34/108 (31%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRS-HAERVLKDGWLVGAAVLG  356
            ER ++   G    L A D   +++CI          P  RS   E+VLKDGWL+GAAVLG
Sbjct  163  ERQDSVYSG----LQAVDLNSELVCIH-----DSARPLVRSGDVEKVLKDGWLIGAAVLG  213

Query  355  FPAKSTIKE-----------------------VIKPELL-KGFALINR  284
             P K+TIKE                       VIKPELL KGF L++R
Sbjct  214  VPVKATIKEANSDSYVVKTLDRKTLWEMQTPQVIKPELLRKGFELVHR  261



>ref|XP_011028436.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X2 [Populus euphratica]
Length=285

 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 53/107 (50%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L   D   +++CI       +LS ED    E+VLKDGW+ GAAVLG 
Sbjct  163  ERQDSVYSG----LQEVDLNSELVCIHDSARPLVLS-ED---VEKVLKDGWINGAAVLGV  214

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            P K+TIKE                       V+KPELL KGF L+NR
Sbjct  215  PVKATIKEADGESFVVRTLDRKTLWEMQTPQVMKPELLKKGFELVNR  261



>ref|XP_007154106.1| hypothetical protein PHAVU_003G0909001g, partial [Phaseolus vulgaris]
 gb|ESW26100.1| hypothetical protein PHAVU_003G0909001g, partial [Phaseolus vulgaris]
Length=120

 Score = 52.0 bits (123),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDDMLLAERILN
Sbjct  79   HPVYITEGSYTNIKVTTPDDMLLAERILN  107



>gb|ACI16377.1| 4-diphosphocytidyl-methylerythritol 2-phosphate synthase [Catharanthus 
roseus]
Length=311

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 45/116 (39%), Positives = 58/116 (50%), Gaps = 32/116 (28%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L A D   +++CI       +L+ ED    E+VLKDG  +GAAVLG 
Sbjct  164  ERQDSVYSG----LQAVDLSAELVCIHDSARPLVLA-ED---VEKVLKDGLSIGAAVLGV  215

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINRYNPLLICDV  257
            PAK+TIKE                       VIKP+LL KGF L+NR N  +  DV
Sbjct  216  PAKATIKEADSKSFVVKTLDRKTLWEMQTPQVIKPDLLKKGFELVNRENLEVTDDV  271



>ref|XP_010523431.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X1 [Tarenaya hassleriana]
Length=304

 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 54/107 (50%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L   D   +++CI       L++ ED    E+VLKDG +VGAAVLG 
Sbjct  158  ERQDSVYNG----LQEVDLNSELVCIHDS-ARPLVTTED---VEKVLKDGSVVGAAVLGV  209

Query  352  PAKSTIKE-----------------------VIKPELLK-GFALINR  284
            PAK+TIKE                       VIKPELLK GF L+N+
Sbjct  210  PAKATIKEANSESFVVKTLDRKTLWEMQTPQVIKPELLKRGFELVNK  256



>ref|XP_006292733.1| hypothetical protein CARUB_v10018977mg [Capsella rubella]
 gb|EOA25631.1| hypothetical protein CARUB_v10018977mg [Capsella rubella]
Length=303

 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 53/107 (50%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L   D   +++CI       L++ ED    E+VLKDG+ VGAAVLG 
Sbjct  157  ERQDSVYSG----LQEIDVNSELVCIHDS-ARPLVNTED---VEKVLKDGYTVGAAVLGV  208

Query  352  PAKSTIKE-----------------------VIKPELLK-GFALINR  284
            PAK+TIKE                       VIKPELLK GF L+ R
Sbjct  209  PAKATIKEVNSESLVVKTLDRKTLWEMQTPQVIKPELLKRGFELVKR  255



>ref|XP_008218627.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X1 [Prunus mume]
Length=307

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 52/107 (49%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L A D   +++CI       L+S  D    E+VLKD WL GAAVLG 
Sbjct  156  ERQDSVYSG----LQAIDLSSELVCIHDS-ARPLVSSGD---VEKVLKDAWLNGAAVLGV  207

