BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2261

Length=763
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006349549.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    343   1e-113   Solanum tuberosum [potatoes]
emb|CDP10072.1|  unnamed protein product                                343   2e-113   Coffea canephora [robusta coffee]
ref|XP_003535857.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    342   4e-113   Glycine max [soybeans]
ref|XP_003518108.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    341   1e-112   Glycine max [soybeans]
ref|XP_006421451.1|  hypothetical protein CICLE_v10005148mg             337   1e-112   
ref|XP_004513649.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    340   2e-112   Cicer arietinum [garbanzo]
ref|XP_004234840.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    339   6e-112   Solanum lycopersicum
ref|XP_006421453.1|  hypothetical protein CICLE_v10005148mg             339   7e-112   Citrus clementina [clementine]
ref|XP_009618579.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    339   1e-111   Nicotiana tomentosiformis
gb|KEH41602.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase-li...    338   2e-111   Medicago truncatula
ref|XP_007145631.1|  hypothetical protein PHAVU_007G255300g             337   3e-111   Phaseolus vulgaris [French bean]
ref|XP_006493900.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    336   1e-110   Citrus sinensis [apfelsine]
ref|XP_009767064.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    335   2e-110   Nicotiana sylvestris
ref|XP_010088401.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    338   2e-109   
gb|AGB05602.1|  sn-glycerol-3-phosphate acyltransferase                 332   3e-109   Camellia oleifera [abura-tsubaki]
ref|XP_002323308.2|  hypothetical protein POPTR_0016s05340g             333   5e-109   Populus trichocarpa [western balsam poplar]
gb|AGO14580.1|  A-class lysophosphatidate acyltransferase 2 isofo...    332   7e-109   Echium pitardii
gb|ABU50327.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase          331   7e-109   Helianthus annuus
ref|XP_011033303.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    330   1e-108   Populus euphratica
gb|AGO14579.1|  A-class lysophosphatidate acyltransferase 2 isofo...    330   4e-108   Echium pitardii
gb|ABP93351.1|  lysophosphatidyl acyltransferase 2                      328   1e-107   Helianthus annuus
emb|CAA88620.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase (...    327   3e-107   Limnanthes douglasii
ref|XP_011020321.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    325   3e-106   Populus euphratica
ref|XP_009116469.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    325   3e-106   Brassica rapa
ref|XP_006402859.1|  hypothetical protein EUTSA_v10006028mg             325   3e-106   Eutrema salsugineum [saltwater cress]
gb|ADC97478.1|  lysophosphatidic acid acyltransferase                   325   3e-106   Brassica napus [oilseed rape]
ref|XP_010524157.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    324   5e-106   Tarenaya hassleriana [spider flower]
gb|ADC97479.1|  lysophosphatidic acid acyltransferase                   324   5e-106   Brassica napus [oilseed rape]
ref|XP_010257310.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    324   5e-106   Nelumbo nucifera [Indian lotus]
emb|CDY33810.1|  BnaCnng07280D                                          324   5e-106   Brassica napus [oilseed rape]
ref|XP_009104068.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    324   5e-106   Brassica rapa
gb|KFK35010.1|  hypothetical protein AALP_AA5G222500                    324   6e-106   Arabis alpina [alpine rockcress]
ref|XP_004307568.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    323   7e-106   Fragaria vesca subsp. vesca
ref|XP_010554846.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    323   9e-106   Tarenaya hassleriana [spider flower]
ref|XP_002308046.1|  acyl-CoA:1-acylglycerol-3-phosphate acyltran...    323   9e-106   Populus trichocarpa [western balsam poplar]
sp|Q6IWY1.1|LPAT2_BRAOL  RecName: Full=1-acyl-sn-glycerol-3-phosp...    323   1e-105   Brassica oleracea
gb|ABN09946.1|  lysophosphatidyl acyltransferase                        323   1e-105   Crambe hispanica subsp. abyssinica [Abyssinian crambe]
ref|XP_008392182.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    323   2e-105   
gb|AAM61033.1|  1-acylcerol-3-phosphate acyltransferase-like protein    323   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567052.1|  lysophosphatidyl acyltransferase 2                    323   2e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002876428.1|  hypothetical protein ARALYDRAFT_907235             322   3e-105   Arabidopsis lyrata subsp. lyrata
sp|Q9XFW4.1|LPAT2_BRANA  RecName: Full=1-acyl-sn-glycerol-3-phosp...    322   3e-105   Brassica napus [oilseed rape]
gb|ABM92334.2|  1-acylglycerol-3-phosphate acyltransferase              322   3e-105   Brassica juncea [brown mustard]
ref|XP_010504698.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    321   9e-105   Camelina sativa [gold-of-pleasure]
ref|XP_009345032.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    321   1e-104   Pyrus x bretschneideri [bai li]
ref|XP_010516385.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    321   1e-104   Camelina sativa [gold-of-pleasure]
gb|KCW90239.1|  hypothetical protein EUGRSUZ_A02397                     317   2e-104   Eucalyptus grandis [rose gum]
ref|XP_003521190.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    320   2e-104   Glycine max [soybeans]
emb|CDX67700.1|  BnaA07g17400D                                          320   3e-104   
gb|KCW90238.1|  hypothetical protein EUGRSUZ_A02397                     317   9e-104   Eucalyptus grandis [rose gum]
ref|XP_011078878.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    318   1e-103   Sesamum indicum [beniseed]
emb|CAN83214.1|  hypothetical protein VITISV_038716                     318   2e-103   Vitis vinifera
ref|NP_001280186.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    318   2e-103   Prunus mume [ume]
ref|XP_010057561.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    317   2e-103   Eucalyptus grandis [rose gum]
ref|XP_002283340.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    317   4e-103   Vitis vinifera
ref|XP_007202144.1|  hypothetical protein PRUPE_ppa007002mg             316   7e-103   Prunus persica
ref|XP_009334964.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    316   8e-103   Pyrus x bretschneideri [bai li]
ref|XP_007162250.1|  hypothetical protein PHAVU_001G136600g             316   1e-102   Phaseolus vulgaris [French bean]
gb|EYU20729.1|  hypothetical protein MIMGU_mgv1a008164mg                315   1e-102   Erythranthe guttata [common monkey flower]
ref|XP_011075205.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    315   2e-102   Sesamum indicum [beniseed]
ref|XP_003554183.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    313   7e-102   Glycine max [soybeans]
emb|CDX88957.1|  BnaA04g02290D                                          313   8e-102   
ref|XP_004493527.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    313   9e-102   Cicer arietinum [garbanzo]
ref|XP_012073008.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    313   1e-101   
gb|AEZ56251.1|  plastid 1-acylglycerol-phosphate acyltransferase        313   1e-101   Jatropha curcas
ref|NP_001105919.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    312   2e-101   Zea mays [maize]
ref|NP_001148618.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    311   3e-101   Zea mays [maize]
gb|ACN28103.1|  unknown                                                 311   3e-101   Zea mays [maize]
gb|KJB16434.1|  hypothetical protein B456_002G230000                    308   3e-101   Gossypium raimondii
ref|XP_010312077.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    310   4e-101   
gb|KJB16435.1|  hypothetical protein B456_002G230000                    308   4e-101   Gossypium raimondii
ref|XP_002451179.1|  hypothetical protein SORBIDRAFT_05g025420          311   6e-101   Sorghum bicolor [broomcorn]
ref|XP_004979811.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    310   7e-101   Setaria italica
gb|ACV73676.1|  lysophosphatidic acid acyltransferase 2                 310   1e-100   Tropaeolum majus
ref|XP_004249199.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    310   1e-100   Solanum lycopersicum
ref|XP_009387255.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    310   2e-100   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB36056.1|  hypothetical protein B456_006G138600                    307   2e-100   Gossypium raimondii
gb|KJB16432.1|  hypothetical protein B456_002G230000                    308   2e-100   Gossypium raimondii
ref|XP_006351222.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    310   2e-100   Solanum tuberosum [potatoes]
gb|KCW90236.1|  hypothetical protein EUGRSUZ_A02397                     310   3e-100   Eucalyptus grandis [rose gum]
ref|XP_009139024.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    309   4e-100   Brassica rapa
gb|KJB16430.1|  hypothetical protein B456_002G230000                    308   6e-100   Gossypium raimondii
gb|AFK40266.1|  unknown                                                 308   7e-100   Medicago truncatula
ref|XP_003625176.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase     308   7e-100   Medicago truncatula
ref|XP_010265751.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    308   9e-100   Nelumbo nucifera [Indian lotus]
gb|KJB36055.1|  hypothetical protein B456_006G138600                    308   9e-100   Gossypium raimondii
ref|XP_006293344.1|  hypothetical protein CARUB_v100174200mg            306   3e-99    
gb|KJB16433.1|  hypothetical protein B456_002G230000                    306   3e-99    Gossypium raimondii
gb|KHG04120.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase 2        306   4e-99    Gossypium arboreum [tree cotton]
ref|XP_009414749.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    304   3e-98    Musa acuminata subsp. malaccensis [pisang utan]
gb|AHC70248.1|  lysophosphatidic acid acyltransferase                   304   4e-98    Sterculia foetida
ref|XP_008443106.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    303   6e-98    Cucumis melo [Oriental melon]
ref|XP_004136588.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    303   7e-98    Cucumis sativus [cucumbers]
dbj|BAJ84894.1|  predicted protein                                      301   2e-97    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009387254.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    300   1e-96    
gb|EPS68644.1|  lysophosphatidic acid acyltransferase                   299   2e-96    Genlisea aurea
ref|XP_008227141.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    299   2e-96    Prunus mume [ume]
ref|XP_006852430.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    299   2e-96    Amborella trichopoda
ref|XP_004486964.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    297   1e-95    
ref|XP_010672763.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    297   2e-95    Beta vulgaris subsp. vulgaris [field beet]
gb|KFK35863.1|  hypothetical protein AALP_AA4G046700                    296   2e-95    Arabis alpina [alpine rockcress]
ref|XP_004486963.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    297   2e-95    Cicer arietinum [garbanzo]
ref|XP_003547001.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    297   2e-95    Glycine max [soybeans]
ref|XP_007150370.1|  hypothetical protein PHAVU_005G147900g             296   2e-95    Phaseolus vulgaris [French bean]
ref|XP_003575968.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    296   2e-95    Brachypodium distachyon [annual false brome]
gb|KHN33345.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase 3        296   2e-95    Glycine soja [wild soybean]
ref|XP_002298406.2|  acyl-CoA:1-acylglycerol-3-phosphate acyltran...    296   3e-95    Populus trichocarpa [western balsam poplar]
ref|XP_011006209.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    295   4e-95    Populus euphratica
ref|XP_011006208.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    295   7e-95    Populus euphratica
ref|XP_007028850.1|  Lysophosphatidyl acyltransferase 2                 296   9e-95    
ref|XP_003597431.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase     295   1e-94    
ref|XP_011006207.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    295   1e-94    Populus euphratica
ref|NP_175537.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase 3      294   3e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002526730.1|  lysophosphatidic acid acyltransferase, putative    294   3e-94    
ref|XP_002894307.1|  hypothetical protein ARALYDRAFT_474240             293   4e-94    
emb|CDP18472.1|  unnamed protein product                                293   4e-94    Coffea canephora [robusta coffee]
gb|ADE75797.1|  unknown                                                 292   1e-93    Picea sitchensis
ref|XP_010479592.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    292   2e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010461958.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    291   3e-93    Camelina sativa [gold-of-pleasure]
ref|XP_010031802.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    291   3e-93    Eucalyptus grandis [rose gum]
ref|XP_003636648.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase     291   3e-92    
ref|XP_006304715.1|  hypothetical protein CARUB_v10012002mg             288   4e-92    Capsella rubella
ref|XP_009395596.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    288   5e-92    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010237505.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    285   6e-92    Brachypodium distachyon [annual false brome]
ref|XP_002513487.1|  lysophosphatidic acid acyltransferase, putative    288   8e-92    Ricinus communis
ref|XP_010500700.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    287   1e-91    Camelina sativa [gold-of-pleasure]
gb|ABA94922.2|  1-acyl-sn-glycerol-3-phosphate acyltransferase PL...    286   2e-91    Oryza sativa Japonica Group [Japonica rice]
gb|EEC68515.1|  hypothetical protein OsI_36790                          286   2e-91    Oryza sativa Indica Group [Indian rice]
ref|XP_004503603.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    286   2e-91    Cicer arietinum [garbanzo]
ref|XP_002894308.1|  hypothetical protein ARALYDRAFT_892094             290   3e-91    
ref|XP_008813484.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    285   3e-91    Phoenix dactylifera
ref|XP_003577308.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    285   4e-91    Brachypodium distachyon [annual false brome]
gb|EEE52425.1|  hypothetical protein OsJ_34550                          286   5e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008813483.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    284   1e-90    Phoenix dactylifera
ref|XP_006663068.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    284   2e-90    Oryza brachyantha
ref|XP_011080283.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    283   3e-90    Sesamum indicum [beniseed]
ref|XP_008801931.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    282   3e-90    
ref|XP_010673624.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    283   5e-90    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009375057.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    282   1e-89    
ref|XP_008801930.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    281   3e-89    Phoenix dactylifera
ref|XP_006597258.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    283   4e-89    Glycine max [soybeans]
ref|XP_006446109.1|  hypothetical protein CICLE_v10015539mg             280   2e-88    Citrus clementina [clementine]
ref|XP_006470598.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    280   3e-88    Citrus sinensis [apfelsine]
ref|XP_010909860.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    278   4e-88    
ref|XP_010906759.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    276   2e-87    Elaeis guineensis
ref|XP_007214575.1|  hypothetical protein PRUPE_ppa019921mg             276   2e-87    
ref|XP_006361745.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    276   3e-87    Solanum tuberosum [potatoes]
ref|XP_006393066.1|  hypothetical protein EUTSA_v10011593mg             275   4e-87    
ref|XP_010545584.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    275   1e-86    
ref|XP_007015031.1|  Lysophosphatidyl acyltransferase 3                 274   1e-86    
gb|EYU46266.1|  hypothetical protein MIMGU_mgv1a026523mg                272   5e-86    Erythranthe guttata [common monkey flower]
ref|XP_004139036.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    273   5e-86    Cucumis sativus [cucumbers]
ref|XP_004250948.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    271   2e-85    
ref|XP_008377433.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    271   3e-85    Malus domestica [apple tree]
ref|XP_002443267.1|  hypothetical protein SORBIDRAFT_08g016610          270   3e-85    Sorghum bicolor [broomcorn]
ref|XP_008450418.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    270   8e-85    Cucumis melo [Oriental melon]
emb|CDY03631.1|  BnaC03g68900D                                          268   4e-84    
ref|XP_010102333.1|  Xanthine dehydrogenase                             285   5e-84    
ref|XP_009144912.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    267   5e-84    Brassica rapa
emb|CDY35563.1|  BnaC05g27180D                                          266   1e-83    Brassica napus [oilseed rape]
ref|XP_009615949.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    266   2e-83    Nicotiana tomentosiformis
emb|CDY65469.1|  BnaA08g29540D                                          265   4e-83    Brassica napus [oilseed rape]
ref|XP_009773917.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    264   1e-82    Nicotiana sylvestris
ref|XP_006470599.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    264   2e-82    Citrus sinensis [apfelsine]
ref|XP_002268451.2|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    262   6e-82    Vitis vinifera
emb|CBI21663.3|  unnamed protein product                                261   2e-81    Vitis vinifera
ref|XP_006421452.1|  hypothetical protein CICLE_v10005148mg             256   4e-80    
emb|CDY52093.1|  BnaC04g55420D                                          258   6e-79    Brassica napus [oilseed rape]
ref|XP_010673625.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    251   5e-78    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002969275.1|  hypothetical protein SELMODRAFT_146320             251   9e-78    
ref|XP_002986838.1|  hypothetical protein SELMODRAFT_124776             251   2e-77    Selaginella moellendorffii
gb|KDO57199.1|  hypothetical protein CISIN_1g0379582mg                  241   1e-76    Citrus sinensis [apfelsine]
ref|XP_007212911.1|  hypothetical protein PRUPE_ppa022232mg             247   6e-76    Prunus persica
ref|XP_006493899.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    246   2e-75    
ref|XP_001764965.1|  predicted protein                                  243   1e-74    
ref|XP_004486965.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    242   3e-74    
ref|XP_002513486.1|  1-acylglycerol-3-phosphate acyltransferase, ...    238   1e-72    Ricinus communis
gb|EMT23643.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1     239   2e-72    
ref|XP_012090707.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    237   3e-72    Jatropha curcas
ref|XP_007015028.1|  Lysophosphatidyl acyltransferase 2, putative...    236   8e-72    
gb|AAF20003.1|AF213937_1  1-acyl-sn-glycerol-3-phosphate acyltran...    232   5e-71    Prunus dulcis [sweet almond]
ref|XP_008227143.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    233   2e-70    Prunus mume [ume]
gb|EMS63864.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1     231   3e-70    Triticum urartu
gb|ACU18782.1|  unknown                                                 228   1e-69    Glycine max [soybeans]
gb|KJB16431.1|  hypothetical protein B456_002G230000                    226   4e-69    Gossypium raimondii
tpg|DAA42326.1|  TPA: hypothetical protein ZEAMMB73_334173              223   9e-68    
gb|AFW60270.1|  hypothetical protein ZEAMMB73_783506                    223   1e-67    
ref|XP_010672762.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    228   1e-67    Beta vulgaris subsp. vulgaris [field beet]
gb|KCW51192.1|  hypothetical protein EUGRSUZ_J00779                     222   4e-67    Eucalyptus grandis [rose gum]
gb|EYU39879.1|  hypothetical protein MIMGU_mgv1a010933mg                218   1e-65    Erythranthe guttata [common monkey flower]
ref|XP_007015027.1|  Lysophosphatidyl acyltransferase 2, putative...    219   1e-65    
ref|XP_011025521.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    216   3e-64    Populus euphratica
ref|XP_008363635.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    216   3e-64    
ref|XP_011025520.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    216   3e-64    Populus euphratica
gb|KDO61278.1|  hypothetical protein CISIN_1g016254mg                   211   4e-63    Citrus sinensis [apfelsine]
ref|XP_006446108.1|  hypothetical protein CICLE_v10015539mg             211   4e-63    
ref|XP_002314068.2|  hypothetical protein POPTR_0009s05930g             214   6e-63    
gb|AAP80656.1|AF479037_1  1-acy1-glycerol-3-phosphate acyltransfe...    203   9e-61    Triticum aestivum [Canadian hard winter wheat]
gb|KHG13155.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase 2 ...    204   3e-60    Gossypium arboreum [tree cotton]
ref|XP_001754626.1|  predicted protein                                  207   3e-59    
ref|XP_008363711.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    178   7e-52    
ref|XP_007015029.1|  Lysophosphatidyl acyltransferase 2, putative...    180   8e-51    
emb|CAA90019.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase         176   2e-49    Brassica napus [oilseed rape]
ref|XP_002590323.1|  hypothetical protein BRAFLDRAFT_121375             177   3e-49    Branchiostoma floridae
gb|KDR11829.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    178   3e-49    Zootermopsis nevadensis
emb|CAB41190.1|  1-acylcerol-3-phosphate acyltransferase-like pro...    176   3e-49    Arabidopsis thaliana [mouse-ear cress]
gb|KDP22082.1|  hypothetical protein JCGZ_25913                         178   3e-49    Jatropha curcas
ref|XP_001621942.1|  predicted protein                                  177   4e-49    Nematostella vectensis
ref|XP_011707986.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    174   8e-49    Wasmannia auropunctata
ref|XP_012145124.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    173   1e-48    Megachile rotundata
ref|XP_001607215.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    175   3e-48    
ref|XP_003419084.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    174   4e-48    Loxodonta africana [African bush elephant]
gb|EFN64501.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    174   5e-48    Camponotus floridanus
ref|XP_011261943.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    174   6e-48    Camponotus floridanus
ref|XP_010127144.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    170   8e-48    Chlamydotis macqueenii
ref|XP_010366228.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    172   1e-47    Rhinopithecus roxellana
ref|XP_008939552.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    170   1e-47    Merops nubicus
ref|XP_003434035.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    173   1e-47    
ref|XP_011634482.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    173   2e-47    Pogonomyrmex barbatus
ref|XP_010206239.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    170   2e-47    Colius striatus
gb|KFP28149.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    170   2e-47    Colius striatus
ref|XP_011875160.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    173   2e-47    Vollenhovia emeryi
ref|XP_003705225.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    173   2e-47    Megachile rotundata
gb|EZA54711.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    172   2e-47    Ooceraea biroi
ref|XP_009071880.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   3e-47    Acanthisitta chloris
ref|XP_011143319.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    172   3e-47    Harpegnathos saltator
ref|XP_004602547.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    172   3e-47    Sorex araneus [Eurasian shrew]
ref|XP_008498571.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    172   4e-47    Calypte anna
ref|XP_004364540.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase     172   4e-47    Capsaspora owczarzaki ATCC 30864
ref|XP_007967793.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    172   4e-47    Chlorocebus sabaeus
ref|XP_011857918.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    171   4e-47    Mandrillus leucophaeus
ref|XP_011161524.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    172   5e-47    Solenopsis invicta [imported red fire ant]
ref|XP_011809517.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    171   5e-47    Colobus angolensis palliatus
ref|XP_008631063.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    171   6e-47    
ref|XP_002189743.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    171   6e-47    Taeniopygia guttata
ref|NP_001068336.2|  Os11g0637800                                       163   7e-47    
ref|XP_008545546.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    171   8e-47    Microplitis demolitor
ref|XP_005548628.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    171   8e-47    
ref|XP_004429705.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    171   8e-47    
ref|XP_008985009.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    171   8e-47    
ref|XP_003277406.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    171   9e-47    
ref|XP_009996223.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    171   9e-47    Chaetura pelagica
ref|XP_003823897.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    171   9e-47    Pan paniscus [bonobo]
ref|XP_010366226.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    171   1e-46    Rhinopithecus roxellana
ref|NP_064517.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase ...    171   1e-46    Homo sapiens [man]
ref|XP_005501703.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    171   1e-46    
ref|XP_003798130.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    171   1e-46    Otolemur garnettii
ref|XP_011338106.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    173   1e-46    Ooceraea biroi
ref|NP_001127407.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    171   1e-46    Pongo abelii [orang utan]
ref|XP_001146797.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    171   1e-46    Pan troglodytes
gb|AAQ89067.1|  AGPAT3                                                  170   1e-46    Homo sapiens [man]
ref|XP_006894008.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    170   1e-46    Elephantulus edwardii [Cape long-eared elephant shrew]
gb|ELV10335.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    168   1e-46    Tupaia chinensis
ref|XP_005037288.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    170   1e-46    
ref|XP_006746103.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   1e-46    Leptonychotes weddellii
ref|XP_004996737.1|  hypothetical protein PTSG_02252                    170   2e-46    Salpingoeca rosetta
ref|XP_005037280.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    170   2e-46    Ficedula albicollis
ref|XP_005427279.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    170   2e-46    Geospiza fortis
ref|XP_416756.2|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate acylt...    170   2e-46    Gallus gallus [bantam]
emb|CAX11992.1|  1-acylglycerol-3-phosphate O-acyltransferase 3         166   2e-46    Danio rerio [leopard danio]
ref|XP_009087839.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    170   2e-46    Serinus canaria [canary]
ref|XP_005489059.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    170   2e-46    Zonotrichia albicollis
dbj|BAG62268.1|  unnamed protein product                                169   2e-46    Homo sapiens [man]
ref|NP_001137172.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    170   2e-46    Sus scrofa [pigs]
ref|XP_010722493.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   2e-46    Meleagris gallopavo [common turkey]
ref|XP_006262808.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   3e-46    
ref|XP_007426401.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   3e-46    Python bivittatus
ref|XP_009639322.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   3e-46    Egretta garzetta
ref|XP_011498819.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    170   3e-46    Ceratosolen solmsi marchali
ref|XP_006608633.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   3e-46    Apis dorsata [rock honeybee]
ref|XP_009489719.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   3e-46    Pelecanus crispus
ref|XP_010159792.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   3e-46    Eurypyga helias
ref|XP_006060833.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   3e-46    
ref|XP_009472604.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   3e-46    Nipponia nippon
gb|KFV99739.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    169   3e-46    Eurypyga helias
ref|XP_010833202.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   3e-46    Bison bison bison
ref|XP_010011299.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   3e-46    Nestor notabilis
ref|XP_005907644.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   4e-46    Bos mutus
ref|XP_008931200.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   4e-46    
ref|XP_009677833.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   4e-46    
ref|XP_005151770.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   4e-46    
ref|XP_009985430.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   4e-46    
gb|EFX76870.1|  hypothetical protein DAPPUDRAFT_198783                  169   4e-46    
ref|XP_005012527.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   4e-46    
ref|XP_001491027.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   4e-46    
ref|XP_005234551.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   4e-46    
ref|XP_009904113.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   4e-46    
ref|XP_010217044.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   4e-46    
ref|XP_009877719.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   4e-46    
ref|XP_010073966.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   5e-46    
ref|XP_012062348.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   5e-46    
ref|XP_005312682.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   5e-46    
ref|XP_005675712.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   5e-46    
ref|XP_004003424.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   5e-46    
ref|XP_011311483.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   5e-46    
ref|XP_003991408.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   6e-46    
ref|XP_005956861.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   6e-46    
ref|XP_004384856.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   6e-46    
ref|XP_011527964.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    170   6e-46    
ref|XP_010634754.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    168   7e-46    
ref|XP_003962129.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    168   7e-46    
ref|NP_001279132.1|  1-acylglycerol-3-phosphate O-acyltransferase 3     168   8e-46    
gb|AFM88716.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase ga...    168   9e-46    
ref|XP_010964818.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    168   9e-46    
ref|XP_003689806.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   9e-46    
ref|XP_006922611.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    168   9e-46    
ref|XP_004762311.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    168   1e-45    
ref|XP_011055419.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    168   1e-45    
ref|XP_007452559.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    168   1e-45    
ref|XP_004264654.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    168   1e-45    
ref|XP_006608632.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    169   1e-45    
gb|KFZ60093.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    168   1e-45    
ref|XP_006169505.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    168   1e-45    
ref|XP_007945444.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    168   1e-45    
ref|XP_010634747.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    168   1e-45    
ref|XP_006876849.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    167   1e-45    
ref|NP_001033135.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    167   1e-45    
ref|XP_001849976.1|  1-acylglycerol-3-phosphate acyltransferase         167   2e-45    
ref|XP_008708403.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    167   2e-45    
gb|EHB08231.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    166   2e-45    
ref|XP_008055094.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    167   2e-45    
ref|XP_006639021.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    167   2e-45    
ref|XP_004410719.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    167   2e-45    
ref|XP_010163464.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    167   2e-45    
ref|XP_005375932.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    167   2e-45    
gb|ETE66236.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    166   3e-45    
ref|XP_002925922.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    167   3e-45    
ref|XP_009930927.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    167   3e-45    
ref|XP_006038517.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    166   3e-45    
ref|XP_004696957.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    166   4e-45    
ref|XP_008275417.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    166   4e-45    
ref|XP_008105662.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    166   5e-45    
ref|XP_004480140.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    167   6e-45    
ref|XP_005745742.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    166   6e-45    
ref|XP_005323500.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    166   6e-45    
ref|XP_005919380.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    166   7e-45    
ref|XP_004892857.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    166   7e-45    
ref|XP_006799219.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    165   7e-45    
ref|XP_007064498.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    166   7e-45    
ref|XP_004575514.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    166   8e-45    
ref|XP_005070749.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    166   8e-45    
ref|XP_004842553.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    166   8e-45    
ref|XP_004654569.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    166   9e-45    
ref|XP_011199230.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    166   9e-45    
ref|NP_998590.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase ...    165   1e-44    
ref|XP_004931957.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    165   1e-44    
ref|XP_006137946.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    165   1e-44    
ref|XP_004631856.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    165   1e-44    
ref|XP_003463996.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    165   2e-44    
gb|AAI58874.1|  Agpat3 protein                                          164   2e-44    
ref|XP_008327138.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    165   2e-44    
ref|NP_001099848.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    165   2e-44    
gb|EFX76865.1|  hypothetical protein DAPPUDRAFT_188541                  165   2e-44    
ref|XP_005360340.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    164   2e-44    
ref|XP_007493273.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    164   2e-44    
ref|XP_004931956.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    165   2e-44    
ref|XP_008565934.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    165   2e-44    
ref|XP_003763398.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    164   2e-44    
ref|XP_006989510.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    164   2e-44    
gb|ADO27983.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    164   2e-44    
ref|XP_010739293.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    164   3e-44    
ref|XP_006099969.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    164   3e-44    
ref|XP_007251394.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    164   3e-44    
gb|ENN81517.1|  hypothetical protein YQE_02046                          164   4e-44    
ref|XP_006759048.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    164   4e-44    
ref|XP_004842550.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    165   4e-44    
ref|XP_001654527.1|  AAEL010399-PA                                      162   4e-44    
gb|KFW74159.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    164   5e-44    
ref|XP_001745510.1|  hypothetical protein                               163   5e-44    
ref|XP_008143886.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    164   5e-44    
gb|EHH16930.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    163   6e-44    
ref|XP_008401471.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    163   7e-44    
ref|NP_001187438.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    163   8e-44    
ref|XP_003927614.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    163   8e-44    
ref|XP_009305745.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    159   8e-44    
ref|XP_007557237.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    163   8e-44    
ref|XP_003445368.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    163   8e-44    
ref|XP_007172727.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    163   9e-44    
gb|AGG54998.1|  acyltransferase AGPAT6                                  163   9e-44    
emb|CDQ68415.1|  unnamed protein product                                162   1e-43    
emb|CDQ81241.1|  unnamed protein product                                162   1e-43    
ref|XP_970017.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate acylt...    163   1e-43    
gb|ACY30369.1|  1-acylglycerol-3-phosphate O-acyltransferase 3          162   1e-43    
ref|XP_007231300.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    162   1e-43    
ref|XP_005807727.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    162   1e-43    
ref|XP_005880486.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    162   1e-43    
ref|XP_007665415.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    162   1e-43    
ref|XP_008825609.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    162   1e-43    
ref|XP_007128496.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    163   2e-43    
ref|XP_007231299.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    162   2e-43    
gb|EDL31741.1|  1-acylglycerol-3-phosphate O-acyltransferase 3, i...    162   2e-43    
ref|XP_001944534.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    162   2e-43    
ref|XP_010884320.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    162   2e-43    
ref|NP_443747.2|  1-acyl-sn-glycerol-3-phosphate acyltransferase ...    162   2e-43    
ref|XP_011471961.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    162   2e-43    
gb|AGG55014.1|  acyltransferase AGPAT6                                  162   3e-43    
dbj|BAE34826.1|  unnamed protein product                                161   3e-43    
gb|ELK03565.1|  Trafficking protein particle complex subunit 10         168   3e-43    
ref|XP_010781417.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    161   3e-43    
ref|XP_007639541.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    161   3e-43    
ref|NP_001011265.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    160   5e-43    
gb|AIN34698.1|  fatty alcohol acetyltransferase                         160   6e-43    
ref|XP_010082881.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    156   7e-43    
ref|XP_001664249.1|  AAEL014026-PA                                      160   8e-43    
ref|XP_003625177.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase     157   9e-43    
ref|XP_011196059.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    160   9e-43    
ref|XP_008320056.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    160   1e-42    
gb|ETN67995.1|  1-acylglycerol-3-phosphate acyltransferase              160   1e-42    
ref|XP_308646.4|  AGAP007113-PA                                         160   1e-42    
gb|KFQ87757.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    155   1e-42    
gb|AAH52382.1|  1-acylglycerol-3-phosphate O-acyltransferase 3          159   1e-42    
ref|XP_006109547.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    155   1e-42    
gb|EFX74227.1|  hypothetical protein DAPPUDRAFT_200081                  160   2e-42    
ref|XP_007538264.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    159   2e-42    
ref|XP_010866423.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    159   2e-42    
ref|NP_998157.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase ...    159   2e-42    
ref|XP_006638831.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    159   2e-42    
ref|NP_001134736.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    155   3e-42    
ref|XP_003488699.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    159   4e-42    
ref|XP_006010829.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    158   5e-42    
ref|XP_006088912.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    158   5e-42    
ref|XP_001957018.1|  GF10214                                            158   5e-42    
ref|XP_011196051.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    158   9e-42    
ref|XP_001371532.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    157   9e-42    
gb|KFP76689.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    153   1e-41    
ref|XP_010155362.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    153   1e-41    
gb|KFB43263.1|  AGAP007113-PA-like protein                              158   1e-41    
ref|XP_006275864.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    157   1e-41    
ref|XP_009868947.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    153   1e-41    
ref|XP_009057171.1|  hypothetical protein LOTGIDRAFT_121393             157   1e-41    
ref|XP_004935617.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    157   2e-41    
ref|NP_001008119.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    157   2e-41    
ref|XP_006021965.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    157   2e-41    
ref|XP_419616.2|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate acylt...    157   2e-41    
ref|XP_003964149.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    156   2e-41    
ref|XP_010138461.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    156   2e-41    
gb|KFO53964.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    156   2e-41    
gb|ACN11432.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase gamma    156   2e-41    
ref|NP_001080456.1|  1-acylglycerol-3-phosphate O-acyltransferase 3     156   2e-41    
ref|XP_003395337.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    156   3e-41    
ref|XP_003441050.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    156   3e-41    
ref|XP_003769643.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    156   3e-41    
ref|XP_004651151.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    156   3e-41    
ref|NP_001085041.1|  1-acylglycerol-3-phosphate O-acyltransferase 4     156   3e-41    
ref|NP_001087659.1|  1-acylglycerol-3-phosphate O-acyltransferase 3     156   3e-41    
ref|XP_008641548.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    156   3e-41    
ref|XP_005973237.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    154   4e-41    
ref|XP_010389961.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    156   4e-41    
ref|XP_005443156.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    155   4e-41    
ref|XP_004525518.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    156   4e-41    
ref|XP_005474100.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    155   4e-41    
ref|XP_005181709.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    156   4e-41    
ref|XP_009893833.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    155   4e-41    
ref|XP_003204124.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    155   4e-41    
ref|XP_009083431.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    155   5e-41    
ref|XP_007546255.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    155   5e-41    
ref|XP_009980716.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    155   5e-41    
gb|KFP74586.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    155   5e-41    
ref|XP_006800842.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    155   6e-41    
ref|XP_011590229.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    155   6e-41    
ref|XP_009686661.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    155   6e-41    
ref|XP_002030766.1|  GM24405                                            155   7e-41    
ref|XP_008428104.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    155   7e-41    
gb|KFV14158.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    155   7e-41    
ref|XP_008923849.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    154   7e-41    
gb|KFQ91658.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    155   8e-41    
ref|XP_002024910.1|  GL17998                                            155   8e-41    
gb|KFW82364.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    155   8e-41    
ref|XP_009469458.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    155   8e-41    
ref|XP_001352573.2|  GA18389                                            155   8e-41    
gb|KFV88186.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    155   8e-41    
ref|XP_005230336.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    155   9e-41    
gb|KFZ68512.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    155   9e-41    
gb|EOB03997.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase delta    155   1e-40    
ref|XP_005015963.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    155   1e-40    
ref|XP_010218895.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    155   1e-40    
ref|XP_004525520.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    155   1e-40    
ref|XP_005305778.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    154   1e-40    
ref|XP_008572824.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    154   1e-40    
ref|XP_008162212.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    154   1e-40    
ref|XP_005836674.1|  hypothetical protein GUITHDRAFT_67735              151   1e-40    
ref|XP_005807690.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    154   1e-40    
ref|XP_005526983.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    154   1e-40    
ref|XP_006882885.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    154   1e-40    
ref|NP_001133610.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    154   1e-40    
ref|XP_009806874.1|  PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-gl...    154   1e-40    
ref|NP_080920.2|  1-acyl-sn-glycerol-3-phosphate acyltransferase ...    154   1e-40    
ref|XP_011199228.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    154   1e-40    
gb|EDL02075.1|  1-acylglycerol-3-phosphate O-acyltransferase 1 (l...    154   1e-40    
gb|AAX08708.1|  1-acylglycerol-3-phosphate O-acyltransferase 4 (l...    154   2e-40    
ref|NP_001015537.1|  1-acyl-sn-glycerol-3-phosphate acyltransfera...    154   2e-40    
sp|Q5E9R2.1|PLCD_BOVIN  RecName: Full=1-acyl-sn-glycerol-3-phosph...    154   2e-40    
emb|CDQ89987.1|  unnamed protein product                                154   2e-40    
ref|XP_011482879.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    154   2e-40    
ref|NP_648888.1|  CG4729, isoform A                                     154   2e-40    
ref|XP_002085135.1|  GD12474                                            154   2e-40    
ref|NP_596897.1|  1-acyl-sn-glycerol-3-phosphate acyltransferase ...    154   2e-40    
ref|XP_005737162.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    153   2e-40    
gb|EHJ69411.1|  hypothetical protein KGM_16372                          154   2e-40    
ref|XP_004702147.1|  PREDICTED: 1-acyl-sn-glycerol-3-phosphate ac...    154   2e-40    



