BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2258

Length=840
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009602054.1|  PREDICTED: putative phagocytic receptor 1b         356   3e-115   Nicotiana tomentosiformis
ref|XP_011099916.1|  PREDICTED: transmembrane 9 superfamily member 3    355   4e-115   
ref|XP_004239834.1|  PREDICTED: putative phagocytic receptor 1b         355   4e-115   Solanum lycopersicum
ref|XP_006346764.1|  PREDICTED: putative phagocytic receptor 1b-like    355   8e-115   Solanum tuberosum [potatoes]
ref|XP_006365862.1|  PREDICTED: putative phagocytic receptor 1b-like    353   2e-114   
ref|XP_004236681.1|  PREDICTED: putative phagocytic receptor 1b         354   2e-114   Solanum lycopersicum
gb|EYU30878.1|  hypothetical protein MIMGU_mgv1a003324mg                353   2e-114   Erythranthe guttata [common monkey flower]
ref|XP_009774478.1|  PREDICTED: putative phagocytic receptor 1b         353   3e-114   Nicotiana sylvestris
ref|XP_009616336.1|  PREDICTED: putative phagocytic receptor 1b         353   3e-114   Nicotiana tomentosiformis
ref|XP_009785097.1|  PREDICTED: putative phagocytic receptor 1b         352   8e-114   Nicotiana sylvestris
ref|XP_009775043.1|  PREDICTED: putative phagocytic receptor 1b         351   1e-113   Nicotiana sylvestris
ref|XP_006352389.1|  PREDICTED: putative phagocytic receptor 1b-l...    350   5e-113   Solanum tuberosum [potatoes]
ref|XP_004250237.1|  PREDICTED: putative phagocytic receptor 1b         350   6e-113   Solanum lycopersicum
gb|EPS59962.1|  hypothetical protein M569_14842                         346   2e-112   Genlisea aurea
ref|XP_009631354.1|  PREDICTED: putative phagocytic receptor 1b         348   3e-112   Nicotiana tomentosiformis
gb|EYU30892.1|  hypothetical protein MIMGU_mgv1a003326mg                347   5e-112   Erythranthe guttata [common monkey flower]
ref|XP_010244840.1|  PREDICTED: putative phagocytic receptor 1b         347   6e-112   Nelumbo nucifera [Indian lotus]
ref|XP_010069472.1|  PREDICTED: putative phagocytic receptor 1b         339   6e-109   Eucalyptus grandis [rose gum]
gb|AAF79216.1|AC006917_1  F10B6.2                                       327   1e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011085893.1|  PREDICTED: transmembrane 9 superfamily membe...    338   1e-108   Sesamum indicum [beniseed]
ref|XP_010276303.1|  PREDICTED: putative phagocytic receptor 1b         337   4e-108   Nelumbo nucifera [Indian lotus]
ref|XP_010691703.1|  PREDICTED: transmembrane 9 superfamily member 2    337   6e-108   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP01680.1|  unnamed protein product                                337   7e-108   Coffea canephora [robusta coffee]
gb|KHG03505.1|  Putative phagocytic receptor 1b                         336   1e-107   Gossypium arboreum [tree cotton]
ref|XP_010691704.1|  PREDICTED: transmembrane 9 superfamily membe...    334   6e-107   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007031333.1|  Endomembrane protein 70 protein family             332   1e-106   
ref|XP_010554368.1|  PREDICTED: putative phagocytic receptor 1b         333   2e-106   Tarenaya hassleriana [spider flower]
ref|XP_011038404.1|  PREDICTED: transmembrane 9 superfamily member 4    332   3e-106   Populus euphratica
gb|KJB15311.1|  hypothetical protein B456_002G170500                    331   3e-106   Gossypium raimondii
gb|KJB08471.1|  hypothetical protein B456_001G083100                    330   6e-106   Gossypium raimondii
ref|XP_010528590.1|  PREDICTED: putative phagocytic receptor 1b         331   8e-106   Tarenaya hassleriana [spider flower]
ref|XP_006416990.1|  hypothetical protein EUTSA_v10007150mg             331   8e-106   Eutrema salsugineum [saltwater cress]
gb|KJB15310.1|  hypothetical protein B456_002G170500                    331   1e-105   Gossypium raimondii
ref|XP_006372420.1|  hypothetical protein POPTR_0017s01480g             328   2e-105   
gb|KFK43715.1|  hypothetical protein AALP_AA1G163400                    330   2e-105   Arabis alpina [alpine rockcress]
ref|XP_008461818.1|  PREDICTED: putative phagocytic receptor 1b i...    330   2e-105   Cucumis melo [Oriental melon]
ref|XP_011005913.1|  PREDICTED: transmembrane 9 superfamily membe...    330   3e-105   Populus euphratica
gb|KJB08470.1|  hypothetical protein B456_001G083100                    330   3e-105   Gossypium raimondii
ref|XP_004137376.1|  PREDICTED: transmembrane 9 superfamily member 3    330   3e-105   Cucumis sativus [cucumbers]
gb|AAF63170.1|AC010657_6  T5E21.15                                      328   3e-105   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011011376.1|  PREDICTED: transmembrane 9 superfamily membe...    328   4e-105   Populus euphratica
gb|KJB08472.1|  hypothetical protein B456_001G083100                    329   5e-105   Gossypium raimondii
gb|KHG00678.1|  Putative phagocytic receptor 1b                         327   5e-105   Gossypium arboreum [tree cotton]
ref|XP_009110524.1|  PREDICTED: putative phagocytic receptor 1b         329   6e-105   Brassica rapa
gb|KHG04463.1|  Putative phagocytic receptor 1b                         330   8e-105   Gossypium arboreum [tree cotton]
ref|XP_006372421.1|  hypothetical protein POPTR_0017s01480g             329   8e-105   Populus trichocarpa [western balsam poplar]
gb|KHG09925.1|  Putative phagocytic receptor 1b                         328   9e-105   Gossypium arboreum [tree cotton]
emb|CDY52035.1|  BnaA08g31480D                                          328   9e-105   Brassica napus [oilseed rape]
ref|XP_006395825.1|  hypothetical protein EUTSA_v10003877mg             328   1e-104   Eutrema salsugineum [saltwater cress]
ref|NP_172919.1|  putative endomembrane protein 70                      328   1e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011038406.1|  PREDICTED: transmembrane 9 superfamily membe...    328   2e-104   Populus euphratica
ref|XP_010527833.1|  PREDICTED: putative phagocytic receptor 1b         328   2e-104   Tarenaya hassleriana [spider flower]
ref|XP_008462539.1|  PREDICTED: putative phagocytic receptor 1b i...    328   2e-104   Cucumis melo [Oriental melon]
gb|KHN43674.1|  Putative phagocytic receptor 1b                         327   2e-104   Glycine soja [wild soybean]
ref|NP_198547.3|  putative endomembrane protein 70                      328   2e-104   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002870515.1|  transporter                                        327   3e-104   Arabidopsis lyrata subsp. lyrata
ref|XP_007158822.1|  hypothetical protein PHAVU_002G184900g             327   3e-104   Phaseolus vulgaris [French bean]
emb|CDX84018.1|  BnaC08g16270D                                          326   6e-104   
gb|KJB60875.1|  hypothetical protein B456_009G329300                    325   9e-104   Gossypium raimondii
ref|XP_006384123.1|  hypothetical protein POPTR_0004s07400g             326   1e-103   
ref|XP_008393472.1|  PREDICTED: putative phagocytic receptor 1b         326   1e-103   Malus domestica [apple tree]
gb|KJB60874.1|  hypothetical protein B456_009G329300                    326   1e-103   Gossypium raimondii
ref|XP_011005915.1|  PREDICTED: transmembrane 9 superfamily membe...    325   1e-103   Populus euphratica
emb|CDX81659.1|  BnaC08g39420D                                          325   1e-103   
gb|KFK33411.1|  hypothetical protein AALP_AA5G009400                    325   1e-103   Arabis alpina [alpine rockcress]
ref|XP_009110529.1|  PREDICTED: putative phagocytic receptor 1b         325   2e-103   Brassica rapa
ref|XP_009355975.1|  PREDICTED: putative phagocytic receptor 1b         325   2e-103   Pyrus x bretschneideri [bai li]
ref|XP_006405901.1|  hypothetical protein EUTSA_v10027693mg             325   2e-103   
ref|XP_002305925.2|  endomembrane protein 70                            325   2e-103   Populus trichocarpa [western balsam poplar]
ref|XP_006307070.1|  hypothetical protein CARUB_v10008657mg             325   3e-103   Capsella rubella
ref|XP_011463508.1|  PREDICTED: transmembrane 9 superfamily member 2    325   3e-103   Fragaria vesca subsp. vesca
ref|XP_007045410.1|  Endomembrane protein 70 protein family isofo...    325   3e-103   
ref|XP_011654527.1|  PREDICTED: transmembrane 9 superfamily member 2    325   3e-103   Cucumis sativus [cucumbers]
ref|XP_007210263.1|  hypothetical protein PRUPE_ppa003204mg             325   3e-103   Prunus persica
ref|XP_010458976.1|  PREDICTED: putative phagocytic receptor 1b         325   3e-103   Camelina sativa [gold-of-pleasure]
ref|XP_007045409.1|  Endomembrane protein 70 protein family isofo...    325   3e-103   
ref|XP_002876790.1|  hypothetical protein ARALYDRAFT_904415             325   3e-103   Arabidopsis lyrata subsp. lyrata
ref|XP_010523531.1|  PREDICTED: putative phagocytic receptor 1b         324   5e-103   Tarenaya hassleriana [spider flower]
ref|XP_008466877.1|  PREDICTED: putative phagocytic receptor 1b         324   5e-103   Cucumis melo [Oriental melon]
ref|XP_006292411.1|  hypothetical protein CARUB_v10018624mg             324   6e-103   Capsella rubella
ref|XP_010502204.1|  PREDICTED: putative phagocytic receptor 1b         324   6e-103   Camelina sativa [gold-of-pleasure]
ref|XP_004515238.1|  PREDICTED: putative phagocytic receptor 1b-like    324   7e-103   Cicer arietinum [garbanzo]
ref|XP_010513951.1|  PREDICTED: putative phagocytic receptor 1b         324   7e-103   Camelina sativa [gold-of-pleasure]
emb|CDY62621.1|  BnaC08g46810D                                          323   7e-103   Brassica napus [oilseed rape]
ref|XP_010523409.1|  PREDICTED: putative phagocytic receptor 1b         323   9e-103   Tarenaya hassleriana [spider flower]
ref|XP_010476529.1|  PREDICTED: putative phagocytic receptor 1b         323   9e-103   Camelina sativa [gold-of-pleasure]
ref|XP_006448060.1|  hypothetical protein CICLE_v10014688mg             322   1e-102   
ref|NP_178306.1|  putative endomembrane protein 70                      323   1e-102   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010496367.1|  PREDICTED: putative phagocytic receptor 1b         323   1e-102   Camelina sativa [gold-of-pleasure]
ref|XP_010066537.1|  PREDICTED: putative phagocytic receptor 1b         323   1e-102   Eucalyptus grandis [rose gum]
ref|XP_008220963.1|  PREDICTED: putative phagocytic receptor 1b         323   1e-102   Prunus mume [ume]
ref|XP_007152616.1|  hypothetical protein PHAVU_004G145000g             323   1e-102   Phaseolus vulgaris [French bean]
ref|XP_007225615.1|  hypothetical protein PRUPE_ppa003229mg             323   2e-102   Prunus persica
ref|XP_006431398.1|  hypothetical protein CICLE_v10000657mg             322   2e-102   
gb|KHN24548.1|  Putative phagocytic receptor 1b                         323   2e-102   Glycine soja [wild soybean]
ref|XP_003548324.1|  PREDICTED: putative phagocytic receptor 1b-like    323   2e-102   Glycine max [soybeans]
emb|CDY47549.1|  BnaA08g07380D                                          323   2e-102   Brassica napus [oilseed rape]
ref|XP_006448061.1|  hypothetical protein CICLE_v10014688mg             323   2e-102   Citrus clementina [clementine]
ref|XP_010917284.1|  PREDICTED: transmembrane 9 superfamily membe...    322   3e-102   Elaeis guineensis
ref|XP_010440842.1|  PREDICTED: putative phagocytic receptor 1b i...    315   3e-102   
ref|XP_010445554.1|  PREDICTED: putative phagocytic receptor 1b         316   4e-102   Camelina sativa [gold-of-pleasure]
ref|XP_009387842.1|  PREDICTED: putative phagocytic receptor 1b         322   4e-102   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006431397.1|  hypothetical protein CICLE_v10000657mg             322   5e-102   Citrus clementina [clementine]
ref|XP_010105529.1|  Putative phagocytic receptor 1b                    321   8e-102   Morus notabilis
ref|XP_006372422.1|  endomembrane protein 70                            321   9e-102   Populus trichocarpa [western balsam poplar]
ref|XP_009108077.1|  PREDICTED: putative phagocytic receptor 1b         321   1e-101   Brassica rapa
emb|CDY15803.1|  BnaC02g34220D                                          320   1e-101   Brassica napus [oilseed rape]
ref|XP_006470811.1|  PREDICTED: putative phagocytic receptor 1b-like    320   2e-101   Citrus sinensis [apfelsine]
ref|XP_009351612.1|  PREDICTED: putative phagocytic receptor 1b         319   3e-101   Pyrus x bretschneideri [bai li]
ref|XP_003620064.1|  Transmembrane 9 superfamily protein member         319   4e-101   Medicago truncatula
ref|XP_012072398.1|  PREDICTED: transmembrane 9 superfamily membe...    319   5e-101   Jatropha curcas
ref|XP_004299493.1|  PREDICTED: transmembrane 9 superfamily membe...    319   5e-101   Fragaria vesca subsp. vesca
ref|XP_008340538.1|  PREDICTED: putative phagocytic receptor 1b         319   5e-101   Malus domestica [apple tree]
ref|XP_008791844.1|  PREDICTED: putative phagocytic receptor 1b         319   6e-101   Phoenix dactylifera
ref|XP_004504610.1|  PREDICTED: putative phagocytic receptor 1b-like    318   7e-101   Cicer arietinum [garbanzo]
ref|XP_006283389.1|  hypothetical protein CARUB_v10004434mg             318   8e-101   Capsella rubella
ref|XP_008789222.1|  PREDICTED: putative phagocytic receptor 1b         318   1e-100   
ref|XP_003524839.1|  PREDICTED: putative phagocytic receptor 1b-like    318   1e-100   Glycine max [soybeans]
emb|CDP01681.1|  unnamed protein product                                318   1e-100   Coffea canephora [robusta coffee]
ref|XP_002285238.1|  PREDICTED: transmembrane 9 superfamily member 2    318   1e-100   Vitis vinifera
ref|XP_010440841.1|  PREDICTED: putative phagocytic receptor 1b i...    317   2e-100   Camelina sativa [gold-of-pleasure]
ref|XP_010932502.1|  PREDICTED: transmembrane 9 superfamily membe...    318   2e-100   Elaeis guineensis
ref|XP_003531127.1|  PREDICTED: putative phagocytic receptor 1b-like    318   2e-100   Glycine max [soybeans]
ref|XP_006854108.2|  PREDICTED: transmembrane 9 superfamily member 2    317   2e-100   Amborella trichopoda
gb|KHN28892.1|  Putative phagocytic receptor 1b                         318   2e-100   Glycine soja [wild soybean]
ref|XP_010450487.1|  PREDICTED: putative phagocytic receptor 1b         317   2e-100   Camelina sativa [gold-of-pleasure]
dbj|BAJ89640.1|  predicted protein                                      317   2e-100   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_012072397.1|  PREDICTED: transmembrane 9 superfamily member 2    317   3e-100   Jatropha curcas
ref|XP_008375035.1|  PREDICTED: putative phagocytic receptor 1b         317   5e-100   
gb|ERN15575.1|  hypothetical protein AMTR_s00048p00146310               317   7e-100   Amborella trichopoda
ref|XP_008389133.1|  PREDICTED: putative phagocytic receptor 1b         316   9e-100   
ref|XP_009380058.1|  PREDICTED: putative phagocytic receptor 1b         315   9e-100   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010936838.1|  PREDICTED: transmembrane 9 superfamily membe...    315   1e-99    Elaeis guineensis
ref|XP_004985073.1|  PREDICTED: putative phagocytic receptor 1b-like    315   1e-99    Setaria italica
ref|XP_009389646.1|  PREDICTED: putative phagocytic receptor 1b         315   3e-99    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010435562.1|  PREDICTED: putative phagocytic receptor 1b         314   4e-99    Camelina sativa [gold-of-pleasure]
ref|XP_008798135.1|  PREDICTED: putative phagocytic receptor 1b         313   8e-99    Phoenix dactylifera
emb|CDY41095.1|  BnaC05g10860D                                          313   1e-98    Brassica napus [oilseed rape]
ref|XP_008787888.1|  PREDICTED: putative phagocytic receptor 1b i...    311   2e-98    Phoenix dactylifera
gb|ADQ43185.1|  endomemebrane protein 70                                312   2e-98    Schrenkiella parvula
tpg|DAA44289.1|  TPA: hypothetical protein ZEAMMB73_547933              310   4e-98    
ref|XP_008787887.1|  PREDICTED: putative phagocytic receptor 1b i...    311   4e-98    Phoenix dactylifera
ref|XP_003558407.1|  PREDICTED: putative phagocytic receptor 1b         310   2e-97    Brachypodium distachyon [annual false brome]
ref|NP_001148980.1|  LOC100282600 precursor                             310   2e-97    Zea mays [maize]
ref|XP_010920043.1|  PREDICTED: transmembrane 9 superfamily membe...    307   4e-97    
ref|XP_010920044.1|  PREDICTED: transmembrane 9 superfamily membe...    306   4e-97    
ref|NP_001049492.1|  Os03g0237000                                       309   5e-97    