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            P K+TIKE                       VIKP+LL KGF L+NR
Sbjct  208  PVKATIKEANSESFVVKTLDRRTLWEMQTPQVIKPQLLRKGFELVNR  254



>ref|XP_008218628.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X2 [Prunus mume]
Length=305

 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 52/107 (49%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L A D   +++CI       L+S  D    E+VLKD WL GAAVLG 
Sbjct  154  ERQDSVYSG----LQAIDLSSELVCIHDS-ARPLVSSGD---VEKVLKDAWLNGAAVLGV  205

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            P K+TIKE                       VIKP+LL KGF L+NR
Sbjct  206  PVKATIKEANSESFVVKTLDRRTLWEMQTPQVIKPQLLRKGFELVNR  252



>gb|KJB66276.1| hypothetical protein B456_010G134700 [Gossypium raimondii]
Length=298

 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 52/107 (49%), Gaps = 34/107 (32%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRS-HAERVLKDGWLVGAAVLG  356
            ER ++   G    L A D   +++CI          P  RS   E+VLKDGWL+GAAVLG
Sbjct  156  ERQDSVYSG----LQAVDLNSELVCIH-----DSARPLVRSGDVEKVLKDGWLIGAAVLG  206

Query  355  FPAKSTIKE-----------------------VIKPELL-KGFALIN  287
             P K+TIKE                       VIKPELL KGF L++
Sbjct  207  VPVKATIKEANSDSYVVKTLDRKTLWEMQTPQVIKPELLRKGFELVH  253



>gb|KJB66275.1| hypothetical protein B456_010G134700 [Gossypium raimondii]
Length=300

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 52/107 (49%), Gaps = 34/107 (32%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRS-HAERVLKDGWLVGAAVLG  356
            ER ++   G    L A D   +++CI          P  RS   E+VLKDGWL+GAAVLG
Sbjct  158  ERQDSVYSG----LQAVDLNSELVCIH-----DSARPLVRSGDVEKVLKDGWLIGAAVLG  208

Query  355  FPAKSTIKE-----------------------VIKPELL-KGFALIN  287
             P K+TIKE                       VIKPELL KGF L++
Sbjct  209  VPVKATIKEANSDSYVVKTLDRKTLWEMQTPQVIKPELLRKGFELVH  255



>ref|XP_002268908.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Vitis vinifera]
 emb|CBI29624.3| unnamed protein product [Vitis vinifera]
Length=308

 Score = 52.8 bits (125),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 56/118 (47%), Gaps = 36/118 (31%)
 Frame = -2

Query  553  HVSIAFY----ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKD  386
            H+ + F     ER ++   G    L A D   +++CI       L+S  D    E+VLKD
Sbjct  148  HIDVKFTLPGKERQDSVYSG----LQAVDLNSELVCIHDS-ARPLVSTGD---IEQVLKD  199

Query  385  GWLVGAAVLGFPAKSTIKE-----------------------VIKPELL-KGFALINR  284
            G L GAAVLG P K+TIKE                       VIKPELL KGF L+NR
Sbjct  200  GQLNGAAVLGVPVKATIKEANSESFVVRTLDRKTLWEMQTPQVIKPELLRKGFELVNR  257


 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + V+IT  SY NIKVTTPDD+LLAERILN
Sbjct  274  HPVFITEGSYTNIKVTTPDDLLLAERILN  302



>emb|CAN80766.1| hypothetical protein VITISV_013863 [Vitis vinifera]
Length=312

 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 56/118 (47%), Gaps = 36/118 (31%)
 Frame = -2

Query  553  HVSIAFY----ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKD  386
            H+ + F     ER ++   G    L A D   +++CI       L+S  D    E+VLKD
Sbjct  152  HIDVKFTLPGKERQDSVYSG----LQAVDLNSELVCIHDS-ARPLVSTGD---IEQVLKD  203