>ref|XP_006349549.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Solanum tuberosum]
Length=388

 Score =   343 bits (881),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N IQA CYV++RP SKSTYRRINR+ AELLWLELVW++DWWAGVK+++Y D
Sbjct  15   LFFISGLVINLIQATCYVLVRPISKSTYRRINRIVAELLWLELVWIVDWWAGVKIKVYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            PETF LMGKEHAL+I+NHRSDIDW+VGW+LAQRSGCLGS+LAVMKKSS  LPVIGWSM+F
Sbjct  75   PETFNLMGKEHALVIANHRSDIDWLVGWILAQRSGCLGSSLAVMKKSSKLLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE TLKSGL+RL DYPLPFWLALFVEGTRFTQAKLLAAQEYAAS GLP
Sbjct  135  SEYLFLERSWAKDERTLKSGLQRLSDYPLPFWLALFVEGTRFTQAKLLAAQEYAASAGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>emb|CDP10072.1| unnamed protein product [Coffea canephora]
Length=386

 Score =   343 bits (880),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF+SGL  N  QAI +V+IRP SKSTYRRINR+ AELLWLELVW++DWWAGVK+QLYTD
Sbjct  15   LFFLSGLVINLFQAIFFVLIRPLSKSTYRRINRVLAELLWLELVWIVDWWAGVKIQLYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETFKLMGKEHAL+ISNH+SDIDW+VGWVLAQRSGCLGSTLAVMKKSS  LPVIGWSM+F
Sbjct  75   SETFKLMGKEHALVISNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDESTLKSGL+RL+DYPLPFWLALFVEGTRFTQAKLLAAQEYAAS+GLP
Sbjct  135  SEYLFLERSWAKDESTLKSGLERLRDYPLPFWLALFVEGTRFTQAKLLAAQEYAASSGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_003535857.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Glycine max]
 gb|KHN22374.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Glycine soja]
Length=383

 Score =   342 bits (878),  Expect = 4e-113, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF SGL  N IQAICYVV+RP SK+ YRR+NR+ AELLWLELVW+IDWWAGVKVQ++TD
Sbjct  12   LFFASGLIVNLIQAICYVVVRPVSKNLYRRMNRVVAELLWLELVWIIDWWAGVKVQVFTD  71

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            PETF+ MGKEHAL+ISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  72   PETFRSMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  131

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE TLKSGL++L+D+PLPFWLALFVEGTRFTQAKLLAAQEYAAS GLP
Sbjct  132  SEYLFLERSWAKDERTLKSGLQQLRDFPLPFWLALFVEGTRFTQAKLLAAQEYAASAGLP  191

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  192  VPRNVLIP  199



>ref|XP_003518108.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Glycine max]
 gb|KHN05957.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Glycine soja]
Length=384

 Score =   341 bits (875),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF SGL  N IQAICYVV+RP SK+ YRR+NR+ AELLWLELVW+IDWWAGVKVQ++TD
Sbjct  12   LFFASGLIVNLIQAICYVVVRPVSKNLYRRMNRVVAELLWLELVWIIDWWAGVKVQVFTD  71

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            PETF  MGKEHAL+ISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  72   PETFHSMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  131

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE TLKSGL++L+D+PLPFWLALFVEGTRFTQAKLLAAQEYAAS GLP
Sbjct  132  SEYLFLERSWAKDERTLKSGLQQLRDFPLPFWLALFVEGTRFTQAKLLAAQEYAASAGLP  191

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  192  VPRNVLIP  199



>ref|XP_006421451.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
 gb|ESR34691.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
Length=282

 Score =   337 bits (865),  Expect = 1e-112, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N IQA+C+V IRP SK+TYRRINR  AELLWLELVW++DWWAGVK++L+ D
Sbjct  15   LFFISGLVVNLIQAVCFVTIRPLSKNTYRRINRWVAELLWLELVWIVDWWAGVKIKLFVD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET++LMGKEHAL++SNH+SDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   RETYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDESTLKSGL+RL+DYP PFWLALFVEGTRFTQAKLLAAQEYAASTGLP
Sbjct  135  SEYLFLERNWAKDESTLKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  194

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  195  IPRNVLIP  202



>ref|XP_004513649.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cicer arietinum]
Length=386

 Score =   340 bits (873),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF SGL  N IQAICYV++RP SK+ +RRINRL AELLWLELVW+IDWWAGV++Q++TD
Sbjct  15   LFFASGLIVNLIQAICYVIVRPVSKNLHRRINRLVAELLWLELVWIIDWWAGVQIQVFTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            PETF+LMGKEHAL+ISNH+SDIDW+VGW+LA+RSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   PETFRLMGKEHALVISNHKSDIDWLVGWILAERSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDESTLKSGL++L+D+PLPFWLALFVEGTRFTQAKLLAAQEYA STGLP
Sbjct  135  SEYLFLERNWAKDESTLKSGLQQLRDFPLPFWLALFVEGTRFTQAKLLAAQEYATSTGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_004234840.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Solanum 
lycopersicum]
 ref|XP_010317926.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Solanum 
lycopersicum]
 ref|XP_010317927.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Solanum 
lycopersicum]
Length=375

 Score =   339 bits (869),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N IQA C+V++RP SKSTYRRINR+ AELLWLELVW++DWWAGVK+++Y D
Sbjct  15   LFFISGLVINLIQATCFVLVRPISKSTYRRINRIVAELLWLELVWIVDWWAGVKIKVYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            PETF LMGKEHAL+I+NHRSDIDW+VGW+LAQRSGCLGS+LAVMKKSS  LPVIGWSM+F
Sbjct  75   PETFNLMGKEHALVIANHRSDIDWLVGWILAQRSGCLGSSLAVMKKSSKLLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE TLKSGL+RL DYPLPFWLALFVEGTRFTQAKLLAAQEYAAS  LP
Sbjct  135  SEYLFLERSWAKDERTLKSGLQRLSDYPLPFWLALFVEGTRFTQAKLLAAQEYAASAELP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_006421453.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
 gb|ESR34693.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
Length=387

 Score =   339 bits (869),  Expect = 7e-112, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N IQA+C+V IRP SK+TYRRINR  AELLWLELVW++DWWAGVK++L+ D
Sbjct  15   LFFISGLVVNLIQAVCFVTIRPLSKNTYRRINRWVAELLWLELVWIVDWWAGVKIKLFVD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET++LMGKEHAL++SNH+SDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   RETYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDESTLKSGL+RL+DYP PFWLALFVEGTRFTQAKLLAAQEYAASTGLP
Sbjct  135  SEYLFLERNWAKDESTLKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  194

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  195  IPRNVLIP  202



>ref|XP_009618579.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Nicotiana 
tomentosiformis]
Length=387

 Score =   339 bits (869),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N IQA C+V+IRP SKSTYRR+NR+FAELLWLELVW++DWWAGVK+++Y D
Sbjct  15   LFFISGLVINLIQATCFVLIRPISKSTYRRLNRIFAELLWLELVWIVDWWAGVKIKVYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            P+ F LMGKEHAL+I+NHRSDIDW+VGW+LAQRSGCLGS+LAVMKKSS  LPVIGWSM+F
Sbjct  75   PKEFNLMGKEHALVIANHRSDIDWLVGWILAQRSGCLGSSLAVMKKSSKLLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE TLKSGL+RL DYPLPFWLALFVEGTRFTQAKLLAAQEYA S GLP
Sbjct  135  SEYLFLERSWAKDERTLKSGLQRLSDYPLPFWLALFVEGTRFTQAKLLAAQEYATSAGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>gb|KEH41602.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase-like protein [Medicago 
truncatula]
Length=386

 Score =   338 bits (867),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF SGL  N IQA C+V++RPFSK+ YRRINR+ AELLWLELVW+ DWWAGVK+QL+TD
Sbjct  15   LFFASGLIVNIIQATCFVILRPFSKNLYRRINRMVAELLWLELVWIFDWWAGVKIQLFTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            PETF+ MG EHAL+ISNHRSDIDW+VGW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   PETFRFMGTEHALVISNHRSDIDWLVGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDE TLKSGL++L+D+PLPFWLALFVEGTRFTQAKLLAAQEYA STGLP
Sbjct  135  SEYLFLERNWAKDERTLKSGLQQLRDFPLPFWLALFVEGTRFTQAKLLAAQEYATSTGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_007145631.1| hypothetical protein PHAVU_007G255300g [Phaseolus vulgaris]
 gb|ESW17625.1| hypothetical protein PHAVU_007G255300g [Phaseolus vulgaris]
Length=383

 Score =   337 bits (865),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF SGL  N IQA+CYV +RP SK+ YRR+NR+ AELLWLELVW+IDWWAGVKVQ++TD
Sbjct  12   LFFSSGLIVNLIQALCYVFVRPVSKNLYRRMNRVVAELLWLELVWIIDWWAGVKVQVFTD  71

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+ MGKEHAL+ISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  72   SETFRSMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  131

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDESTLKSGL++L+D+PLPFWLALFVEGTRFTQAKLLAAQEYAAS GLP
Sbjct  132  SEYLFLERSWAKDESTLKSGLQQLRDFPLPFWLALFVEGTRFTQAKLLAAQEYAASAGLP  191

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  192  VPRNVLIP  199



>ref|XP_006493900.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X2 [Citrus sinensis]
Length=386

 Score =   336 bits (861),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N IQA+C+V IRP SK+TYRRINR  AELLWLELVW++DWWAGVK++L+ D
Sbjct  15   LFFISGLVVNLIQAVCFVTIRPLSKNTYRRINRWVAELLWLELVWIVDWWAGVKIKLFVD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET++LMGKEHAL++SNH+SDIDW+VGWVL+QRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   RETYRLMGKEHALVVSNHKSDIDWLVGWVLSQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+W KDESTLKSGL+RL+DYP PFWLALFVEGTRFTQAKLLAAQEYAASTGLP
Sbjct  135  SEYLFLERNWVKDESTLKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  194

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  195  IPRNVLIP  202



>ref|XP_009767064.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Nicotiana sylvestris]
Length=387

 Score =   335 bits (860),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N IQA C+V++RP SKSTYRR+NR+ AELLWLELVW++DWWAGVK+++Y D
Sbjct  15   LFFISGLVINLIQATCFVLVRPISKSTYRRLNRIVAELLWLELVWIVDWWAGVKIKVYMD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            P+ F LMGKEHAL+I+NHRSDIDW+VGW+LAQRSGCLGS+LAVMKKSS  LPVIGWSM+F
Sbjct  75   PKEFNLMGKEHALVIANHRSDIDWLVGWILAQRSGCLGSSLAVMKKSSKLLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE TLKSGL+RL DYPLPFWLALFVEGTRFTQAKLLAAQEYA S GLP
Sbjct  135  SEYLFLERSWAKDERTLKSGLQRLSDYPLPFWLALFVEGTRFTQAKLLAAQEYATSAGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_010088401.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Morus notabilis]
 gb|EXB35416.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Morus notabilis]
Length=528

 Score =   338 bits (866),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 156/179 (87%), Positives = 173/179 (97%), Gaps = 0/179 (0%)
 Frame = +3

Query  225  NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  404
            N IQAIC+V+IRP SKSTYRRINR+ AELLWLELVW++DWWAGVK+QLYTD +TF LMGK
Sbjct  164  NLIQAICFVLIRPLSKSTYRRINRVVAELLWLELVWVVDWWAGVKIQLYTDSDTFHLMGK  223

Query  405  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  584
            EHAL+ISNHRSDIDW+VGW++AQRSGCLGSTLAVMKKSS +LPVIGWSM+FSEYLFLERS
Sbjct  224  EHALVISNHRSDIDWLVGWIVAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLERS  283

Query  585  WAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            WAKDESTLKSG++RL+DYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP+PRNVLIP
Sbjct  284  WAKDESTLKSGIQRLKDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPVPRNVLIP  342



>gb|AGB05602.1| sn-glycerol-3-phosphate acyltransferase [Camellia oleifera]
Length=386

 Score =   332 bits (852),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF+SGL  N IQAIC+V++RP SK+TYR+INR+ AELLWLELVW++DWWAGVK++L+TD
Sbjct  15   LFFLSGLVVNLIQAICFVLVRPLSKNTYRKINRVVAELLWLELVWIVDWWAGVKIKLFTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+LMGKEHAL++SNH+SDIDW+VGWVLAQR+GCLGS LAVMKKSS +LP IGWSM+F
Sbjct  75   SETFRLMGKEHALVVSNHKSDIDWLVGWVLAQRAGCLGSALAVMKKSSKFLPAIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE TLKSGL+RL+D+PLPFWLALFVEGTRFTQAKL AAQEYAAS GLP
Sbjct  135  SEYLFLERSWAKDEITLKSGLQRLKDFPLPFWLALFVEGTRFTQAKLEAAQEYAASAGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_002323308.2| hypothetical protein POPTR_0016s05340g [Populus trichocarpa]
 gb|EEF05069.2| hypothetical protein POPTR_0016s05340g [Populus trichocarpa]
Length=435

 Score =   333 bits (855),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 155/187 (83%), Positives = 173/187 (93%), Gaps = 0/187 (0%)
 Frame = +3

Query  201  FFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDP  380
            FF SGL  N IQAIC+V IRP SKSTYR+INR  AELLWLELVW+ DWWAGV+++++TDP
Sbjct  64   FFCSGLIVNLIQAICFVFIRPLSKSTYRKINRQLAELLWLELVWIFDWWAGVQIKVFTDP  123

Query  381  ETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFS  560
            ETF+LMGKEHALLI NH+SDIDW+VGWVLAQRSGCLGS LAVMKKSS +LPVIGWSM+FS
Sbjct  124  ETFRLMGKEHALLICNHKSDIDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVIGWSMWFS  183

Query  561  EYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPI  740
            EYLFLER+WAKDE+TLKSGL+RL+D+P PFWLALFVEGTRFTQAKLLAAQEYAAS GLPI
Sbjct  184  EYLFLERNWAKDENTLKSGLQRLKDFPRPFWLALFVEGTRFTQAKLLAAQEYAASQGLPI  243

Query  741  PRNVLIP  761
            PRNVLIP
Sbjct  244  PRNVLIP  250



>gb|AGO14580.1| A-class lysophosphatidate acyltransferase 2 isoform 2 [Echium 
pitardii]
Length=387

 Score =   332 bits (850),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGLF N IQA+ +V++RPFSK+TYRRINR  AELLWLELVW+IDWWAGVK++++ D
Sbjct  15   LFFISGLFVNLIQAVFFVIVRPFSKNTYRRINRWVAELLWLELVWIIDWWAGVKIEVFAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET + MGKEHALLI NHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   AETLRSMGKEHALLICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE+TLKSGL+RL+D+P PFW+ALFVEGTRFTQAKLLAAQEYA STGLP
Sbjct  135  SEYLFLERSWAKDENTLKSGLQRLKDFPQPFWVALFVEGTRFTQAKLLAAQEYATSTGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>gb|ABU50327.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Helianthus annuus]
Length=382

 Score =   331 bits (849),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF+SGL  N IQAI +V +RPFSKS +RRINR  AELLWLELVW++DWWAGVKV LYTD
Sbjct  15   LFFVSGLIVNLIQAIIFVTVRPFSKSLFRRINRQVAELLWLELVWIVDWWAGVKVNLYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET K+MGKEHAL+I+NH+SDIDW++GWV AQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   AETLKMMGKEHALVIANHKSDIDWLIGWVFAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDESTLKSGL+RL+DYP PFWLALFVEGTRFT+AKLLAAQEYA+S GLP
Sbjct  135  SEYLFLERSWAKDESTLKSGLRRLKDYPQPFWLALFVEGTRFTKAKLLAAQEYASSMGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_011033303.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Populus euphratica]
Length=386

 Score =   330 bits (847),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 153/187 (82%), Positives = 172/187 (92%), Gaps = 0/187 (0%)
 Frame = +3

Query  201  FFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDP  380
            FF SG   N IQAIC+V IRP SKSTYR+INR  AELLWLELVW+ DWWAGV+++++TDP
Sbjct  15   FFCSGFIVNLIQAICFVFIRPLSKSTYRKINRQLAELLWLELVWIFDWWAGVQIKVFTDP  74

Query  381  ETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFS  560
            ETF+LMGKEHAL++ NHRSDIDW+VGWVLAQRSGCLGS LAVMKKSS +LPVIGWSM+FS
Sbjct  75   ETFRLMGKEHALVMCNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVIGWSMWFS  134

Query  561  EYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPI  740
            EYLFLER+WAKDE+TLKSGL+RL+D+P PFWLALFVEGTRFTQAKLLAAQEYAAS GLPI
Sbjct  135  EYLFLERNWAKDENTLKSGLQRLKDFPRPFWLALFVEGTRFTQAKLLAAQEYAASQGLPI  194

Query  741  PRNVLIP  761
            PRNVLIP
Sbjct  195  PRNVLIP  201



>gb|AGO14579.1| A-class lysophosphatidate acyltransferase 2 isoform 1 [Echium 
pitardii]
Length=387

 Score =   330 bits (845),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/188 (82%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGLF N IQA+ +V++RPFSK+TYRRINR  AELLWLELVW+IDWWAGVK++++ D
Sbjct  15   LFFISGLFVNLIQAVFFVIVRPFSKNTYRRINRWVAELLWLELVWIIDWWAGVKIEVFAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET + MG EHALLI NHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   AETLRSMGNEHALLICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE+TLKSGL+RL+D+P PFW+ALFVEGTRFTQAKLLAAQEYA STGLP
Sbjct  135  SEYLFLERSWAKDENTLKSGLQRLKDFPQPFWVALFVEGTRFTQAKLLAAQEYATSTGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>gb|ABP93351.1| lysophosphatidyl acyltransferase 2 [Helianthus annuus]
Length=385

 Score =   328 bits (841),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF+SGL    +QA+ +V IRPFSKS +RRINR  AELLWLELVW++DWW+GVKV LYTD
Sbjct  16   LFFVSGLIVTLLQALIFVTIRPFSKSLFRRINRQVAELLWLELVWIVDWWSGVKVNLYTD  75

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            PET  +MGKEHAL+I+NHRSDIDW++GWV AQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  76   PETLNMMGKEHALVIANHRSDIDWLIGWVFAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  135

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER WAKDESTLK+GL+RL+DYP PFWLALFVEGTRFT AKLLAAQEYA+STGLP
Sbjct  136  SEYLFLERRWAKDESTLKAGLQRLKDYPQPFWLALFVEGTRFTNAKLLAAQEYASSTGLP  195

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  196  VPRNVLIP  203



>emb|CAA88620.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase (putative) [Limnanthes 
douglasii]
Length=377

 Score =   327 bits (838),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF+SGL  N IQA+ YV++RP SK TYRRIN L AELLWLELVW+IDWWAGVKVQLYTD
Sbjct  15   LFFMSGLVVNFIQAVFYVLVRPISKDTYRRINTLVAELLWLELVWVIDWWAGVKVQLYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             E+F+LMGKEHALLI NHRSDIDW++GWVLAQR GCL S++AVMKKSS +LPVIGWSM+F
Sbjct  75   TESFRLMGKEHALLICNHRSDIDWLIGWVLAQRCGCLSSSIAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDE+TLKSGL+RL D+P PFWLALFVEGTRFT+AKLLAAQEYAAS GLP
Sbjct  135  SEYLFLERNWAKDENTLKSGLQRLNDFPKPFWLALFVEGTRFTKAKLLAAQEYAASAGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_011020321.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Populus 
euphratica]
Length=379

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/188 (81%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF SGL  N IQAIC+V IRP SKSTYR+INR  AELLWLELVW+ DWWAGV+++++TD
Sbjct  15   LFFCSGLIVNIIQAICFVFIRPLSKSTYRKINRQLAELLWLELVWIFDWWAGVQIKVFTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET +LMGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGS LAVMKKSS +LPVIGWSM+F
Sbjct  75   KETVRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDE+TLKSGL+RL+D+P PFWLALFVEGTRFT  KLLAAQEYAAS GLP
Sbjct  135  SEYLFLERNWAKDENTLKSGLQRLKDFPRPFWLALFVEGTRFTLPKLLAAQEYAASQGLP  194

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  195  IPRNVLIP  202



>ref|XP_009116469.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Brassica 
rapa]
Length=390

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N +QAICYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q++ D
Sbjct  14   LFFISGLVVNLLQAICYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQVFAD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGWSM+F
Sbjct  74   NETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDESTLKSGL+RL D+P PFWLALFVEGTRFT+AKL AAQEYAAS+ LP
Sbjct  134  SEYLFLERNWAKDESTLKSGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQEYAASSELP  193

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  194  VPRNVLIP  201



>ref|XP_006402859.1| hypothetical protein EUTSA_v10006028mg [Eutrema salsugineum]
 gb|ESQ44312.1| hypothetical protein EUTSA_v10006028mg [Eutrema salsugineum]
Length=389

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N +QAICYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q++ D
Sbjct  14   LFFISGLAVNLVQAICYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQVFAD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGWSM+F
Sbjct  74   NETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDESTLKSGL+RL D+P PFWLALFVEGTRFT+AKL AAQEYAAS+ LP
Sbjct  134  SEYLFLERNWAKDESTLKSGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQEYAASSELP  193

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  194  VPRNVLIP  201



>gb|ADC97478.1| lysophosphatidic acid acyltransferase [Brassica napus]
 gb|ADC97480.1| lysophosphatidic acid acyltransferase [Brassica napus]
 emb|CDY06085.1| BnaA09g36950D [Brassica napus]
 emb|CDX72008.1| BnaC08g28660D [Brassica napus]
Length=390

 Score =   325 bits (832),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N +QAICYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q++ D
Sbjct  14   LFFISGLVVNLLQAICYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQVFAD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGWSM+F
Sbjct  74   NETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDESTLKSGL+RL D+P PFWLALFVEGTRFT+AKL AAQEYAAS+ LP
Sbjct  134  SEYLFLERNWAKDESTLKSGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQEYAASSELP  193

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  194  VPRNVLIP  201



>ref|XP_010524157.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Tarenaya 
hassleriana]
 ref|XP_010524167.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Tarenaya 
hassleriana]
Length=382

 Score =   324 bits (830),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF+SGL  N +QA+CYV++RP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q++TD
Sbjct  14   LFFVSGLAVNLVQAVCYVLVRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQVFTD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF  MGKEHAL+I NHRSDIDW+VGW+LAQRSGCLGS+LAVMKKSS +LPVIGWSM+F
Sbjct  74   RETFNQMGKEHALVICNHRSDIDWLVGWMLAQRSGCLGSSLAVMKKSSKFLPVIGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDE+TLK GL+RL+D+P PFWLALFVEGTRFT+AKL AAQEYA S+GLP
Sbjct  134  SEYLFLERNWAKDENTLKLGLQRLKDFPQPFWLALFVEGTRFTEAKLKAAQEYATSSGLP  193

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  194  IPRNVLIP  201



>gb|ADC97479.1| lysophosphatidic acid acyltransferase [Brassica napus]
Length=391

 Score =   324 bits (831),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N +QA+CYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q++ D
Sbjct  15   LFFISGLVVNLLQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQVFAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGWSM+F
Sbjct  75   DETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDESTLKSGL+RL D+P PFWLALFVEGTRFT+AKL AAQEYAAS+ LP
Sbjct  135  SEYLFLERNWAKDESTLKSGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQEYAASSQLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_010257310.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Nelumbo nucifera]
Length=387

 Score =   324 bits (831),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 150/181 (83%), Positives = 169/181 (93%), Gaps = 0/181 (0%)
 Frame = +3

Query  219  FTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLM  398
              N IQA+C++++RP SK+ YR+INR+ +ELLW+ELVWLIDWWAGVKVQLYTD ETFKLM
Sbjct  22   MVNIIQAVCFILVRPVSKNMYRKINRVVSELLWVELVWLIDWWAGVKVQLYTDSETFKLM  81

Query  399  GKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLE  578
            GKEHALLI NHRSDIDW+VGWVLAQ SGCLGSTLAVMKKSS +LPVIGWSM+FSEY+FLE
Sbjct  82   GKEHALLICNHRSDIDWLVGWVLAQHSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYVFLE  141

Query  579  RSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLI  758
            RSWAKDE+TLK+GLKRL+D+P PFWLALFVEGTRFTQAKLLAAQEYAAS GLP+PRNVLI
Sbjct  142  RSWAKDENTLKAGLKRLKDFPRPFWLALFVEGTRFTQAKLLAAQEYAASMGLPVPRNVLI  201

Query  759  P  761
            P
Sbjct  202  P  202



>emb|CDY33810.1| BnaCnng07280D [Brassica napus]
Length=391

 Score =   324 bits (831),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N +QA+CYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q++ D
Sbjct  15   LFFISGLVVNLLQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQVFAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGWSM+F
Sbjct  75   DETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDESTLKSGL+RL D+P PFWLALFVEGTRFT+AKL AAQEYAAS+ LP
Sbjct  135  SEYLFLERNWAKDESTLKSGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQEYAASSELP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_009104068.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Brassica 
rapa]
Length=390

 Score =   324 bits (831),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N +QA+CYV++RP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q++ D
Sbjct  14   LFFISGLVVNLLQAVCYVLVRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQVFAD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGWSM+F
Sbjct  74   DETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDESTLKSGL+RL D+P PFWLALFVEGTRFT+AKL AAQEYAAS+ LP
Sbjct  134  SEYLFLERNWAKDESTLKSGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQEYAASSELP  193

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  194  VPRNVLIP  201



>gb|KFK35010.1| hypothetical protein AALP_AA5G222500 [Arabis alpina]
Length=389

 Score =   324 bits (830),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N +QA+CYV+IRP SKSTYR+INR+ AE LWLELVW++DWWAGVK+Q++ D
Sbjct  14   LFFISGLVVNLVQALCYVLIRPLSKSTYRKINRVVAETLWLELVWIVDWWAGVKIQVFAD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSG LGS LAVMKKSS +LPVIGWSM+F
Sbjct  74   NETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGSLGSALAVMKKSSKFLPVIGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDESTLKSGL+RL D+P PFWLALFVEGTRFT+AKL AAQEYAAS+GLP
Sbjct  134  SEYLFLERNWAKDESTLKSGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQEYAASSGLP  193

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  194  VPRNVLIP  201



>ref|XP_004307568.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Fragaria 
vesca subsp. vesca]
Length=386

 Score =   323 bits (829),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 148/180 (82%), Positives = 170/180 (94%), Gaps = 0/180 (0%)
 Frame = +3

Query  222  TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMG  401
             N +QAIC++ IRP SK+ +RRINR+ AELLWLELVW++DWWAGVKV++YTDPETF LMG
Sbjct  23   VNLLQAICFIFIRPVSKNVHRRINRVVAELLWLELVWIVDWWAGVKVKVYTDPETFHLMG  82

Query  402  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  581
            KEHAL+I NH+SDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+FSEYLFLER
Sbjct  83   KEHALVICNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLER  142

Query  582  SWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            SWAKDEST+K+G++RL+D+P PFWLALFVEGTRFTQAKLLAAQEYAASTGLP+PRNVLIP
Sbjct  143  SWAKDESTIKTGIQRLKDFPRPFWLALFVEGTRFTQAKLLAAQEYAASTGLPVPRNVLIP  202



>ref|XP_010554846.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Tarenaya 
hassleriana]
Length=387

 Score =   323 bits (829),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF+SGL  N +QA+CYV++RP SK+TYR+INR+ AE LWLELVW+IDWWAGVK++++TD
Sbjct  14   LFFVSGLAVNLVQAVCYVLVRPLSKNTYRKINRVVAETLWLELVWIIDWWAGVKIRVFTD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF  MG+EHAL+I NHRSDIDW+VGWVLAQR+GCLGS LAVMKKSS  LPVIGWSM+F
Sbjct  74   RETFHQMGREHALVICNHRSDIDWLVGWVLAQRAGCLGSALAVMKKSSKLLPVIGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDE+TLKSGL+RL D+P PFWLALFVEGTRFTQAKL AAQEYAAS+GLP
Sbjct  134  SEYLFLERNWAKDENTLKSGLQRLYDFPQPFWLALFVEGTRFTQAKLKAAQEYAASSGLP  193

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  194  IPRNVLIP  201



>ref|XP_002308046.1| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase family protein 
[Populus trichocarpa]
 gb|EEE91569.1| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase family protein 
[Populus trichocarpa]
Length=385

 Score =   323 bits (829),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF SGL  N IQAIC+V IRP SKSTYR+INR  AELLWLELVW+ DWWAGV+++++TD
Sbjct  15   LFFCSGLIVNIIQAICFVFIRPLSKSTYRKINRQLAELLWLELVWIFDWWAGVQIKVFTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET +LMGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGS +AVMKKSS +LPVIGWSM+F
Sbjct  75   KETVRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSAVAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE+TLKSGL+RL+D+P PFWLALFVEGTRFT  KLLAAQE+AAS GLP
Sbjct  135  SEYLFLERSWAKDENTLKSGLQRLKDFPRPFWLALFVEGTRFTLPKLLAAQEFAASQGLP  194

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  195  IPRNVLIP  202



>sp|Q6IWY1.1|LPAT2_BRAOL RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
2; AltName: Full=Lysophosphatidyl acyltransferase 2 [Brassica 
oleracea]
 gb|AAT36638.1| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase [Brassica 
oleracea]
Length=391

 Score =   323 bits (829),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 147/188 (78%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N +QA+CYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q++ D
Sbjct  15   LFFISGLVVNLLQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQVFAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGWSM+F
Sbjct  75   DETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDESTLKSGL+RL D+P PFWLALFVEGTRFT+AKL AAQEYAA++ LP
Sbjct  135  SEYLFLERNWAKDESTLKSGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQEYAATSQLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>gb|ABN09946.1| lysophosphatidyl acyltransferase [Crambe hispanica subsp. abyssinica]
 gb|ABN09947.1| lysophosphatidyl acyltransferase [Crambe hispanica subsp. abyssinica]
Length=390

 Score =   323 bits (828),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 148/188 (79%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N +QAICYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q++ D
Sbjct  14   LFFISGLVVNLLQAICYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQVFAD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGWSM+F
Sbjct  74   NETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDESTL+SGL+RL D+P PFWLALFVEGTRFT+AKL AAQEYAAS+ LP
Sbjct  134  SEYLFLERNWAKDESTLQSGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQEYAASSELP  193

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  194  VPRNVLIP  201



>ref|XP_008392182.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Malus 
domestica]
Length=386

 Score =   323 bits (827),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 161/188 (86%), Positives = 179/188 (95%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF+SGL  N IQAIC+++IRP SK+TYR+INR+ AELLWLELVWLIDWWAGVK+Q+YTD
Sbjct  15   LFFVSGLVVNLIQAICFILIRPLSKNTYRKINRVVAELLWLELVWLIDWWAGVKIQVYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            PETF+LMGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   PETFRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE+TLK GL+RL+DYP PFWLALFVEGTRFTQAKLLAAQEYAASTGLP
Sbjct  135  SEYLFLERSWAKDENTLKLGLQRLKDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>gb|AAM61033.1| 1-acylcerol-3-phosphate acyltransferase-like protein [Arabidopsis 
thaliana]
Length=389

 Score =   323 bits (827),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N  QA+CYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q++ D
Sbjct  14   LFFISGLAVNLFQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQVFAD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGWSM+F
Sbjct  74   NETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDESTLKSGL+RL D+P PFWLALFVEGTRFT+AKL AAQEYAAS+ LP
Sbjct  134  SEYLFLERNWAKDESTLKSGLQRLSDFPRPFWLALFVEGTRFTEAKLKAAQEYAASSELP  193

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  194  IPRNVLIP  201



>ref|NP_567052.1| lysophosphatidyl acyltransferase 2 [Arabidopsis thaliana]
 sp|Q8LG50.2|LPAT2_ARATH RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
2; AltName: Full=Lysophosphatidyl acyltransferase 2 [Arabidopsis 
thaliana]
 gb|ABG48392.1| At3g57650 [Arabidopsis thaliana]
 gb|AEE79683.1| lysophosphatidyl acyltransferase 2 [Arabidopsis thaliana]
Length=389

 Score =   323 bits (827),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N  QA+CYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q++ D
Sbjct  14   LFFISGLAVNLFQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQVFAD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGWSM+F
Sbjct  74   NETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDESTLKSGL+RL D+P PFWLALFVEGTRFT+AKL AAQEYAAS+ LP
Sbjct  134  SEYLFLERNWAKDESTLKSGLQRLSDFPRPFWLALFVEGTRFTEAKLKAAQEYAASSELP  193

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  194  IPRNVLIP  201



>ref|XP_002876428.1| hypothetical protein ARALYDRAFT_907235 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52687.1| hypothetical protein ARALYDRAFT_907235 [Arabidopsis lyrata subsp. 
lyrata]
Length=391