ref|XP_009419338.1|  PREDICTED: putative phagocytic receptor 1b         308   6e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404153.1|  PREDICTED: putative phagocytic receptor 1b         308   7e-97    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010939968.1|  PREDICTED: transmembrane 9 superfamily membe...    308   8e-97    Elaeis guineensis
gb|KJB10378.1|  hypothetical protein B456_001G198000                    305   1e-96    Gossypium raimondii
ref|XP_002468203.1|  hypothetical protein SORBIDRAFT_01g041650          308   1e-96    Sorghum bicolor [broomcorn]
gb|AGT15903.1|  transmembrane 9 superfamily protein                     308   1e-96    Saccharum hybrid cultivar R570
ref|XP_008356702.1|  PREDICTED: transmembrane 9 superfamily membe...    302   2e-96    
ref|XP_002521899.1|  transporter, putative                              307   2e-96    Ricinus communis
ref|XP_010920041.1|  PREDICTED: transmembrane 9 superfamily membe...    306   4e-96    
ref|XP_010920042.1|  PREDICTED: transmembrane 9 superfamily membe...    306   4e-96    
gb|ABK25212.1|  unknown                                                 298   7e-96    Picea sitchensis
gb|ACG42357.1|  transmembrane 9 superfamily protein member 1 prec...    303   5e-95    Zea mays [maize]
ref|NP_001151315.1|  transmembrane 9 superfamily protein member 1...    303   5e-95    Zea mays [maize]
ref|XP_010099693.1|  Putative phagocytic receptor 1b                    303   1e-94    
ref|XP_008788644.1|  PREDICTED: putative phagocytic receptor 1b         301   4e-94    Phoenix dactylifera
ref|XP_007141945.1|  hypothetical protein PHAVU_008G239300g             301   4e-94    Phaseolus vulgaris [French bean]
ref|XP_010276746.1|  PREDICTED: putative phagocytic receptor 1b         300   6e-94    Nelumbo nucifera [Indian lotus]
ref|XP_009782678.1|  PREDICTED: putative phagocytic receptor 1b i...    300   2e-93    Nicotiana sylvestris
ref|XP_009628015.1|  PREDICTED: putative phagocytic receptor 1b i...    299   2e-93    Nicotiana tomentosiformis
gb|ABK24901.1|  unknown                                                 298   4e-93    Picea sitchensis
emb|CDP05457.1|  unnamed protein product                                298   5e-93    Coffea canephora [robusta coffee]
ref|XP_004240860.1|  PREDICTED: putative phagocytic receptor 1b i...    298   7e-93    
ref|XP_010036999.1|  PREDICTED: putative phagocytic receptor 1b         298   9e-93    Eucalyptus grandis [rose gum]
gb|ERN11066.1|  hypothetical protein AMTR_s00024p00115620               297   1e-92    Amborella trichopoda
ref|XP_006849485.2|  PREDICTED: transmembrane 9 superfamily member 2    297   1e-92    Amborella trichopoda
gb|KHN41041.1|  Putative phagocytic receptor 1b                         296   2e-92    Glycine soja [wild soybean]
ref|XP_003518365.2|  PREDICTED: putative phagocytic receptor 1b-l...    296   2e-92    Glycine max [soybeans]
ref|XP_004490795.1|  PREDICTED: putative phagocytic receptor 1b-like    296   2e-92    Cicer arietinum [garbanzo]
ref|XP_006358745.1|  PREDICTED: putative phagocytic receptor 1b-like    294   2e-91    
ref|XP_010910475.1|  PREDICTED: transmembrane 9 superfamily membe...    291   5e-91    
ref|XP_002521900.1|  transporter, putative                              292   1e-90    Ricinus communis
ref|XP_010910474.1|  PREDICTED: transmembrane 9 superfamily membe...    291   1e-90    
ref|XP_006575472.1|  PREDICTED: putative phagocytic receptor 1b-l...    291   2e-90    Glycine max [soybeans]
ref|XP_008813153.1|  PREDICTED: putative phagocytic receptor 1b         291   3e-90    Phoenix dactylifera
ref|XP_010910473.1|  PREDICTED: transmembrane 9 superfamily membe...    291   4e-90    Elaeis guineensis
ref|XP_003544357.1|  PREDICTED: putative phagocytic receptor 1b-like    290   5e-90    Glycine max [soybeans]
gb|AES99151.2|  transmembrane 9 family protein                          290   5e-90    Medicago truncatula
gb|KHG20583.1|  Putative phagocytic receptor 1b                         290   1e-89    Gossypium arboreum [tree cotton]
ref|XP_009408099.1|  PREDICTED: putative phagocytic receptor 1b         289   1e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003616193.1|  Transmembrane 9 superfamily protein member         291   3e-89    
gb|KJB15313.1|  hypothetical protein B456_002G170500                    288   3e-89    Gossypium raimondii
ref|XP_009784369.1|  PREDICTED: putative phagocytic receptor 1b i...    288   4e-89    Nicotiana sylvestris
ref|XP_009388099.1|  PREDICTED: putative phagocytic receptor 1b         288   5e-89    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003573450.1|  PREDICTED: putative phagocytic receptor 1b         287   1e-88    Brachypodium distachyon [annual false brome]
gb|EEC82941.1|  hypothetical protein OsI_27915                          287   1e-88    Oryza sativa Indica Group [Indian rice]
gb|KJB43179.1|  hypothetical protein B456_007G188200                    285   6e-88    Gossypium raimondii
ref|XP_010037000.1|  PREDICTED: putative phagocytic receptor 1b         285   8e-88    Eucalyptus grandis [rose gum]
ref|NP_001148367.1|  transmembrane 9 superfamily protein member 1...    283   4e-87    Zea mays [maize]
gb|ABR16201.1|  unknown                                                 282   5e-87    Picea sitchensis
gb|EEE68090.1|  hypothetical protein OsJ_26137                          288   5e-87    Oryza sativa Japonica Group [Japonica rice]
ref|XP_009615617.1|  PREDICTED: putative phagocytic receptor 1b i...    283   6e-87    Nicotiana tomentosiformis
ref|XP_008356706.1|  PREDICTED: transmembrane 9 superfamily membe...    276   1e-86    
ref|XP_006659860.1|  PREDICTED: putative phagocytic receptor 1b-like    281   2e-86    Oryza brachyantha
ref|XP_004972769.1|  PREDICTED: putative phagocytic receptor 1b-l...    280   3e-86    Setaria italica
gb|EMT19161.1|  Putative phagocytic receptor 1b                         280   7e-86    
ref|NP_001064040.1|  Os10g0112600                                       279   9e-86    
gb|AAK52585.1|AC079685_16  Putative endosomal protein                   279   2e-85    Oryza sativa Japonica Group [Japonica rice]
gb|EEC66468.1|  hypothetical protein OsI_32547                          279   2e-85    Oryza sativa Indica Group [Indian rice]
gb|EMS60954.1|  Putative phagocytic receptor 1b                         278   3e-85    Triticum urartu
ref|XP_004972768.1|  PREDICTED: putative phagocytic receptor 1b-l...    281   5e-85    
ref|XP_006661606.1|  PREDICTED: putative phagocytic receptor 1b-like    277   7e-85    Oryza brachyantha
ref|XP_007045412.1|  Endomembrane protein 70 protein family isofo...    270   2e-84    
gb|KHN39489.1|  Putative phagocytic receptor 1b                         274   3e-84    Glycine soja [wild soybean]
gb|EPS73142.1|  hypothetical protein M569_01612                         272   1e-83    Genlisea aurea
dbj|BAJ89513.1|  predicted protein                                      273   2e-83    Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS73381.1|  hypothetical protein M569_01372                         269   8e-82    Genlisea aurea
ref|XP_011003770.1|  PREDICTED: transmembrane 9 superfamily membe...    267   3e-81    Populus euphratica
ref|XP_002521898.1|  transporter, putative                              258   2e-78    
ref|XP_005650990.1|  EMP/nonaspanin domain family protein               261   2e-78    Coccomyxa subellipsoidea C-169
ref|XP_001770691.1|  predicted protein                                  259   3e-78    
emb|CDY52038.1|  BnaA08g31510D                                          255   1e-77    Brassica napus [oilseed rape]
dbj|BAC57816.1|  putative syntaxin SYP111                               257   2e-77    Oryza sativa Japonica Group [Japonica rice]
gb|EEC74833.1|  hypothetical protein OsI_10676                          265   5e-77    Oryza sativa Indica Group [Indian rice]
ref|XP_001775546.1|  predicted protein                                  256   6e-77    
ref|XP_010261665.1|  PREDICTED: putative phagocytic receptor 1b         257   8e-77    Nelumbo nucifera [Indian lotus]
ref|XP_007512838.1|  predicted protein                                  256   2e-76    Bathycoccus prasinos
ref|XP_012077856.1|  PREDICTED: transmembrane 9 superfamily membe...    249   2e-76    
ref|XP_002317710.2|  hypothetical protein POPTR_0012s03920g             255   2e-76    
ref|XP_003059958.1|  predicted protein                                  255   2e-76    Micromonas pusilla CCMP1545
ref|XP_006364083.1|  PREDICTED: putative phagocytic receptor 1b-like    254   3e-76    Solanum tuberosum [potatoes]
ref|XP_006376703.1|  hypothetical protein POPTR_0012s03920g             255   4e-76    
ref|XP_010322125.1|  PREDICTED: putative phagocytic receptor 1b i...    251   2e-75    
ref|XP_001699211.1|  EMP/nonaspanin domain family protein               252   3e-75    Chlamydomonas reinhardtii
ref|XP_010322438.1|  PREDICTED: putative phagocytic receptor 1b i...    249   5e-75    Solanum lycopersicum
emb|CDP05446.1|  unnamed protein product                                251   7e-75    Coffea canephora [robusta coffee]
ref|XP_012077855.1|  PREDICTED: transmembrane 9 superfamily membe...    250   1e-74    Jatropha curcas
ref|XP_006448062.1|  hypothetical protein CICLE_v10014688mg             249   1e-74    
ref|XP_004228944.1|  PREDICTED: putative phagocytic receptor 1b         250   1e-74    Solanum lycopersicum
ref|XP_006361076.1|  PREDICTED: putative phagocytic receptor 1b-like    249   3e-74    Solanum tuberosum [potatoes]
ref|XP_007208295.1|  hypothetical protein PRUPE_ppa003325mg             249   4e-74    
ref|XP_004241321.1|  PREDICTED: putative phagocytic receptor 1b i...    249   4e-74    Solanum lycopersicum
ref|XP_008228600.1|  PREDICTED: putative phagocytic receptor 1b         248   5e-74    Prunus mume [ume]
gb|KJB60873.1|  hypothetical protein B456_009G329300                    247   8e-74    Gossypium raimondii
gb|KHG11801.1|  Putative phagocytic receptor 1b                         248   1e-73    Gossypium arboreum [tree cotton]
ref|XP_008356712.1|  PREDICTED: putative phagocytic receptor 1b         239   1e-73    
gb|KJB55631.1|  hypothetical protein B456_009G086000                    246   3e-73    Gossypium raimondii
gb|KJB55630.1|  hypothetical protein B456_009G086000                    246   4e-73    Gossypium raimondii
ref|XP_002974646.1|  hypothetical protein SELMODRAFT_101645             246   7e-73    
ref|XP_002523798.1|  transporter, putative                              243   9e-73    
ref|XP_002274254.1|  PREDICTED: transmembrane 9 superfamily member 5    246   9e-73    Vitis vinifera
emb|CBI28324.3|  unnamed protein product                                246   1e-72    Vitis vinifera
ref|XP_006487943.1|  PREDICTED: putative phagocytic receptor 1b-l...    244   2e-72    Citrus sinensis [apfelsine]
ref|XP_002973969.1|  hypothetical protein SELMODRAFT_173941             244   2e-72    Selaginella moellendorffii
gb|AHA84153.1|  phagocytic receptor 1b                                  244   2e-72    Phaseolus vulgaris [French bean]
ref|XP_002963357.1|  hypothetical protein SELMODRAFT_166118             244   2e-72    
gb|EMS68537.1|  Putative phagocytic receptor 1b                         243   2e-72    Triticum urartu
ref|XP_010045209.1|  PREDICTED: putative phagocytic receptor 1b         244   3e-72    Eucalyptus grandis [rose gum]
ref|XP_009592973.1|  PREDICTED: putative phagocytic receptor 1b         243   5e-72    Nicotiana tomentosiformis
emb|CDP06928.1|  unnamed protein product                                242   1e-71    Coffea canephora [robusta coffee]
ref|XP_009779343.1|  PREDICTED: putative phagocytic receptor 1b         243   1e-71    Nicotiana sylvestris
ref|XP_010521657.1|  PREDICTED: putative phagocytic receptor 1b i...    242   1e-71    Tarenaya hassleriana [spider flower]
ref|XP_008382598.1|  PREDICTED: putative phagocytic receptor 1b         242   1e-71    
ref|XP_002969094.1|  hypothetical protein SELMODRAFT_170330             242   2e-71    Selaginella moellendorffii
ref|XP_004293072.1|  PREDICTED: transmembrane 9 superfamily member 5    242   2e-71    Fragaria vesca subsp. vesca
emb|CEG02174.1|  Nonaspanin (TM9SF)                                     242   2e-71    Ostreococcus tauri
ref|XP_009343744.1|  PREDICTED: putative phagocytic receptor 1b         241   3e-71    
emb|CAN67239.1|  hypothetical protein VITISV_004804                     246   5e-71    Vitis vinifera
ref|XP_001422764.1|  predicted protein                                  241   6e-71    Ostreococcus lucimarinus CCE9901
ref|XP_009350847.1|  PREDICTED: putative phagocytic receptor 1b         239   1e-70    
ref|XP_006424246.1|  hypothetical protein CICLE_v10028069mg             240   1e-70    Citrus clementina [clementine]
ref|XP_007015826.1|  Endomembrane protein 70 protein family isofo...    239   2e-70    
ref|XP_009784371.1|  PREDICTED: putative phagocytic receptor 1b i...    238   3e-70    Nicotiana sylvestris
ref|XP_009784372.1|  PREDICTED: putative phagocytic receptor 1b i...    238   3e-70    Nicotiana sylvestris
ref|XP_002892454.1|  endomembrane protein 70 family protein             238   3e-70    Arabidopsis lyrata subsp. lyrata
ref|XP_006384818.1|  hypothetical protein POPTR_0004s21340g             238   6e-70    Populus trichocarpa [western balsam poplar]
ref|XP_009615619.1|  PREDICTED: putative phagocytic receptor 1b i...    237   6e-70    Nicotiana tomentosiformis
ref|XP_001783681.1|  predicted protein                                  237   2e-69    
ref|XP_002952428.1|  hypothetical protein VOLCADRAFT_75353              235   3e-69    Volvox carteri f. nagariensis
ref|XP_009615618.1|  PREDICTED: putative phagocytic receptor 1b i...    235   4e-69    
ref|XP_009782694.1|  PREDICTED: putative phagocytic receptor 1b i...    235   4e-69    Nicotiana sylvestris
ref|XP_005850808.1|  hypothetical protein CHLNCDRAFT_29709              236   4e-69    Chlorella variabilis
emb|CDX93569.1|  BnaA06g04790D                                          235   7e-69    
ref|XP_007015827.1|  Endomembrane protein 70 protein family isofo...    234   1e-68    
ref|XP_006849484.1|  PREDICTED: transmembrane 9 superfamily membe...    234   2e-68    
ref|XP_011007160.1|  PREDICTED: transmembrane 9 superfamily member 5    233   3e-68    
gb|AAF22904.1|AC006932_21  T27G7.5                                      232   3e-68    
emb|CDP05443.1|  unnamed protein product                                233   3e-68    
ref|XP_009148093.1|  PREDICTED: putative phagocytic receptor 1b i...    233   4e-68    
ref|NP_001077489.1|  endomembrane protein 70                            233   4e-68    
ref|XP_010089827.1|  Putative phagocytic receptor 1b                    233   4e-68    
ref|XP_009148094.1|  PREDICTED: putative phagocytic receptor 1b i...    233   5e-68    
ref|XP_009628018.1|  PREDICTED: putative phagocytic receptor 1b i...    232   5e-68    
ref|XP_010488740.1|  PREDICTED: putative phagocytic receptor 1b i...    231   2e-67    
ref|XP_010475626.1|  PREDICTED: putative phagocytic receptor 1b i...    230   6e-67    
gb|KGN64924.1|  hypothetical protein Csa_1G162600                       222   9e-67    
gb|KHN21147.1|  Putative phagocytic receptor 1b                         226   2e-65    
ref|XP_010271661.1|  PREDICTED: putative phagocytic receptor 1b         226   2e-65    
ref|XP_007132435.1|  hypothetical protein PHAVU_011G094100g             225   3e-65    
ref|XP_005650801.1|  putative endosomal protein                         225   4e-65    
ref|XP_006417702.1|  hypothetical protein EUTSA_v10007170mg             224   5e-65    
gb|EYU26707.1|  hypothetical protein MIMGU_mgv1a002565mg                226   8e-65    
ref|XP_011088887.1|  PREDICTED: transmembrane 9 superfamily membe...    224   9e-65    
emb|CDX95066.1|  BnaC05g06050D                                          224   9e-65    
ref|XP_003540797.1|  PREDICTED: putative phagocytic receptor 1b-like    224   1e-64    
emb|CDP05449.1|  unnamed protein product                                216   2e-64    
ref|XP_004139482.1|  PREDICTED: transmembrane 9 superfamily membe...    223   4e-64    
ref|XP_006307081.1|  hypothetical protein CARUB_v10008667mg             222   6e-64    
dbj|BAG99652.1|  unnamed protein product                                213   1e-63    
ref|XP_011399711.1|  Putative phagocytic receptor 1b                    220   4e-63    
ref|XP_004506179.1|  PREDICTED: putative phagocytic receptor 1b-like    219   4e-63    
ref|XP_009615620.1|  PREDICTED: putative phagocytic receptor 1b i...    219   5e-63    
ref|XP_010686009.1|  PREDICTED: transmembrane 9 superfamily membe...    218   1e-62    
ref|XP_008461493.1|  PREDICTED: putative phagocytic receptor 1b i...    219   2e-62    