Query  385  GWLVGAAVLGFPAKSTIKE-----------------------VIKPELL-KGFALINR  284
            G L GAAVLG P K+TIKE                       VIKPELL KGF L+NR
Sbjct  204  GQLNGAAVLGVPVKATIKEANSESFVVRTLDRKTLWEMQTPQVIKPELLRKGFELVNR  261


 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + V+IT  SY NIKVTTPDD+LLAERILN
Sbjct  278  HPVFITEGSYTNIKVTTPDDLLLAERILN  306



>gb|KHN03574.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplastic 
[Glycine soja]
Length=304

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDDMLLAERILN
Sbjct  263  HPVYITQGSYTNIKVTTPDDMLLAERILN  291



>ref|XP_009355454.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Pyrus x bretschneideri]
Length=320

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 52/107 (49%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L A D   +++CI       LLS  D    E+VLKDG L GAAVLG 
Sbjct  168  ERQDSVYNG----LQAIDLTSELVCIHDS-ARPLLSSGD---VEKVLKDGCLNGAAVLGV  219

Query  352  PAKSTIKE-----------------------VIKPELLK-GFALINR  284
            P K+TIKE                       VIKP+LLK GF L+NR
Sbjct  220  PVKATIKEANTESYVVKTLDRRTLWEMQTPQVIKPQLLKEGFELVNR  266



>gb|KCW57180.1| hypothetical protein EUGRSUZ_I02806 [Eucalyptus grandis]
Length=216

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 50/107 (47%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G     S S+    ++CI       L+S   R   E+VLKDGW  GAAVLG 
Sbjct  65   ERQDSVYSGLQAVDSGSE----LVCIHDS-ARPLVS---RGDIEKVLKDGWENGAAVLGV  116

Query  352  PAKSTIKE-----------------------VIKPELLK-GFALINR  284
            P K+TIKE                       VIKP LLK GF L+NR
Sbjct  117  PVKATIKEANSESFVVRTLDRKTLWEMQTPQVIKPSLLKRGFELVNR  163


 Score = 49.7 bits (117),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VY+T  SY NIKVTTPDD+LLAERILN
Sbjct  180  HPVYVTEGSYTNIKVTTPDDLLLAERILN  208



>ref|XP_006600264.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like isoform X1 [Glycine max]
Length=314

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDDMLLAERILN
Sbjct  273  HPVYITQGSYTNIKVTTPDDMLLAERILN  301


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 52/107 (49%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   GF     A D   +++CI       +LS    +  ++VLKDG L GAAVLG 
Sbjct  158  ERQDSVYNGFQ----AVDPNSELVCIHDSARPLVLS----ADVKKVLKDGLLNGAAVLGV  209

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            P K+TIKE                       VIKPELL KGF L+NR
Sbjct  210  PVKATIKEANRESFVVKTLDRKTLWEMQTPQVIKPELLRKGFELVNR  256



>ref|NP_001172686.1| Os01g0887000 [Oryza sativa Japonica Group]
 dbj|BAH91416.1| Os01g0887000, partial [Oryza sativa Japonica Group]
Length=50

 Score = 48.9 bits (115),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            ++VYIT  SY NIKVTTPDD+LLAER++N
Sbjct  20   HSVYITEGSYTNIKVTTPDDLLLAERLMN  48



>ref|XP_006600265.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like isoform X2 [Glycine max]
Length=310

 Score = 52.4 bits (124),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDDMLLAERILN
Sbjct  269  HPVYITQGSYTNIKVTTPDDMLLAERILN  297


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 52/107 (49%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   GF     A D   +++CI       +LS    +  ++VLKDG L GAAVLG 
Sbjct  154  ERQDSVYNGFQ----AVDPNSELVCIHDSARPLVLS----ADVKKVLKDGLLNGAAVLGV  205

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            P K+TIKE                       VIKPELL KGF L+NR
Sbjct  206  PVKATIKEANRESFVVKTLDRKTLWEMQTPQVIKPELLRKGFELVNR  252