 Score =   322 bits (826),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N  QA+CYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q++ D
Sbjct  14   LFFISGLVVNLFQAVCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQVFAD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             +TF  MGKEHAL++ NHRSDIDW+VGWVLAQRSGCLGS LAVMKKSS +LPVIGWSM+F
Sbjct  74   NDTFNRMGKEHALVVCNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVIGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDESTLKSGL+RL D+P PFWLALFVEGTRFT+AKL AAQEYAAS+ LP
Sbjct  134  SEYLFLERNWAKDESTLKSGLQRLSDFPRPFWLALFVEGTRFTEAKLKAAQEYAASSELP  193

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  194  IPRNVLIP  201



>sp|Q9XFW4.1|LPAT2_BRANA RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
2; AltName: Full=Lysophosphatidyl acyltransferase 2 [Brassica 
napus]
 emb|CAB09138.1| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase [Brassica 
napus]
Length=390

 Score =   322 bits (826),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N +QA+CYV++RP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q++ D
Sbjct  14   LFFISGLVVNLLQAVCYVLVRPMSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQVFAD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGWSM+F
Sbjct  74   DETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDESTL+SGL+RL D+P PFWLALFVEGTRFT+AKL AAQEYAAS+ LP
Sbjct  134  SEYLFLERNWAKDESTLQSGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQEYAASSELP  193

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  194  VPRNVLIP  201



>gb|ABM92334.2| 1-acylglycerol-3-phosphate acyltransferase [Brassica juncea]
Length=390

 Score =   322 bits (825),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 146/188 (78%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N +QA+CYV++RP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q++ D
Sbjct  14   LFFISGLVVNLLQAVCYVLVRPMSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQVFAD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGWSM+F
Sbjct  74   DETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDESTL+SGL+RL D+P PFWLALFVEGTRFT+AKL AAQEYAAS+ LP
Sbjct  134  SEYLFLERNWAKDESTLQSGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQEYAASSELP  193

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  194  VPRNVLIP  201



>ref|XP_010504698.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Camelina 
sativa]
Length=389

 Score =   321 bits (822),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N IQA+CYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q++ D
Sbjct  14   LFFISGLVVNLIQALCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQVFAD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF  MGKEHAL++ NHRSDIDW+VGWVLAQRSG LGS LAVMKKSS +LPVIGWSM+F
Sbjct  74   NETFNRMGKEHALVVCNHRSDIDWLVGWVLAQRSGSLGSALAVMKKSSKFLPVIGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+W+KDESTLKSGL+RL D+P PFWLALFVEGTRFT+AKL AAQEYAAS+ LP
Sbjct  134  SEYLFLERNWSKDESTLKSGLQRLSDFPRPFWLALFVEGTRFTEAKLKAAQEYAASSDLP  193

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  194  IPRNVLIP  201



>ref|XP_009345032.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Pyrus x bretschneideri]
Length=386

 Score =   321 bits (822),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF+SGL  N IQ IC++++RP SK+TYRRINR+ AELLWLELVWLIDWWAGVK+Q+YTD
Sbjct  15   LFFVSGLVVNLIQGICFILVRPLSKNTYRRINRVVAELLWLELVWLIDWWAGVKIQVYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            PETF+LMGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   PETFRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE+TLK GL+RL+DYP PFWLALFVEGTRFTQAKLLAAQEYAASTGLP
Sbjct  135  SEYLFLERSWAKDENTLKLGLQRLKDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_010516385.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Camelina sativa]
 ref|XP_010516386.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Camelina sativa]
 ref|XP_010516388.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Camelina sativa]
 ref|XP_010427647.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Camelina sativa]
Length=389

 Score =   321 bits (822),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N IQA+CYV+IRP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q++ D
Sbjct  14   LFFISGLVVNLIQALCYVLIRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQVFAD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF  MGKEHAL++ NHRSDIDW+VGWVLAQRSG LGS LAVMKKSS +LPVIGWSM+F
Sbjct  74   NETFNRMGKEHALVVCNHRSDIDWLVGWVLAQRSGSLGSALAVMKKSSKFLPVIGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+W+KDESTLKSGL+RL D+P PFWLALFVEGTRFT+AKL AAQEYAAS+ LP
Sbjct  134  SEYLFLERNWSKDESTLKSGLQRLSDFPRPFWLALFVEGTRFTEAKLKAAQEYAASSDLP  193

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  194  IPRNVLIP  201



>gb|KCW90239.1| hypothetical protein EUGRSUZ_A02397 [Eucalyptus grandis]
Length=291

 Score =   317 bits (811),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N +QA+C+V++RP SK+TYRRINR+ AELLWLEL+WL+DWWAGVK+Q++TD
Sbjct  15   LFFISGLVVNLVQAVCFVLVRPLSKNTYRRINRVVAELLWLELIWLVDWWAGVKIQVFTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF LMGKEHAL+ISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPV+GWSM+F
Sbjct  75   RETFHLMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVLGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDESTLKSGL RL+DYPLPFWLALFVEGTRFTQAKLLAAQEYA STGLP
Sbjct  135  SEYLFLERSWAKDESTLKSGLLRLKDYPLPFWLALFVEGTRFTQAKLLAAQEYANSTGLP  194

Query  738  IPRNVLIP  761
            +PRN LIP
Sbjct  195  VPRNTLIP  202



>ref|XP_003521190.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 isoform 
1 [Glycine max]
 gb|KHN07393.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Glycine soja]
Length=377

 Score =   320 bits (819),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 163/188 (87%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF SGL  N IQAICYVV+RP SKS YRRINR+ AELLWLELVWLIDWWAGVKVQ++TD
Sbjct  15   LFFASGLLVNLIQAICYVVVRPVSKSLYRRINRVVAELLWLELVWLIDWWAGVKVQIFTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+LMGKEHAL+ISNHRSDIDW+VGWV AQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   HETFRLMGKEHALVISNHRSDIDWLVGWVSAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDESTLKSG++RL D+PLPFWLALFVEGTRFTQAKLLAAQEYA STGLP
Sbjct  135  SEYLFLERSWAKDESTLKSGIQRLSDFPLPFWLALFVEGTRFTQAKLLAAQEYATSTGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>emb|CDX67700.1| BnaA07g17400D [Brassica napus]
Length=391

 Score =   320 bits (819),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 147/189 (78%), Positives = 171/189 (90%), Gaps = 1/189 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N +QA+CYV++RP SK+TYR+INR+ AE LWLELVW++DWWAGVK+Q++ D
Sbjct  14   LFFISGLVVNLLQAVCYVLVRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIQVFAD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQ-RSGCLGSTLAVMKKSSVYLPVIGWSMF  554
             ETF  MGKEHAL++ NHRSDIDW+VGW+LAQ RSGCLGS LAVMKKSS +LPVIGWSM+
Sbjct  74   DETFNRMGKEHALVVCNHRSDIDWLVGWILAQQRSGCLGSALAVMKKSSKFLPVIGWSMW  133

Query  555  FSEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGL  734
            FSEYLFLER+WAKDESTLKSGL+RL D+P PFWLALFVEGTRFT+AKL AAQEYAAS+ L
Sbjct  134  FSEYLFLERNWAKDESTLKSGLQRLNDFPRPFWLALFVEGTRFTEAKLKAAQEYAASSEL  193

Query  735  PIPRNVLIP  761
            P+PRNVLIP
Sbjct  194  PVPRNVLIP  202



>gb|KCW90238.1| hypothetical protein EUGRSUZ_A02397 [Eucalyptus grandis]
Length=356

 Score =   317 bits (813),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N +QA+C+V++RP SK+TYRRINR+ AELLWLEL+WL+DWWAGVK+Q++TD
Sbjct  15   LFFISGLVVNLVQAVCFVLVRPLSKNTYRRINRVVAELLWLELIWLVDWWAGVKIQVFTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF LMGKEHAL+ISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPV+GWSM+F
Sbjct  75   RETFHLMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVLGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDESTLKSGL RL+DYPLPFWLALFVEGTRFTQAKLLAAQEYA STGLP
Sbjct  135  SEYLFLERSWAKDESTLKSGLLRLKDYPLPFWLALFVEGTRFTQAKLLAAQEYANSTGLP  194

Query  738  IPRNVLIP  761
            +PRN LIP
Sbjct  195  VPRNTLIP  202



>ref|XP_011078878.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Sesamum indicum]
 ref|XP_011078879.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Sesamum indicum]
Length=386

 Score =   318 bits (814),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 178/188 (95%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF+SGL  N IQAICYV+IRP SK+TYRRINR  AELLWLELVWL+DWWAGVK+++YTD
Sbjct  15   LFFMSGLVVNLIQAICYVLIRPLSKNTYRRINREVAELLWLELVWLVDWWAGVKIEIYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETFKLMGKEHAL+I NHRSDIDW+VGW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   AETFKLMGKEHALVICNHRSDIDWLVGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE+TLK+GL+RL+D+P PFWLALFVEGTRFTQAKLLAAQEYA+STGLP
Sbjct  135  SEYLFLERSWAKDENTLKTGLQRLRDFPRPFWLALFVEGTRFTQAKLLAAQEYASSTGLP  194

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  195  IPRNVLIP  202



>emb|CAN83214.1| hypothetical protein VITISV_038716 [Vitis vinifera]
Length=390

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF  SGL  N IQA+C++++RP SKSTYRRINR+ AELLWLELVWLIDWWAGVK+QLYTD
Sbjct  15   LFLTSGLVVNLIQAVCFILVRPLSKSTYRRINRVVAELLWLELVWLIDWWAGVKIQLYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            PETF+LMGKEHALLISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   PETFRLMGKEHALLISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDES +KSGL RL+DYP PFWLALFVEGTRFTQAKLLAAQEYA ++GLP
Sbjct  135  SEYLFLERNWAKDESIIKSGLLRLKDYPQPFWLALFVEGTRFTQAKLLAAQEYATASGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|NP_001280186.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Prunus mume]
 dbj|BAE48660.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Prunus mume]
Length=386

 Score =   318 bits (814),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N IQAIC+++IRP SK+ YRRINR+ AELLWLELVWLIDWWAGVK+Q+YTD
Sbjct  15   LFFISGLVVNLIQAICFILIRPVSKNLYRRINRVVAELLWLELVWLIDWWAGVKIQVYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF LMGKEHAL+ISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   HETFNLMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE TLKSG++RL+D+P PFWLALFVEGTRFTQAKLLAAQEYAA+TGLP
Sbjct  135  SEYLFLERSWAKDEGTLKSGVQRLKDFPQPFWLALFVEGTRFTQAKLLAAQEYAAATGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_010057561.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Eucalyptus 
grandis]
 gb|KCW90237.1| hypothetical protein EUGRSUZ_A02397 [Eucalyptus grandis]
Length=387

 Score =   317 bits (813),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N +QA+C+V++RP SK+TYRRINR+ AELLWLEL+WL+DWWAGVK+Q++TD
Sbjct  15   LFFISGLVVNLVQAVCFVLVRPLSKNTYRRINRVVAELLWLELIWLVDWWAGVKIQVFTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF LMGKEHAL+ISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPV+GWSM+F
Sbjct  75   RETFHLMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVLGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDESTLKSGL RL+DYPLPFWLALFVEGTRFTQAKLLAAQEYA STGLP
Sbjct  135  SEYLFLERSWAKDESTLKSGLLRLKDYPLPFWLALFVEGTRFTQAKLLAAQEYANSTGLP  194

Query  738  IPRNVLIP  761
            +PRN LIP
Sbjct  195  VPRNTLIP  202



>ref|XP_002283340.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Vitis 
vinifera]
 emb|CBI29878.3| unnamed protein product [Vitis vinifera]
Length=387

 Score =   317 bits (812),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF  SGL  N IQA+C++++RP SKSTYRRINR+ AELLWLELVWLIDWWAGVK+QLYTD
Sbjct  15   LFLTSGLVVNLIQAVCFILVRPLSKSTYRRINRVVAELLWLELVWLIDWWAGVKIQLYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            PETF+LMGKEHALLISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   PETFRLMGKEHALLISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDES +KSGL RL+DYP PFWLALFVEGTRFTQAKLLAAQEYA ++GLP
Sbjct  135  SEYLFLERNWAKDESIIKSGLLRLKDYPQPFWLALFVEGTRFTQAKLLAAQEYATASGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_007202144.1| hypothetical protein PRUPE_ppa007002mg [Prunus persica]
 gb|EMJ03343.1| hypothetical protein PRUPE_ppa007002mg [Prunus persica]
Length=386

 Score =   316 bits (810),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N IQAIC+++IRP SK+ YRRINR+ AELLWLELVWLIDWWAGVK+Q+YTD
Sbjct  15   LFFISGLVVNLIQAICFILIRPVSKNLYRRINRVVAELLWLELVWLIDWWAGVKIQVYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF LMGKEHAL+ISNHRSDIDW+VGWVLAQRSGCLGS+LAVMKKSS +LPVIGWSM+F
Sbjct  75   HETFNLMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSSLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE TLKSG++RL+D+P PFWLALFVEGTRFTQAKLLAAQEYAA+TGLP
Sbjct  135  SEYLFLERSWAKDEGTLKSGVQRLKDFPQPFWLALFVEGTRFTQAKLLAAQEYAAATGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_009334964.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Pyrus x bretschneideri]
 ref|XP_009334965.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Pyrus x bretschneideri]
 ref|XP_009340151.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Pyrus x bretschneideri]
Length=386

 Score =   316 bits (809),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF+SGL  N IQAIC+++IRP SK+TYRRINR+ AELLWLELVWLIDWWAGVK+Q+YTD
Sbjct  15   LFFVSGLVINLIQAICFILIRPLSKNTYRRINRVVAELLWLELVWLIDWWAGVKIQVYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            PETF LMGKEHAL++ NHRSDIDW+VGWVLAQRSGCLGS LAVMKKSS  LPVIGWSM+F
Sbjct  75   PETFHLMGKEHALVMCNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKLLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDESTLK GL+RL+DYP PFWLALFVEGTRFTQAKL AAQEYAASTGLP
Sbjct  135  SEYLFLERSWAKDESTLKLGLQRLKDYPQPFWLALFVEGTRFTQAKLSAAQEYAASTGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_007162250.1| hypothetical protein PHAVU_001G136600g [Phaseolus vulgaris]
 gb|ESW34244.1| hypothetical protein PHAVU_001G136600g [Phaseolus vulgaris]
Length=387

 Score =   316 bits (809),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 158/188 (84%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF SGL  N IQAICYVV+RP SK+ YRRINR+ AELLWLELVWLIDWWAGVK+Q++TD
Sbjct  15   LFFASGLLVNLIQAICYVVLRPVSKNLYRRINRVVAELLWLELVWLIDWWAGVKIQIFTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+LMGKEHAL++SNHRSDIDW+VGWV AQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   HETFRLMGKEHALVMSNHRSDIDWLVGWVSAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDESTL+SG+++L DYPLPFWLALFVEGTRFTQAKLLAA+EYA STGLP
Sbjct  135  SEYLFLERSWAKDESTLRSGIQQLSDYPLPFWLALFVEGTRFTQAKLLAAKEYATSTGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>gb|EYU20729.1| hypothetical protein MIMGU_mgv1a008164mg [Erythranthe guttata]
Length=383

 Score =   315 bits (808),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF+SGL  N IQA+CYV+IRP SK+TYRRINR  AELLWLELVWLIDWWAGVK++LY D
Sbjct  15   LFFVSGLVVNLIQAVCYVLIRPVSKNTYRRINRQVAELLWLELVWLIDWWAGVKIELYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETFKLMGKEHAL+I NH+SDIDW+VGWVLAQRSGCLGSTLAVMKKSS  LPVIGWSM F
Sbjct  75   SETFKLMGKEHALVICNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKLLPVIGWSMCF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDESTLKSGL+RL D+P PFWLALFVEGTRFTQAKLLAAQEYA+S GLP
Sbjct  135  SEYLFLERSWAKDESTLKSGLQRLSDFPRPFWLALFVEGTRFTQAKLLAAQEYASSAGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_011075205.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Sesamum 
indicum]
Length=381

 Score =   315 bits (807),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF+SGL  N IQA+C+++IRP SK TYRRINR  A LLWL LVWLIDWWAGVK++LYTD
Sbjct  15   LFFVSGLVINFIQAVCFLLIRPLSKKTYRRINREVAGLLWLGLVWLIDWWAGVKIELYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETFKLMGKEHAL+I NH+SDIDW+VGWVLA+RSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   SETFKLMGKEHALVICNHKSDIDWLVGWVLAERSGCLGSTLAVMKKSSRFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDESTLKSGL+RL+D+P PFWLALFVEGTRFTQAKLLAAQEYA+S GLP
Sbjct  135  SEYLFLERSWAKDESTLKSGLQRLRDFPRPFWLALFVEGTRFTQAKLLAAQEYASSAGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_003554183.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Glycine max]
 gb|KHN26342.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Glycine soja]
Length=387

 Score =   313 bits (803),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 160/188 (85%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF SGL  N IQAICYVV+RP SK+ YRRINR+ AELLWLELVWLIDWWAGVKVQ++TD
Sbjct  15   LFFASGLLVNLIQAICYVVVRPVSKNLYRRINRVVAELLWLELVWLIDWWAGVKVQIFTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF LMGKEHAL+ISNHRSDIDW+VGWV AQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   HETFHLMGKEHALVISNHRSDIDWLVGWVSAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDESTLKSG+++L D+PLPFWLALFVEGTRFTQAKLLAAQEYA STGL 
Sbjct  135  SEYLFLERSWAKDESTLKSGIQQLSDFPLPFWLALFVEGTRFTQAKLLAAQEYATSTGLS  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>emb|CDX88957.1| BnaA04g02290D [Brassica napus]
Length=384

 Score =   313 bits (802),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 142/188 (76%), Positives = 169/188 (90%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N +QAICYV++RP SK+TYR+INR+ AE LWLELVW++DWWAGVK++++ D
Sbjct  14   LFFISGLLMNLLQAICYVLVRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIKVFAD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAV K S+ +LPVIGWSM+F
Sbjct  74   NETFSRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVTKNSNKFLPVIGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SE+LFLER+WAKDEST+KSGL+RL+D+P PFWLALFVEGTRFT+ KL AAQEYAAS+ LP
Sbjct  134  SEFLFLERNWAKDESTIKSGLQRLKDFPQPFWLALFVEGTRFTETKLKAAQEYAASSELP  193

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  194  IPRNVLIP  201



>ref|XP_004493527.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cicer arietinum]
Length=387

 Score =   313 bits (802),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 157/188 (84%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF+SGL  N IQA CYV++RP SK+ YRRINR+ AELLWLELVWLIDWWAGVK+Q++TD
Sbjct  15   LFFVSGLIVNLIQATCYVLVRPLSKNLYRRINRVVAELLWLELVWLIDWWAGVKIQIFTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+LMGKEHAL+ISNHRSDIDW+VGWVLAQRSG LGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   RETFRLMGKEHALVISNHRSDIDWLVGWVLAQRSGSLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE+TLKSG++RL D+PLPFWLALFVEGTRFTQ KLLAAQEYA STGLP
Sbjct  135  SEYLFLERSWAKDENTLKSGIQRLSDFPLPFWLALFVEGTRFTQVKLLAAQEYATSTGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_012073008.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Jatropha 
curcas]
 gb|KDP37345.1| hypothetical protein JCGZ_06799 [Jatropha curcas]
Length=385

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF+SG   N IQAIC+VVIRP SK+TYR+INR  AELLWLELVWL+DWWAG+++QLYTD
Sbjct  15   LFFLSGFVVNLIQAICFVVIRPLSKNTYRKINRAVAELLWLELVWLVDWWAGIQIQLYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+LMGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGS LAVMKKSS  LPVIGWSM+F
Sbjct  75   QETFRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKLLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDESTLKSGL+RL+D+P PFWLALFVEGTRFTQAKLLAAQEYAAS GLP
Sbjct  135  SEYLFLERSWAKDESTLKSGLQRLKDFPRPFWLALFVEGTRFTQAKLLAAQEYAASAGLP  194

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  195  IPRNVLIP  202



>gb|AEZ56251.1| plastid 1-acylglycerol-phosphate acyltransferase [Jatropha curcas]
Length=385

 Score =   313 bits (801),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF+SG   N IQAIC+VVIRP SK+TYR+INR  AELLWLELVWL+DWWAG+++QLYTD
Sbjct  15   LFFLSGFVVNLIQAICFVVIRPLSKNTYRKINRAVAELLWLELVWLVDWWAGIQIQLYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+LMGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGS LAVMKKSS  LPVIGWSM+F
Sbjct  75   QETFRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKLLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDESTLKSGL+RL+D+P PFWLALFVEGTRFTQAKLLAAQEYAAS GLP
Sbjct  135  SEYLFLERSWAKDESTLKSGLQRLKDFPRPFWLALFVEGTRFTQAKLLAAQEYAASAGLP  194

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  195  IPRNVLIP  202



>ref|NP_001105919.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
 sp|Q41745.1|LPAT_MAIZE RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
PLS1; AltName: Full=Phospholipid synthesis protein 1 [Zea mays]
 emb|CAA82638.1| 1-acyl-glycerol-3-phosphate acyltransferase (putative) [Zea mays]
 gb|ACG37259.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
 gb|ACG40468.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
 gb|ACR38397.1| unknown [Zea mays]
 tpg|DAA42327.1| TPA: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea 
mays]
Length=374

 Score =   312 bits (799),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 164/180 (91%), Gaps = 0/180 (0%)
 Frame = +3

Query  222  TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMG  401
             NAIQA+ +V IRPFSKS YRRINR  AELLWL+LVW++DWWAGVKVQL+ D ET++ MG
Sbjct  23   VNAIQAVLFVTIRPFSKSFYRRINRFLAELLWLQLVWVVDWWAGVKVQLHADEETYRSMG  82

Query  402  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  581
            KEHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLER
Sbjct  83   KEHALIISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLER  142

Query  582  SWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            SWAKDE TLK GL+RL+D+P PFWLALFVEGTRFT AKLLAAQEYAAS GLP PRNVLIP
Sbjct  143  SWAKDEKTLKWGLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQEYAASQGLPAPRNVLIP  202



>ref|NP_001148618.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
 gb|ACG32258.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
Length=374

 Score =   311 bits (798),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  219  FTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLM  398
              N IQAI +V IRPFSKS YRRINR  AELLWL+LVW++DWWAGVKVQL+ D ET++ M
Sbjct  22   IVNTIQAILFVTIRPFSKSLYRRINRFLAELLWLQLVWVVDWWAGVKVQLHADEETYRSM  81

Query  399  GKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLE  578
            GKEHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLE
Sbjct  82   GKEHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLE  141

Query  579  RSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLI  758
            RSWAKDE TLK GL+RL+D+P PFWLALFVEGTRFT AKLLAAQEYAAS GLP PRNVLI
Sbjct  142  RSWAKDEKTLKWGLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQEYAASQGLPAPRNVLI  201

Query  759  P  761
            P
Sbjct  202  P  202



>gb|ACN28103.1| unknown [Zea mays]
 gb|AFW60269.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Zea mays]
Length=374

 Score =   311 bits (797),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 146/181 (81%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  219  FTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLM  398
              N IQAI +V IRPFSKS YRRINR  AELLWL+LVW++DWWAGVKVQL+ D ET++ M
Sbjct  22   IVNTIQAILFVTIRPFSKSLYRRINRFLAELLWLQLVWVVDWWAGVKVQLHADEETYRSM  81

Query  399  GKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLE  578
            GKEHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLE
Sbjct  82   GKEHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLE  141

Query  579  RSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLI  758
            RSWAKDE TLK GL+RL+D+P PFWLALFVEGTRFT AKLLAAQEYAAS GLP PRNVLI
Sbjct  142  RSWAKDEKTLKWGLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQEYAASQGLPAPRNVLI  201

Query  759  P  761
            P
Sbjct  202  P  202



>gb|KJB16434.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=286

 Score =   308 bits (789),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGLF N IQA+C+V+IRP SK TYR+INR+ AELLWL+LVWL+DWWAGVK+ ++ D
Sbjct  15   LFFISGLFVNLIQAVCFVLIRPLSKKTYRKINRVVAELLWLQLVWLVDWWAGVKINVFAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             E+F LMGKEHALL+ NHRSDIDW+VGWVLAQRSGCLGS++AVMKKSS +LPVIGWSM+F
Sbjct  75   NESFSLMGKEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE+T+K+GL+RL+DYP PFWLALFVEGTRFTQAKL+AAQEYA S GLP
Sbjct  135  SEYLFLERSWAKDENTIKAGLQRLRDYPQPFWLALFVEGTRFTQAKLVAAQEYATSQGLP  194

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  195  IPRNVLIP  202



>ref|XP_010312077.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X2 [Solanum lycopersicum]
Length=330

 Score =   310 bits (793),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +FFISGLF N IQA C+V+IRPFSK+ YRRINR+FAELLWLELVWL+DW AGV+++LY D
Sbjct  15   IFFISGLFINLIQAACFVLIRPFSKNIYRRINRIFAELLWLELVWLVDWRAGVEIKLYMD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            PETF+LMGKEHALLI+NHRSDIDW+VGWVLAQRS CLGS LAVMKKSS +LPV+GWSM+F
Sbjct  75   PETFRLMGKEHALLIANHRSDIDWLVGWVLAQRSSCLGSALAVMKKSSKFLPVLGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE+T+KSGL+RL+DYP PFWLALFVEGTRFTQAKLLAAQEYA S GLP
Sbjct  135  SEYLFLERSWAKDENTIKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYATSAGLP  194

Query  738  IPRNVLIP  761
            +P+NVLIP
Sbjct  195  VPKNVLIP  202



>gb|KJB16435.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=273

 Score =   308 bits (788),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGLF N IQA+C+V+IRP SK TYR+INR+ AELLWL+LVWL+DWWAGVK+ ++ D
Sbjct  15   LFFISGLFVNLIQAVCFVLIRPLSKKTYRKINRVVAELLWLQLVWLVDWWAGVKINVFAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             E+F LMGKEHALL+ NHRSDIDW+VGWVLAQRSGCLGS++AVMKKSS +LPVIGWSM+F
Sbjct  75   NESFSLMGKEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE+T+K+GL+RL+DYP PFWLALFVEGTRFTQAKL+AAQEYA S GLP
Sbjct  135  SEYLFLERSWAKDENTIKAGLQRLRDYPQPFWLALFVEGTRFTQAKLVAAQEYATSQGLP  194

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  195  IPRNVLIP  202



>ref|XP_002451179.1| hypothetical protein SORBIDRAFT_05g025420 [Sorghum bicolor]
 gb|EES10167.1| hypothetical protein SORBIDRAFT_05g025420 [Sorghum bicolor]
Length=374

 Score =   311 bits (796),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +3

Query  222  TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMG  401
             N IQAI +V IRPFSKS YRR+NR  AELLWL+LVW++DWWAGVKVQL+ D ET++ MG
Sbjct  23   VNTIQAILFVTIRPFSKSFYRRVNRFLAELLWLQLVWVVDWWAGVKVQLHADEETYRSMG  82

Query  402  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  581
            KEHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLER
Sbjct  83   KEHALIISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLER  142

Query  582  SWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            SWAKDE TLK GL+RL+D+P PFWLALFVEGTRFT AKLLAAQEYAAS GLP PRNVLIP
Sbjct  143  SWAKDEKTLKWGLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQEYAASQGLPAPRNVLIP  202



>ref|XP_004979811.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Setaria italica]
Length=374

 Score =   310 bits (795),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 146/180 (81%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = +3

Query  222  TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMG  401
             N IQAI +V IRPFSKS YRRINR  AELLWL+LVW++DWWAGVKVQL+ D ET++ MG
Sbjct  23   VNTIQAILFVTIRPFSKSFYRRINRFLAELLWLQLVWVVDWWAGVKVQLHADEETYRSMG  82

Query  402  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  581
            KEHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLER
Sbjct  83   KEHALIISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLER  142

Query  582  SWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            SWAKDE TLK GL+RL D+P PFWLALFVEGTRFT AKLLAAQEYAAS GLP PRNVLIP
Sbjct  143  SWAKDEKTLKWGLQRLNDFPRPFWLALFVEGTRFTPAKLLAAQEYAASQGLPAPRNVLIP  202



>gb|ACV73676.1| lysophosphatidic acid acyltransferase 2 [Tropaeolum majus]
Length=380

 Score =   310 bits (794),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 159/188 (85%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF SGL  N IQAI YV++RP SKSTYRRINR+ AELLWLELVWLIDWWAGVK++L+TD
Sbjct  15   LFFFSGLVVNLIQAIFYVLVRPLSKSTYRRINRVVAELLWLELVWLIDWWAGVKIKLFTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET   MGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGS+LAVMKKSS +LPVIGWSM+F
Sbjct  75   RETLHQMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSSLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDESTLKSGL+RL DYP PFWLALFVEGTRFTQAKLLAAQEYA STGLP
Sbjct  135  SEYLFLERSWAKDESTLKSGLQRLNDYPQPFWLALFVEGTRFTQAKLLAAQEYATSTGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_004249199.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X1 [Solanum lycopersicum]
Length=382

 Score =   310 bits (794),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 176/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +FFISGLF N IQA C+V+IRPFSK+ YRRINR+FAELLWLELVWL+DW AGV+++LY D
Sbjct  15   IFFISGLFINLIQAACFVLIRPFSKNIYRRINRIFAELLWLELVWLVDWRAGVEIKLYMD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            PETF+LMGKEHALLI+NHRSDIDW+VGWVLAQRS CLGS LAVMKKSS +LPV+GWSM+F
Sbjct  75   PETFRLMGKEHALLIANHRSDIDWLVGWVLAQRSSCLGSALAVMKKSSKFLPVLGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE+T+KSGL+RL+DYP PFWLALFVEGTRFTQAKLLAAQEYA S GLP
Sbjct  135  SEYLFLERSWAKDENTIKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYATSAGLP  194

Query  738  IPRNVLIP  761
            +P+NVLIP
Sbjct  195  VPKNVLIP  202



>ref|XP_009387255.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=374

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 165/181 (91%), Gaps = 0/181 (0%)
 Frame = +3

Query  219  FTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLM  398
              N +QAI ++ IRPFSKS YRRINR+ AELLWL+++WL+DWWAGVKVQL+ D +T+ LM
Sbjct  22   IVNLVQAIFFITIRPFSKSLYRRINRVVAELLWLQVIWLVDWWAGVKVQLFADSKTYALM  81

Query  399  GKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLE  578
            GKEHAL+ISNH+SDIDW+VGW+L+QRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLE
Sbjct  82   GKEHALVISNHKSDIDWLVGWILSQRSGCLGSTLAVMKKSSKFLPVIGWSMWFTEYLFLE  141

Query  579  RSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLI  758
            RSW KDESTLKSGL++L+D+P PFWLALFVEGTRFT AKLLAAQEYA S GLPIPRNVLI
Sbjct  142  RSWTKDESTLKSGLQQLKDFPRPFWLALFVEGTRFTPAKLLAAQEYATSQGLPIPRNVLI  201

Query  759  P  761
            P
Sbjct  202  P  202



>gb|KJB36056.1| hypothetical protein B456_006G138600 [Gossypium raimondii]
Length=314

 Score =   307 bits (787),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N IQA+C+V+IRP SK+TYR+INR+ AELLWL+LVWL+DWWAGVK++++ D
Sbjct  15   LFFISGLAVNLIQAVCFVLIRPLSKNTYRKINRVLAELLWLQLVWLVDWWAGVKIEVFAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             E+F LMGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   HESFNLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE+TLK+G++RL+D+P PFWLALFVEGTRFTQAKLLAAQEYA S GLP
Sbjct  135  SEYLFLERSWAKDENTLKAGIQRLKDFPRPFWLALFVEGTRFTQAKLLAAQEYATSQGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>gb|KJB16432.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=350

 Score =   308 bits (790),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGLF N IQA+C+V+IRP SK TYR+INR+ AELLWL+LVWL+DWWAGVK+ ++ D
Sbjct  15   LFFISGLFVNLIQAVCFVLIRPLSKKTYRKINRVVAELLWLQLVWLVDWWAGVKINVFAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             E+F LMGKEHALL+ NHRSDIDW+VGWVLAQRSGCLGS++AVMKKSS +LPVIGWSM+F
Sbjct  75   NESFSLMGKEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE+T+K+GL+RL+DYP PFWLALFVEGTRFTQAKL+AAQEYA S GLP
Sbjct  135  SEYLFLERSWAKDENTIKAGLQRLRDYPQPFWLALFVEGTRFTQAKLVAAQEYATSQGLP  194

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  195  IPRNVLIP  202



>ref|XP_006351222.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Solanum tuberosum]
Length=382

 Score =   310 bits (793),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 177/188 (94%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +FFISGLF N IQA C+V+IRPFSK+ YRRINR+FAELLWLELVWL+DW AGV+++LY D
Sbjct  15   VFFISGLFINLIQAACFVLIRPFSKNIYRRINRIFAELLWLELVWLVDWRAGVEIKLYMD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            PETF+LMGKEHALLI+NHRSDIDW+VGWVLAQRSGCLGS LAVMKKSS +LPV+GWSM+F
Sbjct  75   PETFRLMGKEHALLIANHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVLGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE+T+KSGL+ L+DYP PFWLALFVEGTRFTQAKLLAAQEYAAS GLP
Sbjct  135  SEYLFLERSWAKDENTIKSGLQWLRDYPQPFWLALFVEGTRFTQAKLLAAQEYAASAGLP  194

Query  738  IPRNVLIP  761
            +P+NVLIP
Sbjct  195  VPKNVLIP  202



>gb|KCW90236.1| hypothetical protein EUGRSUZ_A02397 [Eucalyptus grandis]
Length=395

 Score =   310 bits (793),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 158/196 (81%), Positives = 177/196 (90%), Gaps = 8/196 (4%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N +QA+C+V++RP SK+TYRRINR+ AELLWLEL+WL+DWWAGVK+Q++TD
Sbjct  15   LFFISGLVVNLVQAVCFVLVRPLSKNTYRRINRVVAELLWLELIWLVDWWAGVKIQVFTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLP--------  533
             ETF LMGKEHAL+ISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LP        
Sbjct  75   RETFHLMGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPDLDFPCLQ  134

Query  534  VIGWSMFFSEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQE  713
            V+GWSM+FSEYLFLERSWAKDESTLKSGL RL+DYPLPFWLALFVEGTRFTQAKLLAAQE
Sbjct  135  VLGWSMWFSEYLFLERSWAKDESTLKSGLLRLKDYPLPFWLALFVEGTRFTQAKLLAAQE  194

Query  714  YAASTGLPIPRNVLIP  761
            YA STGLP+PRN LIP
Sbjct  195  YANSTGLPVPRNTLIP  210



>ref|XP_009139024.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Brassica rapa]
Length=385