gb|KJB43178.1|  hypothetical protein B456_007G188200                    214   3e-61    
ref|XP_003606114.1|  Transmembrane 9 superfamily member                 215   3e-61    
gb|KCW48636.1|  hypothetical protein EUGRSUZ_K02294                     212   9e-61    
ref|XP_010039016.1|  PREDICTED: putative phagocytic receptor 1b         213   4e-60    
emb|CDY03085.1|  BnaC07g21420D                                          209   1e-59    
gb|KIY96549.1|  Putative phagocytic receptor 1b                         205   2e-59    
gb|KCW64445.1|  hypothetical protein EUGRSUZ_G02063                     210   2e-59    
gb|KDO58074.1|  hypothetical protein CISIN_1g036992mg                   209   2e-59    
ref|XP_010066531.1|  PREDICTED: putative phagocytic receptor 1b i...    209   3e-59    
ref|XP_001755694.1|  predicted protein                                  208   7e-59    
ref|XP_002956625.1|  hypothetical protein VOLCADRAFT_110022             206   8e-58    
emb|CDY56297.1|  BnaC09g52300D                                          203   2e-57    
ref|XP_001689987.1|  EMP/nonaspanin domain family protein               204   3e-57    
ref|XP_011003771.1|  PREDICTED: transmembrane 9 superfamily membe...    201   3e-56    
gb|KDD75073.1|  endomembrane protein 70                                 192   8e-53    
emb|CDP05453.1|  unnamed protein product                                189   6e-52    
ref|XP_010271660.1|  PREDICTED: putative phagocytic receptor 1b         189   8e-52    
gb|KDD72720.1|  endomembrane protein 70                                 182   1e-51    
ref|XP_006487944.1|  PREDICTED: putative phagocytic receptor 1b-l...    186   5e-51    
ref|XP_010105528.1|  Putative phagocytic receptor 1b                    186   2e-50    
gb|KDO42648.1|  hypothetical protein CISIN_1g040008mg                   175   8e-50    
gb|EKC28088.1|  Transmembrane 9 superfamily member 1                    181   5e-49    
ref|XP_004352299.1|  TM9 protein B                                      183   6e-49    
ref|XP_007045411.1|  Endomembrane protein 70 protein family isofo...    177   8e-49    
ref|XP_011420426.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    181   1e-48    
ref|XP_009784373.1|  PREDICTED: putative phagocytic receptor 1b i...    179   1e-48    
gb|EFA76586.1|  TM9 protein B                                           179   4e-48    
ref|XP_005824782.1|  hypothetical protein GUITHDRAFT_158562             179   5e-48    
ref|XP_010521658.1|  PREDICTED: putative phagocytic receptor 1b i...    176   2e-47    
ref|XP_011088888.1|  PREDICTED: transmembrane 9 superfamily membe...    174   1e-46    
ref|XP_005109383.1|  PREDICTED: transmembrane 9 superfamily membe...    174   4e-46    
ref|XP_003294418.1|  hypothetical protein DICPUDRAFT_59030              173   8e-46    
ref|XP_787683.3|  PREDICTED: transmembrane 9 superfamily member 1       169   1e-45    
ref|XP_011625258.1|  PREDICTED: transmembrane 9 superfamily membe...    171   2e-45    
ref|XP_010475629.1|  PREDICTED: putative phagocytic receptor 1b i...    171   4e-45    
ref|XP_003083100.1|  putative syntaxin SYP111 (ISS)                     169   5e-45    
emb|CDP05442.1|  unnamed protein product                                167   9e-45    
ref|XP_011654417.1|  PREDICTED: transmembrane 9 superfamily membe...    169   1e-44    
ref|XP_009043140.1|  hypothetical protein AURANDRAFT_72882              162   3e-44    
ref|XP_003457937.2|  PREDICTED: transmembrane 9 superfamily membe...    168   5e-44    
ref|XP_007255923.1|  PREDICTED: transmembrane 9 superfamily member 1    167   7e-44    
ref|XP_002167759.2|  PREDICTED: transmembrane 9 superfamily membe...    167   7e-44    
ref|XP_005822074.1|  hypothetical protein GUITHDRAFT_166088             167   8e-44    
ref|XP_008461510.1|  PREDICTED: putative phagocytic receptor 1b i...    166   9e-44    
ref|XP_642756.1|  TM9 protein B                                         167   1e-43    
ref|XP_008461501.1|  PREDICTED: putative phagocytic receptor 1b i...    166   1e-43    
gb|AAQ95660.1|  Phg1B                                                   167   1e-43    
ref|XP_002939067.1|  PREDICTED: transmembrane 9 superfamily membe...    166   2e-43    
ref|XP_006809561.1|  PREDICTED: transmembrane 9 superfamily membe...    166   3e-43    
ref|XP_004575210.1|  PREDICTED: transmembrane 9 superfamily membe...    166   3e-43    
ref|NP_001003550.1|  transmembrane 9 superfamily member 1               166   3e-43    
ref|XP_005754693.1|  PREDICTED: transmembrane 9 superfamily membe...    166   3e-43    
dbj|GAM27660.1|  hypothetical protein SAMD00019534_108360               165   5e-43    
emb|CBN81815.1|  Transmembrane 9 superfamily member 1                   165   6e-43    
ref|XP_006448059.1|  hypothetical protein CICLE_v10017699mg             161   9e-43    
ref|XP_010884102.1|  PREDICTED: transmembrane 9 superfamily member 1    164   9e-43    
ref|XP_003967994.1|  PREDICTED: transmembrane 9 superfamily member 1    164   1e-42    
gb|ACR33947.1|  unknown                                                 162   1e-42    
ref|XP_006649701.1|  PREDICTED: putative phagocytic receptor 1b-like    162   1e-42    
gb|KFO27482.1|  Importin-4                                              167   2e-42    
ref|XP_008436895.1|  PREDICTED: transmembrane 9 superfamily member 1    163   3e-42    
emb|CDQ70386.1|  unnamed protein product                                163   3e-42    
ref|XP_007548006.1|  PREDICTED: transmembrane 9 superfamily member 1    162   4e-42    
gb|EPY89936.1|  importin-4                                              166   4e-42    
ref|XP_008267651.1|  PREDICTED: transmembrane 9 superfamily membe...    164   5e-42    
ref|XP_010739917.1|  PREDICTED: transmembrane 9 superfamily membe...    162   6e-42    
ref|XP_011733307.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    164   7e-42    
ref|XP_003226712.1|  PREDICTED: transmembrane 9 superfamily member 1    162   7e-42    
ref|XP_006519680.1|  PREDICTED: transmembrane 9 superfamily membe...    159   2e-41    
ref|XP_004698552.1|  PREDICTED: transmembrane 9 superfamily member 1    163   2e-41    
gb|ELW69279.1|  Importin-4                                              164   2e-41    
gb|ELK11218.1|  Importin-4                                              164   2e-41    
ref|XP_009041654.1|  hypothetical protein AURANDRAFT_55500              160   3e-41    
ref|XP_008305730.1|  PREDICTED: transmembrane 9 superfamily member 1    160   3e-41    
ref|XP_011243511.1|  PREDICTED: transmembrane 9 superfamily membe...    159   3e-41    
ref|XP_005803703.1|  PREDICTED: transmembrane 9 superfamily membe...    159   4e-41    
ref|XP_004335868.1|  endomembrane protein EMP70 precursor isolog,...    159   4e-41    
ref|XP_006519679.1|  PREDICTED: transmembrane 9 superfamily membe...    159   5e-41    
ref|XP_008838041.1|  PREDICTED: transmembrane 9 superfamily member 1    159   5e-41    
ref|XP_008067922.1|  PREDICTED: transmembrane 9 superfamily member 1    159   5e-41    
gb|KHN11244.1|  Transmembrane 9 superfamily member 3                    159   6e-41    
ref|XP_010636002.1|  PREDICTED: transmembrane 9 superfamily member 1    159   6e-41    
ref|XP_003540158.1|  PREDICTED: transmembrane 9 superfamily membe...    159   7e-41    
ref|XP_006835459.1|  PREDICTED: charged multivesicular body prote...    159   7e-41    
ref|XP_004885399.1|  PREDICTED: transmembrane 9 superfamily membe...    159   7e-41    
ref|XP_010994078.1|  PREDICTED: LOW QUALITY PROTEIN: transmembran...    160   8e-41    
ref|XP_008276179.1|  PREDICTED: transmembrane 9 superfamily member 1    159   8e-41    
ref|XP_003421009.1|  PREDICTED: transmembrane 9 superfamily membe...    159   9e-41    
ref|XP_004081008.1|  PREDICTED: transmembrane 9 superfamily member 1    158   1e-40    
ref|XP_003532994.1|  PREDICTED: transmembrane 9 superfamily membe...    158   1e-40    
dbj|BAF84799.1|  unnamed protein product                                158   1e-40    
ref|XP_010953066.1|  PREDICTED: transmembrane 9 superfamily membe...    158   1e-40    
ref|XP_006988599.1|  PREDICTED: transmembrane 9 superfamily membe...    158   1e-40    
ref|XP_010598840.1|  PREDICTED: transmembrane 9 superfamily membe...    160   2e-40    
ref|XP_010953065.1|  PREDICTED: transmembrane 9 superfamily membe...    158   2e-40    
ref|XP_004694659.1|  PREDICTED: transmembrane 9 superfamily member 1    160   2e-40    
gb|KHN45466.1|  Transmembrane 9 superfamily member 3                    158   2e-40    
ref|XP_007984497.1|  PREDICTED: transmembrane 9 superfamily membe...    158   2e-40    
emb|CBN73993.1|  conserved unknown protein                              158   2e-40    
ref|NP_001014842.1|  transmembrane 9 superfamily member 1 isoform...    157   2e-40    
ref|NP_001012155.1|  transmembrane 9 superfamily member 1 precursor     157   2e-40    
ref|XP_006217338.1|  PREDICTED: charged multivesicular body prote...    159   2e-40    
ref|XP_006172880.1|  PREDICTED: charged multivesicular body prote...    159   3e-40    
ref|XP_005338783.1|  PREDICTED: transmembrane 9 superfamily membe...    157   3e-40    
ref|XP_006252052.1|  PREDICTED: transmembrane 9 superfamily membe...    157   3e-40    
ref|XP_537385.2|  PREDICTED: transmembrane 9 superfamily member 1...    157   3e-40    
gb|ERE89416.1|  transmembrane 9 superfamily member 1 isoform 2          157   3e-40    
ref|XP_006739631.1|  PREDICTED: transmembrane 9 superfamily membe...    156   3e-40    
gb|EMP30576.1|  Transmembrane 9 superfamily member 1                    157   3e-40    
ref|XP_006883244.1|  PREDICTED: transmembrane 9 superfamily membe...    157   3e-40    
ref|XP_003502106.1|  PREDICTED: transmembrane 9 superfamily member 1    157   3e-40    
ref|XP_005211436.1|  PREDICTED: transmembrane 9 superfamily membe...    157   3e-40    
ref|XP_006043348.1|  PREDICTED: transmembrane 9 superfamily member 1    157   3e-40    
ref|XP_005904977.1|  PREDICTED: transmembrane 9 superfamily member 1    157   3e-40    
ref|NP_001077212.1|  transmembrane 9 superfamily member 1 precursor     157   3e-40    
ref|XP_004421247.1|  PREDICTED: transmembrane 9 superfamily membe...    157   3e-40    
ref|XP_007130112.1|  PREDICTED: transmembrane 9 superfamily membe...    157   3e-40    
gb|AAF98161.1|AF269152_1  transmembrane protein TM9SF1                  157   4e-40    
ref|XP_004055037.1|  PREDICTED: transmembrane 9 superfamily membe...    157   4e-40    
ref|XP_007130114.1|  PREDICTED: transmembrane 9 superfamily membe...    157   4e-40    
ref|XP_007536361.1|  PREDICTED: transmembrane 9 superfamily membe...    158   4e-40    
ref|XP_004390569.1|  PREDICTED: transmembrane 9 superfamily member 1    157   4e-40    
ref|XP_007447941.1|  PREDICTED: transmembrane 9 superfamily membe...    157   4e-40    
ref|XP_002718144.1|  PREDICTED: transmembrane 9 superfamily membe...    157   5e-40    
ref|NP_006396.2|  transmembrane 9 superfamily member 1 isoform a ...    157   5e-40    
ref|XP_003260724.1|  PREDICTED: transmembrane 9 superfamily member 1    157   5e-40    
ref|XP_004661882.1|  PREDICTED: transmembrane 9 superfamily member 1    157   5e-40    
ref|XP_007180675.1|  PREDICTED: transmembrane 9 superfamily membe...    157   5e-40    
ref|XP_007130113.1|  PREDICTED: transmembrane 9 superfamily membe...    157   5e-40    
ref|XP_008959494.1|  PREDICTED: transmembrane 9 superfamily membe...    156   5e-40    
ref|XP_007180676.1|  PREDICTED: transmembrane 9 superfamily membe...    157   5e-40    
ref|XP_004283185.1|  PREDICTED: transmembrane 9 superfamily member 1    157   5e-40    
ref|NP_001267415.1|  transmembrane 9 superfamily member 1 precursor     157   5e-40    
ref|NP_001253390.1|  transmembrane 9 superfamily member 1 precursor     157   5e-40    
ref|XP_007447942.1|  PREDICTED: transmembrane 9 superfamily membe...    157   5e-40    
ref|XP_010333315.1|  PREDICTED: transmembrane 9 superfamily member 1    157   5e-40    
ref|XP_008707016.1|  PREDICTED: transmembrane 9 superfamily member 1    156   5e-40    
ref|XP_007098088.1|  PREDICTED: transmembrane 9 superfamily membe...    156   5e-40    
ref|XP_011281457.1|  PREDICTED: transmembrane 9 superfamily member 1    156   5e-40    
ref|XP_004402105.1|  PREDICTED: transmembrane 9 superfamily membe...    156   5e-40    
ref|XP_004402104.1|  PREDICTED: transmembrane 9 superfamily membe...    157   5e-40    
gb|AAC51782.1|  multispanning membrane protein                          156   5e-40    
ref|XP_006883243.1|  PREDICTED: transmembrane 9 superfamily membe...    158   6e-40    
ref|XP_006835458.1|  PREDICTED: charged multivesicular body prote...    158   6e-40    
ref|XP_006739629.1|  PREDICTED: transmembrane 9 superfamily membe...    156   6e-40    
ref|NP_083056.2|  transmembrane 9 superfamily member 1 precursor        156   7e-40    
ref|XP_006913615.1|  PREDICTED: transmembrane 9 superfamily member 1    156   7e-40    
ref|XP_005377087.1|  PREDICTED: transmembrane 9 superfamily member 1    156   7e-40    
ref|XP_004647518.1|  PREDICTED: transmembrane 9 superfamily member 1    156   7e-40    
ref|XP_003802004.1|  PREDICTED: transmembrane 9 superfamily member 1    157   8e-40    
ref|XP_002921119.1|  PREDICTED: transmembrane 9 superfamily member 1    156   8e-40    
ref|XP_005859645.1|  PREDICTED: transmembrane 9 superfamily membe...    156   8e-40    
ref|XP_008156681.1|  PREDICTED: transmembrane 9 superfamily membe...    156   9e-40    
dbj|BAH13215.1|  unnamed protein product                                157   9e-40    
ref|XP_001490063.1|  PREDICTED: transmembrane 9 superfamily member 1    156   9e-40    
ref|XP_006036573.1|  PREDICTED: transmembrane 9 superfamily membe...    156   9e-40    
ref|XP_006144613.1|  PREDICTED: transmembrane 9 superfamily membe...    155   1e-39    
ref|XP_002181450.1|  predicted protein                                  155   1e-39    
ref|XP_008570550.1|  PREDICTED: transmembrane 9 superfamily member 1    155   1e-39    
ref|XP_004755298.1|  PREDICTED: transmembrane 9 superfamily membe...    155   2e-39    
ref|XP_006259786.1|  PREDICTED: transmembrane 9 superfamily member 1    155   2e-39    
ref|XP_004609500.1|  PREDICTED: transmembrane 9 superfamily membe...    155   2e-39    
ref|XP_004584775.1|  PREDICTED: transmembrane 9 superfamily member 1    156   2e-39    
ref|XP_005370493.1|  PREDICTED: transmembrane 9 superfamily membe...    155   2e-39    
ref|XP_006102307.1|  PREDICTED: transmembrane 9 superfamily membe...    155   2e-39    
ref|XP_005005680.1|  PREDICTED: transmembrane 9 superfamily membe...    155   3e-39    
ref|XP_007148532.1|  hypothetical protein PHAVU_006G216500g             155   3e-39    
gb|KFH64844.1|  hypothetical protein MVEG_09573                         154   3e-39    
ref|XP_004485475.1|  PREDICTED: transmembrane 9 superfamily membe...    154   3e-39    
ref|XP_004485474.1|  PREDICTED: transmembrane 9 superfamily membe...    154   3e-39    
ref|XP_007947407.1|  PREDICTED: transmembrane 9 superfamily membe...    154   3e-39    
ref|XP_004609499.1|  PREDICTED: transmembrane 9 superfamily membe...    156   3e-39    
ref|XP_004463434.1|  PREDICTED: transmembrane 9 superfamily membe...    154   4e-39    
ref|XP_005085662.1|  PREDICTED: transmembrane 9 superfamily member 1    154   4e-39    
ref|XP_004463433.1|  PREDICTED: transmembrane 9 superfamily membe...    154   4e-39    
ref|XP_003474483.1|  PREDICTED: transmembrane 9 superfamily membe...    154   4e-39    
ref|NP_001126136.1|  transmembrane 9 superfamily member 1 precursor     154   5e-39    
ref|NP_563812.1|  endomembrane protein 70                               153   7e-39    
gb|AAK74038.1|  At1g08350/T27G7_4                                       153   7e-39    
ref|XP_003755940.1|  PREDICTED: transmembrane 9 superfamily member 1    153   7e-39    
ref|XP_004463432.1|  PREDICTED: transmembrane 9 superfamily membe...    155   7e-39    
ref|XP_005685277.1|  PREDICTED: transmembrane 9 superfamily membe...    153   7e-39    
ref|XP_005985428.1|  PREDICTED: transmembrane 9 superfamily member 1    153   7e-39    
dbj|BAJ87519.1|  predicted protein                                      153   8e-39    
ref|XP_005645983.1|  hypothetical protein COCSUDRAFT_53991              153   1e-38    
ref|XP_009004051.1|  PREDICTED: transmembrane 9 superfamily member 1    152   1e-38    
emb|CDO97576.1|  unnamed protein product                                152   1e-38    
ref|XP_003629959.1|  Transmembrane 9 superfamily protein member         152   1e-38    
ref|XP_010779259.1|  PREDICTED: transmembrane 9 superfamily member 1    152   2e-38    
ref|XP_012036327.1|  PREDICTED: transmembrane 9 superfamily membe...    154   2e-38    