>ref|XP_004507643.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like isoform X4 [Cicer arietinum]
 ref|XP_004507644.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like isoform X5 [Cicer arietinum]
Length=92

 Score = 49.3 bits (116),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + +YIT  SY NIKVTTPDD+LLAERILN
Sbjct  57   HPIYITEGSYTNIKVTTPDDLLLAERILN  85



>ref|XP_011087605.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X3 [Sesamum indicum]
Length=286

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILNT  45
            + VYIT  SY NIKVTTPDD+LLAERILNT
Sbjct  255  HPVYITEGSYTNIKVTTPDDLLLAERILNT  284



>gb|KDP32436.1| hypothetical protein JCGZ_13361 [Jatropha curcas]
Length=240

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 52/107 (49%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L A D   +++C+       L++  D    E+VLKD W+ GAAVLG 
Sbjct  65   ERQDSVYSG----LQAIDLNSELVCVHDS-ARPLVTSAD---VEKVLKDAWINGAAVLGV  116

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            P K+TIKE                       V+KPELL KGF L+NR
Sbjct  117  PVKATIKEANTDSFVVRTLDRKTLWEMQTPQVMKPELLRKGFELVNR  163



>ref|XP_011087603.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X1 [Sesamum indicum]
Length=313

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILNT  45
            + VYIT  SY NIKVTTPDD+LLAERILNT
Sbjct  282  HPVYITEGSYTNIKVTTPDDLLLAERILNT  311



>ref|XP_011087604.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X2 [Sesamum indicum]
Length=311

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILNT  45
            + VYIT  SY NIKVTTPDD+LLAERILNT
Sbjct  280  HPVYITEGSYTNIKVTTPDDLLLAERILNT  309



>ref|XP_012078830.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Jatropha curcas]
Length=306

 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/107 (36%), Positives = 52/107 (49%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L A D   +++C+       L++  D    E+VLKD W+ GAAVLG 
Sbjct  160  ERQDSVYSG----LQAIDLNSELVCVHDS-ARPLVTSAD---VEKVLKDAWINGAAVLGV  211

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            P K+TIKE                       V+KPELL KGF L+NR
Sbjct  212  PVKATIKEANTDSFVVRTLDRKTLWEMQTPQVMKPELLRKGFELVNR  258



>ref|XP_010425029.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like [Camelina sativa]
Length=315

 Score = 52.0 bits (123),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 52/107 (49%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L   D   +++CI       L++ ED    E+VLKDG  VGAAVLG 
Sbjct  168  ERQDSVYSG----LQEIDVNSELVCIHDS-ARPLVNTED---VEKVLKDGCAVGAAVLGV  219

Query  352  PAKSTIKE-----------------------VIKPELLK-GFALINR  284
            PAK+TIKE                       VIKPELLK GF L+ R
Sbjct  220  PAKATIKEVNSESLVVKTLDRKTLWEMQTPQVIKPELLKRGFELVKR  266



>ref|XP_010514024.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like [Camelina sativa]
Length=309

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 52/107 (49%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L   D   +++CI       L++ ED    E+VLKDG  VGAAVLG 
Sbjct  162  ERQDSVYSG----LQEIDVNSELVCIHDS-ARPLVNTED---VEKVLKDGCAVGAAVLGV  213

Query  352  PAKSTIKE-----------------------VIKPELLK-GFALINR  284
            PAK+TIKE                       VIKPELLK GF L+ R
Sbjct  214  PAKATIKEVNSESLVVKTLDRKTLWEMQTPQVIKPELLKRGFELVKR  260



>ref|XP_002876821.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53080.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=300

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 52/107 (49%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L   D   +++CI       L++ ED    E+VLKDG  VGAAVLG 
Sbjct  154  ERQDSVYSG----LQEVDVNSELVCIHDS-ARPLVNSED---VEKVLKDGSAVGAAVLGV  205

Query  352  PAKSTIKE-----------------------VIKPELLK-GFALINR  284
            PAK+TIKE                       VIKPELLK GF L+ R
Sbjct  206  PAKATIKEVNSESLVVKTLDRKTLWEMQTPQVIKPELLKRGFELVKR  252