 Score =   309 bits (791),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 141/188 (75%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N +QAICYV++RP SK+TYR+INR+ AE LWLELVW++DWWAGVK++++ D
Sbjct  14   LFFISGLLMNLLQAICYVLVRPLSKNTYRKINRVVAETLWLELVWIVDWWAGVKIKVFAD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET   MGKEHAL++ N RSDIDW+VGW+LAQRSGCLGS LAV KKS+ +LPVIGWSM+F
Sbjct  74   DETLSRMGKEHALVVCNLRSDIDWLVGWILAQRSGCLGSALAVTKKSNKFLPVIGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SE+LFLER+WAKDEST+KSGL+RL+D+P PFWLALFVEGTRFT+ KL AAQEYAAS+ LP
Sbjct  134  SEFLFLERNWAKDESTIKSGLQRLKDFPQPFWLALFVEGTRFTETKLKAAQEYAASSELP  193

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  194  IPRNVLIP  201



>gb|KJB16430.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=381

 Score =   308 bits (790),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGLF N IQA+C+V+IRP SK TYR+INR+ AELLWL+LVWL+DWWAGVK+ ++ D
Sbjct  15   LFFISGLFVNLIQAVCFVLIRPLSKKTYRKINRVVAELLWLQLVWLVDWWAGVKINVFAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             E+F LMGKEHALL+ NHRSDIDW+VGWVLAQRSGCLGS++AVMKKSS +LPVIGWSM+F
Sbjct  75   NESFSLMGKEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE+T+K+GL+RL+DYP PFWLALFVEGTRFTQAKL+AAQEYA S GLP
Sbjct  135  SEYLFLERSWAKDENTIKAGLQRLRDYPQPFWLALFVEGTRFTQAKLVAAQEYATSQGLP  194

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  195  IPRNVLIP  202



>gb|AFK40266.1| unknown [Medicago truncatula]
Length=387

 Score =   308 bits (790),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF SGL  N  QAICYV++RP SK+ YRRINR+ AELLWLELVWLIDWWAGVKV++YTD
Sbjct  15   LFFASGLIVNFFQAICYVLVRPLSKNLYRRINRVVAELLWLELVWLIDWWAGVKVEIYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET +LMGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   RETSRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE+TLKSG++RL D+PLPFWLALFVEGTRFT  KLLAAQEYA STGLP
Sbjct  135  SEYLFLERSWAKDENTLKSGIRRLNDFPLPFWLALFVEGTRFTNVKLLAAQEYATSTGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_003625176.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Medicago truncatula]
 gb|AES81394.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase-like protein [Medicago 
truncatula]
Length=387

 Score =   308 bits (790),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 156/188 (83%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF SGL  N  QAICYV++RP SK+ YRRINR+ AELLWLELVWLIDWWAGVKV++YTD
Sbjct  15   LFFASGLIVNFFQAICYVLVRPLSKNLYRRINRVVAELLWLELVWLIDWWAGVKVEIYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET +LMGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   RETSRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE+TLKSG++RL D+PLPFWLALFVEGTRFT  KLLAAQEYA STGLP
Sbjct  135  SEYLFLERSWAKDENTLKSGIRRLNDFPLPFWLALFVEGTRFTNVKLLAAQEYATSTGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_010265751.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Nelumbo nucifera]
Length=387

 Score =   308 bits (789),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 155/188 (82%), Positives = 174/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF  SG+  N IQA+C++++RP SK+ YRRINR+ AELLWLELVWLIDWWAGVKVQLYTD
Sbjct  15   LFLFSGIVVNIIQAVCFILVRPLSKNMYRRINRVVAELLWLELVWLIDWWAGVKVQLYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+ MGKEHALLISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   SETFQSMGKEHALLISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEY+FLERSWAKDESTLK+GL RL+D+P PFWLALFVEGTR+T+AKLLAAQEYA STGLP
Sbjct  135  SEYVFLERSWAKDESTLKAGLGRLKDFPRPFWLALFVEGTRYTRAKLLAAQEYATSTGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>gb|KJB36055.1| hypothetical protein B456_006G138600 [Gossypium raimondii]
Length=387

 Score =   308 bits (789),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N IQA+C+V+IRP SK+TYR+INR+ AELLWL+LVWL+DWWAGVK++++ D
Sbjct  15   LFFISGLAVNLIQAVCFVLIRPLSKNTYRKINRVLAELLWLQLVWLVDWWAGVKIEVFAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             E+F LMGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   HESFNLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE+TLK+G++RL+D+P PFWLALFVEGTRFTQAKLLAAQEYA S GLP
Sbjct  135  SEYLFLERSWAKDENTLKAGIQRLKDFPRPFWLALFVEGTRFTQAKLLAAQEYATSQGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_006293344.1| hypothetical protein CARUB_v100174200mg, partial [Capsella rubella]
 gb|EOA26242.1| hypothetical protein CARUB_v100174200mg, partial [Capsella rubella]
Length=363

 Score =   306 bits (784),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 161/175 (92%), Gaps = 0/175 (0%)
 Frame = +3

Query  237  AICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGKEHAL  416
            A+CYV+IRP SK+TYR++NR+ AE LWLELVW++DWWAGVK+Q++ D ETF  MGKEHAL
Sbjct  1    AVCYVLIRPLSKNTYRKLNRVVAETLWLELVWIVDWWAGVKIQVFADNETFNRMGKEHAL  60

Query  417  LISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERSWAKD  596
            ++ NHRSDIDW+VGWVLAQRSGCLGS LAVMKKSS +LPVIGWSM+FSEYLFLER+WAKD
Sbjct  61   VVCNHRSDIDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKD  120

Query  597  ESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            ESTLKSGL+RL D+P PFWLALFVEGTRFT+AKL AAQEYAAS+ LPIPRNVLIP
Sbjct  121  ESTLKSGLQRLSDFPRPFWLALFVEGTRFTEAKLKAAQEYAASSELPIPRNVLIP  175



>gb|KJB16433.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=381

 Score =   306 bits (785),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGLF N IQA+C+V+IRP SK TYR+INR+ AELLWL+LVWL+DWWAGVK+ ++ D
Sbjct  15   LFFISGLFVNLIQAVCFVLIRPLSKKTYRKINRVVAELLWLQLVWLVDWWAGVKINVFAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             E+F LMG EHALL+ NHRSDIDW+VGWVLAQRSGCLGS++AVMKKSS +LPVIGWSM+F
Sbjct  75   NESFSLMGNEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE+T+K+GL+RL+DYP PFWLALFVEGTRFTQAKL+AAQEYA S GLP
Sbjct  135  SEYLFLERSWAKDENTIKAGLQRLRDYPQPFWLALFVEGTRFTQAKLVAAQEYATSQGLP  194

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  195  IPRNVLIP  202



>gb|KHG04120.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Gossypium arboreum]
Length=381

 Score =   306 bits (784),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 150/188 (80%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N IQA+C+V+IRP SK TYR+INR+ AELLWL+LVWL+DWWAGVK+ ++ D
Sbjct  15   LFFISGLVVNLIQAVCFVLIRPLSKKTYRKINRVVAELLWLQLVWLVDWWAGVKINVFAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             E+F LMGKEHALL+ NHRSDIDW+VGWVLAQRSGCLGS++AVMKKSS +LPVIGWSM+F
Sbjct  75   NESFNLMGKEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE+T+K+GL+RL+DYP PFWLALFVEGTRFTQAKL+AAQEYA S GLP
Sbjct  135  SEYLFLERSWAKDENTIKAGLQRLRDYPQPFWLALFVEGTRFTQAKLVAAQEYATSQGLP  194

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  195  IPRNVLIP  202



>ref|XP_009414749.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Musa acuminata subsp. malaccensis]
Length=374

 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = +3

Query  222  TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMG  401
             N IQA  Y+ IRPFSKS +RRINR+ AELLWL+L+WL+DWWAGVKVQLY D +T++LMG
Sbjct  23   VNLIQATIYITIRPFSKSLFRRINRVVAELLWLQLIWLVDWWAGVKVQLYADSKTYELMG  82

Query  402  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  581
            KEHAL+I NH+SDIDW+VGW+L+QRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLER
Sbjct  83   KEHALVICNHKSDIDWLVGWILSQRSGCLGSTLAVMKKSSKFLPVIGWSMWFTEYLFLER  142

Query  582  SWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            SWAKDE+ L  GL+ L+D+P PFWLALFVEGTRFT AKL+AAQEYAAS GLPIPRNVLIP
Sbjct  143  SWAKDENILTLGLQHLKDFPRPFWLALFVEGTRFTPAKLIAAQEYAASQGLPIPRNVLIP  202



>gb|AHC70248.1| lysophosphatidic acid acyltransferase [Sterculia foetida]
Length=387

 Score =   304 bits (778),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 175/188 (93%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N IQA+C+V+IRP SK TYR+IN++ AELLWLEL+WL+DWWAGVK++++ D
Sbjct  15   LFFISGLVVNLIQAVCFVLIRPLSKKTYRKINKVVAELLWLELIWLVDWWAGVKIKVFAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             E+F LMGKEHAL+++NHRSDIDW+VGWVLAQRSGCLGS++AVMKKSS +LPVIGWSM+F
Sbjct  75   HESFNLMGKEHALVVANHRSDIDWLVGWVLAQRSGCLGSSVAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDESTLK+GL+RL+D+P PFWLALFVEGTRFTQAKLLAAQEYA S GLP
Sbjct  135  SEYLFLERNWAKDESTLKAGLQRLKDFPQPFWLALFVEGTRFTQAKLLAAQEYATSQGLP  194

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  195  IPRNVLIP  202



>ref|XP_008443106.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Cucumis 
melo]
Length=388

 Score =   303 bits (777),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 153/188 (81%), Positives = 172/188 (91%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF SGL  N IQAICYV IRP +K+ YRRINR  AELLWLELVWLIDWWAGV+++++TD
Sbjct  15   LFFFSGLVVNLIQAICYVFIRPITKNGYRRINRFVAELLWLELVWLIDWWAGVQIKVFTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET KLMGKEHAL++SNHRSDIDW+VGW+LAQRSGCLGSTLAVMKKSS +LPV+GWSM+F
Sbjct  75   RETLKLMGKEHALVVSNHRSDIDWLVGWILAQRSGCLGSTLAVMKKSSKFLPVLGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE TLKSGL RL+DYPLPFWLALFVEGTRFT+AKLLAA+EYA + GLP
Sbjct  135  SEYLFLERSWAKDEITLKSGLLRLKDYPLPFWLALFVEGTRFTEAKLLAAKEYAIANGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_004136588.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Cucumis 
sativus]
 gb|KGN59338.1| hypothetical protein Csa_3G812100 [Cucumis sativus]
Length=388

 Score =   303 bits (777),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 151/188 (80%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF SGL  N IQAICYV++RP +K+ YRR+NR  AELLWLELVWLIDWWAGV+++++TD
Sbjct  15   LFFFSGLVVNLIQAICYVLVRPITKNGYRRMNRFVAELLWLELVWLIDWWAGVQIKVFTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET KLMGKEHAL++SNHRSDIDW+VGW+LAQRSGCLGSTLAVMKKSS +LPV+GWSM+F
Sbjct  75   RETLKLMGKEHALVVSNHRSDIDWLVGWILAQRSGCLGSTLAVMKKSSKFLPVLGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDE TLKSGL RL+DYPLPFWLALFVEGTRFT+AKLLAA+EYA + GLP
Sbjct  135  SEYLFLERSWAKDEITLKSGLLRLKDYPLPFWLALFVEGTRFTEAKLLAAKEYAIANGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>dbj|BAJ84894.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   301 bits (772),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 139/179 (78%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +3

Query  225  NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  404
            N +QA+ ++ IRPFSK  YR+IN   AELLWL+L+WL+DWWAGVKVQ+Y DPET+K+MGK
Sbjct  24   NTVQAVLFLTIRPFSKRLYRQINVFLAELLWLQLIWLVDWWAGVKVQVYADPETWKVMGK  83

Query  405  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  584
            EHALLISNHRSDIDW+VGW+LAQRSGCLGS +A+MKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  84   EHALLISNHRSDIDWLVGWILAQRSGCLGSAIAIMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  585  WAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            WAKDE TLKSGL+RL+D+P  FWLALFVEGTRFT AKLLAAQEYA S GL  PRNVLIP
Sbjct  144  WAKDEKTLKSGLQRLKDFPRSFWLALFVEGTRFTPAKLLAAQEYAVSQGLTAPRNVLIP  202



>ref|XP_009387254.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=389

 Score =   300 bits (768),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/196 (72%), Positives = 165/196 (84%), Gaps = 15/196 (8%)
 Frame = +3

Query  219  FTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVK-------------  359
              N +QAI ++ IRPFSKS YRRINR+ AELLWL+++WL+DWWAGVK             
Sbjct  22   IVNLVQAIFFITIRPFSKSLYRRINRVVAELLWLQVIWLVDWWAGVKKMRSLRERQLAYE  81

Query  360  --VQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLP  533
              VQL+ D +T+ LMGKEHAL+ISNH+SDIDW+VGW+L+QRSGCLGSTLAVMKKSS +LP
Sbjct  82   IEVQLFADSKTYALMGKEHALVISNHKSDIDWLVGWILSQRSGCLGSTLAVMKKSSKFLP  141

Query  534  VIGWSMFFSEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQE  713
            VIGWSM+F+EYLFLERSW KDESTLKSGL++L+D+P PFWLALFVEGTRFT AKLLAAQE
Sbjct  142  VIGWSMWFTEYLFLERSWTKDESTLKSGLQQLKDFPRPFWLALFVEGTRFTPAKLLAAQE  201

Query  714  YAASTGLPIPRNVLIP  761
            YA S GLPIPRNVLIP
Sbjct  202  YATSQGLPIPRNVLIP  217



>gb|EPS68644.1| lysophosphatidic acid acyltransferase, partial [Genlisea aurea]
Length=365

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 173/188 (92%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N IQA+CY++IRP+S++ YR IN+  AELLWLELVWL+DWWAGVK+++Y D
Sbjct  18   LFFISGLVVNLIQALCYLLIRPWSRNIYRIINKSVAELLWLELVWLVDWWAGVKIEVYAD  77

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            PE+FK MGKEHAL++SNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS++LPVIGWSM+F
Sbjct  78   PESFKFMGKEHALVMSNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSMFLPVIGWSMWF  137

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEY+FLERSWAKDE+TLK G +RL D+P PFWLALFVEGTRFTQAKL AAQEYA+S GLP
Sbjct  138  SEYVFLERSWAKDENTLKVGYQRLSDFPRPFWLALFVEGTRFTQAKLFAAQEYASSAGLP  197

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  198  VPRNVLIP  205



>ref|XP_008227141.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
[Prunus mume]
Length=380

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N +Q + ++++RP SK  YR+IN++ AELLWLE +WLIDWWAG+KV+LY D
Sbjct  15   LFILSGLIVNLMQVVSFILLRPISKKLYRKINKVVAELLWLEPIWLIDWWAGIKVELYVD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             +TF+LMGKEHAL+I NHRSDIDW+VGW++AQRSGCLGS LA+MKK   +LPVIGWSM+F
Sbjct  75   SDTFQLMGKEHALVICNHRSDIDWLVGWLIAQRSGCLGSALAIMKKEVKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEY FLER W KDE TLKSG ++L+D+P+PFWLALFVEGTRFTQAKL+ AQE+AAS GLP
Sbjct  135  SEYFFLERRWTKDEITLKSGFQQLEDFPMPFWLALFVEGTRFTQAKLMVAQEFAASRGLP  194

Query  738  IPRNVLIP  761
            IPRNVL+P
Sbjct  195  IPRNVLLP  202



>ref|XP_006852430.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
[Amborella trichopoda]
 gb|ERN13897.1| hypothetical protein AMTR_s00021p00084240 [Amborella trichopoda]
Length=387

 Score =   299 bits (766),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 151/180 (84%), Positives = 167/180 (93%), Gaps = 0/180 (0%)
 Frame = +3

Query  222  TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMG  401
             N IQ +CYV+ RP SK+ YRRINR+ AELLWLELVWLIDWW GVKVQLY D ETF+ MG
Sbjct  23   VNLIQIVCYVIFRPLSKNLYRRINRVVAELLWLELVWLIDWWGGVKVQLYADSETFRHMG  82

Query  402  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  581
            KEHAL+ISNHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+FSEYLFLER
Sbjct  83   KEHALVISNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFLER  142

Query  582  SWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            SWAKDE+TLK+GL+RL+D+P PFWLALFVEGTRFTQAKLLAAQEYAAS+GLP+PRNVLIP
Sbjct  143  SWAKDENTLKAGLQRLKDFPRPFWLALFVEGTRFTQAKLLAAQEYAASSGLPVPRNVLIP  202



>ref|XP_004486964.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
isoform X2 [Cicer arietinum]
Length=377

 Score =   297 bits (760),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N +QAI +V++RP S+  YRRIN++  E LWLEL+WL+DWWAGVKV+LY D
Sbjct  15   LFILSGLIVNVLQAIIFVLVRPISRYCYRRINKVLTESLWLELIWLVDWWAGVKVELYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+LMGKE+ALLI NHRSDIDW++GWVLAQR+GCLG+T+A+MKK   YLPVIGWSM+F
Sbjct  75   SETFQLMGKENALLICNHRSDIDWLIGWVLAQRTGCLGNTIAIMKKEVKYLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +E+LFLER+WAKDE+ LKSG K+L+  P+PFW+ALFVEGTRFT  KLLAAQE+A S G+P
Sbjct  135  AEFLFLERNWAKDEAALKSGFKQLEHKPVPFWMALFVEGTRFTHTKLLAAQEFAISRGMP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_010672763.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=391

 Score =   297 bits (761),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 148/179 (83%), Positives = 168/179 (94%), Gaps = 0/179 (0%)
 Frame = +3

Query  225  NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  404
            N +QA C+V++RP SKSTYRRINRL AELLWLELVWL+DWWA V+V+++TDPETF+ MGK
Sbjct  24   NVLQATCFVLVRPLSKSTYRRINRLVAELLWLELVWLVDWWARVQVKVFTDPETFRQMGK  83

Query  405  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  584
            EHAL++ NH+SDIDW+VGWVLAQR+GCLGSTLAVMKKSS  LPVIGWSM+FSEYLFLERS
Sbjct  84   EHALVVCNHKSDIDWLVGWVLAQRAGCLGSTLAVMKKSSKMLPVIGWSMWFSEYLFLERS  143

Query  585  WAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            WAKDEST+K GL+RL+DYPLPFWLALFVEGTRFTQAKLLAAQEYA STGLP+PRNVLIP
Sbjct  144  WAKDESTIKLGLERLKDYPLPFWLALFVEGTRFTQAKLLAAQEYATSTGLPVPRNVLIP  202



>gb|KFK35863.1| hypothetical protein AALP_AA4G046700 [Arabis alpina]
Length=376

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N IQ + ++++RPFS+S Y RIN+  AELLWL+L+WL+DWWA +K+ LY D
Sbjct  15   LFLVSGLIVNLIQLVFFIIVRPFSRSLYGRINKNVAELLWLQLIWLVDWWACIKINLYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET +LMGKEHAL++ NHRSDIDW++GWV+AQRSGCLGSTLA+MKK + YLP+IGWSM+F
Sbjct  75   EETLELMGKEHALVLCNHRSDIDWLLGWVMAQRSGCLGSTLAIMKKEAKYLPIIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+FLER+WAKDE+TLK+G KRL+D+P+ FWLALFVEGTRFTQ KL AAQ+YA+S GLP
Sbjct  135  SDYIFLERNWAKDENTLKAGFKRLEDFPMTFWLALFVEGTRFTQEKLEAAQDYASSRGLP  194

Query  738  IPRNVLIP  761
             PRNVLIP
Sbjct  195  SPRNVLIP  202



>ref|XP_004486963.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
isoform X1 [Cicer arietinum]
Length=390

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N +QAI +V++RP S+  YRRIN++  E LWLEL+WL+DWWAGVKV+LY D
Sbjct  15   LFILSGLIVNVLQAIIFVLVRPISRYCYRRINKVLTESLWLELIWLVDWWAGVKVELYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+LMGKE+ALLI NHRSDIDW++GWVLAQR+GCLG+T+A+MKK   YLPVIGWSM+F
Sbjct  75   SETFQLMGKENALLICNHRSDIDWLIGWVLAQRTGCLGNTIAIMKKEVKYLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +E+LFLER+WAKDE+ LKSG K+L+  P+PFW+ALFVEGTRFT  KLLAAQE+A S G+P
Sbjct  135  AEFLFLERNWAKDEAALKSGFKQLEHKPVPFWMALFVEGTRFTHTKLLAAQEFAISRGMP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_003547001.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
isoform X1 [Glycine max]
Length=381

 Score =   297 bits (760),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N IQA+ +V++RP SK+ Y RIN+L  E LWLEL+WLIDWWAG+K++LYTD
Sbjct  15   LFILSGLIVNIIQAVFFVLLRPLSKNCYSRINKLLTESLWLELIWLIDWWAGIKIELYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET +LMGKE+AL+I NHRSDIDW++GWVLAQRSGCLGST+A+MKK   +LPV+GWSM+F
Sbjct  75   SETLQLMGKENALVICNHRSDIDWLIGWVLAQRSGCLGSTVAIMKKEVKFLPVLGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +EY+FLER WAKDE++LKSG + L+  P PFWLALFVEGTRFTQ KLL AQE+AAS GLP
Sbjct  135  AEYIFLERDWAKDETSLKSGFRHLEHMPFPFWLALFVEGTRFTQTKLLQAQEFAASKGLP  194

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  195  IPRNVLIP  202



>ref|XP_007150370.1| hypothetical protein PHAVU_005G147900g [Phaseolus vulgaris]
 gb|ESW22364.1| hypothetical protein PHAVU_005G147900g [Phaseolus vulgaris]
Length=379

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N IQAI ++++RP SK+ YRR+N+L  E LWL+L+WLIDWWAG+K++L+TD
Sbjct  14   LFILSGLIVNIIQAIFFLLLRPISKNCYRRVNKLLTESLWLQLIWLIDWWAGIKIELHTD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+LMGKE+AL+I NHRSDIDW++GWVLAQRSGCLGST+A+MKK   +LPV+GWSM+F
Sbjct  74   SETFQLMGKENALVICNHRSDIDWLIGWVLAQRSGCLGSTVAIMKKEIKFLPVLGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +EY+FLER+W KDE++LKS  K L+  PLPFWLALFVEGTRFTQ KLL AQE+AAS GLP
Sbjct  134  AEYIFLERNWKKDETSLKSNFKHLEHMPLPFWLALFVEGTRFTQTKLLQAQEFAASKGLP  193

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  194  IPRNVLIP  201



>ref|XP_003575968.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Brachypodium distachyon]
Length=374

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 138/179 (77%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +3

Query  225  NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  404
            NAIQA+ +++IRPFSK  YR+IN   AELLWL+L+WL+DWWAGVKVQL+ D ET++ MGK
Sbjct  24   NAIQAVLFLLIRPFSKRLYRQINVFVAELLWLQLIWLVDWWAGVKVQLHADQETYESMGK  83

Query  405  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  584
            EHALLISNHRSDIDW+VGW+LAQRSGCLGS +A+MKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  84   EHALLISNHRSDIDWLVGWILAQRSGCLGSAIAIMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  585  WAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            WAKDE TLKSGL+RL+D+P  FWLALFVEGTR+T AKLLAAQEYA S GL  PRNVLIP
Sbjct  144  WAKDEKTLKSGLQRLKDFPRSFWLALFVEGTRYTPAKLLAAQEYAVSQGLTAPRNVLIP  202



>gb|KHN33345.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Glycine soja]
Length=381

 Score =   296 bits (759),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N IQA+ +V++RP SK+ Y RIN+L  E LWLEL+WLIDWWAG+K++LYTD
Sbjct  15   LFILSGLIVNIIQAVFFVLLRPLSKNCYSRINKLLTESLWLELIWLIDWWAGIKIELYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET +LMGKE+AL+I NHRSDIDW++GWVLAQRSGCLGST+A+MKK   +LPV+GWSM+F
Sbjct  75   SETLQLMGKENALVICNHRSDIDWLIGWVLAQRSGCLGSTVAIMKKEVKFLPVLGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +EY+FLER WAKDE++LKSG + L+  P PFWLALFVEGTRFTQ KLL AQE+AAS GLP
Sbjct  135  AEYIFLERDWAKDETSLKSGFRHLEHMPFPFWLALFVEGTRFTQTKLLQAQEFAASKGLP  194

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  195  IPRNVLIP  202



>ref|XP_002298406.2| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase family protein 
[Populus trichocarpa]
 gb|EEE83211.2| acyl-CoA:1-acylglycerol-3-phosphate acyltransferase family protein 
[Populus trichocarpa]
Length=382

 Score =   296 bits (758),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N IQA+ ++++RP SKS +RRIN++ AELLWLEL+ L+DWWA +K+++Y D
Sbjct  15   IFILSGLIVNLIQAVLFILVRPVSKSLHRRINKIVAELLWLELIVLVDWWANLKIEVYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+L+GKEHAL+ISNH SD+DW+VGW+LAQRSGCLGS LAVMKK +  LP+IGWSM+F
Sbjct  75   DETFELLGKEHALVISNHNSDLDWLVGWILAQRSGCLGSALAVMKKEAKVLPIIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+FLERSW KDE  L+SG +RL D+P+PFWLALFVEGTRFTQAKLLAAQE+AAS G+P
Sbjct  135  SDYVFLERSWGKDERILQSGFERLADFPMPFWLALFVEGTRFTQAKLLAAQEFAASRGIP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_011006209.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 isoform 
X3 [Populus euphratica]
Length=340

 Score =   295 bits (754),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N IQA+ ++++RP SKS +RRIN++ AELLWLEL+ L+DWWA +K+++Y D
Sbjct  15   IFILSGLIVNLIQAVLFILVRPLSKSLHRRINKIVAELLWLELIVLVDWWANLKIEVYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+L+GKEHAL+ISNH+SD+DW+VGW+LAQRSGCLGS LAVMKK +  LP+IGWSM+F
Sbjct  75   DETFELLGKEHALVISNHKSDLDWLVGWILAQRSGCLGSALAVMKKEAKVLPIIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+FLERSW KDE TL+SG + L+D+P+PFWLALFVEGTRFTQAKLLAAQE+AAS G P
Sbjct  135  SDYVFLERSWGKDERTLQSGFEWLEDFPMPFWLALFVEGTRFTQAKLLAAQEFAASRGSP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_011006208.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 isoform 
X2 [Populus euphratica]
Length=382

 Score =   295 bits (756),  Expect = 7e-95, Method: Compositional matrix adjust.
 Identities = 132/188 (70%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N IQA+ ++++RP SKS +RRIN++ AELLWLEL+ L+DWWA +K+++Y D
Sbjct  15   IFILSGLIVNLIQAVLFILVRPLSKSLHRRINKIVAELLWLELIVLVDWWANLKIEVYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+L+GKEHAL+ISNH+SD+DW+VGW+LAQRSGCLGS LAVMKK +  LPVIGWSM+F
Sbjct  75   DETFELLGKEHALVISNHKSDLDWLVGWILAQRSGCLGSALAVMKKEAKVLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+FLERSW KDE TL+SG + L+D+P+PFWLALFVEGTRFTQAKLLAAQE+AAS G P
Sbjct  135  SDYVFLERSWGKDERTLQSGFEWLEDFPMPFWLALFVEGTRFTQAKLLAAQEFAASRGSP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_007028850.1| Lysophosphatidyl acyltransferase 2 [Theobroma cacao]
 gb|EOY09352.1| Lysophosphatidyl acyltransferase 2 [Theobroma cacao]
Length=401

 Score =   296 bits (757),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 151/202 (75%), Positives = 175/202 (87%), Gaps = 14/202 (7%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N IQA+C+V+IRP SK+TYR+INR+ AELLWLELVWL+DWWAGVK++++ D
Sbjct  15   LFFISGLVVNLIQALCFVLIRPLSKNTYRKINRVVAELLWLELVWLVDWWAGVKIKVFMD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLP--------  533
            PE+F LMGKEHAL+++NHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LP        
Sbjct  75   PESFNLMGKEHALVVANHRSDIDWLVGWLLAQRSGCLGSALAVMKKSSKFLPVYVVVICL  134

Query  534  ------VIGWSMFFSEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAK  695
                  VIGWSM+FSEYLFLERSWAKDE+TLK+GL+RL+D+P PFWLA FVEGTRFTQAK
Sbjct  135  KFQLSIVIGWSMWFSEYLFLERSWAKDENTLKAGLQRLKDFPRPFWLAFFVEGTRFTQAK  194

Query  696  LLAAQEYAASTGLPIPRNVLIP  761
             LAAQEYAAS GLPIPRNVLIP
Sbjct  195  FLAAQEYAASQGLPIPRNVLIP  216



>ref|XP_003597431.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Medicago truncatula]
 gb|AES67682.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase-like protein [Medicago 
truncatula]
Length=376

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 161/188 (86%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N IQAI +V +RP S+  YRRIN +  E LWLEL+WLIDWWAGVKV+LY D
Sbjct  15   IFILSGLIINVIQAIFFVFVRPISRYCYRRINNVLTESLWLELIWLIDWWAGVKVELYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+LMGKE+ALLI NHRSDIDW++GWVLAQR+GCLGST+A+MKK   YLPVIGWSM+F
Sbjct  75   SETFQLMGKENALLICNHRSDIDWLIGWVLAQRTGCLGSTIAIMKKEFKYLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +EYLFLER+WAKDES+LKSG K L+  P+PFW+ALFVEGTRFT  KLLAAQE+A S G+P
Sbjct  135  AEYLFLERNWAKDESSLKSGFKLLEHKPVPFWVALFVEGTRFTHTKLLAAQEFAISRGIP  194

Query  738  IPRNVLIP  761
            +P+NVLIP
Sbjct  195  VPKNVLIP  202



>ref|XP_011006207.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 isoform 
X1 [Populus euphratica]
Length=382

 Score =   295 bits (755),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N IQA+ ++++RP SKS +RRIN++ AELLWLEL+ L+DWWA +K+++Y D
Sbjct  15   IFILSGLIVNLIQAVLFILVRPLSKSLHRRINKIVAELLWLELIVLVDWWANLKIEVYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+L+GKEHAL+ISNH+SD+DW+VGW+LAQRSGCLGS LAVMKK +  LP+IGWSM+F
Sbjct  75   DETFELLGKEHALVISNHKSDLDWLVGWILAQRSGCLGSALAVMKKEAKVLPIIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+FLERSW KDE TL+SG + L+D+P+PFWLALFVEGTRFTQAKLLAAQE+AAS G P
Sbjct  135  SDYVFLERSWGKDERTLQSGFEWLEDFPMPFWLALFVEGTRFTQAKLLAAQEFAASRGSP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|NP_175537.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Arabidopsis 
thaliana]
 sp|Q9SYC8.1|LPAT3_ARATH RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
3; AltName: Full=Lysophosphatidyl acyltransferase 3 [Arabidopsis 
thaliana]
 gb|AAD30638.1|AC006085_11 Putative acyl-CoA:1-acylglycerol-3-phosphate acyltransferase 
[Arabidopsis thaliana]
 gb|AEE32642.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Arabidopsis 
thaliana]
Length=376

 Score =   294 bits (752),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF ISGL  N IQ + ++++RPFS+S YRRIN+  AELLWL+L+WL DWWA +K+ LY D
Sbjct  15   LFLISGLIVNIIQLVFFIIVRPFSRSLYRRINKNVAELLWLQLIWLFDWWACIKINLYVD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET +L+GKEHAL++SNHRSDIDW++GWV+AQR GCLGS+LA+MKK + YLP+IGWSM+F
Sbjct  75   AETLELIGKEHALVLSNHRSDIDWLIGWVMAQRVGCLGSSLAIMKKEAKYLPIIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+FLERSWAKDE+TLK+G KRL+D+P+ FWLALFVEGTRFTQ KL AAQEYA+   LP
Sbjct  135  SDYIFLERSWAKDENTLKAGFKRLEDFPMTFWLALFVEGTRFTQEKLEAAQEYASIRSLP  194

Query  738  IPRNVLIP  761
             PRNVLIP
Sbjct  195  SPRNVLIP  202



>ref|XP_002526730.1| lysophosphatidic acid acyltransferase, putative [Ricinus communis]
 gb|ACC59198.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Ricinus communis]
 gb|EEF35644.1| lysophosphatidic acid acyltransferase, putative [Ricinus communis]
 gb|AFR42413.1| A-class lysophosphatidate acyltransferase-2 [Ricinus communis]
Length=395

 Score =   294 bits (753),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 149/188 (79%), Positives = 171/188 (91%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF+SGL  N  QAIC+V+IRP SKS+YR INR  AELLWLELVWL+DWWA +K+Q+YTD
Sbjct  15   LFFLSGLVVNLFQAICFVLIRPISKSSYRMINRALAELLWLELVWLVDWWAKIKIQVYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET  LMGKEHAL+++NHRSDIDW+VGW+LAQR+GCLGS LAVMKKSS +LPVIGWSM+F
Sbjct  75   RETLCLMGKEHALILANHRSDIDWLVGWMLAQRAGCLGSALAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLERSWAKDESTLKSG++RL+D+P PFWL LFVEGTRFT+AKLLAAQ+YAAS GLP
Sbjct  135  SEYLFLERSWAKDESTLKSGIQRLKDFPRPFWLGLFVEGTRFTKAKLLAAQQYAASQGLP  194

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  195  IPRNVLIP  202



>ref|XP_002894307.1| hypothetical protein ARALYDRAFT_474240 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70566.1| hypothetical protein ARALYDRAFT_474240 [Arabidopsis lyrata subsp. 
lyrata]
Length=376

 Score =   293 bits (750),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF ISGL  N IQ + ++++RPFS+S YRRIN+  AELLWL+L+WL DWWA +K+ LY D
Sbjct  15   LFLISGLIVNIIQLVFFIIVRPFSRSLYRRINKNVAELLWLQLIWLFDWWACIKINLYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET +L+GKEHAL++SNHRSDIDW++GWV+AQR+GCLGS+LA+MKK + YLP+IGWSM+F
Sbjct  75   AETLELIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPIIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+FLERSWAKDE+TLK+G KRL+D+P+ FWLALFVEGTRFTQ KL AAQ+YA+   LP
Sbjct  135  SDYIFLERSWAKDENTLKAGFKRLEDFPMTFWLALFVEGTRFTQEKLEAAQDYASIRSLP  194

Query  738  IPRNVLIP  761
             PRNVLIP
Sbjct  195  SPRNVLIP  202



>emb|CDP18472.1| unnamed protein product [Coffea canephora]
Length=377

 Score =   293 bits (750),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 133/179 (74%), Positives = 160/179 (89%), Gaps = 0/179 (0%)
 Frame = +3