>ref|XP_009602054.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=594

 Score =   356 bits (913),  Expect = 3e-115, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDH+YK GD V LYANKVGPFHNPSETY + DLPFC+PA+V++K EALGEVLNGDR
Sbjct  25   RSDGSDHKYKAGDPVPLYANKVGPFHNPSETYRFFDLPFCAPAHVKEKKEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF+ DK+SE+VCKKKLSK +V +FR AVA+DYYFQMYYDDLP+WG++GKVDK
Sbjct  85   LVSAPYKLDFMYDKDSEIVCKKKLSKEEVAQFRSAVAKDYYFQMYYDDLPIWGFLGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGKSDPSEYKYYLFKHLHFEIFYN D+++EI AR DP+A+VDIT DKE+DVDFMYSVKWK
Sbjct  145  EGKSDPSEYKYYLFKHLHFEIFYNNDRVIEINARTDPNALVDITEDKEVDVDFMYSVKWK  204

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPF+KRMEK+SQ S+LP HLEIHWF
Sbjct  205  ETKTPFDKRMEKYSQSSSLPHHLEIHWF  232



>ref|XP_011099916.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099917.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099918.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
 ref|XP_011099919.1| PREDICTED: transmembrane 9 superfamily member 3 [Sesamum indicum]
Length=592

 Score =   355 bits (912),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 164/208 (79%), Positives = 186/208 (89%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDH+YK GD V LYANKVGPFHNPSETY Y DLPFCSP +V+ KSEALGEVLNGDR
Sbjct  23   RSDASDHKYKIGDAVPLYANKVGPFHNPSETYRYFDLPFCSPGDVKDKSEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DKESEV+CKKKLS  +V +FR AVA+DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVSAPYKLDFLVDKESEVICKKKLSVKEVAEFRSAVAKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKYYLFKHLHFEIFYNKD+++EI AR DP+A+VD+T DKE+DVDFMYS KWK
Sbjct  143  EGKTDPSEYKYYLFKHLHFEIFYNKDRVIEINARTDPNALVDLTEDKEVDVDFMYSAKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ETN  FEKRMEK+S  S+LP+HLEIHWF
Sbjct  203  ETNIAFEKRMEKYSHSSSLPRHLEIHWF  230



>ref|XP_004239834.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=597

 Score =   355 bits (912),  Expect = 4e-115, Method: Compositional matrix adjust.
 Identities = 161/208 (77%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDH+YK GD+V +YANKVGPFHNPSETY + DLPFC+PA+V +K EALGEVLNGDR
Sbjct  28   RSDGSDHKYKAGDQVTMYANKVGPFHNPSETYRFFDLPFCAPAHVTEKKEALGEVLNGDR  87

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF+ DK+SE+VCKKKLSK +V  FR+AVA+DYYFQMYYDDLP+WG++GKVDK
Sbjct  88   LVSAPYKLDFMYDKDSEIVCKKKLSKEEVSLFRNAVAKDYYFQMYYDDLPIWGFLGKVDK  147

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKYYLFKHLHFEIFYN D++VEI AR DP+A+VDIT DKE+DVDFMYSVKWK
Sbjct  148  EGKTDPSEYKYYLFKHLHFEIFYNNDRVVEINARTDPNALVDITEDKEVDVDFMYSVKWK  207

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            E+ TPFEKRMEK+SQ S++P HLEIHWF
Sbjct  208  ESTTPFEKRMEKYSQSSSMPHHLEIHWF  235



>ref|XP_006346764.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=598

 Score =   355 bits (910),  Expect = 8e-115, Method: Compositional matrix adjust.
 Identities = 163/208 (78%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDH+YK GD+V LYANKVGPFHNPSETY + DLPFC+P +V++K EALGEVLNGDR
Sbjct  29   RSDGSDHKYKSGDQVPLYANKVGPFHNPSETYRFFDLPFCTPDHVKEKKEALGEVLNGDR  88

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE+VCKKKLSK +V +FR AVA+DYYFQMYYDDLP+WG++GKVDK
Sbjct  89   LVSAPYKLDFLYDKDSEIVCKKKLSKEEVSQFRSAVAKDYYFQMYYDDLPIWGFLGKVDK  148

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGKSDPSEYKYYLFKHLHFEIFYN D+++EI AR DP+A+VDIT DKE+DVDFMYSVKWK
Sbjct  149  EGKSDPSEYKYYLFKHLHFEIFYNDDRVIEINARTDPNALVDITEDKEVDVDFMYSVKWK  208

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPF+KRMEK+SQ S+LP HLEIHWF
Sbjct  209  ETKTPFDKRMEKYSQSSSLPHHLEIHWF  236



>ref|XP_006365862.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=588

 Score =   353 bits (907),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDH+YK GD+V +YANKVGPFHNPSETY + DLPFC+PA+V +K EALGEVLNGDR
Sbjct  19   RSDGSDHKYKAGDQVTMYANKVGPFHNPSETYRFFDLPFCAPAHVTEKKEALGEVLNGDR  78

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF+ DK+SE+VCKKKLSK +V +FR AVA+DYYFQMYYDDLP+WG++GKVDK
Sbjct  79   LVSAPYKLDFMYDKDSEIVCKKKLSKEEVSQFRSAVAKDYYFQMYYDDLPIWGFLGKVDK  138

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPS+YKYYLFKHLHFEIFYN D++VEI AR DP+A+VDIT DKE+DVDF+YSVKWK
Sbjct  139  EGKTDPSKYKYYLFKHLHFEIFYNNDRVVEINARTDPNALVDITEDKEVDVDFVYSVKWK  198

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            E+ TPFEKRMEK+SQ S+LP HLEIHWF
Sbjct  199  ESTTPFEKRMEKYSQSSSLPHHLEIHWF  226



>ref|XP_004236681.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=598

 Score =   354 bits (908),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDH+YK GD+V LYANKVGPFHNPSETY + DLPFC+P +V++K EALGEVLNGDR
Sbjct  29   RSDGSDHKYKSGDQVPLYANKVGPFHNPSETYRFFDLPFCTPDHVKEKKEALGEVLNGDR  88

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE+VCKKKLSK +V +FR AVA+DYYFQMYYDDLP+WG++GKVDK
Sbjct  89   LVSAPYKLDFLYDKDSEIVCKKKLSKEEVSQFRSAVAKDYYFQMYYDDLPIWGFLGKVDK  148

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGKSDPSEYKYYLFKHLHFEIFYN D+++EI AR DP+A+VDIT DKE+DVDFMY+VKWK
Sbjct  149  EGKSDPSEYKYYLFKHLHFEIFYNDDRVIEINARTDPNALVDITEDKEVDVDFMYTVKWK  208

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPF+KRMEK+SQ S+LP HLEIHWF
Sbjct  209  ETKTPFDKRMEKYSQSSSLPHHLEIHWF  236



>gb|EYU30878.1| hypothetical protein MIMGU_mgv1a003324mg [Erythranthe guttata]
 gb|EYU30879.1| hypothetical protein MIMGU_mgv1a003324mg [Erythranthe guttata]
Length=592

 Score =   353 bits (906),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 186/208 (89%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDH+YK GD V LYANKVGPFHNPSETY Y DLPFCSP +V+ KSEALGEVLNGDR
Sbjct  23   RSDGSDHKYKVGDPVPLYANKVGPFHNPSETYRYFDLPFCSPGDVKDKSEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFLAD+ESEV+CKK+LSK +V  FR AVA+DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVSAPYKLDFLADRESEVICKKQLSKEEVAVFRSAVAKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKYYLFKHLHFEIFYNKD+++EI AR DPSA+VD+T DKE+DV+F+YS KWK
Sbjct  143  EGKADPSEYKYYLFKHLHFEIFYNKDRVIEINARTDPSALVDLTEDKEVDVEFVYSAKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ETN  FEKRMEK+S  S+LP+HLEIHWF
Sbjct  203  ETNIAFEKRMEKYSHSSSLPRHLEIHWF  230



>ref|XP_009774478.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=593

 Score =   353 bits (906),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 186/208 (89%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDH+YK GD V LYANKVGPFHNPSETY + DLPFC+PA+ ++K EALGEVLNGDR
Sbjct  24   RSDGSDHKYKAGDPVPLYANKVGPFHNPSETYRFFDLPFCAPAHAKEKKEALGEVLNGDR  83

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF+ DK+SE+VCKKKLSK +V +FR AVA+DYYFQMYYDDLP+WG++GKVDK
Sbjct  84   LVSAPYKLDFMYDKDSEIVCKKKLSKEEVSQFRSAVAKDYYFQMYYDDLPIWGFLGKVDK  143

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            +GKSDPSEYKYYLFKHLHFEIFYN D +VEI AR DP+A+VDIT DKE+DVDF+YSVKWK
Sbjct  144  DGKSDPSEYKYYLFKHLHFEIFYNNDHVVEINARTDPNALVDITEDKEVDVDFIYSVKWK  203

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRMEK+SQ S+LP HLEIHWF
Sbjct  204  ETTTPFEKRMEKYSQSSSLPHHLEIHWF  231



>ref|XP_009616336.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=593

 Score =   353 bits (906),  Expect = 3e-114, Method: Compositional matrix adjust.
 Identities = 162/208 (78%), Positives = 186/208 (89%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDH+YK GD V LYANKVGPFHNPSETY + DLPFC+PA+V++K EALGEVLNGDR
Sbjct  24   RSDGSDHKYKAGDSVPLYANKVGPFHNPSETYRFFDLPFCAPAHVKEKKEALGEVLNGDR  83

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF+ DK+SE+VCKKKLSK +V +FR AVA+DYYFQMYYDDLP+WG++GKV K
Sbjct  84   LVSAPYKLDFMYDKDSEIVCKKKLSKEEVSQFRSAVAKDYYFQMYYDDLPIWGFLGKVGK  143