>ref|XP_010502265.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Camelina sativa]
Length=315

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 52/107 (49%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L   D   +++CI       L++ ED    E+VLKDG  VGAAVLG 
Sbjct  168  ERQDSVYSG----LQEIDVNSELVCIHDS-ARPLVNTED---VEKVLKDGCAVGAAVLGV  219

Query  352  PAKSTIKE-----------------------VIKPELLK-GFALINR  284
            PAK+TIKE                       VIKPELLK GF L+ R
Sbjct  220  PAKATIKEVNSESLVVKTLDRKTLWEMQTPQVIKPELLKRGFELVKR  266



>gb|EYU33225.1| hypothetical protein MIMGU_mgv1a010477mg [Erythranthe guttata]
Length=311

 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 57/118 (48%), Gaps = 36/118 (31%)
 Frame = -2

Query  553  HVSIAF----YERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKD  386
            HV + F     ER ++   G    L A D   +++CI       +L+ ED    E+VLKD
Sbjct  154  HVDLKFALPGKERQDSVYSG----LEAIDSNSELVCIHDSARPLVLT-ED---VEKVLKD  205

Query  385  GWLVGAAVLGFPAKSTIKE-----------------------VIKPELL-KGFALINR  284
            G  +GAAVLG PAK+TIKE                       VIKPELL KGF  +NR
Sbjct  206  GRRIGAAVLGVPAKATIKEANSESFVVKTLDRKMLWEMQTPQVIKPELLKKGFEYVNR  263


 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+LLAERILN
Sbjct  280  HPVYITQGSYTNIKVTTPDDLLLAERILN  308



>gb|AFM93780.1| plastid 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase 
[Picrorhiza kurrooa]
Length=311

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 40/107 (37%), Positives = 54/107 (50%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L A D   +++C+       +L+ ED     +VLKDGWL+GAAV+G 
Sbjct  165  ERQDSVYSG----LEAIDSNSELVCVHDSARPLVLT-ED---VAKVLKDGWLIGAAVVGV  216

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            PAK+TIKE                       VIKP+LL KGF  +NR
Sbjct  217  PAKATIKEANTESFVVKTLDRKTLWEMQTPQVIKPDLLKKGFEHVNR  263



>gb|KCW57181.1| hypothetical protein EUGRSUZ_I02806 [Eucalyptus grandis]
Length=256

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 50/107 (47%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G     S S+    ++CI       L+S   R   E+VLKDGW  GAAVLG 
Sbjct  157  ERQDSVYSGLQAVDSGSE----LVCIHDS-ARPLVS---RGDIEKVLKDGWENGAAVLGV  208

Query  352  PAKSTIKE-----------------------VIKPELLK-GFALINR  284
            P K+TIKE                       VIKP LLK GF L+NR
Sbjct  209  PVKATIKEANSESFVVRTLDRKTLWEMQTPQVIKPSLLKRGFELVNR  255



>ref|XP_010030242.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Eucalyptus grandis]
 gb|KCW57179.1| hypothetical protein EUGRSUZ_I02806 [Eucalyptus grandis]
Length=308

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 50/107 (47%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G     S S+    ++CI       L+S   R   E+VLKDGW  GAAVLG 
Sbjct  157  ERQDSVYSGLQAVDSGSE----LVCIHDS-ARPLVS---RGDIEKVLKDGWENGAAVLGV  208

Query  352  PAKSTIKE-----------------------VIKPELLK-GFALINR  284
            P K+TIKE                       VIKP LLK GF L+NR
Sbjct  209  PVKATIKEANSESFVVRTLDRKTLWEMQTPQVIKPSLLKRGFELVNR  255


 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VY+T  SY NIKVTTPDD+LLAERILN
Sbjct  272  HPVYVTEGSYTNIKVTTPDDLLLAERILN  300



>gb|AID51430.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Astragalus 
membranaceus]
Length=263