Query  225  NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  404
            N IQA+ ++++RP SK+ +RRIN+   ELLWLE+VWL DWWA +KV+LYTDPETF+ +GK
Sbjct  23   NFIQALIFILVRPLSKNLFRRINKEVTELLWLEIVWLFDWWANIKVELYTDPETFEFLGK  82

Query  405  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  584
            EHALLI NHRSDIDW+VGWVLAQR GCLGSTLA++KK+++YLPV+GWSM+F+ Y+FLERS
Sbjct  83   EHALLICNHRSDIDWLVGWVLAQRFGCLGSTLALIKKAALYLPVLGWSMWFNNYIFLERS  142

Query  585  WAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            W KDE TLKSGL+ L D+P PFWLALFVEGTRFTQAKLLAAQEYAAS GLP+P+NVLIP
Sbjct  143  WTKDEYTLKSGLQGLNDFPRPFWLALFVEGTRFTQAKLLAAQEYAASAGLPVPQNVLIP  201



>gb|ADE75797.1| unknown [Picea sitchensis]
Length=385

 Score =   292 bits (748),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 144/188 (77%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N IQA+CY+++RPFSK+ YR  NR+ AELLWLELVWL DWWAGVK+++Y D
Sbjct  15   LFLLSGLIVNCIQALCYIILRPFSKNLYRMANRVVAELLWLELVWLFDWWAGVKIRIYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            P   + MGKEHAL+ISNHRSD+DW+VGWVLAQRSGCLGS LAVMKKSS +LPV+GWSM+F
Sbjct  75   PGILQHMGKEHALVISNHRSDVDWLVGWVLAQRSGCLGSALAVMKKSSKFLPVMGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEY+FLER+WAKDE+TLKSGLK+L+D+P PFWLALFVEGTRFT AKLLAAQEYA S GLP
Sbjct  135  SEYVFLERNWAKDETTLKSGLKKLRDFPRPFWLALFVEGTRFTNAKLLAAQEYAESVGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_010479592.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
[Camelina sativa]
Length=376

 Score =   292 bits (747),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 161/188 (86%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF ISGL  N IQ + ++ +RPFS+S YRRIN+  AELLWL+L+WL DWWA +K+ LY D
Sbjct  15   LFLISGLIVNIIQLVFFITVRPFSRSLYRRINKTVAELLWLQLIWLFDWWACIKINLYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET +L+GKEHAL++SNHRSDIDW++GWV+AQR+GCLGS+LA+MKK + YLP+IGWSM+F
Sbjct  75   AETLELIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPIIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+FLERSWAKDE+ LK+G KRL+D+P+ FWLALFVEGTRFTQ KL AAQEYA+   +P
Sbjct  135  SDYIFLERSWAKDENNLKAGFKRLEDFPMTFWLALFVEGTRFTQEKLEAAQEYASIRSIP  194

Query  738  IPRNVLIP  761
             PRNVLIP
Sbjct  195  SPRNVLIP  202



>ref|XP_010461958.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Camelina 
sativa]
Length=376

 Score =   291 bits (745),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 161/188 (86%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF ISGL  N IQ + ++ +RPFS+S YRRIN+  AELLWL+L+WL DWWA +K+ LY D
Sbjct  15   LFLISGLIVNIIQLVFFITVRPFSRSWYRRINKTVAELLWLQLIWLFDWWACIKINLYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET +L+GKEHAL++SNHRSDIDW++GWV+AQR+GCLGS+LA+MKK + YLP+IGWSM+F
Sbjct  75   AETLELIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPIIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+FLERSWAKDE+ LK+G KRL+D+P+ FWLALFVEGTRFTQ KL AAQEYA+   LP
Sbjct  135  SDYIFLERSWAKDENNLKAGFKRLEDFPMTFWLALFVEGTRFTQEKLEAAQEYASFRSLP  194

Query  738  IPRNVLIP  761
             PRNVLIP
Sbjct  195  SPRNVLIP  202



>ref|XP_010031802.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Eucalyptus grandis]
Length=380

 Score =   291 bits (745),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 166/188 (88%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N +QA  YV+IRP SK TYR+IN++ AELL LEL+WL DWWAG+KV+LY D
Sbjct  15   LFILSGLLVNLVQAFFYVLIRPLSKKTYRKINKVVAELLLLELIWLFDWWAGIKVELYMD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             +TF++MGKEHALLI NHRSDIDW+VGWV+AQR+GCLGS LA+MKK + +LPV+GWSM+F
Sbjct  75   SQTFEMMGKEHALLICNHRSDIDWLVGWVIAQRAGCLGSALAIMKKEAKFLPVVGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+F++R WAKDE+TLKSG +RL D+P+PFWLALFVEGTRFTQAKL AAQEYAAS GLP
Sbjct  135  SDYVFVDRCWAKDENTLKSGFERLSDFPMPFWLALFVEGTRFTQAKLQAAQEYAASRGLP  194

Query  738  IPRNVLIP  761
            +PRNVL+P
Sbjct  195  LPRNVLLP  202



>ref|XP_003636648.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Medicago truncatula]
Length=438

 Score =   291 bits (744),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 148/185 (80%), Positives = 167/185 (90%), Gaps = 4/185 (2%)
 Frame = +3

Query  219  FTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKV----QLYTDPET  386
            + + + AICYV++RP SK+ YRRINR+ AELLWLELVWLIDWWAGVKV    ++YTD ET
Sbjct  51   YIHELHAICYVLVRPLSKNLYRRINRVVAELLWLELVWLIDWWAGVKVLKQVEIYTDRET  110

Query  387  FKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEY  566
             +LMGKEHAL+I NHRSDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+FSEY
Sbjct  111  SRLMGKEHALVICNHRSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEY  170

Query  567  LFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPR  746
            LFLERSWAKDE+TLKSG++RL D+PLPFWLALFVEGTRFT  KLLAAQEYA STGLP+PR
Sbjct  171  LFLERSWAKDENTLKSGIRRLNDFPLPFWLALFVEGTRFTNVKLLAAQEYATSTGLPVPR  230

Query  747  NVLIP  761
            NVLIP
Sbjct  231  NVLIP  235



>ref|XP_006304715.1| hypothetical protein CARUB_v10012002mg [Capsella rubella]
 gb|EOA37613.1| hypothetical protein CARUB_v10012002mg [Capsella rubella]
Length=376

 Score =   288 bits (737),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 161/188 (86%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N IQ   ++++RPFS+S YRRIN+  AELLWL+L+WL  WWA +K+ LY D
Sbjct  15   LFLVSGLIVNIIQLFFFIIVRPFSRSLYRRINKTIAELLWLQLIWLFHWWACIKINLYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET + +GKEHAL++SNHRSDIDW++GWV+AQR+GCLGS+LA+MKK + YLP+IGWSM+F
Sbjct  75   AETLEFIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPIIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+FLERSWAKDE+TL++G KRL+D+P+ FWLALFVEGTRFTQ KL AAQEYA++  +P
Sbjct  135  SDYIFLERSWAKDENTLEAGFKRLEDFPMTFWLALFVEGTRFTQEKLEAAQEYASTRSIP  194

Query  738  IPRNVLIP  761
             PRNVLIP
Sbjct  195  SPRNVLIP  202



>ref|XP_009395596.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Musa acuminata subsp. malaccensis]
Length=374

 Score =   288 bits (736),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 142/181 (78%), Positives = 164/181 (91%), Gaps = 0/181 (0%)
 Frame = +3

Query  219  FTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLM  398
              N +QA+C++ IR FSKS YRRINR+ AELLWL+LVWL+DWWAGVK+Q+Y D +TF+ M
Sbjct  22   IVNVVQAVCFITIRLFSKSLYRRINRVLAELLWLQLVWLVDWWAGVKIQVYADSKTFESM  81

Query  399  GKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLE  578
            G+EHAL+ISNHRSDIDW+VGW+LAQRSGCLGS LAVMKKSS +LPVIGWSM+F+EYLFLE
Sbjct  82   GEEHALVISNHRSDIDWLVGWILAQRSGCLGSALAVMKKSSKFLPVIGWSMWFAEYLFLE  141

Query  579  RSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLI  758
            RSWAKDE+TLK GL+RL+D+P PFWLALFVEGTRFT AKLLAAQEYAAS GLP PRNVLI
Sbjct  142  RSWAKDETTLKLGLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQEYAASQGLPTPRNVLI  201

Query  759  P  761
            P
Sbjct  202  P  202



>ref|XP_010237505.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
isoform X2 [Brachypodium distachyon]
Length=310

 Score =   285 bits (730),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 163/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  219  FTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLM  398
              NA+QA+ +V IRPFSKS YRRINR  AELLWL+LVWL+DWWAGVK+QL+ D E+++ M
Sbjct  22   IVNAVQAVLFVSIRPFSKSFYRRINRFLAELLWLQLVWLVDWWAGVKIQLHADEESYQSM  81

Query  399  GKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLE  578
            GKEHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLE
Sbjct  82   GKEHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLE  141

Query  579  RSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLI  758
            RSWAKDE TLK GL+RL+D+P PFWLALFVEGTRFT AKLLAAQEYA S GLP PRNVLI
Sbjct  142  RSWAKDEKTLKWGLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQEYAVSQGLPAPRNVLI  201

Query  759  P  761
            P
Sbjct  202  P  202



>ref|XP_002513487.1| lysophosphatidic acid acyltransferase, putative [Ricinus communis]
 gb|EEF48890.1| lysophosphatidic acid acyltransferase, putative [Ricinus communis]
Length=381

 Score =   288 bits (736),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 168/188 (89%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF+SG   N IQA+ ++++RP SKS +RRIN++ AELLWLEL+WL+DWWA +K+++Y D
Sbjct  15   LFFVSGFVVNLIQAVLFILVRPVSKSLHRRINKIVAELLWLELIWLVDWWAHLKIEVYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+LMGKEHALLI NHRSDIDW+VGW+LAQRSGCLGS LAVMKK +  LP+IGWSM+F
Sbjct  75   DETFELMGKEHALLICNHRSDIDWLVGWILAQRSGCLGSALAVMKKQAKVLPIIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+YLFLERSWAKDE+TLKSG KRL+D+P+PFWLALFVEGTRFT+AKL AAQEYA + GLP
Sbjct  135  SDYLFLERSWAKDETTLKSGFKRLEDFPMPFWLALFVEGTRFTEAKLQAAQEYAVTRGLP  194

Query  738  IPRNVLIP  761
            IPRNVL+P
Sbjct  195  IPRNVLLP  202



>ref|XP_010500700.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
[Camelina sativa]
Length=376

 Score =   287 bits (734),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 158/188 (84%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF ISGL  N IQ + ++ +RPFS+S YRRIN+  AELLWL+L+WL DWWA +K+ LY D
Sbjct  15   LFLISGLIVNIIQLVFFITVRPFSRSLYRRINKTVAELLWLQLIWLFDWWACIKINLYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET + +GKEHAL++SNHRSDIDW++GWV+AQR+GCLGS+LA+MKK + YLP+IGWSM+F
Sbjct  75   AETLERIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPIIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y FLERSWAKDE+ LK+G KRL+D+P+ FWLALFVEGTRFTQ KL  AQEYA+   LP
Sbjct  135  SDYSFLERSWAKDENNLKAGFKRLEDFPMTFWLALFVEGTRFTQEKLEVAQEYASIRSLP  194

Query  738  IPRNVLIP  761
             PRNVLIP
Sbjct  195  SPRNVLIP  202



>gb|ABA94922.2| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAH01342.1| unnamed protein product [Oryza sativa Japonica Group]
Length=374

 Score =   286 bits (733),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  225  NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  404
            NAIQA+ ++ IRPFSKS YRRINR  AELLWL+LVWL+DWWAGVK+QL+ D ET+K MG 
Sbjct  24   NAIQAVLFLSIRPFSKSLYRRINRFLAELLWLQLVWLVDWWAGVKIQLHADDETYKAMGN  83

Query  405  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  584
            EHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  84   EHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  585  WAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            WAKDE TLK GL+RL+D+P PFWLALFVEGTRFT AKLLAAQEYA S GLP PRNVLIP
Sbjct  144  WAKDEKTLKWGLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQEYAVSQGLPAPRNVLIP  202



>gb|EEC68515.1| hypothetical protein OsI_36790 [Oryza sativa Indica Group]
Length=374

 Score =   286 bits (733),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  225  NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  404
            NAIQA+ ++ IRPFSKS YRRINR  AELLWL+LVWL+DWWAGVK+QL+ D ET+K MG 
Sbjct  24   NAIQAVLFLSIRPFSKSLYRRINRFLAELLWLQLVWLVDWWAGVKIQLHADDETYKAMGN  83

Query  405  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  584
            EHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  84   EHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  585  WAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            WAKDE TLK GL+RL+D+P PFWLALFVEGTRFT AKLLAAQEYA S GLP PRNVLIP
Sbjct  144  WAKDEKTLKWGLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQEYAVSQGLPAPRNVLIP  202



>ref|XP_004503603.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
[Cicer arietinum]
Length=380

 Score =   286 bits (733),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 162/188 (86%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N IQ + +V+ RP S+  YR+IN++  E+LWLEL+WL+DWWAGVK++LYTD
Sbjct  15   LFILSGLIVNVIQVVIFVLFRPISRYYYRKINKVLTEILWLELIWLVDWWAGVKIELYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+L+G+E+ALLI NHRSDIDW++GW LAQRSGCLGST+A+MKK   YLPV+GWSM+F
Sbjct  75   SETFELLGRENALLICNHRSDIDWLIGWTLAQRSGCLGSTVAIMKKEVKYLPVLGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +++LFLER+WAKDE TLK+G K+    P+PFW+ALFVEGTRFTQ+KLLAAQ++A S G+P
Sbjct  135  ADFLFLERNWAKDEVTLKTGFKQQVQNPVPFWMALFVEGTRFTQSKLLAAQDFAISRGMP  194

Query  738  IPRNVLIP  761
            +P+NVL+P
Sbjct  195  VPKNVLVP  202



>ref|XP_002894308.1| hypothetical protein ARALYDRAFT_892094 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70567.1| hypothetical protein ARALYDRAFT_892094 [Arabidopsis lyrata subsp. 
lyrata]
Length=504

 Score =   290 bits (742),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N+IQ + ++++RPFS+S YRRIN+  AELLWL+L+WL DWWA +K+ LY D
Sbjct  15   LFLVSGLIVNSIQLVFFIIVRPFSRSLYRRINKNVAELLWLQLIWLSDWWACIKINLYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET +L+GKEHAL++SNHRSDIDW++GWV+AQR+GCLGS+LA+M K + YLP+IGWSM+F
Sbjct  75   AETLELIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMAKEAKYLPIIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+FLERSWAKDE+TLK+G KRL+D+P+ FWLALFVEGTRFTQ KL AAQ+YA+   LP
Sbjct  135  SDYIFLERSWAKDENTLKAGFKRLEDFPMTFWLALFVEGTRFTQEKLEAAQDYASIRSLP  194

Query  738  IPRNVLIP  761
             PRNVLIP
Sbjct  195  SPRNVLIP  202



>ref|XP_008813484.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X2 [Phoenix dactylifera]
Length=343

 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  225  NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  404
            N IQA C+V+IRPFSK+ YR+INR+ AELLWL+LVWL+DWWAGVKV LY D ET+K +GK
Sbjct  24   NLIQATCFVMIRPFSKNLYRKINRVVAELLWLQLVWLVDWWAGVKVHLYADSETYKSLGK  83

Query  405  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  584
            EHAL+I NHRSDIDW+VGW+LAQRSGCLGST+AVMKKSS +LPVIGWSM+F+EYLFLER+
Sbjct  84   EHALVICNHRSDIDWLVGWILAQRSGCLGSTIAVMKKSSKFLPVIGWSMWFAEYLFLERN  143

Query  585  WAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            WAKDE+TLK GL+R +D+P PFWLALFVEGTRFT  KLLAAQEYAAS GLP PRNVLIP
Sbjct  144  WAKDENTLKLGLQRFRDFPRPFWLALFVEGTRFTPTKLLAAQEYAASQGLPTPRNVLIP  202



>ref|XP_003577308.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
isoform X1 [Brachypodium distachyon]
Length=374

 Score =   285 bits (730),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 163/180 (91%), Gaps = 0/180 (0%)
 Frame = +3

Query  222  TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMG  401
             NA+QA+ +V IRPFSKS YRRINR  AELLWL+LVWL+DWWAGVK+QL+ D E+++ MG
Sbjct  23   VNAVQAVLFVSIRPFSKSFYRRINRFLAELLWLQLVWLVDWWAGVKIQLHADEESYQSMG  82

Query  402  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  581
            KEHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLER
Sbjct  83   KEHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLER  142

Query  582  SWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            SWAKDE TLK GL+RL+D+P PFWLALFVEGTRFT AKLLAAQEYA S GLP PRNVLIP
Sbjct  143  SWAKDEKTLKWGLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQEYAVSQGLPAPRNVLIP  202



>gb|EEE52425.1| hypothetical protein OsJ_34550 [Oryza sativa Japonica Group]
Length=409

 Score =   286 bits (733),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 144/179 (80%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  225  NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  404
            NAIQA+ ++ IRPFSKS YRRINR  AELLWL+LVWL+DWWAGVK+QL+ D ET+K MG 
Sbjct  24   NAIQAVLFLSIRPFSKSLYRRINRFLAELLWLQLVWLVDWWAGVKIQLHADDETYKAMGN  83

Query  405  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  584
            EHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  84   EHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLERS  143

Query  585  WAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            WAKDE TLK GL+RL+D+P PFWLALFVEGTRFT AKLLAAQEYA S GLP PRNVLIP
Sbjct  144  WAKDEKTLKWGLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQEYAVSQGLPAPRNVLIP  202



>ref|XP_008813483.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X1 [Phoenix dactylifera]
Length=374

 Score =   284 bits (727),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 141/179 (79%), Positives = 162/179 (91%), Gaps = 0/179 (0%)
 Frame = +3

Query  225  NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  404
            N IQA C+V+IRPFSK+ YR+INR+ AELLWL+LVWL+DWWAGVKV LY D ET+K +GK
Sbjct  24   NLIQATCFVMIRPFSKNLYRKINRVVAELLWLQLVWLVDWWAGVKVHLYADSETYKSLGK  83

Query  405  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  584
            EHAL+I NHRSDIDW+VGW+LAQRSGCLGST+AVMKKSS +LPVIGWSM+F+EYLFLER+
Sbjct  84   EHALVICNHRSDIDWLVGWILAQRSGCLGSTIAVMKKSSKFLPVIGWSMWFAEYLFLERN  143

Query  585  WAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            WAKDE+TLK GL+R +D+P PFWLALFVEGTRFT  KLLAAQEYAAS GLP PRNVLIP
Sbjct  144  WAKDENTLKLGLQRFRDFPRPFWLALFVEGTRFTPTKLLAAQEYAASQGLPTPRNVLIP  202



>ref|XP_006663068.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Oryza brachyantha]
Length=374

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 143/181 (79%), Positives = 162/181 (90%), Gaps = 0/181 (0%)
 Frame = +3

Query  219  FTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLM  398
              NAIQA+ ++ IRPFSK+ YRRINR  AELLWL+LVWL+DWWAGVK+QL+ D ET+K M
Sbjct  22   IVNAIQAVLFLSIRPFSKNLYRRINRFLAELLWLQLVWLVDWWAGVKIQLHADDETYKSM  81

Query  399  GKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLE  578
            G EHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLE
Sbjct  82   GTEHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLE  141

Query  579  RSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLI  758
            RSWAKDE TLK GL+RL+D+P PFWLALFVEGTRFT AKLLAAQEYAAS  LP PRNVLI
Sbjct  142  RSWAKDEKTLKWGLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQEYAASQSLPAPRNVLI  201

Query  759  P  761
            P
Sbjct  202  P  202



>ref|XP_011080283.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Sesamum indicum]
Length=377

 Score =   283 bits (725),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 143/188 (76%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SG   N IQA+ +V+IRP SKS YRRIN+   ELLWLEL+WL DWWA +KV+L+ D
Sbjct  14   LFLLSGFIVNLIQAVLFVLIRPVSKSAYRRINKEIIELLWLELIWLFDWWANIKVELFVD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF L+GKE ALLI NHRSDIDW+VGWVLAQR+GCLGS+LA++KKSS++LPVIGWSM+F
Sbjct  74   QETFDLLGKERALLICNHRSDIDWLVGWVLAQRAGCLGSSLAMIKKSSLFLPVIGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+FLERSWAKDE+TLKSGL  L DYPLPFWLALFVEGTRFTQAKL AAQEYAAS GLP
Sbjct  134  SDYIFLERSWAKDENTLKSGLVALNDYPLPFWLALFVEGTRFTQAKLEAAQEYAASAGLP  193

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  194  VPRNVLIP  201



>ref|XP_008801931.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
isoform X2 [Phoenix dactylifera]
Length=343

 Score =   282 bits (722),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N IQA C+V+IRP SK+ YR+INR+ AELLWL+LVWL+DWWAGVKVQLY D
Sbjct  15   LFLLSGLVVNLIQATCFVMIRPLSKNLYRKINRVVAELLWLQLVWLLDWWAGVKVQLYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET+  +GKEHAL+I NHRSDIDW+VGW+LAQRSGCLGS +AVMKK+S +LPVIGWSM+F
Sbjct  75   SETYASLGKEHALVICNHRSDIDWLVGWILAQRSGCLGSAIAVMKKTSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +EYLFLERSWAKDE+TLK GL+R +D+P PFWLALFVEGTRFT AKLLAAQEYAAS GLP
Sbjct  135  AEYLFLERSWAKDENTLKLGLQRFRDFPRPFWLALFVEGTRFTPAKLLAAQEYAASQGLP  194

Query  738  IPRNVLIP  761
             PRNVLIP
Sbjct  195  TPRNVLIP  202



>ref|XP_010673624.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X1 [Beta vulgaris subsp. vulgaris]
Length=383

 Score =   283 bits (724),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N IQAI YV++RP SK+ +RR N++ AELLWLE VWL DWWAGVKV+L+TD
Sbjct  15   LFLMSGLIINLIQAILYVLVRPLSKNMHRRFNKVVAELLWLETVWLFDWWAGVKVELHTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF LMGKEHALLI NHRSDIDW++GWVLAQR+GCLG T+A+MK    YLPVIGWSM+F
Sbjct  75   SETFHLMGKEHALLICNHRSDIDWLIGWVLAQRAGCLGCTMAIMKDVLKYLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEY+F++R W  D+STL SG + L+D+P+PFWLALFVEGTRFTQ+KLL AQ++A S GL 
Sbjct  135  SEYIFIKRRWDVDQSTLTSGCENLKDFPVPFWLALFVEGTRFTQSKLLDAQQHARSKGLD  194

Query  738  IPRNVLIP  761
            +P++VL+P
Sbjct  195  VPKHVLLP  202



>ref|XP_009375057.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Pyrus 
x bretschneideri]
Length=380

 Score =   282 bits (721),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 170/188 (90%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N +Q +C++++RP SKS YR+IN++ AELLWLEL+WLIDWWAG+KV+LY D
Sbjct  15   LFILSGLIVNLMQIVCFLLVRPVSKSMYRKINKVVAELLWLELIWLIDWWAGIKVELYVD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             +TF+LMG+EHAL+ISNH+SDIDW+VGW++AQR+GCLGS LA++KK  ++LPVIGWSM+F
Sbjct  75   SKTFQLMGQEHALVISNHKSDIDWLVGWLVAQRTGCLGSALAIIKKEIMFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+FLER W KDESTLKSG +RL+D+P+PFWLALFVEGTRFTQAKL+ AQE+AAS GLP
Sbjct  135  SDYVFLERRWTKDESTLKSGFRRLEDFPMPFWLALFVEGTRFTQAKLMVAQEFAASRGLP  194

Query  738  IPRNVLIP  761
            IPRNVL+P
Sbjct  195  IPRNVLLP  202



>ref|XP_008801930.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
isoform X1 [Phoenix dactylifera]
Length=374

 Score =   281 bits (718),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 145/188 (77%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N IQA C+V+IRP SK+ YR+INR+ AELLWL+LVWL+DWWAGVKVQLY D
Sbjct  15   LFLLSGLVVNLIQATCFVMIRPLSKNLYRKINRVVAELLWLQLVWLLDWWAGVKVQLYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET+  +GKEHAL+I NHRSDIDW+VGW+LAQRSGCLGS +AVMKK+S +LPVIGWSM+F
Sbjct  75   SETYASLGKEHALVICNHRSDIDWLVGWILAQRSGCLGSAIAVMKKTSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +EYLFLERSWAKDE+TLK GL+R +D+P PFWLALFVEGTRFT AKLLAAQEYAAS GLP
Sbjct  135  AEYLFLERSWAKDENTLKLGLQRFRDFPRPFWLALFVEGTRFTPAKLLAAQEYAASQGLP  194

Query  738  IPRNVLIP  761
             PRNVLIP
Sbjct  195  TPRNVLIP  202



>ref|XP_006597258.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
isoform X2 [Glycine max]
Length=450

 Score =   283 bits (724),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 128/185 (69%), Positives = 157/185 (85%), Gaps = 0/185 (0%)
 Frame = +3

Query  207  ISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPET  386
            ++G      QA+ +V++RP SK+ Y RIN+L  E LWLEL+WLIDWWAG+K++LYTD ET
Sbjct  87   LAGGGEAVAQAVFFVLLRPLSKNCYSRINKLLTESLWLELIWLIDWWAGIKIELYTDSET  146

Query  387  FKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEY  566
             +LMGKE+AL+I NHRSDIDW++GWVLAQRSGCLGST+A+MKK   +LPV+GWSM+F+EY
Sbjct  147  LQLMGKENALVICNHRSDIDWLIGWVLAQRSGCLGSTVAIMKKEVKFLPVLGWSMWFAEY  206

Query  567  LFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPR  746
            +FLER WAKDE++LKSG + L+  P PFWLALFVEGTRFTQ KLL AQE+AAS GLPIPR
Sbjct  207  IFLERDWAKDETSLKSGFRHLEHMPFPFWLALFVEGTRFTQTKLLQAQEFAASKGLPIPR  266

Query  747  NVLIP  761
            NVLIP
Sbjct  267  NVLIP  271



>ref|XP_006446109.1| hypothetical protein CICLE_v10015539mg [Citrus clementina]
 gb|ESR59349.1| hypothetical protein CICLE_v10015539mg [Citrus clementina]
Length=390

 Score =   280 bits (715),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/188 (74%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N+IQA+ +V++RP SK  YRRIN++  ELLWLEL+WLIDWWA +KV+LY D
Sbjct  15   LFILSGLIVNSIQAVLFVLVRPASKRVYRRINKIIVELLWLELIWLIDWWACIKVELYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+LMGKEHAL+I NHRSDIDW+VGWV+AQR GCLGSTLA++KK + +LP IGWSM+F
Sbjct  75   AETFQLMGKEHALVICNHRSDIDWLVGWVVAQRKGCLGSTLAIIKKEAKHLPFIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEY+FLER W KDE TLKSG KRL D+P+PFWLAL+VEGTRFT+AKLLAAQEYA S GLP
Sbjct  135  SEYVFLERRWNKDEQTLKSGFKRLVDFPMPFWLALYVEGTRFTEAKLLAAQEYALSRGLP  194

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  195  IPRNVLIP  202



>ref|XP_006470598.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X1 [Citrus sinensis]
Length=426

 Score =   280 bits (716),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N+IQA+ ++++RP SK  YRRIN++  ELLWLEL+WLIDWWA +KV+LY D
Sbjct  52   LFILSGLIVNSIQAVLFILVRPASKRVYRRINKIIVELLWLELIWLIDWWACIKVELYAD  111

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+LMGKEHAL+I NHRSDIDW+VGWV+AQR GCLGSTLA++KK + +LP IGWSM+F
Sbjct  112  AETFQLMGKEHALVICNHRSDIDWLVGWVVAQRKGCLGSTLAIIKKEAKHLPFIGWSMWF  171

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEY+FLER W KDE TLKSG KRL D+P+PFWLAL+VEGTRFT+AKLLAAQEYA S GLP
Sbjct  172  SEYVFLERRWNKDEQTLKSGFKRLVDFPMPFWLALYVEGTRFTEAKLLAAQEYALSRGLP  231

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  232  IPRNVLIP  239



>ref|XP_010909860.1| PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-glycerol-3-phosphate 
acyltransferase PLS1-like [Elaeis guineensis]
Length=373

 Score =   278 bits (710),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 140/180 (78%), Positives = 161/180 (89%), Gaps = 0/180 (0%)
 Frame = +3

Query  222  TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMG  401
             N IQA C+V+IRPFSK+ YR+INR+ AELLWL+LVWL+DWWAGVKVQLY D ET+K +G
Sbjct  23   VNLIQATCFVMIRPFSKNLYRKINRVVAELLWLQLVWLVDWWAGVKVQLYADSETYKSLG  82

Query  402  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  581
            KEHAL+I NH+SDIDW+V W+LAQRSGCLGST+AVMKKSS +L VIGWSM+F+EYLFLER
Sbjct  83   KEHALVICNHKSDIDWLVRWILAQRSGCLGSTVAVMKKSSKFLRVIGWSMWFAEYLFLER  142

Query  582  SWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            SWAKDE+TLK GL+R +D+P PFWLALFVEGT FT AKLLAAQEYAAS GLP PRNVLIP
Sbjct  143  SWAKDENTLKLGLQRFRDFPRPFWLALFVEGTHFTLAKLLAAQEYAASQGLPTPRNVLIP  202



>ref|XP_010906759.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
[Elaeis guineensis]
Length=374

 Score =   276 bits (706),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 145/180 (81%), Positives = 162/180 (90%), Gaps = 0/180 (0%)
 Frame = +3

Query  222  TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMG  401
             N IQA C+V+IRP SK+ YRRINR+ AELLWLELVWL+DWWAGVKVQLY D ET+  +G
Sbjct  23   VNLIQATCFVMIRPLSKNLYRRINRVVAELLWLELVWLLDWWAGVKVQLYADSETYASLG  82

Query  402  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  581
            KEHAL+I NHRSDIDW+VGW+LAQRSGCLGST+AVMKKSS +LPVIGWSM+F+EYLFLER
Sbjct  83   KEHALVICNHRSDIDWLVGWILAQRSGCLGSTIAVMKKSSKFLPVIGWSMWFAEYLFLER  142

Query  582  SWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            SWAKDESTLK GL+R +D+P PFWLALFVEGTRFT AKLLAAQEYAAS GLP PRNVLIP
Sbjct  143  SWAKDESTLKLGLQRFRDFPRPFWLALFVEGTRFTPAKLLAAQEYAASQGLPAPRNVLIP  202



>ref|XP_007214575.1| hypothetical protein PRUPE_ppa019921mg [Prunus persica]
 gb|EMJ15774.1| hypothetical protein PRUPE_ppa019921mg [Prunus persica]
Length=380

 Score =   276 bits (707),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 165/188 (88%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N +Q + ++++RP SK  YR+IN++ AELLWLEL+WLIDWWAG+KV+LY D
Sbjct  15   VFILSGLIVNLMQVVSFILLRPISKKLYRKINKVVAELLWLELIWLIDWWAGIKVELYVD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             +TF+LMGKEHAL+I NHRSDIDW+VGW++AQRSGCLGS LA+MKK  ++LPVIGWSM+F
Sbjct  75   SDTFQLMGKEHALVICNHRSDIDWLVGWLVAQRSGCLGSALAIMKKEVMFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEY FLER W KDE TLKSG ++L+D+P+PFWLALFVEGTRFTQAKL+ AQE+AAS GLP
Sbjct  135  SEYFFLERRWTKDEITLKSGFQQLEDFPMPFWLALFVEGTRFTQAKLMVAQEFAASRGLP  194

Query  738  IPRNVLIP  761
            IPRNVL+P
Sbjct  195  IPRNVLLP  202



>ref|XP_006361745.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Solanum tuberosum]
Length=377

 Score =   276 bits (705),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 130/188 (69%), Positives = 155/188 (82%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N IQA+ ++++RPFS + +RRIN+  AELLWLE+VWL DWWA VKV+LYTD
Sbjct  14   LFLLSGLIINFIQALLFILVRPFSNNIFRRINKEVAELLWLEIVWLFDWWANVKVELYTD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET+ +MGKE AL+ISNHRSDIDW+VGWVLAQR GCLG+T+A+ KKS  YLPV+GWSM+F
Sbjct  74   QETYGIMGKEPALIISNHRSDIDWLVGWVLAQRVGCLGNTIALAKKSLSYLPVLGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S  + LERSW KDE+ LKSG + L D+  PFWLA+FVEGTRFT  KLLAAQEYA S G P
Sbjct  134  SCCISLERSWNKDENILKSGFQELNDFHQPFWLAVFVEGTRFTHTKLLAAQEYAVSVGKP  193

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  194  IPRNVLIP  201



>ref|XP_006393066.1| hypothetical protein EUTSA_v10011593mg [Eutrema salsugineum]
 gb|ESQ30352.1| hypothetical protein EUTSA_v10011593mg [Eutrema salsugineum]
Length=365

 Score =   275 bits (703),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF ISGL  N IQ + ++++RPFS+S YRRIN+  AELLWL+L+WLIDWWA +K+ LY D
Sbjct  15   LFLISGLIVNLIQLVFFIIVRPFSRSLYRRINKTVAELLWLQLIWLIDWWACIKINLYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET +L+GKEHAL++SNHRSDIDW++GWV+AQR+GCLGS+LA+MKK + YLP+IGWSM+F
Sbjct  75   AETLELIGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPIIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+FLERSWAKDE+TLK+G KRL+D+P+ FWLALFVEGTRFTQ KL AAQ+YA+   LP
Sbjct  135  SDYIFLERSWAKDENTLKAGFKRLEDFPMTFWLALFVEGTRFTQEKLEAAQDYASIRSLP  194

Query  738  IPRNVLIP  761
             PRNVLIP
Sbjct  195  TPRNVLIP  202



>ref|XP_010545584.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Tarenaya 
hassleriana]
 ref|XP_010545585.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Tarenaya 
hassleriana]
Length=380

 Score =   275 bits (702),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N IQ +  +++ P S++ YRRIN+   ELLW++L+WL+DWWA  KV LY D
Sbjct  15   LFLVSGLIVNIIQVVLVIIVLPISRNLYRRINKAVVELLWMQLIWLVDWWAATKVNLYID  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET + +GKEHALLI NHRSDIDW++GWVLAQR+GCLGS+LA+MKK + YLP+IGWSM+F
Sbjct  75   AETLESLGKEHALLICNHRSDIDWLIGWVLAQRAGCLGSSLAMMKKEAKYLPIIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEY+FLERSW+KDE+TLK+GLK+L+++P PFWLALFVEGTRFTQ KL AA+EYA+S GLP
Sbjct  135  SEYIFLERSWSKDETTLKTGLKQLENFPTPFWLALFVEGTRFTQQKLEAAKEYASSRGLP  194