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            +GKSDP EYKYYLFKHLHFEIFYN D++VEI AR DP+A+VDIT DKE+DVDFMYSVKWK
Sbjct  144  DGKSDPIEYKYYLFKHLHFEIFYNNDRVVEINARTDPNALVDITEDKEVDVDFMYSVKWK  203

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRMEK+SQ S+LP HLEIHWF
Sbjct  204  ETTTPFEKRMEKYSQSSSLPHHLEIHWF  231



>ref|XP_009785097.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=596

 Score =   352 bits (903),  Expect = 8e-114, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 188/208 (90%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD+SDH+YK G+EV LYANKVGPFHNPSETY Y DLPFCSP +V+ K+EALGEVLNGDR
Sbjct  27   RSDSSDHKYKNGEEVPLYANKVGPFHNPSETYRYFDLPFCSPGHVKDKTEALGEVLNGDR  86

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL+D+E+EVVCKK LSK +V +FR AVA+DYYFQM+YDDLP+WG+IGKVDK
Sbjct  87   LVTAPYKLDFLSDRETEVVCKKSLSKEEVARFRDAVAKDYYFQMFYDDLPIWGFIGKVDK  146

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGKSDP+EYKYYLFKHLHF+I +N D+++E+ AR DP+A+VDIT DKE+DVDFMYSVKWK
Sbjct  147  EGKSDPNEYKYYLFKHLHFDIHFNNDRVIEVNARTDPNALVDITEDKEVDVDFMYSVKWK  206

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+ PFEKRMEK+SQ SALP HLEIHWF
Sbjct  207  ETDIPFEKRMEKYSQTSALPHHLEIHWF  234



>ref|XP_009775043.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana sylvestris]
Length=593

 Score =   351 bits (901),  Expect = 1e-113, Method: Compositional matrix adjust.
 Identities = 168/234 (72%), Positives = 200/234 (85%), Gaps = 3/234 (1%)
 Frame = +3

Query  138  MDRRRAMRHYavvlavlllgtatevvRSDASDHRYKQGDEVHLYANKVGPFHNPSETYMY  317
            M+++R M  Y VVL ++   +     RSD SDH+YK GD V LYANKVGPFHNPSETY +
Sbjct  1    MEKKRTMAWYVVVLLIVSCASPV---RSDGSDHKYKAGDPVPLYANKVGPFHNPSETYRF  57

Query  318  HDLPFCSPANVEKKSEALGEVLNGDRLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRH  497
             DLPFC+P +V++K EALGEVLNGDRLV + YKLDF+ DK+SE+VCKKKLSK +V +FR 
Sbjct  58   FDLPFCAPDHVKEKKEALGEVLNGDRLVSAPYKLDFMYDKDSEIVCKKKLSKEEVAQFRS  117

Query  498  AVAEDYYFQMYYDDLPVWGYIGKVDKEGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIAR  677
            AVA+DYYFQMYYDDLP+WG++GKVDKEGKSDPSEYKYYLFKHLHFEIFYN D+++EI AR
Sbjct  118  AVAKDYYFQMYYDDLPIWGFLGKVDKEGKSDPSEYKYYLFKHLHFEIFYNNDRVIEINAR  177

Query  678  ADPSAMVDITMDKELDVDFMYSVKWKETNTPFEKRMEKFSQISALPQHLEIHWF  839
             DP+A+VDIT DKE+DV+FMYSVKWKET TPF+KRMEK+SQ S+LP HLEIHWF
Sbjct  178  TDPNALVDITEDKEVDVEFMYSVKWKETKTPFDKRMEKYSQSSSLPHHLEIHWF  231



>ref|XP_006352389.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006352390.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Solanum 
tuberosum]
Length=596

 Score =   350 bits (898),  Expect = 5e-113, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD+SDH+YK G+EV LYANKVGPFHNPSETY Y DLPFCSP +V+ K+EALGEVLNGDR
Sbjct  27   RSDSSDHKYKSGEEVPLYANKVGPFHNPSETYRYFDLPFCSPGHVKDKTEALGEVLNGDR  86

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF  D+E+EVVCKK LSK +V +FR AVA+DYYFQM+YDDLP+WG+IGKVDK
Sbjct  87   LVTAPYKLDFTNDRETEVVCKKTLSKEEVARFRDAVAKDYYFQMFYDDLPIWGFIGKVDK  146

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKYYLFKHLHF+I +NKD+++E+ AR DP+A+VDIT DKE+DVDFMYSVKWK
Sbjct  147  EGKADPSEYKYYLFKHLHFDIHHNKDRVIEVNARTDPNALVDITEDKEIDVDFMYSVKWK  206

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+ PFEKRMEK+SQ SALP HLEIHWF
Sbjct  207  ETHIPFEKRMEKYSQTSALPHHLEIHWF  234



>ref|XP_004250237.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
 ref|XP_010312729.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=596

 Score =   350 bits (897),  Expect = 6e-113, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 186/208 (89%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD+SDH+YK G+EV LYANKVGPFHNPSETY Y DLPFCSP +V+ K+EALGEVLNGDR
Sbjct  27   RSDSSDHKYKSGEEVPLYANKVGPFHNPSETYRYFDLPFCSPGHVKDKTEALGEVLNGDR  86

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF  D+E+EVVCKK LSK +V +FR AVA+DYYFQM+YDDLP+WG+IGKVDK
Sbjct  87   LVTAPYKLDFTNDRETEVVCKKTLSKEEVARFRDAVAKDYYFQMFYDDLPIWGFIGKVDK  146

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKYYLFKHLHF+I +NKD+++E+ AR DP+A+VDIT DKE+DVDFMYSVKWK
Sbjct  147  EGKADPSEYKYYLFKHLHFDIHHNKDRVIEVNARTDPNALVDITEDKEIDVDFMYSVKWK  206

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET  PFEKRMEK+SQ SALP HLEIHWF
Sbjct  207  ETEIPFEKRMEKYSQTSALPHHLEIHWF  234



>gb|EPS59962.1| hypothetical protein M569_14842, partial [Genlisea aurea]
Length=510

 Score =   346 bits (887),  Expect = 2e-112, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 186/208 (89%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDAS+HRY QGD V LYANKVGPFHNPSETY Y DLPFCSP +V+ KSEALGEVLNGDR
Sbjct  13   RSDASNHRYNQGDTVPLYANKVGPFHNPSETYRYFDLPFCSPGDVKDKSEALGEVLNGDR  72

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL D+ESEV+CKKKLSK++V  FR+AVA+DYYFQMYYDDLP+WG++GKV K
Sbjct  73   LVSAPYKLDFLVDRESEVICKKKLSKTEVTVFRNAVAKDYYFQMYYDDLPIWGFLGKVYK  132

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E K+DPS+YKYYLFKHLHFEI YNKD+++EI AR DP+A+VDIT DKE+D++F+YSVKWK
Sbjct  133  EDKTDPSDYKYYLFKHLHFEISYNKDRVIEINARTDPNALVDITDDKEVDLEFLYSVKWK  192

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET  PFE+RMEK+S  S+LP+HLEIHWF
Sbjct  193  ETTIPFERRMEKYSHSSSLPRHLEIHWF  220



>ref|XP_009631354.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
 ref|XP_009631355.1| PREDICTED: putative phagocytic receptor 1b [Nicotiana tomentosiformis]
Length=596

 Score =   348 bits (893),  Expect = 3e-112, Method: Compositional matrix adjust.
 Identities = 159/208 (76%), Positives = 187/208 (90%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD+SDH+YK G+EV LYANKVGPFHNPSETY Y DLPFCSP +V+ K+EALGEVLNGDR
Sbjct  27   RSDSSDHKYKNGEEVPLYANKVGPFHNPSETYRYFDLPFCSPGHVKDKTEALGEVLNGDR  86

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL+D+E+EVVCKK LSK +V +FR AVA+DYYFQM+YDDLP+WG+IGKVDK
Sbjct  87   LVTAPYKLDFLSDRETEVVCKKSLSKEEVARFRDAVAKDYYFQMFYDDLPIWGFIGKVDK  146

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E KSDP+EYKYYLFKHLHF+I +N D+++E+ AR DP+A+VDIT DKE+DVDFMYSVKWK
Sbjct  147  ERKSDPNEYKYYLFKHLHFDIHFNNDRVIEVNARTDPNALVDITEDKEVDVDFMYSVKWK  206

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+ PFEKRMEK+SQ SALP HLEIHWF
Sbjct  207  ETDIPFEKRMEKYSQTSALPHHLEIHWF  234



>gb|EYU30892.1| hypothetical protein MIMGU_mgv1a003326mg [Erythranthe guttata]
Length=592

 Score =   347 bits (891),  Expect = 5e-112, Method: Compositional matrix adjust.
 Identities = 160/208 (77%), Positives = 186/208 (89%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDH++K GD V LYANKVGPFHNPSETY Y DLPFCSP NV+ KSEALGEVLNGDR
Sbjct  23   RSDASDHKFKVGDPVPLYANKVGPFHNPSETYRYFDLPFCSPGNVKDKSEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFLADKESEV+CKK LSK +V  FR AVA+DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVSAPYKLDFLADKESEVICKKHLSKEEVAVFRSAVAKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKY+LFKHLHFEIFYNKD+++EI AR DP+A+VD+T DKE+DV+F++S KWK
Sbjct  143  EGKADPSEYKYHLFKHLHFEIFYNKDRVIEINARTDPNALVDLTDDKEVDVEFVFSAKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ETN  F+KRMEK+S  S+LP+HLEIHWF
Sbjct  203  ETNIEFDKRMEKYSHSSSLPRHLEIHWF  230



>ref|XP_010244840.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
 ref|XP_010244916.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=592

 Score =   347 bits (890),  Expect = 6e-112, Method: Compositional matrix adjust.
 Identities = 158/208 (76%), Positives = 185/208 (89%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFCSPA+V +K EALGEVLNGDR
Sbjct  23   RSDASDHRYKAGDPVPLYANKVGPFHNPSETYRYFDLPFCSPAHVTEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL++K+SE+VCKKKLS  +V +FR AV  DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLDFLSEKDSELVCKKKLSTGEVAQFRKAVINDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKY+L+KH+HF+I YNKD+++EI  R DP+A+VD+T DKE +V+FMYSVKWK
Sbjct  143  EGKTDPSEYKYFLYKHIHFDILYNKDRVIEINVRTDPNALVDLTEDKETEVEFMYSVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+TPFEKRMEK+SQ S+LP HLEIHWF
Sbjct  203  ETDTPFEKRMEKYSQSSSLPHHLEIHWF  230



>ref|XP_010069472.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW57835.1| hypothetical protein EUGRSUZ_H00588 [Eucalyptus grandis]
Length=590

 Score =   339 bits (870),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 184/208 (88%), Gaps = 1/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK GD V LYANKVGPFHNPSETY Y DLPFC PA++++K EALGEVLNGDR
Sbjct  22   RSDGSDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCIPAHLKEKKEALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF+ DKESEV+CKKKLSK +V +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  82   LVSAPYKLDFMKDKESEVICKKKLSKEEVAQFRSAVIKDYYFQMYYDDLPIWGFIGKVDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK DPSEYKY+L+KH+HF+IFYNKD+++EI  R DP+A+VD+T DK+  V+FMY+VKWK
Sbjct  142  EGK-DPSEYKYFLYKHIHFDIFYNKDRVIEINVRTDPNALVDLTEDKQTQVEFMYTVKWK  200

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ETNTPF+KRM+K+SQ S+LP HLEIHWF
Sbjct  201  ETNTPFDKRMDKYSQSSSLPHHLEIHWF  228



>gb|AAF79216.1|AC006917_1 F10B6.2 [Arabidopsis thaliana]
Length=260

 Score =   327 bits (839),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 179/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +KESEV C KKLSK +V++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKESEVYCNKKLSKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            + KSDPSE+KY+L+KH+ FEI YNKD+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  143  DIKSDPSEFKYFLYKHIQFEILYNKDRVIEISARMDPHSLVDLTEDKEVDAEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRMEK+S  S+LP HLEIHWF
Sbjct  203  ETETPFEKRMEKYSMSSSLPHHLEIHWF  230



>ref|XP_011085893.1| PREDICTED: transmembrane 9 superfamily member 2-like [Sesamum 
indicum]
Length=587

 Score =   338 bits (867),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 155/204 (76%), Positives = 181/204 (89%), Gaps = 0/204 (0%)
 Frame = +3

Query  228  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHS  407
            SDH +K GD V LYANKVGPFHNPSETY Y DLPFC PA++++K EALGEVLNGDRLV +
Sbjct  22   SDHTFKAGDPVPLYANKVGPFHNPSETYRYFDLPFCFPAHMKEKKEALGEVLNGDRLVSA  81

Query  408  LYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKS  587
             Y LDFL DK SEVVC KKL K++V +FR AVA+DYYFQMY+DDLP+WG++GKV+KE KS
Sbjct  82   PYTLDFLQDKSSEVVCNKKLDKNEVAQFRSAVAKDYYFQMYFDDLPIWGFLGKVEKEEKS  141

Query  588  DPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKETNT  767
            DPSEYKYYLFKHLHFEIFYNKD+++EI AR DP+A+VD+T DKE++V+FMYSVKWKETNT
Sbjct  142  DPSEYKYYLFKHLHFEIFYNKDRVIEINARTDPNALVDVTEDKEINVEFMYSVKWKETNT  201

Query  768  PFEKRMEKFSQISALPQHLEIHWF  839
            PFEKRMEK+SQ S+LP HLEIHWF
Sbjct  202  PFEKRMEKYSQSSSLPHHLEIHWF  225



>ref|XP_010276303.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=592

 Score =   337 bits (864),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 154/208 (74%), Positives = 184/208 (88%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFCSP +V +K EALGEVLNGDR
Sbjct  23   RSDASDHRYKAGDPVPLYANKVGPFHNPSETYRYFDLPFCSPGHVTEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL+DK+SE+VC+KKL+K +V +FR AV++DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLDFLSDKDSELVCRKKLTKEEVAQFRKAVSKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKY+L+KH+HF+I YNKD+++EI  R DP+A+VD+T DKE+DV+F Y+VKWK
Sbjct  143  EGKADPSEYKYFLYKHIHFDILYNKDRVIEINVRTDPNALVDLTEDKEVDVEFFYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET T FEKRMEK+S  S+LP HLEIHWF
Sbjct  203  ETTTAFEKRMEKYSSSSSLPHHLEIHWF  230



>ref|XP_010691703.1| PREDICTED: transmembrane 9 superfamily member 2 [Beta vulgaris 
subsp. vulgaris]
Length=592

 Score =   337 bits (864),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 186/208 (89%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK G+ V LYANKVGPFHNPSETY Y DLPFC+P +V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCAPDHVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE++CKKK+SK +V KFR AV++DYYFQMYYDDLP+WG++GK DK
Sbjct  83   LVSAPYKLDFLVDKDSELICKKKMSKEEVVKFRDAVSKDYYFQMYYDDLPIWGFLGKADK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK DPSEYK+YL+KH+HF+IFYNKD+++EI  R DP+++VDIT DK++D++FMY+VKWK
Sbjct  143  EGKLDPSEYKFYLYKHIHFDIFYNKDRVIEINVRMDPNSLVDITEDKDIDMEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            +T TPFEKRM+K+SQ S+LP HLEIHWF
Sbjct  203  DTITPFEKRMDKYSQSSSLPHHLEIHWF  230



>emb|CDP01680.1| unnamed protein product [Coffea canephora]
Length=594

 Score =   337 bits (863),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 155/208 (75%), Positives = 183/208 (88%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDH+YK  D+V LYANKVGPFHNPSETY Y DLPFC PA V++K EALGEVLNGDR
Sbjct  25   RSDASDHKYKVSDQVPLYANKVGPFHNPSETYRYFDLPFCLPAQVKEKKEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y L+FL DKESEVVCKKKLSK +V +FR+AV++DYYF+MYYDDLP+WG++GKV+K
Sbjct  85   LVVAPYNLEFLHDKESEVVCKKKLSKEEVAQFRNAVSKDYYFEMYYDDLPLWGFLGKVEK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
             GK+DPSEYKYYLFK++HFEI Y KD+++EI AR DP ++VDIT DKE+DV+FMYSVKWK
Sbjct  145  TGKTDPSEYKYYLFKNIHFEILYKKDRVIEINARTDPGSIVDITDDKEVDVEFMYSVKWK  204