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 53/107 (50%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G     S+S+    ++C+       L+  ED    ++VLKDG L GAAVLG 
Sbjct  112  ERQDSVFNGLQAVDSSSE----LVCVHDS-ARPLVLQED---VKKVLKDGLLNGAAVLGV  163

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            PAK+TIKE                       VIKPELL KGF L+NR
Sbjct  164  PAKATIKEANSESFVVRTLDRKTLWEMQTPQVIKPELLRKGFELVNR  210


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+LLAERILN
Sbjct  227  HPVYITEGSYTNIKVTTPDDLLLAERILN  255



>ref|XP_010088695.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Morus 
notabilis]
 gb|EXB36876.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Morus 
notabilis]
Length=292

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 55/118 (47%), Gaps = 36/118 (31%)
 Frame = -2

Query  553  HVSIAFY----ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKD  386
            HV + F     ER ++   G    L A D   +++CI       + S E      +VL+D
Sbjct  130  HVELKFTLPGKERQDSVFSG----LQAVDLSSELVCIHDSARPLVTSGE----VGKVLQD  181

Query  385  GWLVGAAVLGFPAKSTIKE-----------------------VIKPELL-KGFALINR  284
            GWL GAAVLG PAK+TIKE                       VIKP+LL KGF  +NR
Sbjct  182  GWLHGAAVLGVPAKATIKEANSESFVVRTLDRKTLWEMQTPQVIKPDLLKKGFEFVNR  239



>ref|XP_006395779.1| hypothetical protein EUTSA_v10004647mg [Eutrema salsugineum]
 gb|ESQ33065.1| hypothetical protein EUTSA_v10004647mg [Eutrema salsugineum]
Length=279

 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 52/108 (48%), Gaps = 32/108 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L   D   +++CI       L+  ED    ++VLKDG  VGAAVLG 
Sbjct  164  ERQDSVHSG----LQEIDVNSELVCIHDS-ARPLVDTED---VKKVLKDGLAVGAAVLGV  215

Query  352  PAKSTIKE-----------------------VIKPELLK-GFALINRY  281
            PAK+TIKE                       VIKPELLK GF L+ R+
Sbjct  216  PAKATIKEVNSDSLVVKTLDRKTLWEMQTPQVIKPELLKRGFELVKRF  263



>gb|ACN40114.1| unknown [Picea sitchensis]
Length=319

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY+NIKVTTPDD+LLAERILN
Sbjct  289  HPVYITEGSYSNIKVTTPDDILLAERILN  317



>dbj|BAF98292.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Hevea 
brasiliensis]
Length=311

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+LLAERILN
Sbjct  275  HPVYITEGSYTNIKVTTPDDLLLAERILN  303



>ref|XP_004499358.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like [Cicer arietinum]
Length=303

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+LLAERILN
Sbjct  268  HPVYITEGSYTNIKVTTPDDLLLAERILN  296



>dbj|BAF98291.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Hevea 
brasiliensis]
Length=311

 Score = 50.8 bits (120),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+LLAERILN
Sbjct  275  HPVYITEGSYTNIKVTTPDDLLLAERILN  303



>gb|EPS72731.1| 4-diphosphocytidyl-methylerythritol 2-phosphate synthase, partial 
[Genlisea aurea]
Length=236

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+LLAERILN
Sbjct  204  HPVYITEGSYTNIKVTTPDDLLLAERILN  232


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 38/108 (35%), Positives = 52/108 (48%), Gaps = 34/108 (31%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICI-GAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLG  356
            ER ++   G     S+S+    ++CI  +   L L+         +VL DGW +GAAVLG
Sbjct  89   ERQDSVYNGLKEIASSSE----LVCIHDSARPLVLVQ-----DIAKVLNDGWRIGAAVLG  139

Query  355  FPAKSTIKE-----------------------VIKPELL-KGFALINR  284
             PAK+TIKE                       VIKP+LL +GF L+NR
Sbjct  140  VPAKATIKEADSDSFVVKTLDRKTLWEMQTPQVIKPQLLNEGFELVNR  187