Query  738  IPRNVLIP  761
             PRNVLIP
Sbjct  195  SPRNVLIP  202



>ref|XP_007015031.1| Lysophosphatidyl acyltransferase 3 [Theobroma cacao]
 gb|EOY32650.1| Lysophosphatidyl acyltransferase 3 [Theobroma cacao]
Length=379

 Score =   274 bits (701),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N IQA+  V++RP SKS YRR N++  ELLWLEL+WLIDWWA +K+ LYTD
Sbjct  15   LFILSGLIVNLIQAVLLVLLRPLSKSLYRRTNKVIVELLWLELIWLIDWWASIKIDLYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              TF+LMGKEHAL+I NHRSDIDW+VGWVLAQRS CLGS LA++K+S+ +LP+IGWSM+F
Sbjct  75   AATFQLMGKEHALVICNHRSDIDWLVGWVLAQRSSCLGSALAIIKRSAKFLPIIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+FLERSWAKD+ TLK G K+L+D+P+PFWLALFVEGTRFTQAKLL AQ+YA S GLP
Sbjct  135  SDYVFLERSWAKDKETLKFGFKQLEDFPMPFWLALFVEGTRFTQAKLLLAQDYATSKGLP  194

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  195  IPRNVLIP  202



>gb|EYU46266.1| hypothetical protein MIMGU_mgv1a026523mg, partial [Erythranthe 
guttata]
Length=351

 Score =   272 bits (695),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 164/188 (87%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N +QAI  V++RP SK+ YRRIN+   ELLWLEL+WL DWWA +KV+L+ D
Sbjct  14   MFLLSGLIVNLLQAILLVLVRPLSKNAYRRINKQLIELLWLELIWLFDWWANIKVELFAD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF ++GKE ALLI NHRSDIDW+VGWVLAQR+GCLGS+LA++KKSS++LPVIGWSM+F
Sbjct  74   EETFAMLGKEPALLICNHRSDIDWLVGWVLAQRAGCLGSSLAMIKKSSLFLPVIGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S ++FLER+WAKDE+T+KSG + L  +P+PFWLALFVEGTRFTQAKLLAAQEYAAS GLP
Sbjct  134  SGFIFLERNWAKDENTMKSGFEALNGFPIPFWLALFVEGTRFTQAKLLAAQEYAASAGLP  193

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  194  VPRNVLIP  201



>ref|XP_004139036.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 [Cucumis 
sativus]
 gb|KGN66490.1| hypothetical protein Csa_1G613620 [Cucumis sativus]
Length=380

 Score =   273 bits (697),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 135/188 (72%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N IQA  +V++RP SK  YRRIN++ AELLWLEL+WLIDWWA  KV++YTD
Sbjct  15   LFILSGLIVNVIQAFIFVLVRPISKCLYRRINKVVAELLWLELIWLIDWWAEAKVEVYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              TF+LMGKEHAL++ NHRSDIDW+VGWVLAQR+GCLGS LA+MKK + +LPVIGWSM+F
Sbjct  75   QATFQLMGKEHALVLCNHRSDIDWLVGWVLAQRAGCLGSALAIMKKEAKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+FLERSWAKDESTL+S  + L D+ +PFWLALFVEGTRFTQ KLLA+QEYAA+ GLP
Sbjct  135  SDYIFLERSWAKDESTLESSFQSLMDFSMPFWLALFVEGTRFTQQKLLASQEYAAARGLP  194

Query  738  IPRNVLIP  761
            +P+NVLIP
Sbjct  195  VPKNVLIP  202



>ref|XP_004250948.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
[Solanum lycopersicum]
Length=377

 Score =   271 bits (692),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/188 (67%), Positives = 153/188 (81%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N IQ + ++++RPFSK+ +RRIN+  AELLWLE++WL DWWA VKV+LYTD
Sbjct  14   IFLLSGLIINFIQVVLFILVRPFSKNIFRRINKEVAELLWLEIIWLFDWWANVKVELYTD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET+ ++GKE AL+ISNHRSDIDW+VGWVLAQR GCLG T+A+ KKS  YLPV+GWSM+F
Sbjct  74   QETYGILGKEPALIISNHRSDIDWLVGWVLAQRVGCLGYTIALAKKSLSYLPVLGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S  + LERSW KDE+ LKSG + L  +  PFWLA+FVEGTRFT  KLLAAQEYA S G P
Sbjct  134  SSLISLERSWNKDENILKSGFRELNGFHQPFWLAVFVEGTRFTHTKLLAAQEYAVSVGKP  193

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  194  IPRNVLIP  201



>ref|XP_008377433.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Malus 
domestica]
Length=380

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            L  +SGL  N +Q +  +++RP SKS YR+IN++ AELLWLEL+WLIDWWAG+KV+LY D
Sbjct  15   LLVLSGLIVNLMQIVFSILVRPVSKSMYRKINKVVAELLWLELIWLIDWWAGIKVELYVD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+LMGKE ALLISNH+SDIDW+VGW++AQRSGCLGSTLA+MKK  +++P IGWSM+F
Sbjct  75   SETFQLMGKERALLISNHKSDIDWLVGWLVAQRSGCLGSTLAIMKKEIMFIPFIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEY+FLER W KDE TLKS  +RL+D+P PFWLALFVEGTRFTQAKL+ AQE+AAS GLP
Sbjct  135  SEYVFLERQWTKDEKTLKSCFRRLEDFPGPFWLALFVEGTRFTQAKLMVAQEFAASRGLP  194

Query  738  IPRNVLIP  761
            IPRNVL+P
Sbjct  195  IPRNVLLP  202



>ref|XP_002443267.1| hypothetical protein SORBIDRAFT_08g016610 [Sorghum bicolor]
 gb|EES17105.1| hypothetical protein SORBIDRAFT_08g016610 [Sorghum bicolor]
Length=374

 Score =   270 bits (691),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 143/180 (79%), Positives = 160/180 (89%), Gaps = 0/180 (0%)
 Frame = +3

Query  222  TNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMG  401
             NAIQAI  V +RP SKS YRRINR   ELLWL+L+WL+DWWA VKVQL+ D ET++LMG
Sbjct  23   VNAIQAILLVSVRPLSKSLYRRINRFLVELLWLQLIWLLDWWAVVKVQLHADQETYQLMG  82

Query  402  KEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLER  581
            KEHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLA+MKKSS +LPVIGWSM+FSEYLFLER
Sbjct  83   KEHALIISNHRSDIDWLIGWILAQRSGCLGSTLAIMKKSSKFLPVIGWSMWFSEYLFLER  142

Query  582  SWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            SWAKDE TLK GL+RL+D+P  FWLALFVEGTRFT AKLLAAQEYAAS GLP PRNVLIP
Sbjct  143  SWAKDEKTLKWGLRRLKDFPRSFWLALFVEGTRFTPAKLLAAQEYAASQGLPAPRNVLIP  202



>ref|XP_008450418.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
[Cucumis melo]
Length=380

 Score =   270 bits (689),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 134/188 (71%), Positives = 163/188 (87%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N IQA  +V++RP SK  +RRIN++ AELLWLEL+WLIDWWA  KV+++TD
Sbjct  15   LFILSGLIVNIIQAFIFVLVRPISKCLFRRINKVVAELLWLELIWLIDWWAEAKVEVFTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              TF+LMGKEHAL++ NHRSDIDW+VGWVLAQR+GCLGS LA+MKK + +LPVIGWSM+F
Sbjct  75   QATFQLMGKEHALVLCNHRSDIDWLVGWVLAQRAGCLGSALAIMKKEAKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+FLERSWAKDE+TL+S  + L D+ +PFWLALFVEGTRFTQ KLLA+QEYAAS GLP
Sbjct  135  SDYIFLERSWAKDENTLESSFQSLMDFSMPFWLALFVEGTRFTQQKLLASQEYAASRGLP  194

Query  738  IPRNVLIP  761
            IP+NVLIP
Sbjct  195  IPKNVLIP  202



>emb|CDY03631.1| BnaC03g68900D [Brassica napus]
Length=378

 Score =   268 bits (684),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 149/188 (79%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFF+SGL  N IQ + ++ +RP S+S YR IN    ELLWL+L+WL+DWWA +KV LY D
Sbjct  45   LFFVSGLIINLIQLVLFIFVRPVSRSLYRGINTSVVELLWLQLIWLVDWWAFIKVNLYAD  104

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET +L+GKEHAL++SNHR DIDW+VGWV+AQ SGCLGSTLA+M+K + Y P+IGWSM+F
Sbjct  105  AETLELLGKEHALVLSNHRGDIDWLVGWVMAQHSGCLGSTLAIMRKEAKYFPIIGWSMWF  164

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEY+ LE++WAKDE  LK+G  +L+D+P  FWL LFVEGTRF Q  L AA+ YA+  GLP
Sbjct  165  SEYIILEKNWAKDEKILKAGFNQLKDFPTTFWLGLFVEGTRFNQKNLEAAKVYASLKGLP  224

Query  738  IPRNVLIP  761
             PRNVLIP
Sbjct  225  TPRNVLIP  232



>ref|XP_010102333.1| Xanthine dehydrogenase [Morus notabilis]
 gb|EXB93294.1| Xanthine dehydrogenase [Morus notabilis]
Length=1731

 Score =   285 bits (730),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 138/188 (73%), Positives = 167/188 (89%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF  SG   N +QA+ ++++RP SK TYRRIN++ AELLWLEL+WLIDWWAG+K++++TD
Sbjct  15   LFIFSGFLVNFLQAMLFILVRPISKRTYRRINKVIAELLWLELIWLIDWWAGIKIEVHTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF LMGKEHAL+ISNHRSDIDW+VGWVLAQR+GCLGS LA+MKK + +LP+IGWSM+F
Sbjct  75   SETFSLMGKEHALVISNHRSDIDWLVGWVLAQRAGCLGSALAIMKKEAKFLPIIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+FLER WA DESTLKSG +RL+D+P+PFWLALFVEGTRFTQAKL AAQ YAAS GLP
Sbjct  135  SDYVFLERKWAIDESTLKSGFRRLEDFPMPFWLALFVEGTRFTQAKLAAAQHYAASRGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>ref|XP_009144912.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3 [Brassica 
rapa]
 emb|CDY29625.1| BnaA05g15450D [Brassica napus]
Length=376

 Score =   267 bits (683),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/188 (68%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N IQ + ++++RPFSKS YRRIN+   ELLWL+L+WLIDWWA +KV +Y D
Sbjct  15   LFLVSGLIVNLIQLVFFIIVRPFSKSLYRRINKNVVELLWLQLIWLIDWWACIKVNIYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET +L+GKEHAL++SNHRSDIDW++GWV+AQR+GCLGS+LA+MKK + YLP+IGWSM+F
Sbjct  75   AETLQLLGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPIIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+FLERSW KDE TL +G KR +D+P+ FWLALFVEGTRFTQ KL AAQEYA+   LP
Sbjct  135  SDYIFLERSWDKDEKTLTAGFKRFEDFPMTFWLALFVEGTRFTQEKLEAAQEYASIRSLP  194

Query  738  IPRNVLIP  761
             PRNVLIP
Sbjct  195  SPRNVLIP  202



>emb|CDY35563.1| BnaC05g27180D [Brassica napus]
Length=376

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 158/188 (84%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N IQ + ++++RPFSKS YRRIN+   ELLWL+L+WLIDWWA +KV LY D
Sbjct  15   LFLVSGLIVNLIQLVFFIIVRPFSKSLYRRINKNVVELLWLQLIWLIDWWACIKVNLYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET +L+GKEHAL++SNHRSDIDW++GWV+AQR+GCLGS+LA+MKK + YLP+IGWSM+F
Sbjct  75   AETLQLLGKEHALVLSNHRSDIDWLIGWVMAQRAGCLGSSLAIMKKEAKYLPIIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S+Y+FLERSW KDE TL +G KR +D+P+ FWLALFVEGTRFTQ KL AAQEYA    LP
Sbjct  135  SDYIFLERSWDKDEKTLTAGFKRFEDFPMTFWLALFVEGTRFTQEKLEAAQEYAYIRSLP  194

Query  738  IPRNVLIP  761
             PRNVLIP
Sbjct  195  SPRNVLIP  202



>ref|XP_009615949.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 
[Nicotiana tomentosiformis]
Length=377

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 160/188 (85%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N IQA+ ++++RP SK+ YRRIN+   ELLWLEL+WL DWWA VKV+LYTD
Sbjct  14   LFLLSGLIINFIQALLFILVRPCSKNMYRRINKEVTELLWLELIWLFDWWANVKVELYTD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET+ LMGKEHAL+ISNHRSDIDW+VGWV+AQR GCLGST+A+ KKS  YLPV+GWSM+F
Sbjct  74   QETYGLMGKEHALVISNHRSDIDWLVGWVIAQRVGCLGSTIALAKKSLSYLPVLGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S Y+ LERSWAKDE+TLKSG ++L D+  PFWLA+FVEGTRFT  KLLAAQEYA S GLP
Sbjct  134  SGYISLERSWAKDENTLKSGFQQLNDFHQPFWLAVFVEGTRFTHTKLLAAQEYATSAGLP  193

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  194  IPRNVLIP  201



>emb|CDY65469.1| BnaA08g29540D [Brassica napus]
Length=358

 Score =   265 bits (676),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 149/188 (79%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N IQ + ++ +RP S++ YRR N    ELLWL+L+WL+DWWA +K+ LY D
Sbjct  47   LFLVSGLIINLIQLVLFIFVRPVSRNVYRRTNTSVVELLWLQLIWLVDWWAFMKINLYAD  106

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             E  +L+GKEHAL++SNHR DIDW+VGWV+AQRSGCLGSTLA+M+K + Y P+IGWSM+F
Sbjct  107  AEALELLGKEHALVLSNHRGDIDWLVGWVMAQRSGCLGSTLAIMRKEAKYFPIIGWSMWF  166

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEY+FLE++WAKDE  LK+G  +L+D+P   WL LFVEGTRF QA L AA+ YA+  GLP
Sbjct  167  SEYIFLEKNWAKDEKILKAGFNQLKDFPTTLWLGLFVEGTRFNQANLEAAKNYASLKGLP  226

Query  738  IPRNVLIP  761
             PR+VLIP
Sbjct  227  TPRSVLIP  234



>ref|XP_009773917.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Nicotiana sylvestris]
Length=377

 Score =   264 bits (675),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 136/188 (72%), Positives = 159/188 (85%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N IQA+ ++++RP SK+ YR IN+   ELLWLEL+WL DWWA VKV+LYTD
Sbjct  14   LFLLSGLIINFIQALLFILVRPCSKNIYRGINKEVTELLWLELIWLFDWWANVKVELYTD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF LMGKEHAL+ISNHRSDIDW+VGWV+AQR GCLGST+A+ KKS  YLPV+GWSM+F
Sbjct  74   QETFGLMGKEHALVISNHRSDIDWLVGWVIAQRVGCLGSTIALAKKSLSYLPVLGWSMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            S Y+ LERSWAKDE+TLKSG ++L D+  PFWLA+FVEGTRFT  KLLAAQEYA S GLP
Sbjct  134  SGYISLERSWAKDENTLKSGFQQLNDFHQPFWLAVFVEGTRFTHTKLLAAQEYATSAGLP  193

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  194  IPRNVLIP  201



>ref|XP_006470599.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X2 [Citrus sinensis]
 gb|KDO61277.1| hypothetical protein CISIN_1g016254mg [Citrus sinensis]
Length=392

 Score =   264 bits (674),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 133/188 (71%), Positives = 158/188 (84%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +S        A+ ++++RP SK  YRRIN++  ELLWLEL+WLIDWWA +KV+LY D
Sbjct  18   LFIVSAERQIPNSAVLFILVRPASKRVYRRINKIIVELLWLELIWLIDWWACIKVELYAD  77

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+LMGKEHAL+I NHRSDIDW+VGWV+AQR GCLGSTLA++KK + +LP IGWSM+F
Sbjct  78   AETFQLMGKEHALVICNHRSDIDWLVGWVVAQRKGCLGSTLAIIKKEAKHLPFIGWSMWF  137

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEY+FLER W KDE TLKSG KRL D+P+PFWLAL+VEGTRFT+AKLLAAQEYA S GLP
Sbjct  138  SEYVFLERRWNKDEQTLKSGFKRLVDFPMPFWLALYVEGTRFTEAKLLAAQEYALSRGLP  197

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  198  IPRNVLIP  205



>ref|XP_002268451.2| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Vitis vinifera]
Length=386

 Score =   262 bits (670),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 162/189 (86%), Gaps = 1/189 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYT-  374
            LF +SGL  N IQ   Y+++RP SK+ YRRIN++  ELLWLEL+WLIDWWAGVKV+++  
Sbjct  20   LFILSGLVVNLIQVAFYILVRPMSKNLYRRINKVVVELLWLELIWLIDWWAGVKVEVFAA  79

Query  375  DPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMF  554
            D ETF+LMGKEH+L+I NHRSDIDW+VGWVLAQRS CLGSTLAVMKKS  +LP+IGWSM+
Sbjct  80   DSETFELMGKEHSLVICNHRSDIDWLVGWVLAQRSNCLGSTLAVMKKSLKFLPIIGWSMW  139

Query  555  FSEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGL  734
            FS+Y+F+ERSWAKDE TLK GL+RL+D+P PFWLALFVEGTRFT  KL AA++YA S+ L
Sbjct  140  FSDYVFVERSWAKDERTLKWGLERLEDFPRPFWLALFVEGTRFTHTKLSAARQYAISSDL  199

Query  735  PIPRNVLIP  761
            PIP NVLIP
Sbjct  200  PIPSNVLIP  208



>emb|CBI21663.3| unnamed protein product [Vitis vinifera]
Length=402

 Score =   261 bits (668),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/189 (71%), Positives = 162/189 (86%), Gaps = 1/189 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYT-  374
            LF +SGL  N IQ   Y+++RP SK+ YRRIN++  ELLWLEL+WLIDWWAGVKV+++  
Sbjct  15   LFILSGLVVNLIQVAFYILVRPMSKNLYRRINKVVVELLWLELIWLIDWWAGVKVEVFAA  74

Query  375  DPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMF  554
            D ETF+LMGKEH+L+I NHRSDIDW+VGWVLAQRS CLGSTLAVMKKS  +LP+IGWSM+
Sbjct  75   DSETFELMGKEHSLVICNHRSDIDWLVGWVLAQRSNCLGSTLAVMKKSLKFLPIIGWSMW  134

Query  555  FSEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGL  734
            FS+Y+F+ERSWAKDE TLK GL+RL+D+P PFWLALFVEGTRFT  KL AA++YA S+ L
Sbjct  135  FSDYVFVERSWAKDERTLKWGLERLEDFPRPFWLALFVEGTRFTHTKLSAARQYAISSDL  194

Query  735  PIPRNVLIP  761
            PIP NVLIP
Sbjct  195  PIPSNVLIP  203



>ref|XP_006421452.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
 gb|ESR34692.1| hypothetical protein CICLE_v10005148mg [Citrus clementina]
Length=349

 Score =   256 bits (655),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 131/188 (70%), Positives = 141/188 (75%), Gaps = 38/188 (20%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N IQA+C+V IRP SK+TYRRINR  AELLWLELVW++DWWAGVK      
Sbjct  15   LFFISGLVVNLIQAVCFVTIRPLSKNTYRRINRWVAELLWLELVWIVDWWAGVK------  68

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
                                            RSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  69   --------------------------------RSGCLGSTLAVMKKSSKFLPVIGWSMWF  96

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+WAKDESTLKSGL+RL+DYP PFWLALFVEGTRFTQAKLLAAQEYAASTGLP
Sbjct  97   SEYLFLERNWAKDESTLKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  156

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  157  IPRNVLIP  164



>emb|CDY52093.1| BnaC04g55420D [Brassica napus]
Length=496

 Score =   258 bits (659),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 124/188 (66%), Positives = 144/188 (77%), Gaps = 25/188 (13%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFI GL  N + AICY                         LVW++DWWAGV ++++TD
Sbjct  14   LFFIFGLLVNLLLAICY-------------------------LVWIVDWWAGVTIKVFTD  48

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF  MGKEHAL++ NHRSDIDW+VGW+LAQRSGCLGS LAV KKSS +LPV GWSM+F
Sbjct  49   NETFNRMGKEHALVVCNHRSDIDWLVGWILAQRSGCLGSALAVTKKSSKFLPVKGWSMWF  108

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEYLFLER+W KDEST+KSGL+RL+D+P PFWLALFVEGTRFT+ KL AAQEYAAS+ LP
Sbjct  109  SEYLFLERNWVKDESTIKSGLQRLKDFPQPFWLALFVEGTRFTETKLKAAQEYAASSELP  168

Query  738  IPRNVLIP  761
            IPRNVLIP
Sbjct  169  IPRNVLIP  176



>ref|XP_010673625.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X2 [Beta vulgaris subsp. vulgaris]
Length=343

 Score =   251 bits (641),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 113/161 (70%), Positives = 139/161 (86%), Gaps = 0/161 (0%)
 Frame = +3

Query  279  YRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVG  458
            +RR N++ AELLWLE VWL DWWAGVKV+L+TD ETF LMGKEHALLI NHRSDIDW++G
Sbjct  2    HRRFNKVVAELLWLETVWLFDWWAGVKVELHTDSETFHLMGKEHALLICNHRSDIDWLIG  61

Query  459  WVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERSWAKDESTLKSGLKRLQDY  638
            WVLAQR+GCLG T+A+MK    YLPVIGWSM+FSEY+F++R W  D+STL SG + L+D+
Sbjct  62   WVLAQRAGCLGCTMAIMKDVLKYLPVIGWSMWFSEYIFIKRRWDVDQSTLTSGCENLKDF  121

Query  639  PLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            P+PFWLALFVEGTRFTQ+KLL AQ++A S GL +P++VL+P
Sbjct  122  PVPFWLALFVEGTRFTQSKLLDAQQHARSKGLDVPKHVLLP  162



>ref|XP_002969275.1| hypothetical protein SELMODRAFT_146320 [Selaginella moellendorffii]
 gb|EFJ29363.1| hypothetical protein SELMODRAFT_146320 [Selaginella moellendorffii]
Length=358

 Score =   251 bits (640),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 147/188 (78%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +FF SG   N +Q +C +V+ PFS+  +R +N    EL   +LVW+++WWAGV+V++Y D
Sbjct  1    MFFCSGFVVNLLQ-VCSLVLLPFSRGLFRAVNMSLFELASSQLVWMVEWWAGVEVRIYAD  59

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET K  GKEHAL+ISNHRSDIDW+VGW+ A R GCL  T A+MKKSS +LPVIGW M+F
Sbjct  60   EETRKHFGKEHALIISNHRSDIDWLVGWIFASRVGCLDGTRAIMKKSSKFLPVIGWGMWF  119

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +EY+FLER W KDE+TLK G +R +++P   W+ALFVEGTRFT+AKL AAQEYAAS GLP
Sbjct  120  TEYIFLERKWEKDENTLKIGFQRWKNFPRVLWVALFVEGTRFTEAKLKAAQEYAASAGLP  179

Query  738  IPRNVLIP  761
            +PRNVL+P
Sbjct  180  VPRNVLVP  187



>ref|XP_002986838.1| hypothetical protein SELMODRAFT_124776 [Selaginella moellendorffii]
 gb|EFJ12168.1| hypothetical protein SELMODRAFT_124776 [Selaginella moellendorffii]
Length=372

 Score =   251 bits (640),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 147/188 (78%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +FF SG   N +Q +C +V+ PFS+  +R +N    EL   +LVW+++WWAGV+V++Y D
Sbjct  15   MFFCSGFVVNLLQ-VCSLVLLPFSRGLFRAVNMSLFELASSQLVWMVEWWAGVEVRIYAD  73

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET K  GKEHAL+ISNHRSDIDW+VGW+ A R GCL  T A+MKKSS +LPVIGW M+F
Sbjct  74   EETRKHFGKEHALIISNHRSDIDWLVGWIFASRVGCLDGTRAIMKKSSKFLPVIGWGMWF  133

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +EY+FLER W KDE+TLK G +R +++P   W+ALFVEGTRFT+AKL AAQEYAAS GLP
Sbjct  134  TEYIFLERKWEKDENTLKIGFQRWKNFPRVLWVALFVEGTRFTEAKLKAAQEYAASAGLP  193

Query  738  IPRNVLIP  761
            +PRNVL+P
Sbjct  194  VPRNVLVP  201



>gb|KDO57199.1| hypothetical protein CISIN_1g0379582mg, partial [Citrus sinensis]
Length=152

 Score =   241 bits (615),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LFFISGL  N IQA+C+V IRP SK+TYRRINR  AELLWLELVW++DWWAGVK++L+ D
Sbjct  15   LFFISGLVVNLIQAVCFVTIRPLSKNTYRRINRWVAELLWLELVWIVDWWAGVKIKLFVD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET++LMGKEHAL++SNH+SDIDW+VGWVLAQRSGCLGSTLAVMKKSS +LPVIGWSM+F
Sbjct  75   RETYRLMGKEHALVVSNHKSDIDWLVGWVLAQRSGCLGSTLAVMKKSSKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLK  611
            SEYLFLER+WAKDESTLK
Sbjct  135  SEYLFLERNWAKDESTLK  152



>ref|XP_007212911.1| hypothetical protein PRUPE_ppa022232mg [Prunus persica]
 gb|EMJ14110.1| hypothetical protein PRUPE_ppa022232mg [Prunus persica]
Length=381

 Score =   247 bits (630),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 147/188 (78%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F + GLF N +QAIC++ IRP SKSTYR+IN   A LLWL+ +WL++WWAG+KV+LYTD
Sbjct  15   IFVVLGLFVNLLQAICFLTIRPLSKSTYRKINGTIASLLWLDHIWLLEWWAGLKVKLYTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET++LMG+EHALL+ NH  D D ++G++LAQR GCL S L VMKKS+ +LP+ GW+ +F
Sbjct  75   LETYRLMGEEHALLMPNHMCDADILIGFLLAQRLGCLRSALMVMKKSAKFLPIFGWTSWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
              ++FL RSW KDES LK  L+ L+D+P+PFWL +F EGTR T  KL  AQ++AAS  LP
Sbjct  135  LGFVFLNRSWEKDESNLKRSLQGLKDFPMPFWLTIFAEGTRMTPDKLSEAQKFAASRKLP  194

Query  738  IPRNVLIP  761
            IP+NVLIP
Sbjct  195  IPKNVLIP  202



>ref|XP_006493899.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2-like 
isoform X1 [Citrus sinensis]
Length=413

 Score =   246 bits (629),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 114/136 (84%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  354  VKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLP  533
            ++++L+ D ET++LMGKEHAL++SNH+SDIDW+VGWVL+QRSGCLGSTLAVMKKSS +LP
Sbjct  94   LQIKLFVDRETYRLMGKEHALVVSNHKSDIDWLVGWVLSQRSGCLGSTLAVMKKSSKFLP  153

Query  534  VIGWSMFFSEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQE  713
            VIGWSM+FSEYLFLER+W KDESTLKSGL+RL+DYP PFWLALFVEGTRFTQAKLLAAQE
Sbjct  154  VIGWSMWFSEYLFLERNWVKDESTLKSGLQRLRDYPQPFWLALFVEGTRFTQAKLLAAQE  213

Query  714  YAASTGLPIPRNVLIP  761
            YAASTGLPIPRNVLIP
Sbjct  214  YAASTGLPIPRNVLIP  229



>ref|XP_001764965.1| predicted protein [Physcomitrella patens]
 gb|EDQ70181.1| predicted protein [Physcomitrella patens]
Length=383

 Score =   243 bits (621),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 142/188 (76%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F  SG F N +Q +  + I PFS+  YR +N +  E+LW EL+WL+DWWA VKV   + 
Sbjct  15   MFLFSGFFINILQLLSVLFILPFSRRAYRVVNMIMMEVLWSELIWLLDWWANVKVSRLSG  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              +  L GKEHALLI NHRSDIDW+VGW++AQR GCLG T AVMKKS+ +LPVIGWSM+F
Sbjct  75   SLSISLFGKEHALLICNHRSDIDWLVGWIIAQRLGCLGGTRAVMKKSTKFLPVIGWSMWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SEY+FL R WAKDE  LK+G   L+ +P   W+ALFVEGTRFT+AKL AAQ++AA TGL 
Sbjct  135  SEYVFLSRDWAKDEKVLKNGYSSLKGFPRTLWVALFVEGTRFTKAKLEAAQKFAADTGLR  194

Query  738  IPRNVLIP  761
            +PR+VL+P
Sbjct  195  VPRHVLVP  202



>ref|XP_004486965.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
isoform X3 [Cicer arietinum]
Length=365

 Score =   242 bits (618),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/188 (60%), Positives = 140/188 (74%), Gaps = 25/188 (13%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N +QAI +V++RP S+  YRRIN++  E LWLEL+WL+DWWAGVKV+LY D
Sbjct  15   LFILSGLIVNVLQAIIFVLVRPISRYCYRRINKVLTESLWLELIWLVDWWAGVKVELYAD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ETF+LMGKE+ALLI NHRSDIDW++GWVLAQR+GCLG+T+A+MKK   YLPVIG+    
Sbjct  75   SETFQLMGKENALLICNHRSDIDWLIGWVLAQRTGCLGNTIAIMKKEVKYLPVIGF----  130

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
                                 K+L+  P+PFW+ALFVEGTRFT  KLLAAQE+A S G+P
Sbjct  131  ---------------------KQLEHKPVPFWMALFVEGTRFTHTKLLAAQEFAISRGMP  169

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  170  VPRNVLIP  177



>ref|XP_002513486.1| 1-acylglycerol-3-phosphate acyltransferase, putative [Ricinus 
communis]
 gb|EEF48889.1| 1-acylglycerol-3-phosphate acyltransferase, putative [Ricinus 
communis]
Length=376

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/188 (56%), Positives = 141/188 (75%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F  SGL  N IQ  CY++++P SK+ +RRI     E+LWLE ++L+DWW+G KV L+TD
Sbjct  15   VFLFSGLIINLIQGACYILVQPLSKTAHRRIIGAVTEILWLEFIFLMDWWSGFKVHLHTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET++LMGKEHALL+ NH  D D  + W+LAQRS CL   L V+K+SS+Y+P+ GW+ +F
Sbjct  75   FETYQLMGKEHALLMPNHICDADIFIMWLLAQRSSCLRGALMVVKRSSMYIPIYGWATWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +E++F+ R+W KDE  LKS  + LQD+P PFWL LFVEGTR T  KL+AAQ +A S GLP
Sbjct  135  AEHVFVSRNWGKDEEVLKSRFQSLQDFPRPFWLTLFVEGTRMTSDKLVAAQNFATSKGLP  194

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  195  VPRNVLIP  202



>gb|EMT23643.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Aegilops 
tauschii]
Length=439

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 117/179 (65%), Positives = 138/179 (77%), Gaps = 13/179 (7%)
 Frame = +3

Query  225  NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  404
            N +QA+ ++ IRPFSK  YR+IN   AELLWL+L+WL+DWWAG+KVQ+Y DPET+KLM  
Sbjct  24   NTVQAVLFLTIRPFSKRLYRQINVFLAELLWLQLIWLVDWWAGIKVQVYADPETWKLMVH  83

Query  405  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  584
                 + +              QRSGCLGS +A+MKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  84   YDESPVFD-------------GQRSGCLGSAIAIMKKSSKFLPVIGWSMWFAEYLFLERS  130

Query  585  WAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            WAKDE TLKSGL+RL+D+P  FWLALFVEGTRFT AKLLAAQEYA S GL  PRNVLIP
Sbjct  131  WAKDEKTLKSGLQRLKDFPRSFWLALFVEGTRFTPAKLLAAQEYAVSQGLTAPRNVLIP  189



>ref|XP_012090707.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Jatropha curcas]
Length=376

 Score =   237 bits (604),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 142/188 (76%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F  SG   N IQ  C+++IRPFSKS YR+I  +  E+LWL L+WL+DW AG+++ L+TD
Sbjct  15   IFLSSGFIVNIIQGSCFLLIRPFSKSAYRKIVGVVTEILWLTLIWLMDWRAGLEIHLFTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET+KLMGKEHAL++ NH SD D  + W+LAQR  CL S L V+KKSS+Y+P+ GW+ +F
Sbjct  75   SETYKLMGKEHALVMPNHISDADIFILWLLAQRFNCLRSALMVVKKSSMYIPIFGWAAWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             EY+F+ RSWAKDE  LKS L  LQD+P PFWL +F EGTR T  KL+A+Q++A S GLP
Sbjct  135  MEYVFMSRSWAKDEKNLKSRLIGLQDFPWPFWLTIFTEGTRLTPDKLVASQKFAISKGLP  194

Query  738  IPRNVLIP  761
            +P NVLIP
Sbjct  195  VPSNVLIP  202



>ref|XP_007015028.1| Lysophosphatidyl acyltransferase 2, putative isoform 2 [Theobroma 
cacao]
 gb|EOY32647.1| Lysophosphatidyl acyltransferase 2, putative isoform 2 [Theobroma 
cacao]
Length=374

 Score =   236 bits (602),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 105/188 (56%), Positives = 144/188 (77%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F   G   N IQ  CY+ IRP SKST+RRIN   +E+LWLELVWL++WW+G +V+L+TD
Sbjct  15   MFIFIGTIINLIQVACYLTIRPLSKSTFRRINGAVSEVLWLELVWLMEWWSGCEVKLHTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             +T++LMGKEHALL+ NH +D D ++ W+LAQR GCL S L + KKS+ YLP+ GW+ +F
Sbjct  75   LKTYRLMGKEHALLMPNHVADADTMLVWLLAQRMGCLRSALIISKKSTQYLPIFGWTTWF  134

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E++F++R+WAKD S LKS  + L+D+P+PFW+ +F EGTR T  KLL AQ +A++ GL 
Sbjct  135  YEFIFVDRNWAKDGSKLKSSFQALKDFPIPFWVTIFAEGTRLTPDKLLEAQTFASTKGLA  194

Query  738  IPRNVLIP  761
            IP+NVLIP
Sbjct  195  IPKNVLIP  202



>gb|AAF20003.1|AF213937_1 1-acyl-sn-glycerol-3-phosphate acyltransferase [Prunus dulcis]
Length=306

 Score =   232 bits (591),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 119/122 (98%), Gaps = 0/122 (0%)
 Frame = +3

Query  396  MGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFL  575
            MGKEHAL+ISNHRSDIDW+VGWVLAQRSGCLGS+LAVMKKSS +LPVIGWSM+FSEYLFL
Sbjct  1    MGKEHALVISNHRSDIDWLVGWVLAQRSGCLGSSLAVMKKSSKFLPVIGWSMWFSEYLFL  60