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRMEK+S  S+LP HLEIHWF
Sbjct  205  ETTTPFEKRMEKYSHSSSLPHHLEIHWF  232



>gb|KHG03505.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=592

 Score =   336 bits (861),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 182/208 (88%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RS ASDHRY  GDEV LYANKVGPFHNPSETY + D PFCS A V++K EALGEVLNGDR
Sbjct  23   RSSASDHRYTAGDEVPLYANKVGPFHNPSETYRFFDFPFCSSAPVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+LDFL +KE+EV CK+KL+K +V KFR AV++DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVSAPYRLDFLGNKEAEVACKRKLTKEEVAKFRTAVSKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKYYLFKHL FEI YNKD+++EI  R+DP+A+VD+T D+ ++VDFMY+VKWK
Sbjct  143  EGKADPSEYKYYLFKHLIFEILYNKDRVIEITVRSDPNALVDLTQDEPVNVDFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRM+K+S+ S++P HLEIHWF
Sbjct  203  ETETPFEKRMDKYSESSSMPHHLEIHWF  230



>ref|XP_010691704.1| PREDICTED: transmembrane 9 superfamily member 3-like [Beta vulgaris 
subsp. vulgaris]
Length=593

 Score =   334 bits (857),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 181/208 (87%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK G+ V LYANKVGPFHNPSETY Y DLPFC P +V++K EALGEVLNGDR
Sbjct  24   RSDASDHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCIPDHVKEKREALGEVLNGDR  83

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE +CKK L K +  KFR AVA+DYYFQMYYDDLP+WG++GKVDK
Sbjct  84   LVSAPYKLDFLVDKDSEAICKKTLKKEEAAKFRDAVAKDYYFQMYYDDLPIWGFLGKVDK  143

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK DPS+YKYYL+KH+HF+++YNKD+++EI  R DP+++VDIT DKE+D++FMY+VKWK
Sbjct  144  EGKLDPSDYKYYLYKHIHFDVYYNKDRVIEINVRTDPNSLVDITEDKEVDIEFMYTVKWK  203

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFE RM+K+SQ S+LP HLEIHWF
Sbjct  204  ETKTPFENRMDKYSQSSSLPHHLEIHWF  231



>ref|XP_007031333.1| Endomembrane protein 70 protein family [Theobroma cacao]
 gb|EOY02259.1| Endomembrane protein 70 protein family [Theobroma cacao]
Length=561

 Score =   332 bits (852),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 181/208 (87%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RS ASDHRYK G EV LYANKVGPFHNPSETY Y D PFCS   V++K+EALGEVLNGDR
Sbjct  23   RSSASDHRYKAGAEVPLYANKVGPFHNPSETYRYFDFPFCSSTPVKEKNEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DKE+E+ CKKKL+K +V KFR AV++DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVSAPYKLDFLNDKEAEIACKKKLTKEEVAKFRSAVSKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK DPSEYKYYLFKHL FEI YNKD+++EI  ++DP+A+VD+T D++++VDFMY+VKWK
Sbjct  143  EGKVDPSEYKYYLFKHLIFEILYNKDRVIEITVQSDPNALVDLTEDEQVNVDFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRM+K+S  S+LP HLEIHW+
Sbjct  203  ETETPFEKRMDKYSLSSSLPHHLEIHWY  230



>ref|XP_010554368.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=592

 Score =   333 bits (854),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 181/208 (87%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFCVPDGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV C+KKLSK DV++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFGEEKDSEVYCRKKLSKDDVKQFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSE+KY+L+KH+ FEI YNKD+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  143  EGKADPSEFKYFLYKHIQFEILYNKDRVIEISARMDPHSLVDLTEDKEVDAEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRMEK+S  S+LP HLEIHWF
Sbjct  203  ETETPFEKRMEKYSMSSSLPHHLEIHWF  230



>ref|XP_011038404.1| PREDICTED: transmembrane 9 superfamily member 4 [Populus euphratica]
 ref|XP_011038405.1| PREDICTED: transmembrane 9 superfamily member 4 [Populus euphratica]
Length=592

 Score =   332 bits (852),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 179/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK G++V LY NKVGPFHNPSETY Y DLPFCS    + K EALGEVLNGDR
Sbjct  23   RSDASDHRYKVGEDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE+ C+K+L+K  V +FR  V++DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVTAPYKLDFLNDKDSEIACRKRLTKEQVAQFREVVSKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKYYLFKHLHF IFYNKD+++EI A++D + +VD+T DKE+DV+FMYSVKWK
Sbjct  143  EGKNDPSEYKYYLFKHLHFTIFYNKDRVIEITAQSDLNNVVDLTEDKEVDVEFMYSVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET  PFEKRMEK+SQ S+LP HLEIHWF
Sbjct  203  ETEIPFEKRMEKYSQSSSLPHHLEIHWF  230



>gb|KJB15311.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=540

 Score =   331 bits (848),  Expect = 3e-106, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 180/208 (87%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFCSP +V++K EALGEVLNGDR
Sbjct  25   RSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDHVKEKKEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+S VVCKKKLSK +V  FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVSAPYKLNFREEKDSSVVCKKKLSKDEVVFFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKYYL+KH+ F++ YNKD+++EI AR DP  +VD+T DKE+D +FMY+VKWK
Sbjct  145  EGKADPSEYKYYLYKHIQFDVLYNKDRVIEISARMDPHLLVDLTEDKEVDAEFMYTVKWK  204

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRME++S  S+LP HLEIHWF
Sbjct  205  ETGTPFEKRMERYSMSSSLPHHLEIHWF  232



>gb|KJB08471.1| hypothetical protein B456_001G083100 [Gossypium raimondii]
Length=531

 Score =   330 bits (845),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 182/208 (88%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RS ASDHRYK GDEV LYANKVGP+HNPSETY Y D PFCS A V++K EALGEVLNGDR
Sbjct  23   RSTASDHRYKAGDEVPLYANKVGPYHNPSETYRYFDFPFCSSAPVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL +KE+E+ CK+KL+K +V KFR AV++DYYFQMYYDDLP+WG++GKV+K
Sbjct  83   LVSAPYKLEFLTEKEAEIACKRKLTKEEVVKFRKAVSKDYYFQMYYDDLPIWGFLGKVEK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DP++YKYYLFKHL FEI +NKD+++EI  R+DP+A+VD+T D  +DVDFMY+VKWK
Sbjct  143  EGKTDPADYKYYLFKHLVFEIHHNKDRVIEITVRSDPNALVDLTEDVPVDVDFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ETNTPFEKRM+K+S  S+LP HLEIHWF
Sbjct  203  ETNTPFEKRMDKYSLSSSLPHHLEIHWF  230



>ref|XP_010528590.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=595

 Score =   331 bits (849),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 181/208 (87%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRY+ GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDR
Sbjct  26   RSDGSDHRYRAGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDR  85

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL DK+SEV CKK+L++ +V +FR A+++DYYFQMYYDDLP+WG++GKVD+
Sbjct  86   LVSAPYKLEFLGDKDSEVACKKRLNREEVSQFREAISKDYYFQMYYDDLPIWGFLGKVDR  145

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E K++PSEY+YYLF HL FEIFYNKD+++EII R D +++VD+T DKE+DVDFMY+V+WK
Sbjct  146  ERKTNPSEYRYYLFNHLQFEIFYNKDRVIEIIVRTDQNSLVDVTEDKEIDVDFMYTVRWK  205

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET  PFEKRMEK+S  S++P HLEIHWF
Sbjct  206  ETEIPFEKRMEKYSLASSMPHHLEIHWF  233



>ref|XP_006416990.1| hypothetical protein EUTSA_v10007150mg [Eutrema salsugineum]
 gb|ESQ35343.1| hypothetical protein EUTSA_v10007150mg [Eutrema salsugineum]
Length=592

 Score =   331 bits (849),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 153/208 (74%), Positives = 180/208 (87%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +KESEV CKKKLSK +V++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKESEVYCKKKLSKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            + KSDPSEYKY+L+KH+ FEI YNKD+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  143  DIKSDPSEYKYFLYKHIQFEILYNKDRVIEISARMDPHSLVDLTEDKEVDAEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRMEK+S  S+LP HLEIHWF
Sbjct  203  ETETPFEKRMEKYSMSSSLPHHLEIHWF  230



>gb|KJB15310.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
 gb|KJB15312.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=594

 Score =   331 bits (848),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 180/208 (87%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFCSP +V++K EALGEVLNGDR
Sbjct  25   RSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDHVKEKKEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+S VVCKKKLSK +V  FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVSAPYKLNFREEKDSSVVCKKKLSKDEVVFFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKYYL+KH+ F++ YNKD+++EI AR DP  +VD+T DKE+D +FMY+VKWK
Sbjct  145  EGKADPSEYKYYLYKHIQFDVLYNKDRVIEISARMDPHLLVDLTEDKEVDAEFMYTVKWK  204

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRME++S  S+LP HLEIHWF
Sbjct  205  ETGTPFEKRMERYSMSSSLPHHLEIHWF  232



>ref|XP_006372420.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
 gb|ERP50217.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
Length=526

 Score =   328 bits (842),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK G++V LY NKVGPFHNPSETY Y DLPFCS    + K EALGEVLNGDR
Sbjct  23   RSDASDHRYKVGEDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE+ C+K+L+K  V +FR  V++DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVTAPYKLDFLNDKDSEIACRKRLTKEQVAQFREVVSKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E K+DPSEYKYYLFKHLHF IFYNKD+++EI A++D + +VD+T DKE+DV+FMYSVKWK
Sbjct  143  ERKNDPSEYKYYLFKHLHFTIFYNKDRVIEITAQSDLNNVVDLTEDKEVDVEFMYSVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET  PFEKRMEK+SQ S+LP HLEIHWF
Sbjct  203  ETEIPFEKRMEKYSQSSSLPHHLEIHWF  230



>gb|KFK43715.1| hypothetical protein AALP_AA1G163400 [Arabis alpina]
Length=592

 Score =   330 bits (847),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 180/208 (87%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+ D V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEADNVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +KESEV C+KKLSK DV++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKESEVYCRKKLSKEDVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E KSDPSEYKY+L+KH+ FEI YNKD+++EI AR DP ++VD+T DKE+D +FM++VKWK
Sbjct  143  EIKSDPSEYKYFLYKHIQFEILYNKDRVIEISARMDPHSLVDLTEDKEVDAEFMFTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+TPFEKRMEK+S  S+LP HLEIHWF
Sbjct  203  ETDTPFEKRMEKYSMSSSLPHHLEIHWF  230



>ref|XP_008461818.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Cucumis 
melo]
Length=591

 Score =   330 bits (846),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 181/208 (87%), Gaps = 1/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK GD V LYANKVGPFHNPSETY Y DLPFC P +V++K EALGEVLNGDR
Sbjct  23   RSDGSDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDDVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL +K+S  VC+KKLSK DV +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLDFLQEKDSSSVCQKKLSKEDVARFRAAVDKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK DPS++KYYL+KH+HF+IFYNKD+++EI  R DP+A+VD+T DKE+DV+F+Y+VKWK
Sbjct  143  EGK-DPSDFKYYLYKHIHFDIFYNKDRVIEINVRTDPNALVDLTEDKEVDVEFLYTVKWK  201

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFE RM+K+SQ S+LP HLEIHWF
Sbjct  202  ETTTPFENRMDKYSQSSSLPHHLEIHWF  229



>ref|XP_011005913.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
 ref|XP_011005914.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
Length=592

 Score =   330 bits (845),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 179/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASD+RYK G++V LY NKVGPFHNPSETY Y DLPFCS    + K EALGE+LNGDR
Sbjct  23   RSDASDNRYKVGEDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGELLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE+ CK KL+K  V +FR A+++D+YFQMYYDDLP+WG+IGKV+K
Sbjct  83   LVTAPYKLDFLNDKDSEIACKNKLTKEQVAQFREAISKDFYFQMYYDDLPIWGFIGKVEK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKYYLFKHLHF IFYNKD+++EI A +DP ++VD+T DKE++V+FMYSVKWK
Sbjct  143  EGKNDPSEYKYYLFKHLHFTIFYNKDRVIEITALSDPKSVVDLTEDKEVNVEFMYSVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET  PFEKRMEK+SQ S+LP HLEIHWF
Sbjct  203  ETEIPFEKRMEKYSQSSSLPHHLEIHWF  230



>gb|KJB08470.1| hypothetical protein B456_001G083100 [Gossypium raimondii]
Length=592

 Score =   330 bits (845),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 182/208 (88%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RS ASDHRYK GDEV LYANKVGP+HNPSETY Y D PFCS A V++K EALGEVLNGDR
Sbjct  23   RSTASDHRYKAGDEVPLYANKVGPYHNPSETYRYFDFPFCSSAPVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL +KE+E+ CK+KL+K +V KFR AV++DYYFQMYYDDLP+WG++GKV+K
Sbjct  83   LVSAPYKLEFLTEKEAEIACKRKLTKEEVVKFRKAVSKDYYFQMYYDDLPIWGFLGKVEK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DP++YKYYLFKHL FEI +NKD+++EI  R+DP+A+VD+T D  +DVDFMY+VKWK
Sbjct  143  EGKTDPADYKYYLFKHLVFEIHHNKDRVIEITVRSDPNALVDLTEDVPVDVDFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ETNTPFEKRM+K+S  S+LP HLEIHWF
Sbjct  203  ETNTPFEKRMDKYSLSSSLPHHLEIHWF  230



>ref|XP_004137376.1| PREDICTED: transmembrane 9 superfamily member 3 [Cucumis sativus]
 gb|KGN63933.1| hypothetical protein Csa_1G029600 [Cucumis sativus]
Length=591

 Score =   330 bits (845),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 181/208 (87%), Gaps = 1/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK GD V LYANKVGPFHNPSETY Y DLPFC P +V++K EALGEVLNGDR
Sbjct  23   RSDGSDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDDVKEKREALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL +K+S  VC+KKLSK DV +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLDFLQEKDSSSVCQKKLSKEDVGRFRAAVDKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK DPS++KYYL+KH+HF+IFYNKD+++EI  R DP+A+VD+T DKE+DV+F+Y+VKWK
Sbjct  143  EGK-DPSDFKYYLYKHIHFDIFYNKDRVIEINVRTDPNALVDLTEDKEVDVEFLYTVKWK  201

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFE RM+K+SQ S+LP HLEIHWF
Sbjct  202  ETTTPFENRMDKYSQSSSLPHHLEIHWF  229



>gb|AAF63170.1|AC010657_6 T5E21.15 [Arabidopsis thaliana]
Length=546

 Score =   328 bits (841),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 179/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +KESEV C KKLSK +V++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKESEVYCNKKLSKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            + KSDPSE+KY+L+KH+ FEI YNKD+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  143  DIKSDPSEFKYFLYKHIQFEILYNKDRVIEISARMDPHSLVDLTEDKEVDAEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRMEK+S  S+LP HLEIHWF
Sbjct  203  ETETPFEKRMEKYSMSSSLPHHLEIHWF  230



>ref|XP_011011376.1| PREDICTED: transmembrane 9 superfamily member 3-like [Populus 
euphratica]
Length=542

 Score =   328 bits (840),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD+V LY NKVGPFHNPSETY Y DLPFCS    + K EALGEVLNGDR
Sbjct  23   RSDASDHRYKVGDDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SEV CK  L+K  V +FR AV++DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVTAPYKLDFLNDKDSEVACKNTLTKEQVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKYYLFKHLHF IFYNKD+++EI A++D + +VD+T DKE++V+FMYSVKWK
Sbjct  143  EGKNDPSEYKYYLFKHLHFTIFYNKDRVIEISAQSDLNNVVDLTEDKEVNVEFMYSVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+  FEKRM+K+SQ S+LP HLEIHWF
Sbjct  203  ETDITFEKRMDKYSQSSSLPHHLEIHWF  230



>gb|KJB08472.1| hypothetical protein B456_001G083100 [Gossypium raimondii]
Length=592