>gb|ABB88837.2| 4-diphosphocytidyl-2-C-methyl-D-erythritol synthase [Stevia rebaudiana]
Length=317

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+LLAERILN
Sbjct  282  HPVYITQGSYTNIKVTTPDDLLLAERILN  310



>dbj|BAJ91237.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=298

 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDDMLLAER++N
Sbjct  268  HPVYITEGSYTNIKVTTPDDMLLAERLMN  296



>emb|CDM85383.1| unnamed protein product [Triticum aestivum]
Length=301

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDDMLLAER++N
Sbjct  271  HPVYITEGSYTNIKVTTPDDMLLAERLMN  299



>gb|AEZ55666.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Salvia 
miltiorrhiza]
Length=304

 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+LLAERILN
Sbjct  273  HPVYITEGSYTNIKVTTPDDLLLAERILN  301



>gb|AFK34060.1| unknown [Lotus japonicus]
Length=314

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 51/107 (48%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L A D   +++CI       +LS       ++VLKDG L GAAVLG 
Sbjct  164  ERQDSVYNG----LQAVDSNSELVCIHDSARPLVLS----GDVKKVLKDGLLNGAAVLGV  215

Query  352  PAKSTIKE-----------------------VIKPELL-KGFALINR  284
            P K+TIKE                       VIKPELL KGF L+NR
Sbjct  216  PVKATIKEANSESFVVRTLDRKTLWEMQTPQVIKPELLRKGFELVNR  262



>gb|KCW57178.1| hypothetical protein EUGRSUZ_I02806 [Eucalyptus grandis]
Length=282

 Score = 50.1 bits (118),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VY+T  SY NIKVTTPDD+LLAERILN
Sbjct  246  HPVYVTEGSYTNIKVTTPDDLLLAERILN  274



>gb|KDO41351.1| hypothetical protein CISIN_1g022657mg [Citrus sinensis]
Length=210

 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+L+AERILN
Sbjct  176  HPVYITEGSYTNIKVTTPDDLLIAERILN  204



>gb|KDO41350.1| hypothetical protein CISIN_1g022657mg [Citrus sinensis]
Length=214

 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+L+AERILN
Sbjct  180  HPVYITEGSYTNIKVTTPDDLLIAERILN  208



>dbj|BAF52631.1| 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol synthase [Oryza 
sativa Japonica Group]
Length=206

 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            ++VYIT  SY NIKVTTPDD+LLAER++N
Sbjct  176  HSVYITEGSYTNIKVTTPDDLLLAERLMN  204



>gb|AEM42975.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase [Siraitia 
grosvenorii]
Length=303

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + V+IT  SY NIKVTTPDD+LLAERILN
Sbjct  272  HPVFITEGSYTNIKVTTPDDLLLAERILN  300



>ref|XP_004133739.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X1 [Cucumis sativus]
 gb|KGN56290.1| hypothetical protein Csa_3G113320 [Cucumis sativus]
Length=304

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + V+IT  SY NIKVTTPDD+LLAERILN
Sbjct  273  HPVFITEGSYTNIKVTTPDDLLLAERILN  301



>ref|XP_006836933.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Amborella trichopoda]
 gb|ERM99786.1| hypothetical protein AMTR_s00099p00152040 [Amborella trichopoda]
Length=325

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+LLAERILN
Sbjct  290  HPVYITVGSYTNIKVTTPDDLLLAERILN  318



>gb|ABU48538.1| 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase [Taxus 
x media]
Length=312

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+L+AERILN
Sbjct  282  HPVYITQGSYTNIKVTTPDDLLVAERILN  310



>gb|AGP04988.1| 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase [Taxus 
wallichiana var. chinensis]
Length=313

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+L+AERILN
Sbjct  283  HPVYITQGSYTNIKVTTPDDLLVAERILN  311



>ref|XP_011650586.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X2 [Cucumis sativus]
Length=254