Query  576  ERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVL  755
            ERSWAKDE TLKSG++RL+D+P PFWLALFVEGTRFTQAKLLAAQEYAA+TGLP+PRNVL
Sbjct  61   ERSWAKDEGTLKSGVQRLKDFPQPFWLALFVEGTRFTQAKLLAAQEYAAATGLPVPRNVL  120

Query  756  IP  761
            IP
Sbjct  121  IP  122



>ref|XP_008227143.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Prunus mume]
Length=381

 Score =   233 bits (593),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 107/179 (60%), Positives = 138/179 (77%), Gaps = 0/179 (0%)
 Frame = +3

Query  225  NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  404
            N +QAIC++ IRP SKS YR+IN   A LLWL  + L++WWAG+KV+LYTD ET++LMGK
Sbjct  24   NLLQAICFLTIRPLSKSAYRKINGTVASLLWLVHICLLEWWAGLKVKLYTDLETYRLMGK  83

Query  405  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  584
            EHALL+ NH  D D ++G++LAQR GCL S L VMKKS+ YLP+ GW+ +F  ++FL RS
Sbjct  84   EHALLMPNHMCDADVLIGFLLAQRLGCLRSALMVMKKSAKYLPIFGWTSWFLGFVFLNRS  143

Query  585  WAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            W KDES LK  L+ L+D+P+PFWL ++ EGTR T  KL  AQ++AAS  LPIP+NVLIP
Sbjct  144  WEKDESNLKRSLQGLKDFPMPFWLTMYAEGTRMTPDKLSEAQKFAASRKLPIPKNVLIP  202



>gb|EMS63864.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1 [Triticum 
urartu]
Length=347

 Score =   231 bits (589),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 132/179 (74%), Gaps = 27/179 (15%)
 Frame = +3

Query  225  NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLMGK  404
            N +QA+ ++ IRPFSK  YR+IN   AELLWL+L+WL+DWWAG+KVQ+Y DP T+KLMG 
Sbjct  24   NTVQAVLFLTIRPFSKRLYRQINVFLAELLWLQLIWLVDWWAGIKVQVYADPATWKLMG-  82

Query  405  EHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERS  584
                                      CLGS +A+MKKSS +LPVIGWSM+F+EYLFLERS
Sbjct  83   --------------------------CLGSAIAIMKKSSKFLPVIGWSMWFAEYLFLERS  116

Query  585  WAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            WAKDE TLKSGL+RL+D+P  FWLALFVEGTRFT AKLLAAQEYA S GL  PRNVLIP
Sbjct  117  WAKDEKTLKSGLQRLKDFPRSFWLALFVEGTRFTPAKLLAAQEYAVSQGLTAPRNVLIP  175



>gb|ACU18782.1| unknown [Glycine max]
Length=297

 Score =   228 bits (581),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/122 (89%), Positives = 116/122 (95%), Gaps = 0/122 (0%)
 Frame = +3

Query  396  MGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFL  575
            MGKEHAL+ISNHR DIDW+VG V AQRSGCLGSTLAVMKKSS +LPVIGWSM+FSEYLFL
Sbjct  1    MGKEHALVISNHRGDIDWLVGRVSAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFSEYLFL  60

Query  576  ERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVL  755
            ERSWAKDESTLKSG++RL D+PLPFWLALFVEGTRFTQAKLLAAQEYA STGLP+PRNVL
Sbjct  61   ERSWAKDESTLKSGIQRLSDFPLPFWLALFVEGTRFTQAKLLAAQEYATSTGLPVPRNVL  120

Query  756  IP  761
            IP
Sbjct  121  IP  122



>gb|KJB16431.1| hypothetical protein B456_002G230000 [Gossypium raimondii]
Length=301

 Score =   226 bits (577),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 117/122 (96%), Gaps = 0/122 (0%)
 Frame = +3

Query  396  MGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFL  575
            MGKEHALL+ NHRSDIDW+VGWVLAQRSGCLGS++AVMKKSS +LPVIGWSM+FSEYLFL
Sbjct  1    MGKEHALLLPNHRSDIDWLVGWVLAQRSGCLGSSIAVMKKSSKFLPVIGWSMWFSEYLFL  60

Query  576  ERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVL  755
            ERSWAKDE+T+K+GL+RL+DYP PFWLALFVEGTRFTQAKL+AAQEYA S GLPIPRNVL
Sbjct  61   ERSWAKDENTIKAGLQRLRDYPQPFWLALFVEGTRFTQAKLVAAQEYATSQGLPIPRNVL  120

Query  756  IP  761
            IP
Sbjct  121  IP  122



>tpg|DAA42326.1| TPA: hypothetical protein ZEAMMB73_334173 [Zea mays]
Length=294

 Score =   223 bits (568),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +3

Query  396  MGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFL  575
            MGKEHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFL
Sbjct  1    MGKEHALIISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFL  60

Query  576  ERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVL  755
            ERSWAKDE TLK GL+RL+D+P PFWLALFVEGTRFT AKLLAAQEYAAS GLP PRNVL
Sbjct  61   ERSWAKDEKTLKWGLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQEYAASQGLPAPRNVL  120

Query  756  IP  761
            IP
Sbjct  121  IP  122



>gb|AFW60270.1| hypothetical protein ZEAMMB73_783506 [Zea mays]
Length=294

 Score =   223 bits (567),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 105/122 (86%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +3

Query  396  MGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFL  575
            MGKEHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFL
Sbjct  1    MGKEHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFL  60

Query  576  ERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVL  755
            ERSWAKDE TLK GL+RL+D+P PFWLALFVEGTRFT AKLLAAQEYAAS GLP PRNVL
Sbjct  61   ERSWAKDEKTLKWGLQRLKDFPRPFWLALFVEGTRFTPAKLLAAQEYAASQGLPAPRNVL  120

Query  756  IP  761
            IP
Sbjct  121  IP  122



>ref|XP_010672762.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=462

 Score =   228 bits (580),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 138/177 (78%), Gaps = 20/177 (11%)
 Frame = +3

Query  282  RRINRLFAE--LLWL-----ELVWLIDWWAGVKVQLYTDPET----------FKLMGKEH  410
            RR +R  AE  LLW       L+WL ++   + + L    E+          ++  GKEH
Sbjct  100  RRGDRSLAEAQLLWRLMVKPPLIWLGEY---IDIGLSEGEESTLSCSLKVSWYQPSGKEH  156

Query  411  ALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERSWA  590
            AL++ NH+SDIDW+VGWVLAQR+GCLGSTLAVMKKSS  LPVIGWSM+FSEYLFLERSWA
Sbjct  157  ALVVCNHKSDIDWLVGWVLAQRAGCLGSTLAVMKKSSKMLPVIGWSMWFSEYLFLERSWA  216

Query  591  KDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            KDEST+K GL+RL+DYPLPFWLALFVEGTRFTQAKLLAAQEYA STGLP+PRNVLIP
Sbjct  217  KDESTIKLGLERLKDYPLPFWLALFVEGTRFTQAKLLAAQEYATSTGLPVPRNVLIP  273


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = +3

Query  225  NAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDPETFKLM  398
            N +QA C+V++RP SKSTYRRINRL AELLWLELVWL+DWWA V+V+++TDPETF+ M
Sbjct  24   NVLQATCFVLVRPLSKSTYRRINRLVAELLWLELVWLVDWWARVQVKVFTDPETFRQM  81



>gb|KCW51192.1| hypothetical protein EUGRSUZ_J00779 [Eucalyptus grandis]
Length=308

 Score =   222 bits (565),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 98/129 (76%), Positives = 119/129 (92%), Gaps = 0/129 (0%)
 Frame = +3

Query  375  DPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMF  554
            D +TF++MGKEHALLI NHRSDIDW+VGWV+AQR+GCLGS LA+MKK + +LPV+GWSM+
Sbjct  2    DSQTFEMMGKEHALLICNHRSDIDWLVGWVIAQRAGCLGSALAIMKKEAKFLPVVGWSMW  61

Query  555  FSEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGL  734
            FS+Y+F++R WAKDE+TLKSG +RL D+P+PFWLALFVEGTRFTQAKL AAQEYAAS GL
Sbjct  62   FSDYVFVDRCWAKDENTLKSGFERLSDFPMPFWLALFVEGTRFTQAKLQAAQEYAASRGL  121

Query  735  PIPRNVLIP  761
            P+PRNVL+P
Sbjct  122  PLPRNVLLP  130



>gb|EYU39879.1| hypothetical protein MIMGU_mgv1a010933mg [Erythranthe guttata]
Length=297

 Score =   218 bits (554),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/122 (83%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  396  MGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFL  575
            MGKEHAL+I NH+SDIDW+VGWVLAQRSGCLGS+ AVMKKS   LPVIGW+M+FSE+LFL
Sbjct  1    MGKEHALVICNHKSDIDWLVGWVLAQRSGCLGSSFAVMKKSMKVLPVIGWAMWFSEHLFL  60

Query  576  ERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVL  755
            ERSWA DESTLKSGL+RL+D+P PFWLALFVEGTRFT AKLLAAQEYA+S GLP+PRNVL
Sbjct  61   ERSWATDESTLKSGLQRLKDFPQPFWLALFVEGTRFTHAKLLAAQEYASSVGLPVPRNVL  120

Query  756  IP  761
            IP
Sbjct  121  IP  122



>ref|XP_007015027.1| Lysophosphatidyl acyltransferase 2, putative isoform 1 [Theobroma 
cacao]
 gb|EOY32646.1| Lysophosphatidyl acyltransferase 2, putative isoform 1 [Theobroma 
cacao]
Length=367

 Score =   219 bits (559),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 101/188 (54%), Positives = 137/188 (73%), Gaps = 7/188 (4%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F   G   N IQ  CY+ IRP SKST+RRIN   +E+LWLELVWL++WW+G        
Sbjct  15   MFIFIGTIINLIQVACYLTIRPLSKSTFRRINGAVSEVLWLELVWLMEWWSGYL------  68

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             +T++LMGKEHALL+ NH +D D ++ W+LAQR GCL S L + KKS+ YLP+ GW+ +F
Sbjct  69   -KTYRLMGKEHALLMPNHVADADTMLVWLLAQRMGCLRSALIISKKSTQYLPIFGWTTWF  127

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E++F++R+WAKD S LKS  + L+D+P+PFW+ +F EGTR T  KLL AQ +A++ GL 
Sbjct  128  YEFIFVDRNWAKDGSKLKSSFQALKDFPIPFWVTIFAEGTRLTPDKLLEAQTFASTKGLA  187

Query  738  IPRNVLIP  761
            IP+NVLIP
Sbjct  188  IPKNVLIP  195



>ref|XP_011025521.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X2 [Populus euphratica]
Length=371

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 142/188 (76%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F ++G+  N IQA C+++I P SK+TYRRI     E+ +L + +L++W+AG++V L+TD
Sbjct  16   VFCLTGIAINIIQAACFLIIWPLSKNTYRRIVGAVTEIFFLVMTFLVNWFAGLEVHLHTD  75

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET++L+GKE+AL++ NH  D+D ++ W+LA+R  CL   L VMKKSS YLP+ GW+ +F
Sbjct  76   LETYELIGKENALVMPNHICDVDVLMMWLLAERFNCLRGVLMVMKKSSKYLPIYGWANWF  135

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +  +FL+R+WAKDE  LKS  + L+D+P  FWL +FVEGTR T  KLLAAQE+A S GLP
Sbjct  136  NGAVFLDRNWAKDEGKLKSSFRELKDFPGSFWLTIFVEGTRMTPDKLLAAQEFAISKGLP  195

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  196  VPRNVLIP  203



>ref|XP_008363635.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase 3-like 
[Malus domestica]
Length=385

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/193 (60%), Positives = 146/193 (76%), Gaps = 5/193 (3%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF +SGL  N +Q +C++++RP SK  YR+IN+L AELLWLEL+WLIDWWAG+K   +  
Sbjct  15   LFILSGLIVNLMQIVCFLLVRPVSKRMYRKINKLVAELLWLELIWLIDWWAGIKACFFLK  74

Query  378  PE-----TFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIG  542
                   T  L+    A L  + RS  +    W++ QRSGC GS LA++KK  ++LPVIG
Sbjct  75   VVHIYAFTSHLLNNIIADLSFSSRSFFEINAQWIVQQRSGCXGSALAIIKKEIMFLPVIG  134

Query  543  WSMFFSEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAA  722
            WSM+FSEY+FL+R W KDE TLKSG +RL+D+P+PFWLALFVEGTRFTQAKL+AAQE+AA
Sbjct  135  WSMWFSEYVFLQRRWTKDEXTLKSGFRRLEDFPMPFWLALFVEGTRFTQAKLMAAQEFAA  194

Query  723  STGLPIPRNVLIP  761
            S GLPIPRNVL+P
Sbjct  195  SRGLPIPRNVLLP  207



>ref|XP_011025520.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
isoform X1 [Populus euphratica]
Length=378

 Score =   216 bits (551),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/188 (53%), Positives = 142/188 (76%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F ++G+  N IQA C+++I P SK+TYRRI     E+ +L + +L++W+AG++V L+TD
Sbjct  16   VFCLTGIAINIIQAACFLIIWPLSKNTYRRIVGAVTEIFFLVMTFLVNWFAGLEVHLHTD  75

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET++L+GKE+AL++ NH  D+D ++ W+LA+R  CL   L VMKKSS YLP+ GW+ +F
Sbjct  76   LETYELIGKENALVMPNHICDVDVLMMWLLAERFNCLRGVLMVMKKSSKYLPIYGWANWF  135

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +  +FL+R+WAKDE  LKS  + L+D+P  FWL +FVEGTR T  KLLAAQE+A S GLP
Sbjct  136  NGAVFLDRNWAKDEGKLKSSFRELKDFPGSFWLTIFVEGTRMTPDKLLAAQEFAISKGLP  195

Query  738  IPRNVLIP  761
            +PRNVLIP
Sbjct  196  VPRNVLIP  203



>gb|KDO61278.1| hypothetical protein CISIN_1g016254mg [Citrus sinensis]
 gb|KDO61279.1| hypothetical protein CISIN_1g016254mg [Citrus sinensis]
Length=309

 Score =   211 bits (538),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  396  MGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFL  575
            MGKEHAL+I NHRSDIDW+VGWV+AQR GCLGSTLA++KK + +LP IGWSM+FSEY+FL
Sbjct  1    MGKEHALVICNHRSDIDWLVGWVVAQRKGCLGSTLAIIKKEAKHLPFIGWSMWFSEYVFL  60

Query  576  ERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVL  755
            ER W KDE TLKSG KRL D+P+PFWLAL+VEGTRFT+AKLLAAQEYA S GLPIPRNVL
Sbjct  61   ERRWNKDEQTLKSGFKRLVDFPMPFWLALYVEGTRFTEAKLLAAQEYALSRGLPIPRNVL  120

Query  756  IP  761
            IP
Sbjct  121  IP  122



>ref|XP_006446108.1| hypothetical protein CICLE_v10015539mg [Citrus clementina]
 gb|ESR59348.1| hypothetical protein CICLE_v10015539mg [Citrus clementina]
Length=310

 Score =   211 bits (538),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  396  MGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFL  575
            MGKEHAL+I NHRSDIDW+VGWV+AQR GCLGSTLA++KK + +LP IGWSM+FSEY+FL
Sbjct  1    MGKEHALVICNHRSDIDWLVGWVVAQRKGCLGSTLAIIKKEAKHLPFIGWSMWFSEYVFL  60

Query  576  ERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVL  755
            ER W KDE TLKSG KRL D+P+PFWLAL+VEGTRFT+AKLLAAQEYA S GLPIPRNVL
Sbjct  61   ERRWNKDEQTLKSGFKRLVDFPMPFWLALYVEGTRFTEAKLLAAQEYALSRGLPIPRNVL  120

Query  756  IP  761
            IP
Sbjct  121  IP  122



>ref|XP_002314068.2| hypothetical protein POPTR_0009s05930g [Populus trichocarpa]
 gb|EEE88023.2| hypothetical protein POPTR_0009s05930g [Populus trichocarpa]
Length=423

 Score =   214 bits (546),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 99/188 (53%), Positives = 141/188 (75%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F ++G+    IQA C+++I P S++TYRRI     E+L+LE+++L+DW AG++V+L+TD
Sbjct  16   VFCLTGVLITIIQAACFLIIWPLSRNTYRRIVGAVTEILFLEMIFLMDWLAGLEVRLHTD  75

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET++L+GKE+AL++ NH  D D ++ W+LA+R  CL   L VMKKSS YLP+ GW+ +F
Sbjct  76   LETYELIGKENALVMPNHICDADVLIMWLLAERFNCLRGALMVMKKSSKYLPIYGWANWF  135

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +  +FL R+WAKDE  LKS  + L+D+P  FWL +FVEGTR T  KLLAAQE+A   GLP
Sbjct  136  NGAVFLNRNWAKDEGKLKSSFQELKDFPGSFWLTIFVEGTRITPDKLLAAQEFAILKGLP  195

Query  738  IPRNVLIP  761
            +P+NVLIP
Sbjct  196  VPKNVLIP  203



>gb|AAP80656.1|AF479037_1 1-acy1-glycerol-3-phosphate acyltransferase, partial [Triticum 
aestivum]
Length=237

 Score =   203 bits (516),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 97/118 (82%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  408  HALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERSW  587
             ALLISNHRSDIDW+VGW+LAQRSGCLGS +A+MKKSS +LPVIGWSM+F+EYLFLERSW
Sbjct  2    DALLISNHRSDIDWLVGWILAQRSGCLGSAIAIMKKSSKFLPVIGWSMWFAEYLFLERSW  61

Query  588  AKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            AKDE TLKSGL+RL+D+P  FWLALFVEGTRFT AKLLAAQEYA S GL  PRNVLIP
Sbjct  62   AKDEKTLKSGLQRLKDFPRSFWLALFVEGTRFTPAKLLAAQEYAISQGLTAPRNVLIP  119



>gb|KHG13155.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase 2 -like protein 
[Gossypium arboreum]
Length=311

 Score =   204 bits (519),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/188 (52%), Positives = 129/188 (69%), Gaps = 20/188 (11%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            LF  +G+  N IQ  CY+ I P SKST+RRIN    ELLWLE+VWL++WW+G +V+++TD
Sbjct  15   LFIFTGILVNLIQVSCYLTIWPVSKSTFRRINGAITELLWLEVVWLMEWWSGFEVKVHTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             +T +LMGKEHA+++ NH SD D ++ W+LAQ                    V GW+ +F
Sbjct  75   AKTCQLMGKEHAIIMPNHVSDSDTLLTWILAQ--------------------VFGWTNWF  114

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            SE +FL+R+WAKDES LKS  + L DYP PFW+ +FVEGTR T  KL+ AQ +A+S G P
Sbjct  115  SESIFLDRNWAKDESKLKSSFEALSDYPTPFWMTIFVEGTRLTADKLVEAQSFASSKGYP  174

Query  738  IPRNVLIP  761
            IP+NVLIP
Sbjct  175  IPKNVLIP  182



>ref|XP_001754626.1| predicted protein [Physcomitrella patens]
 gb|EDQ80596.1| predicted protein [Physcomitrella patens]
Length=554

 Score =   207 bits (528),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/197 (55%), Positives = 136/197 (69%), Gaps = 9/197 (5%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F  SGLF N +Q I  + I PFS+  YR +N +  E LW ELVWL+DWWAGVKV++YT 
Sbjct  141  MFIFSGLFINGLQVISVLFILPFSRRAYRVVNMIMMEALWSELVWLLDWWAGVKVKVYTP  200

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             ET + +GKE AL+ISNHRSDIDW+VGW++AQR GCLG T AVMKKS+ +LPVIGWSM+F
Sbjct  201  RETSEHLGKERALVISNHRSDIDWLVGWIIAQRLGCLGGTRAVMKKSTKFLPVIGWSMWF  260

Query  558  SEYLFLERSWAKDESTLKSGLKRLQ-DYPLPFWLALFV--------EGTRFTQAKLLAAQ  710
            SEY+FL R+W KDE  LK    +LQ    L   + L V        EG     AKL AA+
Sbjct  261  SEYVFLSRNWTKDEKVLKVLRCKLQLRIALLKHVCLGVCAEWLFKPEGLPKDLAKLEAAR  320

Query  711  EYAASTGLPIPRNVLIP  761
            +YA   GL +PR+VL+P
Sbjct  321  KYATEAGLRVPRHVLVP  337



>ref|XP_008363711.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Malus domestica]
 ref|XP_008363731.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase PLS1-like 
[Malus domestica]
Length=169

 Score =   178 bits (451),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/137 (61%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +3

Query  201  FFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDP  380
            F + GL  N IQAIC++ IRP SKS +R+IN   A  LWL+L+WL++WW G+KV+LYTD 
Sbjct  16   FLLFGLAINLIQAICFLTIRPLSKSAFRQINGAVASFLWLDLIWLMEWWGGLKVKLYTDL  75

Query  381  ETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFS  560
            ET++LMGKEHALL+ NH  D D ++G +LA RSGCL S L V+KKSS YLPV GW+ +F 
Sbjct  76   ETYRLMGKEHALLMPNHICDADILMGLLLANRSGCLRSALMVVKKSSKYLPVFGWTSWFL  135

Query  561  EYLFLERSWAKDESTLK  611
            E++FL+RSW KDES LK
Sbjct  136  EFVFLDRSWEKDESNLK  152



>ref|XP_007015029.1| Lysophosphatidyl acyltransferase 2, putative isoform 3 [Theobroma 
cacao]
 gb|EOY32648.1| Lysophosphatidyl acyltransferase 2, putative isoform 3 [Theobroma 
cacao]
Length=338

 Score =   180 bits (457),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 119/188 (63%), Gaps = 36/188 (19%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F   G   N IQ  CY+ IRP SKST+RRIN   +E+LWLELVWL++WW+G +V+L+TD
Sbjct  15   MFIFIGTIINLIQVACYLTIRPLSKSTFRRINGAVSEVLWLELVWLMEWWSGCEVKLHTD  74

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
             +T++LMGKEHALL                                    +P+ GW+ +F
Sbjct  75   LKTYRLMGKEHALL------------------------------------MPIFGWTTWF  98

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E++F++R+WAKD S LKS  + L+D+P+PFW+ +F EGTR T  KLL AQ +A++ GL 
Sbjct  99   YEFIFVDRNWAKDGSKLKSSFQALKDFPIPFWVTIFAEGTRLTPDKLLEAQTFASTKGLA  158

Query  738  IPRNVLIP  761
            IP+NVLIP
Sbjct  159  IPKNVLIP  166



>emb|CAA90019.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Brassica napus]
Length=311

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +3

Query  465  LAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERSWAKDESTLKSGLKRLQDYPL  644
            L QRSGCLGS LAVMKKSS +LPVIGWSM+FSEYLFLER+WAKDESTLKSGL+RL D+P 
Sbjct  24   LLQRSGCLGSALAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRLNDFPR  83

Query  645  PFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            PFWLALFVEGTRFT+AKL AAQEYAAS+ LP+PRNVLIP
Sbjct  84   PFWLALFVEGTRFTEAKLKAAQEYAASSELPVPRNVLIP  122



>ref|XP_002590323.1| hypothetical protein BRAFLDRAFT_121375 [Branchiostoma floridae]
 gb|EEN46334.1| hypothetical protein BRAFLDRAFT_121375 [Branchiostoma floridae]
Length=373

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 123/188 (65%), Gaps = 0/188 (0%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SG+  N  QA  Y+++RP S + YR++   F  + W +LV+L +WWAG  + +Y  
Sbjct  20   VFIVSGIICNIFQAAGYLLLRPISLTAYRKLAAFFTNMHWSQLVFLNEWWAGSTINMYGT  79

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
                  +GKE+A+L+ NH+ + D + GW + +R GCLG++ A++K+S  YLPV+GW+MFF
Sbjct  80   DADIGRIGKENAVLLMNHKYETDMISGWTVCERFGCLGTSRALIKESVKYLPVVGWTMFF  139

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E+LFL+R + +D+ T+   LK LQ+YP  FWL LF EGTRFT  K   + E A   G+P
Sbjct  140  IEFLFLKRDYEEDKRTIIKQLKELQNYPDNFWLLLFCEGTRFTAEKHEKSMEVARKKGVP  199

Query  738  IPRNVLIP  761
              ++ L+P
Sbjct  200  ELKHHLLP  207



>gb|KDR11829.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Zootermopsis 
nevadensis]
Length=398

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 119/188 (63%), Gaps = 1/188 (1%)
 Frame = +3

Query  201  FFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDP  380
            FF+SGL  N IQA+ Y  +RPFSK  YR+IN      L+ +LV++ +WWA   + +Y D 
Sbjct  22   FFVSGLIINLIQALLYCGLRPFSKYLYRKINYYVCYSLYCQLVFMAEWWASTDLIIYIDK  81

Query  381  ETF-KLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            E   +  GKEH  LI NHR ++DW++GWVL  R   LG+     KKS  Y+P +GW+  F
Sbjct  82   EDLERYYGKEHGFLIMNHRYEVDWLMGWVLCDRVNILGNCKTYAKKSIQYVPTMGWAWMF  141

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +E +FLER+W KD+ T+   +K L ++P P WL L  EGTRFT  K  A++++A   GLP
Sbjct  142  AESVFLERNWEKDKETIGRQIKELVEHPDPIWLLLMAEGTRFTTEKHEASKKFAEEKGLP  201

Query  738  IPRNVLIP  761
            I ++ L P
Sbjct  202  ILKHHLTP  209



>emb|CAB41190.1| 1-acylcerol-3-phosphate acyltransferase-like protein [Arabidopsis 
thaliana]
Length=310

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +3

Query  465  LAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLERSWAKDESTLKSGLKRLQDYPL  644
            L QRSGCLGS LAVMKKSS +LPVIGWSM+FSEYLFLER+WAKDESTLKSGL+RL D+P 
Sbjct  24   LFQRSGCLGSALAVMKKSSKFLPVIGWSMWFSEYLFLERNWAKDESTLKSGLQRLSDFPR  83

Query  645  PFWLALFVEGTRFTQAKLLAAQEYAASTGLPIPRNVLIP  761
            PFWLALFVEGTRFT+AKL AAQEYAAS+ LPIPRNVLIP
Sbjct  84   PFWLALFVEGTRFTEAKLKAAQEYAASSELPIPRNVLIP  122



>gb|KDP22082.1| hypothetical protein JCGZ_25913 [Jatropha curcas]
Length=406

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/136 (60%), Positives = 105/136 (77%), Gaps = 0/136 (0%)
 Frame = +3

Query  354  VKVQLYTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLP  533
            V++ L+TD ET+KLMGKEHAL++ NH SD D  + W+LAQR  CL S L V+KKSS+Y+P
Sbjct  97   VQIHLFTDSETYKLMGKEHALVMPNHISDADIFILWLLAQRFNCLRSALMVVKKSSMYIP  156

Query  534  VIGWSMFFSEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQE  713
            + GW+ +F EY+F+ RSWAKDE  LKS L  LQD+P PFWL +F EGTR T  KL+A+Q+
Sbjct  157  IFGWAAWFMEYVFMSRSWAKDEKNLKSRLIGLQDFPWPFWLTIFTEGTRLTPDKLVASQK  216

Query  714  YAASTGLPIPRNVLIP  761
            +A S GLP+P NVLIP
Sbjct  217  FAISKGLPVPSNVLIP  232



>ref|XP_001621942.1| predicted protein [Nematostella vectensis]
 gb|EDO29842.1| predicted protein [Nematostella vectensis]
Length=385

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/191 (46%), Positives = 124/191 (65%), Gaps = 7/191 (4%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRP---FSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQL  368
            +F I+G+  N IQ    V I P   F+K+ YR IN     L W +L +L+DWW+   ++L
Sbjct  21   VFLITGMIINIIQ----VAILPLWTFNKTLYRWINMHVVYLHWSQLTFLVDWWSETDLRL  76

Query  369  YTDPETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWS  548
            Y + E F+  GKE A+ ++NHRSD+DW++GWV+A R   LG+T   MK    YLP++G+S
Sbjct  77   YGNEEDFRYFGKESAICVANHRSDVDWLIGWVMADRVDTLGTTKCYMKGYLKYLPIMGFS  136

Query  549  MFFSEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAAST  728
               SEY F+ R+W KD+  L++ L  LQD+P PFW+A+F EGTR TQ KL A+ EYA S 
Sbjct  137  WLSSEYAFVSRNWQKDQRVLQNSLDTLQDFPYPFWIAIFAEGTRLTQEKLQASIEYARSK  196

Query  729  GLPIPRNVLIP  761
             +P  ++ L+P
Sbjct  197  NIPELQHHLLP  207



>ref|XP_011707986.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Wasmannia auropunctata]
 ref|XP_011707987.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Wasmannia auropunctata]
Length=296

 Score =   174 bits (441),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 86/188 (46%), Positives = 116/188 (62%), Gaps = 1/188 (1%)
 Frame = +3

Query  201  FFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDP  380
            FF SGL  N  Q I Y  +RPFSK  YR+IN       + +LV++ +WWAG  + LY D 
Sbjct  21   FFTSGLIINFFQCILYFGLRPFSKYLYRKINYYLCYSFYCQLVFMAEWWAGADLVLYIDK  80

Query  381  ETF-KLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            + F K  G EH  L+ NH  + DW++GW+L  R   LG+  A  KKS  Y+P +GW+  F
Sbjct  81   KDFDKYFGNEHGYLLMNHSYETDWLIGWLLCDRVRLLGNCKAYAKKSIQYIPTLGWAWKF  140

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +E +FLERSW KD+  +KS +K L +YP   WL L+ EGTRFT  KL A+Q++A   GLP
Sbjct  141  AESIFLERSWEKDKENIKSQIKELVEYPDTMWLLLYPEGTRFTPKKLEASQKFAIEKGLP  200

Query  738  IPRNVLIP  761
            + +  L P
Sbjct  201  VLKYHLTP  208



>ref|XP_012145124.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X4 [Megachile rotundata]
Length=283

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 122/188 (65%), Gaps = 1/188 (1%)
 Frame = +3

Query  201  FFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDP  380
            FF SGL  +  Q + Y  +RPFS+  YR+IN      L+ +LV++ +WW+G    ++ D 
Sbjct  21   FFTSGLIISFFQCLLYFGLRPFSRYFYRKINYYLCYSLFSQLVFVAEWWSGTDPIMHIDK  80

Query  381  ETF-KLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            + F K  GKEHA L+ NHR +IDW++GW+  +R   LG+  A  KKS  Y+P+IGW+  F
Sbjct  81   KEFEKYFGKEHAYLVMNHRYEIDWLMGWIFCERISSLGNCKAYSKKSLQYVPIIGWTWKF  140

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +E++FLER+W KD+  + + +K L +YP   WL L+ EGTRFT+ KL A+Q++A   GLP
Sbjct  141  AEFIFLERNWTKDKEIIGTQIKELCEYPDNIWLLLYPEGTRFTEKKLEASQKFAQEQGLP  200

Query  738  IPRNVLIP  761
            + +  L P
Sbjct  201  VLKYHLTP  208



>ref|XP_001607215.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X1 [Nasonia vitripennis]
 ref|XP_008214892.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X1 [Nasonia vitripennis]
 ref|XP_008214893.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X1 [Nasonia vitripennis]
 ref|XP_008214894.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X1 [Nasonia vitripennis]
 ref|XP_008214895.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X1 [Nasonia vitripennis]
Length=387

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 118/188 (63%), Gaps = 1/188 (1%)
 Frame = +3

Query  201  FFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDP  380
            FF SGL  N  Q I Y  +RPFSK  YR+IN       + +LV++ +WW+G  V +Y D 
Sbjct  21   FFTSGLIINFFQCILYFGLRPFSKYLYRKINYYLCYSFYSQLVFMAEWWSGTDVIIYIDK  80

Query  381  ETF-KLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            + F K  GKEH  L+ NH  +IDW++GW+  +R   LG+  A  KKS  Y+P +GW+  F
Sbjct  81   KDFEKYYGKEHGYLVMNHSYEIDWLMGWMFCERIRMLGNCKAYAKKSIQYIPTLGWAWKF  140

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +E +FLERSW KD+ T+ + ++ L DYP   WL L+ EGTRFT  K  A+Q++A   GLP
Sbjct  141  AESIFLERSWDKDKETIGAQIRELADYPDTMWLLLYAEGTRFTPEKAEASQKFAKEKGLP  200

Query  738  IPRNVLIP  761
            + ++ L P
Sbjct  201  VLKHHLTP  208



>ref|XP_003419084.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Loxodonta africana]
Length=376

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 122/188 (65%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N IQ +C +++ P +K  YRR+N   A  LW +LV L++WW+  +  L+TD
Sbjct  20   VFVVSGLTINFIQ-LCTLILWPVNKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T   +GKEH ++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P++GW+ +F
Sbjct  79   QATIDRLGKEHVIIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLVGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             EY+F +R W +D  T+  GLKRL DYP PFW  L+ EGTRFT+ K   + E AA+ GL 
Sbjct  139  LEYVFCKRKWEEDRQTVIEGLKRLSDYPEPFWFLLYCEGTRFTETKHRVSMEVAAAKGLA  198

Query  738  IPRNVLIP  761
              +  L+P
Sbjct  199  PLKYHLLP  206



>gb|EFN64501.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Camponotus 
floridanus]
Length=360

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 116/188 (62%), Gaps = 1/188 (1%)
 Frame = +3

Query  201  FFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDP  380
            FF SGL  N  Q I Y  +RPFSK  YR+IN       + +LV++ +WWAG  + LY D 
Sbjct  21   FFTSGLIINFFQCILYFGLRPFSKYLYRKINYYLCYSFYCQLVFMAEWWAGSNLILYIDK  80

Query  381  ETF-KLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            + F K  G EH  L+ NH  + DW++GW+L  R   LG+  A  KKS  Y+P +GW+  F
Sbjct  81   KDFDKYFGNEHGYLLMNHSYETDWLIGWLLCDRVKLLGNCKAYAKKSIQYIPTLGWAWKF  140

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +E +FLERSW KD+  +K+ +K L +YP   WL L+ EGTRFT  KL A+Q++A   GLP
Sbjct  141  AESIFLERSWEKDKENIKNQIKELVEYPDTMWLLLYPEGTRFTSKKLEASQKFAIEKGLP  200

Query  738  IPRNVLIP  761
            + +  L P
Sbjct  201  VLKYHLTP  208



>ref|XP_011261943.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Camponotus floridanus]
Length=387

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 116/188 (62%), Gaps = 1/188 (1%)
 Frame = +3

Query  201  FFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDP  380
            FF SGL  N  Q I Y  +RPFSK  YR+IN       + +LV++ +WWAG  + LY D 
Sbjct  21   FFTSGLIINFFQCILYFGLRPFSKYLYRKINYYLCYSFYCQLVFMAEWWAGSNLILYIDK  80

Query  381  ETF-KLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            + F K  G EH  L+ NH  + DW++GW+L  R   LG+  A  KKS  Y+P +GW+  F
Sbjct  81   KDFDKYFGNEHGYLLMNHSYETDWLIGWLLCDRVKLLGNCKAYAKKSIQYIPTLGWAWKF  140