 Score =   329 bits (844),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 182/208 (88%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RS ASDHRYK GDEV LYANKVGP+HNPSETY Y D PFCS A V++K EALGEVLNGDR
Sbjct  23   RSTASDHRYKAGDEVPLYANKVGPYHNPSETYRYFDFPFCSSAPVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL +KE+E+ CK+KL+K +V KFR AV++DYYFQMYYDDLP+WG++GKV+K
Sbjct  83   LVSAPYKLEFLTEKEAEIACKRKLTKEEVVKFRKAVSKDYYFQMYYDDLPIWGFLGKVEK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DP++YKYYLFKHL FEI +NKD+++EI  R+DP+A+VD+T D  +DVDFMY+VKWK
Sbjct  143  EGKTDPADYKYYLFKHLVFEIHHNKDRVIEITVRSDPNALVDLTEDVPVDVDFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ETNTPFEKRM+K+S  S+LP HLEIHWF
Sbjct  203  ETNTPFEKRMDKYSLSSSLPHHLEIHWF  230



>gb|KHG00678.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=528

 Score =   327 bits (839),  Expect = 5e-105, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 179/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFCSP +V +K EALGEVLNGDR
Sbjct  25   RSDASDHRYKDGDAVPLYANKVGPFHNPSETYRYFDLPFCSPDHVTEKREALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+S VVCKK+LSK +V  FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVSAPYKLNFKEEKDSSVVCKKQLSKDEVAFFRKAVDKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKY+LFKH+ F++ YNKD+++E+ AR DP ++VD+T DKE+D  FMYSVKWK
Sbjct  145  EGKTDPSEYKYFLFKHIQFDVLYNKDRVIEVNARMDPHSLVDLTEDKEVDAQFMYSVKWK  204

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+TPFEKRM+K+S  S+LP HLEIHWF
Sbjct  205  ETDTPFEKRMDKYSMSSSLPHHLEIHWF  232



>ref|XP_009110524.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=589

 Score =   329 bits (843),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  20   RSDASDHRYKEGDIVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV CKKKLSK +V KFR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  80   LVSAPYKLNFREEKDSEVYCKKKLSKEEVRKFRQAVEKDYYFQMYYDDLPIWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E KSDPSEYKY+L+KH+ FEI YN D+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  140  EIKSDPSEYKYFLYKHIEFEILYNNDRVIEISARMDPHSLVDLTEDKEVDAEFMYTVKWK  199

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRM+K+S  S+LP HLEIHWF
Sbjct  200  ETETPFEKRMDKYSMSSSLPHHLEIHWF  227



>gb|KHG04463.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=629

 Score =   330 bits (845),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 181/208 (87%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFCSP +V++K EALGEVLNGDR
Sbjct  60   RSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDHVKEKKEALGEVLNGDR  119

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+S VVCKKKLSK +V  FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  120  LVSAPYKLNFKEEKDSSVVCKKKLSKDEVVFFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  179

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKYYL+KH+ F++ YNKD+++EI AR DP  +VD+T DKE+D +FMY+VKWK
Sbjct  180  EGKADPSEYKYYLYKHIQFDVLYNKDRVIEISARMDPHLLVDLTEDKEVDAEFMYTVKWK  239

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+TPFEKRME++S  S+LP HLEIHWF
Sbjct  240  ETDTPFEKRMERYSMSSSLPHHLEIHWF  267



>ref|XP_006372421.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
 gb|ERP50218.1| hypothetical protein POPTR_0017s01480g [Populus trichocarpa]
Length=592

 Score =   329 bits (843),  Expect = 8e-105, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK G++V LY NKVGPFHNPSETY Y DLPFCS    + K EALGEVLNGDR
Sbjct  23   RSDASDHRYKVGEDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE+ C+K+L+K  V +FR  V++DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVTAPYKLDFLNDKDSEIACRKRLTKEQVAQFREVVSKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E K+DPSEYKYYLFKHLHF IFYNKD+++EI A++D + +VD+T DKE+DV+FMYSVKWK
Sbjct  143  ERKNDPSEYKYYLFKHLHFTIFYNKDRVIEITAQSDLNNVVDLTEDKEVDVEFMYSVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET  PFEKRMEK+SQ S+LP HLEIHWF
Sbjct  203  ETEIPFEKRMEKYSQSSSLPHHLEIHWF  230



>gb|KHG09925.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=592

 Score =   328 bits (842),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 183/208 (88%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RS ASDHRYK GDEV LYANKVGP+HNPSETY Y D PFCS A V++K EALGEVLNGDR
Sbjct  23   RSTASDHRYKAGDEVPLYANKVGPYHNPSETYRYFDFPFCSSAPVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL +KE+E+ CK+KL++ +V KFR AV++DYYFQMYYDDLP+WG++GKV+K
Sbjct  83   LVSAPYKLEFLTEKEAEIACKRKLTRDEVVKFRKAVSKDYYFQMYYDDLPIWGFLGKVEK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DP++YKYYLFKHL FEI +NKD+++E+  R+DP+A+VD+T D+ +DVDFMY+VKWK
Sbjct  143  EGKTDPADYKYYLFKHLVFEIHHNKDRVIEVTVRSDPNALVDLTEDEPVDVDFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ETNTPFEKRM+K+S  S+LP HLEIHWF
Sbjct  203  ETNTPFEKRMDKYSLSSSLPHHLEIHWF  230



>emb|CDY52035.1| BnaA08g31480D [Brassica napus]
Length=589

 Score =   328 bits (842),  Expect = 9e-105, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  20   RSDASDHRYKEGDIVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV CKKKLSK +V KFR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  80   LVSAPYKLNFREEKDSEVYCKKKLSKEEVRKFRQAVEKDYYFQMYYDDLPIWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E KSDPSEYKY+L+KH+ FEI YN D+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  140  EIKSDPSEYKYFLYKHIEFEILYNNDRVIEISARMDPHSLVDLTEDKEVDAEFMYTVKWK  199

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRM+K+S  S+LP HLEIHWF
Sbjct  200  ETETPFEKRMDKYSMSSSLPHHLEIHWF  227



>ref|XP_006395825.1| hypothetical protein EUTSA_v10003877mg [Eutrema salsugineum]
 gb|ACQ90591.1| putative transmembrane transporter [Eutrema halophilum]
 gb|ESQ33111.1| hypothetical protein EUTSA_v10003877mg [Eutrema salsugineum]
Length=592

 Score =   328 bits (841),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 179/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V+ K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SE+ CKKKLS+ +VE+FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKDSEIYCKKKLSREEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E KSDPSE+KY+L+KH+ FEI YNKD+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  143  ESKSDPSEFKYFLYKHIQFEILYNKDRVIEINARMDPHSLVDLTEDKEVDAEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPF+KRMEK++  S+LP HLEIHWF
Sbjct  203  ETETPFDKRMEKYAMSSSLPHHLEIHWF  230



>ref|NP_172919.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q940S0.1|TMN2_ARATH RecName: Full=Transmembrane 9 superfamily member 2; AltName: 
Full=Endomembrane protein 8; AltName: Full=Transmembrane nine 
protein 2; Short=AtTMN2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAK96649.1| T5E21.14/T5E21.14 [Arabidopsis thaliana]
 gb|AAM16222.1| At1g14670/T5E21.14 [Arabidopsis thaliana]
 gb|AEE29200.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=592

 Score =   328 bits (841),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 179/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +KESEV C KKLSK +V++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKESEVYCNKKLSKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            + KSDPSE+KY+L+KH+ FEI YNKD+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  143  DIKSDPSEFKYFLYKHIQFEILYNKDRVIEISARMDPHSLVDLTEDKEVDAEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRMEK+S  S+LP HLEIHWF
Sbjct  203  ETETPFEKRMEKYSMSSSLPHHLEIHWF  230



>ref|XP_011038406.1| PREDICTED: transmembrane 9 superfamily member 3-like [Populus 
euphratica]
Length=592

 Score =   328 bits (841),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD+V LY NKVGPFHNPSETY Y DLPFCS    + K EALGEVLNGDR
Sbjct  23   RSDASDHRYKVGDDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SEV CK  L+K  V +FR AV++DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVTAPYKLDFLNDKDSEVACKNTLTKEQVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKYYLFKHLHF IFYNKD+++EI A++D + +VD+T DKE++V+FMYSVKWK
Sbjct  143  EGKNDPSEYKYYLFKHLHFTIFYNKDRVIEISAQSDLNNVVDLTEDKEVNVEFMYSVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+  FEKRM+K+SQ S+LP HLEIHWF
Sbjct  203  ETDITFEKRMDKYSQSSSLPHHLEIHWF  230



>ref|XP_010527833.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=593

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 179/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  24   RSDASDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFCVPDGVKEKKEALGEVLNGDR  83

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV C KKLSK +V++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  84   LVSAPYKLNFREEKDSEVYCSKKLSKDEVKQFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  143

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSE+KY+L+KH+ FEI YNK +++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  144  EGKADPSEFKYFLYKHIQFEILYNKYRVIEISARMDPHSLVDLTEDKEVDAEFMYTVKWK  203

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRMEK+S  S+LP HLEIHWF
Sbjct  204  ETETPFEKRMEKYSMSSSLPHHLEIHWF  231



>ref|XP_008462539.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Cucumis 
melo]
Length=601

 Score =   328 bits (841),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 151/207 (73%), Positives = 180/207 (87%), Gaps = 1/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD V LYANKVGPFHNPSETY Y DLPFC P +V++K EALGEVLNGDRL
Sbjct  34   SDGSDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDDVKEKKEALGEVLNGDRL  93

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDFL +K+S  VC+KKLSK DV +FR AV +DYYFQMYYDDLP+WG+IGKVDKE
Sbjct  94   VSAPYKLDFLQEKDSSSVCQKKLSKEDVARFRAAVDKDYYFQMYYDDLPIWGFIGKVDKE  153

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GK DPS++KYYL+KH+HF+IFYNKD+++EI  R DP+A+VD+T DKE+DV+F+Y+VKWKE
Sbjct  154  GK-DPSDFKYYLYKHIHFDIFYNKDRVIEINVRTDPNALVDLTEDKEVDVEFLYTVKWKE  212

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T TPFE RM+K+SQ S+LP HLEIHWF
Sbjct  213  TTTPFENRMDKYSQSSSLPHHLEIHWF  239



>gb|KHN43674.1| Putative phagocytic receptor 1b [Glycine soja]
Length=588

 Score =   327 bits (839),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 180/208 (87%), Gaps = 1/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P ++++K EALGEVLNGDR
Sbjct  20   RSDPSDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFCEPGDLKEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  DKES  VC +KLSK DV +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  80   LVSAPYKLEFQRDKESISVCNRKLSKQDVARFRSAVRKDYYFQMYYDDLPIWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK DPS+Y+Y+L+KH+HF++FYNKD+++EI  R DP+A+VD+T D E+D +F+Y+VKWK
Sbjct  140  EGK-DPSDYRYFLYKHIHFDVFYNKDRVIEINVRTDPNALVDLTKDSEVDAEFLYTVKWK  198

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ETNTPFEKRM+++SQ S+LP HLEIHWF
Sbjct  199  ETNTPFEKRMDRYSQSSSLPHHLEIHWF  226



>ref|NP_198547.3| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q9FHT4.1|TMN4_ARATH RecName: Full=Transmembrane 9 superfamily member 4; AltName: 
Full=Endomembrane protein 10; AltName: Full=Transmembrane nine 
protein 4; Short=AtTMN4; Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09103.1| endosomal protein-like [Arabidopsis thaliana]
 dbj|BAE99006.1| multispanning membrane protein - like [Arabidopsis thaliana]
 gb|AED94164.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=593

 Score =   328 bits (840),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 175/207 (85%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  25   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  84

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL +K SEV C+K+LS+ DV KFR  +A+DYYFQMYYDDLP+WG++GKV KE
Sbjct  85   VSAPYKLEFLGEKNSEVACRKRLSREDVAKFRDVIAKDYYFQMYYDDLPIWGFLGKVVKE  144

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GK+DPSEYKYYLF HL FEIFYNKD+++EII R D + +VD+T DKE+ VDF Y+V+WKE
Sbjct  145  GKTDPSEYKYYLFNHLQFEIFYNKDRVIEIIVRTDQNFLVDLTEDKEVQVDFTYTVRWKE  204

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T  PFEKRMEK+S  S++P HLEIHWF
Sbjct  205  TEIPFEKRMEKYSLASSMPHHLEIHWF  231



>ref|XP_002870515.1| transporter [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46774.1| transporter [Arabidopsis lyrata subsp. lyrata]
Length=593

 Score =   327 bits (839),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 175/207 (85%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  25   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  84

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL +K SEV C+K+LS+ DV KFR  +A+DYYFQMYYDDLP+WG++GKV KE
Sbjct  85   VSAPYKLEFLGEKNSEVACRKRLSREDVAKFRDVIAKDYYFQMYYDDLPIWGFLGKVFKE  144

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GK+DPSEYKYYLF HL FEIFYNKD+++EII R D + +VD+T DKE+ VDF Y+V+WKE
Sbjct  145  GKTDPSEYKYYLFNHLQFEIFYNKDRVIEIIVRTDQNFLVDLTEDKEVQVDFTYTVRWKE  204

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T  PFEKRMEK+S  S++P HLEIHWF
Sbjct  205  TEIPFEKRMEKYSLASSMPHHLEIHWF  231



>ref|XP_007158822.1| hypothetical protein PHAVU_002G184900g [Phaseolus vulgaris]
 gb|ESW30816.1| hypothetical protein PHAVU_002G184900g [Phaseolus vulgaris]
Length=592

 Score =   327 bits (838),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 180/208 (87%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC   N ++K+EALGEVLNGDR
Sbjct  23   RSDASDHRYKEGDHVPLYANKVGPFHNPSETYRYFDLPFCVTGNEKEKTEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+LDF  +K++++VC +KL K +V +FR AV +DYYFQMYYDDLP+WG+IG VDK
Sbjct  83   LVSTPYELDFRTEKDAKLVCSRKLKKQEVAQFREAVKKDYYFQMYYDDLPIWGFIGTVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKY+L+KH+ F+I YNKD++VEI AR DP+++VD+T DKE+DVDF Y+ KWK
Sbjct  143  EGKTDPSEYKYFLYKHIQFDILYNKDRVVEISARMDPNSVVDLTEDKEVDVDFRYTAKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+TPFEKRMEK+SQ S+LP HLEIHWF
Sbjct  203  ETDTPFEKRMEKYSQSSSLPHHLEIHWF  230



>emb|CDX84018.1| BnaC08g16270D [Brassica napus]
Length=589

 Score =   326 bits (836),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EA GEVLNGDR
Sbjct  20   RSDASDHRYKEGDIVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEAFGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV CKKKLSK +V+KFR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  80   LVSAPYKLNFRDEKDSEVYCKKKLSKEEVKKFRQAVEKDYYFQMYYDDLPIWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E KSDPSEYKY+L+KH+ FEI YN D+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  140  EIKSDPSEYKYFLYKHIEFEILYNNDRVIEISARMDPHSLVDLTEDKEVDAEFMYTVKWK  199

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRM+K+S  S+LP HLEIHWF
Sbjct  200  ETETPFEKRMDKYSMSSSLPHHLEIHWF  227



>gb|KJB60875.1| hypothetical protein B456_009G329300 [Gossypium raimondii]
Length=549

 Score =   325 bits (832),  Expect = 9e-104, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFCSP +V +K EALGEVLNGDR
Sbjct  25   RSDASDHRYKDGDAVPLYANKVGPFHNPSETYRYFDLPFCSPDHVTEKREALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+S VVCKKKL K +V  FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVSAPYKLNFKEEKDSSVVCKKKLLKDEVAFFRKAVDKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKY+LFKH+ F++ YNKD+++E+ AR DP ++VD+T DKE+D +FMYS KWK
Sbjct  145  EGKTDPSEYKYFLFKHIQFDVLYNKDRVIEVNARMDPHSLVDLTEDKEVDAEFMYSAKWK  204

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRM+K+S  S+LP HLEIHWF
Sbjct  205  ETETPFEKRMDKYSMSSSLPHHLEIHWF  232



>ref|XP_006384123.1| hypothetical protein POPTR_0004s07400g [Populus trichocarpa]
 gb|ERP61920.1| hypothetical protein POPTR_0004s07400g [Populus trichocarpa]
Length=592