 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + V+IT  SY NIKVTTPDD+LLAERILN
Sbjct  223  HPVFITEGSYTNIKVTTPDDLLLAERILN  251



>ref|XP_008452187.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X1 [Cucumis melo]
Length=304

 Score = 49.7 bits (117),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + V+IT  SY NIKVTTPDD+LLAERILN
Sbjct  273  HPVFITEGSYTNIKVTTPDDLLLAERILN  301



>ref|XP_009410727.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic [Musa acuminata subsp. malaccensis]
Length=305

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + V+IT  SY NIKVTTPDD+LLAERILN
Sbjct  270  HPVFITEGSYTNIKVTTPDDLLLAERILN  298



>ref|XP_008452188.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic isoform X2 [Cucumis melo]
Length=254

 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + V+IT  SY NIKVTTPDD+LLAERILN
Sbjct  223  HPVFITEGSYTNIKVTTPDDLLLAERILN  251



>ref|XP_006395780.1| hypothetical protein EUTSA_v10004647mg [Eutrema salsugineum]
 gb|ESQ33066.1| hypothetical protein EUTSA_v10004647mg [Eutrema salsugineum]
Length=310

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 51/107 (48%), Gaps = 32/107 (30%)
 Frame = -2

Query  532  ERHETAGGGFSIFLSASDFILKIICIGAFLGLHLLSPEDRSHAERVLKDGWLVGAAVLGF  353
            ER ++   G    L   D   +++CI       L+  ED    ++VLKDG  VGAAVLG 
Sbjct  164  ERQDSVHSG----LQEIDVNSELVCIHDS-ARPLVDTED---VKKVLKDGLAVGAAVLGV  215

Query  352  PAKSTIKE-----------------------VIKPELLK-GFALINR  284
            PAK+TIKE                       VIKPELLK GF L+ R
Sbjct  216  PAKATIKEVNSDSLVVKTLDRKTLWEMQTPQVIKPELLKRGFELVKR  262



>ref|XP_006470808.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic-like [Citrus sinensis]
Length=294

 Score = 49.7 bits (117),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+L+AERILN
Sbjct  260  HPVYITEGSYTNIKVTTPDDLLIAERILN  288



>ref|XP_006431390.1| hypothetical protein CICLE_v10002035mg [Citrus clementina]
 gb|ESR44630.1| hypothetical protein CICLE_v10002035mg [Citrus clementina]
 gb|KDO41348.1| hypothetical protein CISIN_1g022657mg [Citrus sinensis]
Length=294

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + VYIT  SY NIKVTTPDD+L+AERILN
Sbjct  260  HPVYITEGSYTNIKVTTPDDLLIAERILN  288



>sp|Q5N8G1.1|ISPD_ORYSJ RecName: Full=2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, 
chloroplastic; AltName: Full=4-diphosphocytidyl-2C-methyl-D-erythritol 
synthase; Short=OsCMS; AltName: Full=MEP 
cytidylyltransferase; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAD82245.1| putative 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase 
[Oryza sativa Japonica Group]
 dbj|BAD82130.1| putative 2-C-methyl-D-erythritol 4-phosphate cytidyltransferase 
[Oryza sativa Japonica Group]
 gb|EAZ14419.1| hypothetical protein OsJ_04342 [Oryza sativa Japonica Group]
 gb|EEC71920.1| hypothetical protein OsI_04715 [Oryza sativa Indica Group]
Length=297

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            ++VYIT  SY NIKVTTPDD+LLAER++N
Sbjct  267  HSVYITEGSYTNIKVTTPDDLLLAERLMN  295



>ref|XP_002519366.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplast 
precursor, putative [Ricinus communis]
 gb|EEF42983.1| 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplast 
precursor, putative [Ricinus communis]
Length=285

 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = -1

Query  134  YAVYITGSSYANIKVTTPDDMLLAERILN  48
            + V+IT  SY NIKVTTPDD+LLAERILN
Sbjct  254  HPVFITEGSYTNIKVTTPDDLLLAERILN  282



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1169905022664