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +E +FLERSW KD+  +K+ +K L +YP   WL L+ EGTRFT  KL A+Q++A   GLP
Sbjct  141  AESIFLERSWEKDKENIKNQIKELVEYPDTMWLLLYPEGTRFTSKKLEASQKFAIEKGLP  200

Query  738  IPRNVLIP  761
            + +  L P
Sbjct  201  VLKYHLTP  208



>ref|XP_010127144.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Chlamydotis macqueenii]
 gb|KFP45955.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Chlamydotis 
macqueenii]
Length=256

 Score =   170 bits (431),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 119/188 (63%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N IQ +C +V+ P +K  YRR+N   A  LW +LV L++WW+G +  L++D
Sbjct  20   VFVVSGLIINFIQ-LCTLVLWPINKQFYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T    GKEH ++I NH  +ID++ GW + +R G LGS+  + K+  +Y+P+IGW+ +F
Sbjct  79   EATVNTFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKRELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GLKRL DYP   W  L+ EGTRFT+ K   + E A S GLP
Sbjct  139  LEIVFCKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYCEGTRFTETKHRISMEVAESKGLP  198

Query  738  IPRNVLIP  761
              +  L+P
Sbjct  199  KLKYHLLP  206



>ref|XP_010366228.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Rhinopithecus roxellana]
Length=320

 Score =   172 bits (435),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 121/188 (64%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD
Sbjct  20   VFVVSGLVINFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T +  GKEHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F
Sbjct  79   QATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GL+RL DYP   W  L+ EGTRFT+ K   + E AA+ GLP
Sbjct  139  LEIVFCKRKWEEDRDTVIEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLP  198

Query  738  IPRNVLIP  761
            + +  L+P
Sbjct  199  VLKYHLLP  206



>ref|XP_008939552.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Merops nubicus]
 ref|XP_009695017.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Cariama cristata]
 gb|KFP57188.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Cariama 
cristata]
 gb|KFQ30670.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Merops 
nubicus]
Length=256

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 119/188 (63%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N IQ +C +V+ P +K  YRR+N   A  LW +LV L++WW+G +  L++D
Sbjct  20   VFVVSGLIINFIQ-LCTLVLWPINKQFYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T    GKEH ++I NH  +ID++ GW + +R G LGS+  + K+  +Y+P+IGW+ +F
Sbjct  79   EATVNTFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKRELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GLKRL DYP   W  L+ EGTRFT+ K   + E A S GLP
Sbjct  139  LEIVFCKRKWEEDRDTVIEGLKRLADYPEYMWFLLYCEGTRFTETKHRISMEVAESKGLP  198

Query  738  IPRNVLIP  761
              +  L+P
Sbjct  199  KLKYHLLP  206



>ref|XP_003434035.1| PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-glycerol-3-phosphate 
acyltransferase gamma [Canis lupus familiaris]
Length=376

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 121/188 (64%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N +Q +C +V+RP +K  YRR+    A  LW +LV L++WW+G +  L+TD
Sbjct  20   VFVVSGLLINFVQ-LCTLVLRPINKQLYRRLXCRLAYSLWSQLVMLLEWWSGTECTLFTD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T    GKEH ++I NH  +ID++ GW +++R G LGS+  + K+  +Y+P+IGW+ +F
Sbjct  79   QATVDRFGKEHVVIILNHNFEIDFLCGWTMSERFGMLGSSQVLAKRELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GLKRL DYP   W  L+ EGTRFT+ K   + E A S GLP
Sbjct  139  LEIVFCKRKWEEDRDTVIQGLKRLSDYPEYMWFLLYCEGTRFTEKKHRVSMEVAVSKGLP  198

Query  738  IPRNVLIP  761
            + +  L+P
Sbjct  199  VLKYHLLP  206



>ref|XP_011634482.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Pogonomyrmex barbatus]
Length=387

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 116/188 (62%), Gaps = 1/188 (1%)
 Frame = +3

Query  201  FFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDP  380
            FF SGL  N  Q I Y+ +RPFSK  YR+IN       + +LV++ +WWAG  + LY D 
Sbjct  21   FFTSGLIINFFQCILYLGLRPFSKYLYRKINYYLCYSFYCQLVFMAEWWAGSDLVLYIDK  80

Query  381  ETF-KLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            + F K  G EH  L+ NH  + DW++GW+L  R   LG+  A  KKS  Y+P +GW+  F
Sbjct  81   KDFDKYFGNEHGYLLMNHSYETDWLIGWLLCDRVRLLGNCKAYAKKSIQYIPTLGWAWKF  140

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +E +FLERSW KD+  +K  +K L +YP   WL L+ EGTRFT  KL A+Q++A   GLP
Sbjct  141  AESIFLERSWEKDKENIKGQIKELVEYPDTMWLLLYPEGTRFTPKKLEASQKFAIEKGLP  200

Query  738  IPRNVLIP  761
            + +  L P
Sbjct  201  VLKYHLTP  208



>ref|XP_010206239.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Colius striatus]
Length=289

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 119/188 (63%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N IQ +C +V+ P +K  YRR+N   A  LW +LV L++WW+G +  L++D
Sbjct  20   VFVVSGLIINFIQ-LCTLVLWPINKQFYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T    GKEH ++I NH  +ID++ GW + +R G LGS+  + K+  +Y+P+IGW+ +F
Sbjct  79   EATVNTFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKRELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GLKRL DYP   W  L+ EGTRFT+ K   + E A S GLP
Sbjct  139  LEIVFCKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYCEGTRFTETKHRISMEVAESKGLP  198

Query  738  IPRNVLIP  761
              +  L+P
Sbjct  199  KLKYHLLP  206



>gb|KFP28149.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma, partial 
[Colius striatus]
Length=281

 Score =   170 bits (431),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 119/188 (63%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N IQ +C +V+ P +K  YRR+N   A  LW +LV L++WW+G +  L++D
Sbjct  20   VFVVSGLIINFIQ-LCTLVLWPINKQFYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T    GKEH ++I NH  +ID++ GW + +R G LGS+  + K+  +Y+P+IGW+ +F
Sbjct  79   EATVNTFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKRELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GLKRL DYP   W  L+ EGTRFT+ K   + E A S GLP
Sbjct  139  LEIVFCKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYCEGTRFTETKHRISMEVAESKGLP  198

Query  738  IPRNVLIP  761
              +  L+P
Sbjct  199  KLKYHLLP  206



>ref|XP_011875160.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Vollenhovia emeryi]
Length=386

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 117/188 (62%), Gaps = 1/188 (1%)
 Frame = +3

Query  201  FFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDP  380
            FF SGL  N  Q I Y+ +RPFSK  YR+IN       + +LV++ +WWAG  + LY D 
Sbjct  20   FFTSGLIINFFQCILYLGLRPFSKYLYRKINYYLCYSFYCQLVFMAEWWAGSDLILYIDK  79

Query  381  ETF-KLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            + F K  G EH  L+ NH  + DW++GW+L  R   LG+  A  KKS  Y+P +GW+  F
Sbjct  80   KDFDKYFGNEHGYLLMNHSYETDWLIGWLLCDRVRLLGNCKAYAKKSIQYIPTLGWAWKF  139

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +E +FLERSW KD+  +K+ +K L +YP   WL L+ EGTRFT  KL A+Q++A   GLP
Sbjct  140  AESIFLERSWEKDKENIKTQIKELVEYPDTMWLLLYPEGTRFTPKKLEASQKFAIEKGLP  199

Query  738  IPRNVLIP  761
            + +  L P
Sbjct  200  VLKYHLTP  207



>ref|XP_003705225.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X1 [Megachile rotundata]
 ref|XP_012145117.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X1 [Megachile rotundata]
 ref|XP_012145119.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
isoform X1 [Megachile rotundata]
Length=386

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 122/188 (65%), Gaps = 1/188 (1%)
 Frame = +3

Query  201  FFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDP  380
            FF SGL  +  Q + Y  +RPFS+  YR+IN      L+ +LV++ +WW+G    ++ D 
Sbjct  21   FFTSGLIISFFQCLLYFGLRPFSRYFYRKINYYLCYSLFSQLVFVAEWWSGTDPIMHIDK  80

Query  381  ETF-KLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            + F K  GKEHA L+ NHR +IDW++GW+  +R   LG+  A  KKS  Y+P+IGW+  F
Sbjct  81   KEFEKYFGKEHAYLVMNHRYEIDWLMGWIFCERISSLGNCKAYSKKSLQYVPIIGWTWKF  140

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +E++FLER+W KD+  + + +K L +YP   WL L+ EGTRFT+ KL A+Q++A   GLP
Sbjct  141  AEFIFLERNWTKDKEIIGTQIKELCEYPDNIWLLLYPEGTRFTEKKLEASQKFAQEQGLP  200

Query  738  IPRNVLIP  761
            + +  L P
Sbjct  201  VLKYHLTP  208



>gb|EZA54711.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Cerapachys 
biroi]
Length=387

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 116/188 (62%), Gaps = 1/188 (1%)
 Frame = +3

Query  201  FFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDP  380
            FF SGL  N  Q I Y  +RPFSK  YR+IN       + +LV++ +WWAG  + LY D 
Sbjct  21   FFTSGLIINFFQCILYFGLRPFSKYLYRKINYYLCYSFYCQLVFMAEWWAGSDLILYIDK  80

Query  381  ETF-KLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            + F K  G EH  L+ NH  + DW++GW+L  R   LG+  A  KKS  Y+P +GW+  F
Sbjct  81   DDFAKYFGNEHGYLLMNHSYETDWLIGWLLCDRVRLLGNCKAYAKKSIQYIPTLGWAWKF  140

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +E +FLERSW KD+  +K+ +K L +YP   WL L+ EGTRFT  KL A+Q++A   GLP
Sbjct  141  AESIFLERSWEKDKEKIKNQIKELVEYPDTMWLLLYPEGTRFTPKKLEASQKFAIEKGLP  200

Query  738  IPRNVLIP  761
            + +  L P
Sbjct  201  VLKYHLTP  208



>ref|XP_009071880.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Acanthisitta chloris]
 gb|KFP79366.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Acanthisitta 
chloris]
Length=256

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 119/188 (63%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N IQ +C +V+ P +K  YRR+N   A  LW +LV L++WW+G +  L++D
Sbjct  20   VFVVSGLIINFIQ-LCTLVLWPINKQLYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T    GKEH ++I NH  +ID++ GW + +R G LGS+  + K+  +Y+P+IGW+ +F
Sbjct  79   EATVNTFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKRELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GLKRL DYP   W  L+ EGTRFT+ K   + + A S GLP
Sbjct  139  LEIVFCKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYCEGTRFTETKHRISMKVAESKGLP  198

Query  738  IPRNVLIP  761
              +  L+P
Sbjct  199  KLKYHLLP  206



>ref|XP_011143319.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Harpegnathos saltator]
 ref|XP_011143320.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Harpegnathos saltator]
 ref|XP_011143321.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Harpegnathos saltator]
 ref|XP_011143322.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Harpegnathos saltator]
 gb|EFN82046.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Harpegnathos 
saltator]
Length=387

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 84/188 (45%), Positives = 115/188 (61%), Gaps = 1/188 (1%)
 Frame = +3

Query  201  FFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDP  380
            FF SGL  N  Q + Y  +RPFSK  YR+IN       + +LV++ +WWAG  V LY D 
Sbjct  21   FFTSGLIINFFQCVLYFGLRPFSKYLYRKINYYLCYSFYCQLVFMAEWWAGSDVILYIDK  80

Query  381  ETF-KLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            + F K  G EH  L+ NH  + DW++GW+L  R   LG+  A  KKS  Y+P +GW+  F
Sbjct  81   KDFDKYYGNEHGYLLMNHSYETDWLIGWLLCDRVRLLGNCKAYAKKSIQYIPTLGWAWKF  140

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +E +FLERSW KD+  +K  ++ L +YP   WL L+ EGTRFT  KL A+Q++A   GLP
Sbjct  141  AESIFLERSWEKDKENIKGQIRELVEYPDTIWLLLYPEGTRFTSKKLEASQKFAIEKGLP  200

Query  738  IPRNVLIP  761
            + +  L P
Sbjct  201  VLKYHLTP  208



>ref|XP_004602547.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Sorex araneus]
Length=362

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 80/188 (43%), Positives = 121/188 (64%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  NA+Q +C +++ P  K  YRR+N   A  LW +LV L++WW+G +  L+TD
Sbjct  20   VFVVSGLLINALQ-LCSLLLWPLDKQLYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFTD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            P T   +GKEH ++I NH  +ID++ GW + +R G LGS+  + K+  + +P+IGW+ +F
Sbjct  79   PATLSRLGKEHVVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKRELLCVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GL+RL DYP   W  L+ EGTRFT+ K   + E AA+ GLP
Sbjct  139  LEIVFCKRKWEEDRDTVIQGLQRLSDYPEYMWFLLYCEGTRFTEKKHRVSMEVAAAKGLP  198

Query  738  IPRNVLIP  761
              +  L+P
Sbjct  199  ALKYHLLP  206



>ref|XP_008498571.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Calypte anna]
 gb|KFP05918.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Calypte 
anna]
Length=376

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 120/188 (64%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N IQ +C +V+ P +K  YRR+N   A  LW +LV L++WW+G +  L++D
Sbjct  20   VFVVSGLIINFIQ-LCTLVLWPVNKQLYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T K  GKEH ++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F
Sbjct  79   EATVKTFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKKELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GLKRL DYP   W  L+ EGTRFT+ K   + E A S GLP
Sbjct  139  LEIVFCKRKWEEDRDTVIEGLKRLADYPEYMWFLLYCEGTRFTETKHRISMEVAESKGLP  198

Query  738  IPRNVLIP  761
              +  L+P
Sbjct  199  KLKYHLLP  206



>ref|XP_004364540.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE90348.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase [Capsaspora owczarzaki 
ATCC 30864]
Length=400

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/190 (42%), Positives = 124/190 (65%), Gaps = 3/190 (2%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F ISGL  N +Q +  +++ P S   YRR N    ++ W E++W+ +WWAG+KV L + 
Sbjct  45   VFLISGLAVNVLQ-LASLLLWPVSPLLYRRFNHTIIQIHWSEMIWVAEWWAGIKVVLSSS  103

Query  378  PETF--KLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSM  551
                    +G +  + + NHRSD+DW+ G VLA++  CLG   A MK ++ +LP++GWS 
Sbjct  104  SRKALEASIGVDQGVALCNHRSDVDWLFGLVLAEKYNCLGGAKAYMKGNTKFLPILGWSW  163

Query  552  FFSEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTG  731
            +F E++FL R+W KD+S L S  K L  +PLPFW+ +F EGTR+T+ K  A+QE+A +  
Sbjct  164  WFLEFVFLSRAWDKDQSKLASACKSLDGFPLPFWMVIFAEGTRYTEEKHRASQEFARANN  223

Query  732  LPIPRNVLIP  761
            LP+ R++L+P
Sbjct  224  LPVLRHLLVP  233



>ref|XP_007967793.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Chlorocebus sabaeus]
 ref|XP_007967803.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Chlorocebus sabaeus]
 ref|XP_011892793.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Cercocebus atys]
 ref|XP_011892794.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Cercocebus atys]
 ref|XP_011892795.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Cercocebus atys]
 ref|XP_011892796.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Cercocebus atys]
 ref|XP_011892797.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Cercocebus atys]
 ref|XP_011724214.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Macaca nemestrina]
 ref|XP_011724215.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Macaca nemestrina]
 ref|XP_011724216.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Macaca nemestrina]
 ref|XP_011724217.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Macaca nemestrina]
Length=376

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 121/188 (64%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD
Sbjct  20   VFVVSGLVINFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T +  GKEHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F
Sbjct  79   QATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GLKRL DYP   W  L+ EGTRFT+ K   + E AA+ GLP
Sbjct  139  LEIVFCKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLP  198

Query  738  IPRNVLIP  761
            + +  L+P
Sbjct  199  VLKYHLLP  206



>ref|XP_011857918.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Mandrillus leucophaeus]
 ref|XP_011857919.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Mandrillus leucophaeus]
 ref|XP_011857920.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Mandrillus leucophaeus]
Length=376

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 121/188 (64%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD
Sbjct  20   VFVVSGLVINFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T +  GKEHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F
Sbjct  79   QATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GLKRL DYP   W  L+ EGTRFT+ K   + E AA+ GLP
Sbjct  139  LEIVFCKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLP  198

Query  738  IPRNVLIP  761
            + +  L+P
Sbjct  199  VLKYHLLP  206



>ref|XP_011161524.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Solenopsis invicta]
Length=387

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 115/188 (61%), Gaps = 1/188 (1%)
 Frame = +3

Query  201  FFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDP  380
            FF SGL  N  Q I Y  +RPFSK  YR+IN       + +LV++ +WWAG  + LY D 
Sbjct  21   FFTSGLIINFFQCILYFGLRPFSKYLYRKINYYLCYSFYCQLVFMAEWWAGSDLILYIDK  80

Query  381  ETF-KLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            + F K  G EH  L+ NH  + DW++GW+L  R   LG+  A  KKS  Y+P +GW+  F
Sbjct  81   QDFDKYFGNEHGYLLMNHSYETDWLLGWLLCDRVRLLGNCKAYAKKSIQYIPTLGWAWKF  140

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +E +FLERSW KD+  +K  +K L +YP   WL L+ EGTRFT  KL A+Q++A   GLP
Sbjct  141  AESIFLERSWEKDKENIKGQIKELVEYPDTMWLLLYPEGTRFTPKKLEASQKFAIEKGLP  200

Query  738  IPRNVLIP  761
            + +  L P
Sbjct  201  VLKYHLTP  208



>ref|XP_011809517.1| PREDICTED: LOW QUALITY PROTEIN: 1-acyl-sn-glycerol-3-phosphate 
acyltransferase gamma [Colobus angolensis palliatus]
Length=379

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 121/188 (64%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD
Sbjct  20   VFVVSGLVINFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T +  GKEHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F
Sbjct  79   QATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GLKRL DYP   W  L+ EGTRFT+ K   + E AA+ GLP
Sbjct  139  LEIVFCKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLP  198

Query  738  IPRNVLIP  761
            + +  L+P
Sbjct  199  VLKYHLLP  206



>ref|XP_008631063.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Corvus brachyrhynchos]
 ref|XP_010392907.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Corvus cornix cornix]
 ref|XP_010392908.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Corvus cornix cornix]
 gb|KFO58491.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Corvus 
brachyrhynchos]
Length=376

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 120/188 (64%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N IQ +C +V+ P +K  YRR+N   A  LW +LV L++WW+G +  L++D
Sbjct  20   VFVVSGLIINFIQ-LCTLVLWPINKQLYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T K  GKEH ++I NH  +ID++ GW + +R G LGS+  + K+  +Y+P+IGW+ +F
Sbjct  79   EATVKTFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKRELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GLKRL DYP   W  L+ EGTRFT+ K   + E A S GLP
Sbjct  139  LEIVFCKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYCEGTRFTETKHRISMEVAESKGLP  198

Query  738  IPRNVLIP  761
              +  L+P
Sbjct  199  KLKYHLLP  206



>ref|XP_002189743.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Taeniopygia guttata]
 ref|XP_005526574.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Pseudopodoces humilis]
Length=376

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 120/188 (64%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N IQ +C +V+ P +K  YRR+N   A  LW +LV L++WW+G +  L++D
Sbjct  20   VFVVSGLIINFIQ-LCTLVLWPINKQLYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T K  GKEH ++I NH  +ID++ GW + +R G LGS+  + K+  +Y+P+IGW+ +F
Sbjct  79   EATVKTFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKRELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GLKRL DYP   W  L+ EGTRFT+ K   + E A S GLP
Sbjct  139  LEIVFCKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYCEGTRFTETKHRISMEVAESKGLP  198

Query  738  IPRNVLIP  761
              +  L+P
Sbjct  199  KLKYHLLP  206



>ref|NP_001068336.2| Os11g0637800 [Oryza sativa Japonica Group]
 dbj|BAF28699.2| Os11g0637800, partial [Oryza sativa Japonica Group]
Length=100

 Score =   163 bits (412),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 85/90 (94%), Gaps = 0/90 (0%)
 Frame = +3

Query  399  GKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFFSEYLFLE  578
            G EHAL+ISNHRSDIDW++GW+LAQRSGCLGSTLAVMKKSS +LPVIGWSM+F+EYLFLE
Sbjct  11   GNEHALVISNHRSDIDWLIGWILAQRSGCLGSTLAVMKKSSKFLPVIGWSMWFAEYLFLE  70

Query  579  RSWAKDESTLKSGLKRLQDYPLPFWLALFV  668
            RSWAKDE TLK GL+RL+D+P PFWLALFV
Sbjct  71   RSWAKDEKTLKWGLQRLKDFPRPFWLALFV  100



>ref|XP_008545546.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Microplitis demolitor]
Length=387

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 116/188 (62%), Gaps = 1/188 (1%)
 Frame = +3

Query  201  FFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDP  380
            FF SGL  N +Q I Y+ ++PFSK  YR+IN       + +LV++ +WW+G  + +Y D 
Sbjct  21   FFTSGLIINVLQCILYLGLKPFSKYYYRKINYYLCYSFYSQLVFMAEWWSGTDLIIYIDK  80

Query  381  ETF-KLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              F K  GKEH  L+ NH  +IDW++GW+   R   LG+  A  KKS  Y+P +GW+  F
Sbjct  81   NDFDKYYGKEHGYLLMNHSYEIDWLMGWMFCDRIKMLGNCKAYAKKSIQYVPTLGWAWKF  140

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +E +FLERSW KD+ T+   +  L DYP   WL L+ EGTRFT  KL A+Q++A   GL 
Sbjct  141  AESVFLERSWEKDKETIGHQISELGDYPDTMWLLLYAEGTRFTAEKLEASQKFAKEKGLA  200

Query  738  IPRNVLIP  761
            I ++ L P
Sbjct  201  ILKHHLTP  208



>ref|XP_005548628.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Macaca fascicularis]
Length=403

 Score =   171 bits (434),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 121/188 (64%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD
Sbjct  47   VFVVSGLVINFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTD  105

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T +  GKEHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F
Sbjct  106  QATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYF  165

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GLKRL DYP   W  L+ EGTRFT+ K   + E AA+ GLP
Sbjct  166  LEIVFCKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLP  225

Query  738  IPRNVLIP  761
            + +  L+P
Sbjct  226  VLKYHLLP  233



>ref|XP_004429705.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform 1 [Ceratotherium simum simum]
 ref|XP_004429706.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform 2 [Ceratotherium simum simum]
Length=376

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 120/188 (64%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N++Q +C +V+ P +K  YRR+N   A  LW +LV L++WW+  +  L+TD
Sbjct  20   VFVVSGLVINSVQ-LCTLVLWPLNKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T    GKEH ++I NH  +ID++ GW + +R G LGS+  + K+  +Y+P+IGW+ +F
Sbjct  79   QATVDRFGKEHVVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKRELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GLKRL DYP   W  L+ EGTRFT+ K   + E AAS GLP
Sbjct  139  LEIVFCKRKWEEDRDTVIEGLKRLSDYPESMWFLLYCEGTRFTEKKHRVSMEVAASKGLP  198

Query  738  IPRNVLIP  761
              +  L+P
Sbjct  199  ALKYHLLP  206



>ref|XP_008985009.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Callithrix jacchus]
Length=376

 Score =   171 bits (433),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 121/188 (64%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD
Sbjct  20   VFVVSGLVINFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T +  GKEHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F
Sbjct  79   QATVERFGKEHAVIILNHNFEIDFLCGWTMCERYGVLGSSKVLAKKELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GL+RL DYP   W  L+ EGTRFT+ K   + E AA+ GLP
Sbjct  139  LEIVFCKRKWEEDRDTVIEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLP  198

Query  738  IPRNVLIP  761
            + +  L+P
Sbjct  199  VLKYHLLP  206



>ref|XP_003277406.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform 1 [Nomascus leucogenys]
 ref|XP_003277407.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform 2 [Nomascus leucogenys]
 ref|XP_003277408.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform 3 [Nomascus leucogenys]
 ref|XP_004092377.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Nomascus leucogenys]
Length=376

 Score =   171 bits (432),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 121/188 (64%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD
Sbjct  20   VFVVSGLVINFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T +  GKEHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F
Sbjct  79   EATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GL+RL DYP   W  L+ EGTRFT+ K   + E AA+ GLP
Sbjct  139  LEIVFCKRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLP  198

Query  738  IPRNVLIP  761
            + +  L+P
Sbjct  199  VLKYHLLP  206



>ref|XP_009996223.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Chaetura pelagica]
 gb|KFU84109.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Chaetura 
pelagica]
Length=376

 Score =   171 bits (432),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 119/188 (63%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N IQ +C +V+ P +K  YRRIN   A  LW +LV L++WW+G +  L++D
Sbjct  20   VFVVSGLIINFIQ-LCTLVLWPINKQFYRRINCRLAYSLWSQLVMLLEWWSGTECTLFSD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T    GKEH ++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F
Sbjct  79   EATVNTFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKKELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GLKRL DYP   W  L+ EGTRFT+ K   + E A S GLP
Sbjct  139  LEIVFCKRKWEEDRDTVIEGLKRLSDYPEYMWFLLYCEGTRFTETKHRISMEVAESKGLP  198

Query  738  IPRNVLIP  761
              +  L+P
Sbjct  199  KLKYHLLP  206



>ref|XP_003823897.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Pan paniscus]
 ref|XP_003823899.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Pan paniscus]
 ref|XP_008975810.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Pan paniscus]
Length=376

 Score =   171 bits (432),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 121/188 (64%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD
Sbjct  20   VFVVSGLVINFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T +  GKEHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F
Sbjct  79   QATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GL+RL DYP   W  L+ EGTRFT+ K   + E AA+ GLP
Sbjct  139  LEIVFCKRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLP  198

Query  738  IPRNVLIP  761
            + +  L+P
Sbjct  199  VLKYHLLP  206



>ref|XP_010366226.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Rhinopithecus roxellana]
 ref|XP_010366227.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Rhinopithecus roxellana]
Length=376

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 121/188 (64%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD
Sbjct  20   VFVVSGLVINFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T +  GKEHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F
Sbjct  79   QATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GL+RL DYP   W  L+ EGTRFT+ K   + E AA+ GLP
Sbjct  139  LEIVFCKRKWEEDRDTVIEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLP  198

Query  738  IPRNVLIP  761
            + +  L+P
Sbjct  199  VLKYHLLP  206



>ref|NP_064517.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Homo sapiens]
 ref|NP_001032642.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Homo sapiens]
 ref|XP_005261217.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Homo sapiens]
 ref|XP_006724092.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Homo sapiens]
 ref|XP_006724093.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Homo sapiens]
 ref|XP_011527967.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Homo sapiens]
 sp|Q9NRZ7.1|PLCC_HUMAN RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
gamma; AltName: Full=1-acylglycerol-3-phosphate O-acyltransferase 
3; Short=1-AGP acyltransferase 3; Short=1-AGPAT 3; AltName: 
Full=Lysophosphatidic acid acyltransferase gamma; Short=LPAAT-gamma 
[Homo sapiens]
 gb|AAF80336.1|AF156774_1 lysophosphatidic acid acyltransferase-gamma1 [Homo sapiens]
 dbj|BAB18943.1| 1-acylglycerol-3-phosphate O-acyltransferase 3 [Homo sapiens]
 gb|AAH11971.1| 1-acylglycerol-3-phosphate O-acyltransferase 3 [Homo sapiens]
 gb|AAH63552.1| 1-acylglycerol-3-phosphate O-acyltransferase 3 [Homo sapiens]
 gb|AAH40603.1| AGPAT3 protein [Homo sapiens]
 gb|EAX09461.1| 1-acylglycerol-3-phosphate O-acyltransferase 3, isoform CRA_a 
[Homo sapiens]
 gb|EAX09463.1| 1-acylglycerol-3-phosphate O-acyltransferase 3, isoform CRA_a 
[Homo sapiens]
 gb|EAX09464.1| 1-acylglycerol-3-phosphate O-acyltransferase 3, isoform CRA_a 
[Homo sapiens]
 gb|EAX09465.1| 1-acylglycerol-3-phosphate O-acyltransferase 3, isoform CRA_a 
[Homo sapiens]
 dbj|BAJ17860.1| 1-acylglycerol-3-phosphate O-acyltransferase 3 [synthetic construct]
 gb|ADQ31993.1| 1-acylglycerol-3-phosphate O-acyltransferase 3 [synthetic construct]
 gb|AIC51937.1| AGPAT3, partial [synthetic construct]
 gb|AIC56809.1| AGPAT3, partial [synthetic construct]
Length=376

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 121/188 (64%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD
Sbjct  20   VFVVSGLVINFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T +  GKEHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F
Sbjct  79   QATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GL+RL DYP   W  L+ EGTRFT+ K   + E AA+ GLP
Sbjct  139  LEIVFCKRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLP  198

Query  738  IPRNVLIP  761
            + +  L+P
Sbjct  199  VLKYHLLP  206



>ref|XP_005501703.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X1 [Columba livia]
 ref|XP_005501704.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Columba livia]
 ref|XP_005501705.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X3 [Columba livia]
 gb|EMC79519.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Columba 
livia]
Length=376

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/188 (44%), Positives = 120/188 (64%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N IQ +C +V+ P +K  YRR+N   A  LW +LV L++WW+G +  L++D
Sbjct  20   VFVVSGLIINFIQ-LCTLVLWPINKQFYRRVNCRLAYSLWSQLVMLLEWWSGTECTLFSD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T    GKEH ++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F
Sbjct  79   EATVNTFGKEHVIIILNHNFEIDFLCGWTMTERFGVLGSSKVLAKKELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+ +GLKRL DYP   W  L+ EGTRFT+ K   + E A S GLP
Sbjct  139  LEIVFCKRKWEEDRDTVIAGLKRLADYPEYMWFLLYCEGTRFTETKHRISMEVAESKGLP  198

Query  738  IPRNVLIP  761
              +  L+P
Sbjct  199  KLKYHLLP  206



>ref|XP_003798130.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
[Otolemur garnettii]
Length=376

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/188 (44%), Positives = 119/188 (63%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N  Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD
Sbjct  20   VFVVSGLAINCAQ-LCMLALWPLSKQLYRRVNCRLAYSLWSQLVMLLEWWSCTECTLFTD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T    GKEHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F
Sbjct  79   QATVDRFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+ +GLKRL DYP   W  L+ EGTRFT+ K   + E AAS GLP
Sbjct  139  LEIVFCKRKWEEDRDTVIAGLKRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAASKGLP  198

Query  738  IPRNVLIP  761
              +  L+P
Sbjct  199  PLKYHLLP  206



>ref|XP_011338106.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Cerapachys biroi]
 ref|XP_011338107.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma-like 
[Cerapachys biroi]
Length=513

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 85/188 (45%), Positives = 116/188 (62%), Gaps = 1/188 (1%)
 Frame = +3

Query  201  FFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTDP  380
            FF SGL  N  Q I Y  +RPFSK  YR+IN       + +LV++ +WWAG  + LY D 
Sbjct  21   FFTSGLIINFFQCILYFGLRPFSKYLYRKINYYLCYSFYCQLVFMAEWWAGSDLILYIDK  80

Query  381  ETF-KLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
            + F K  G EH  L+ NH  + DW++GW+L  R   LG+  A  KKS  Y+P +GW+  F
Sbjct  81   DDFAKYFGNEHGYLLMNHSYETDWLIGWLLCDRVRLLGNCKAYAKKSIQYIPTLGWAWKF  140

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
            +E +FLERSW KD+  +K+ +K L +YP   WL L+ EGTRFT  KL A+Q++A   GLP
Sbjct  141  AESIFLERSWEKDKEKIKNQIKELVEYPDTMWLLLYPEGTRFTPKKLEASQKFAIEKGLP  200

Query  738  IPRNVLIP  761
            + +  L P
Sbjct  201  VLKYHLTP  208



>ref|NP_001127407.1| 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma [Pongo abelii]
 sp|Q5RA57.1|PLCC_PONAB RecName: Full=1-acyl-sn-glycerol-3-phosphate acyltransferase 
gamma; AltName: Full=1-acylglycerol-3-phosphate O-acyltransferase 
3; Short=1-AGP acyltransferase 3; Short=1-AGPAT 3; AltName: 
Full=Lysophosphatidic acid acyltransferase gamma; Short=LPAAT-gamma 
[Pongo abelii]
 emb|CAH91353.1| hypothetical protein [Pongo abelii]
Length=376

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 121/188 (64%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD
Sbjct  20   VFVVSGLVINFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T +  GKEHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F
Sbjct  79   QATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GL+RL DYP   W  L+ EGTRFT+ K   + E AA+ GLP
Sbjct  139  LEIVFCKRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLP  198

Query  738  IPRNVLIP  761
            + +  L+P
Sbjct  199  VLKYHLLP  206



>ref|XP_001146797.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Pan troglodytes]
 ref|XP_001146861.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Pan troglodytes]
 ref|XP_009438696.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Pan troglodytes]
 ref|XP_009438806.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Pan troglodytes]
 ref|XP_009438849.1| PREDICTED: 1-acyl-sn-glycerol-3-phosphate acyltransferase gamma 
isoform X2 [Pan troglodytes]
Length=376

 Score =   171 bits (432),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 121/188 (64%), Gaps = 1/188 (1%)
 Frame = +3

Query  198  LFFISGLFTNAIQAICYVVIRPFSKSTYRRINRLFAELLWLELVWLIDWWAGVKVQLYTD  377
            +F +SGL  N +Q +C + + P SK  YRR+N   A  LW +LV L++WW+  +  L+TD
Sbjct  20   VFVVSGLVINFVQ-LCTLALWPVSKQLYRRLNCRLAYSLWSQLVMLLEWWSCTECTLFTD  78

Query  378  PETFKLMGKEHALLISNHRSDIDWVVGWVLAQRSGCLGSTLAVMKKSSVYLPVIGWSMFF  557
              T +  GKEHA++I NH  +ID++ GW + +R G LGS+  + KK  +Y+P+IGW+ +F
Sbjct  79   QATVERFGKEHAVIILNHNFEIDFLCGWTMCERFGVLGSSKVLAKKELLYVPLIGWTWYF  138

Query  558  SEYLFLERSWAKDESTLKSGLKRLQDYPLPFWLALFVEGTRFTQAKLLAAQEYAASTGLP  737
             E +F +R W +D  T+  GL+RL DYP   W  L+ EGTRFT+ K   + E AA+ GLP
Sbjct  139  LEIVFCKRKWEEDRDTVVEGLRRLSDYPEYMWFLLYCEGTRFTETKHRVSMEVAAAKGLP  198

Query  738  IPRNVLIP  761
            + +  L+P
Sbjct  199  VLKYHLLP  206



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1497111138900