 Score =   326 bits (835),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDAS +RYK GD+V LY NKVGPFHNPSETY Y DLPFCS    + K EALGE+LNGDR
Sbjct  23   RSDASTNRYKVGDDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGELLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE+ CK KL+K  V +FR AV++DYYFQMYYDDLP+WG+IGKV+K
Sbjct  83   LVTAPYKLDFLNDKDSEIACKNKLTKEQVAQFREAVSKDYYFQMYYDDLPIWGFIGKVEK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKYYLFKHLHF IFYNKD+++EI A +DP  +V++T +KE++V+FMYSVKWK
Sbjct  143  EGKNDPSEYKYYLFKHLHFTIFYNKDRVIEITALSDPKNVVELTENKEVNVEFMYSVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET  P+EKRMEK+SQ S+LP HLEIHWF
Sbjct  203  ETEIPYEKRMEKYSQSSSLPHHLEIHWF  230



>ref|XP_008393472.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=593

 Score =   326 bits (835),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 180/208 (87%), Gaps = 1/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DLPFCSP  V++K EALGEVLNGDR
Sbjct  25   RSDGSDHRYKEGDLVPLYANKVGPFHNPSETYRYFDLPFCSPGAVKEKKEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL  K+++V CK KL K +V +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVSAPYKLEFLKHKDTDVACKTKLKKEEVAQFRSAVNKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK DPSEYK YL+KH+HF+++YNKD+++E+  R DP+A+VD+T DKE+DV+FMY+V+WK
Sbjct  145  EGK-DPSEYKTYLYKHIHFDLYYNKDRVIEVNVRTDPNALVDLTEDKEVDVEFMYTVEWK  203

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRM+K+SQ S+LP HLEIHWF
Sbjct  204  ETATPFEKRMDKYSQSSSLPHHLEIHWF  231



>gb|KJB60874.1| hypothetical protein B456_009G329300 [Gossypium raimondii]
Length=594

 Score =   326 bits (835),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFCSP +V +K EALGEVLNGDR
Sbjct  25   RSDASDHRYKDGDAVPLYANKVGPFHNPSETYRYFDLPFCSPDHVTEKREALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+S VVCKKKL K +V  FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVSAPYKLNFKEEKDSSVVCKKKLLKDEVAFFRKAVDKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKY+LFKH+ F++ YNKD+++E+ AR DP ++VD+T DKE+D +FMYS KWK
Sbjct  145  EGKTDPSEYKYFLFKHIQFDVLYNKDRVIEVNARMDPHSLVDLTEDKEVDAEFMYSAKWK  204

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRM+K+S  S+LP HLEIHWF
Sbjct  205  ETETPFEKRMDKYSMSSSLPHHLEIHWF  232



>ref|XP_011005915.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
 ref|XP_011005916.1| PREDICTED: transmembrane 9 superfamily member 4-like [Populus 
euphratica]
Length=592

 Score =   325 bits (834),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 176/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDAS+HRYK GD V LY NKVGPFHNPSETY Y DLPFCS    + K EALGE+LNGDR
Sbjct  23   RSDASNHRYKVGDGVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGELLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE+ CK KL+K  V +FR AV++DYYFQMYYDDLP+WG+IGKV+K
Sbjct  83   LVTAPYKLDFLNDKDSEIACKNKLTKEQVAQFREAVSKDYYFQMYYDDLPIWGFIGKVEK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKYYLFKHLHF IFYNKD+++EI A +D   +V++T +KE++V+FMYSVKWK
Sbjct  143  EGKNDPSEYKYYLFKHLHFTIFYNKDRVIEITALSDQKNVVELTENKEVNVEFMYSVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET  PFEKRMEK+SQ S+LP HLEIHWF
Sbjct  203  ETEIPFEKRMEKYSQSSSLPHHLEIHWF  230



>emb|CDX81659.1| BnaC08g39420D [Brassica napus]
Length=589

 Score =   325 bits (834),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 179/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD+SDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  20   RSDSSDHRYKEGDIVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV CKKKLSK +V+ FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  80   LVSAPYKLNFRDEKDSEVYCKKKLSKEEVKHFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            + KSDPSEYKY+L+KH+ FEI YNKD+++EI AR DP ++VD++ DKE+D +FMYSVKWK
Sbjct  140  DIKSDPSEYKYFLYKHIQFEILYNKDRVIEISARMDPHSLVDLSEDKEVDAEFMYSVKWK  199

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRMEK+S  S+LP HLEIHWF
Sbjct  200  ETETPFEKRMEKYSMSSSLPHHLEIHWF  227



>gb|KFK33411.1| hypothetical protein AALP_AA5G009400 [Arabis alpina]
Length=592

 Score =   325 bits (834),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+G+ V LYANKVGPFHNPSETY Y DLPFC P  V+ K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEGETVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SE  CKKKLS+ +VE+FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKDSERYCKKKLSREEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E KSDPSE+KY+L+KH+ FEI YNKD+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  143  ESKSDPSEFKYFLYKHIQFEILYNKDRVIEINARMDPHSLVDLTEDKEVDAEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRMEK++  S+LP HLEIHWF
Sbjct  203  ETETPFEKRMEKYAMSSSLPHHLEIHWF  230



>ref|XP_009110529.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=589

 Score =   325 bits (834),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 151/208 (73%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RS ASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  20   RSYASDHRYKEGDIVLLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV CKKKLSK +V KFR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  80   LVSAPYKLNFREEKDSEVYCKKKLSKEEVRKFRQAVEKDYYFQMYYDDLPIWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E KSDPSEYKY+L+KH+ FEI YN D+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  140  EIKSDPSEYKYFLYKHIEFEILYNNDRVIEISARMDPHSLVDLTEDKEVDAEFMYTVKWK  199

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRM+K+S  S+LP HLEIHWF
Sbjct  200  ETETPFEKRMDKYSMSSSLPHHLEIHWF  227



>ref|XP_009355975.1| PREDICTED: putative phagocytic receptor 1b [Pyrus x bretschneideri]
Length=593

 Score =   325 bits (834),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 181/208 (87%), Gaps = 1/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DLPFCSP  V++K EALGEVLNGDR
Sbjct  25   RSDGSDHRYKEGDFVPLYANKVGPFHNPSETYRYFDLPFCSPDAVKEKREALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL  K++EV CKK L+K +V +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVSAPYKLEFLRHKDTEVACKKTLTKEEVARFRSAVNKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK DPSEYK YL+KH+HF+++YNKD+++E+  R DP+A+VD+T DKE+DV+FMY+V+WK
Sbjct  145  EGK-DPSEYKTYLYKHIHFDLYYNKDRVIEVNVRTDPNALVDLTEDKEVDVEFMYTVEWK  203

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPF+KRM+K+SQ S+LP HLEIHWF
Sbjct  204  ETTTPFDKRMDKYSQSSSLPHHLEIHWF  231



>ref|XP_006405901.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 ref|XP_006405902.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 gb|ESQ47354.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
 gb|ESQ47355.1| hypothetical protein EUTSA_v10027693mg [Eutrema salsugineum]
Length=595

 Score =   325 bits (834),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 175/207 (85%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  27   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  86

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL +K SEV C+K+LS+ DV KFR  + +DYYFQMYYDDLP+WG++GKV K+
Sbjct  87   VSAPYKLEFLGEKNSEVACRKRLSREDVAKFRDVITKDYYFQMYYDDLPIWGFLGKVVKD  146

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GKSDPSEYKYYLF HL FEIFYNKD+++EII R D + +VD+T DKE++VDF Y+V+WKE
Sbjct  147  GKSDPSEYKYYLFNHLQFEIFYNKDRVIEIIVRTDQNFLVDLTEDKEVEVDFTYTVRWKE  206

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T  PFEKRMEK+S  S++P HLEIHWF
Sbjct  207  TEIPFEKRMEKYSLASSMPHHLEIHWF  233



>ref|XP_002305925.2| endomembrane protein 70 [Populus trichocarpa]
 gb|EEE86436.2| endomembrane protein 70 [Populus trichocarpa]
Length=592

 Score =   325 bits (833),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASD+RYK G++V LY NKVGPFHNPSETY Y DLPFCS    + K EALGE+LNGDR
Sbjct  23   RSDASDNRYKVGEDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGELLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SE+ CK KL+K  V +FR A+++D+YFQMYYDDLP+WG+IGKV+K
Sbjct  83   LVTAPYKLDFLNDKDSEIACKNKLTKEQVAQFREAISKDFYFQMYYDDLPIWGFIGKVEK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKYYL KHLHF IFYNKD+++EI A +DP  +VD+T DKE++V+FMYSVKWK
Sbjct  143  EGKNDPSEYKYYLLKHLHFTIFYNKDRVIEITALSDPKNVVDLTEDKEVNVEFMYSVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET  P+EKRMEK+SQ S+LP HLEIHWF
Sbjct  203  ETEIPYEKRMEKYSQSSSLPHHLEIHWF  230



>ref|XP_006307070.1| hypothetical protein CARUB_v10008657mg [Capsella rubella]
 gb|EOA39968.1| hypothetical protein CARUB_v10008657mg [Capsella rubella]
Length=592

 Score =   325 bits (832),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+ D V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYKERDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +KE EV C KKLSK +V++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFREEKEGEVYCNKKLSKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            + KSDPSEYKY+L+KH+ FEI YNKD+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  143  DIKSDPSEYKYFLYKHIQFEILYNKDRVIEISARMDPHSLVDLTEDKEVDAEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRMEK+S  S+LP HLEIHWF
Sbjct  203  ETETPFEKRMEKYSMSSSLPHHLEIHWF  230



>ref|XP_011463508.1| PREDICTED: transmembrane 9 superfamily member 2 [Fragaria vesca 
subsp. vesca]
Length=592

 Score =   325 bits (832),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 180/208 (87%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRY + D V LYANKVGPFHNPSETY Y DLPFCSP +V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYNENDVVPLYANKVGPFHNPSETYRYFDLPFCSPGDVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K++EV C++KL+K +V +FR AV +DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVSAPYKLEFRKEKDTEVACRRKLTKEEVAEFRKAVEKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKY+L+KH+ FEI YNKD+++EI A+ DP ++VD+T DK++D DFMY+VKW+
Sbjct  143  EGKTDPSEYKYFLYKHIQFEILYNKDRVIEIGAKMDPHSVVDLTEDKDVDADFMYTVKWR  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ETN PFE RM+K+SQ S+LP HLEIHWF
Sbjct  203  ETNIPFENRMDKYSQSSSLPHHLEIHWF  230



>ref|XP_007045410.1| Endomembrane protein 70 protein family isoform 2 [Theobroma cacao]
 gb|EOY01242.1| Endomembrane protein 70 protein family isoform 2 [Theobroma cacao]
Length=594

 Score =   325 bits (832),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 180/208 (87%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFCSP ++++K EALGEVLNGDR
Sbjct  25   RSDASDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDHLKEKKEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV++ YKL+F  +++S VVCK KLSK +V  FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVNAPYKLNFREERDSYVVCKTKLSKDEVAIFRKAVDKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKY+L+KH+ F+I YNKD+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  145  EGKADPSEYKYFLYKHIQFDILYNKDRVIEISARMDPHSLVDLTEDKEVDAEFMYTVKWK  204

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRM+K+S  S+LP HLEIHWF
Sbjct  205  ETETPFEKRMDKYSMSSSLPHHLEIHWF  232



>ref|XP_011654527.1| PREDICTED: transmembrane 9 superfamily member 2 [Cucumis sativus]
 gb|KGN49739.1| hypothetical protein Csa_5G096460 [Cucumis sativus]
Length=589

 Score =   325 bits (832),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLV  401
            DAS+HRY +GD V LYANKVGPFHNPSETY Y DLPFCSP +V++K EALGEVLNGDRLV
Sbjct  22   DASNHRYSEGDSVPLYANKVGPFHNPSETYRYFDLPFCSPGDVKEKKEALGEVLNGDRLV  81

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             + YKLDF  +K++EV CK KLSK +V +FR AV +DYYFQMYYDDLP+WG+IGKVD+EG
Sbjct  82   SAPYKLDFKREKDTEVACKSKLSKKEVAQFRAAVKKDYYFQMYYDDLPIWGFIGKVDREG  141

Query  582  KSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKET  761
            + DPSEYKY+LFKH+ F+I YN+D+++EI AR DP ++VD+T DK++DV+FMY+VKW+ET
Sbjct  142  RDDPSEYKYFLFKHIQFDISYNRDRVIEISARMDPHSVVDLTEDKDVDVEFMYTVKWRET  201

Query  762  NTPFEKRMEKFSQISALPQHLEIHWF  839
            +TPFEKRM+K+SQ S+LP HLEIHWF
Sbjct  202  DTPFEKRMDKYSQSSSLPHHLEIHWF  227



>ref|XP_007210263.1| hypothetical protein PRUPE_ppa003204mg [Prunus persica]
 ref|XP_008240392.1| PREDICTED: putative phagocytic receptor 1b [Prunus mume]
 gb|EMJ11462.1| hypothetical protein PRUPE_ppa003204mg [Prunus persica]
Length=593

 Score =   325 bits (832),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 150/208 (72%), Positives = 179/208 (86%), Gaps = 1/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFCSP  V++K EALGEVLNGDR
Sbjct  25   RSDASDHRYKEGDLVPLYANKVGPFHNPSETYRYFDLPFCSPDKVKEKKEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F   K+SEV CK+ + K +V +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVSAPYKLEFQKHKDSEVACKRTIKKEEVARFRSAVNKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK DPSEYK YL+KH+HF+I YNKD+++EI  R DP+A+VD+T DKE+DV+FMY+VKWK
Sbjct  145  EGK-DPSEYKTYLYKHIHFDISYNKDRVIEINVRTDPNALVDLTEDKEIDVEFMYTVKWK  203

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPF+KRM+K+SQ S+LP HLEIHWF
Sbjct  204  ETTTPFDKRMDKYSQSSSLPHHLEIHWF  231



>ref|XP_010458976.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   325 bits (832),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDAS+HRYK GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASNHRYKDGDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +KESEV C KKL+K +V++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKESEVYCNKKLTKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            + KSDPSE+KY+L+KH+ FEI YNKD+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  143  DIKSDPSEFKYFLYKHIQFEILYNKDRVIEISARMDPHSLVDLTEDKEVDAEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRMEK+S  S+LP HLEIHWF
Sbjct  203  ETETPFEKRMEKYSMSSSLPHHLEIHWF  230



>ref|XP_007045409.1| Endomembrane protein 70 protein family isoform 1 [Theobroma cacao]
 gb|EOY01241.1| Endomembrane protein 70 protein family isoform 1 [Theobroma cacao]
Length=594

 Score =   325 bits (832),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 180/208 (87%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFCSP ++++K EALGEVLNGDR
Sbjct  25   RSDASDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDHLKEKKEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV++ YKL+F  +++S VVCK KLSK +V  FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVNAPYKLNFREERDSYVVCKTKLSKDEVAIFRKAVDKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKY+L+KH+ F+I YNKD+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  145  EGKADPSEYKYFLYKHIQFDILYNKDRVIEISARMDPHSLVDLTEDKEVDAEFMYTVKWK  204

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRM+K+S  S+LP HLEIHWF
Sbjct  205  ETETPFEKRMDKYSMSSSLPHHLEIHWF  232



>ref|XP_002876790.1| hypothetical protein ARALYDRAFT_904415 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53049.1| hypothetical protein ARALYDRAFT_904415 [Arabidopsis lyrata subsp. 
lyrata]
Length=592

 Score =   325 bits (832),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFC P  V+ K EALGEVLNGDR
Sbjct  23   RSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFCIPDGVKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+S+V C+KKLS+  VE+FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFREEKDSDVYCRKKLSREQVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E KSDPSE+KY+L+KH+ FEI YNKD+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  143  ESKSDPSEFKYFLYKHIQFEILYNKDRVIEINARMDPHSLVDLTEDKEVDAEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRM+K++  S+LP HLEIHWF
Sbjct  203  ETETPFEKRMDKYAMSSSLPHHLEIHWF  230



>ref|XP_010523531.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
Length=584

 Score =   324 bits (830),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+ D V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEADSVPLYANKVGPFHNPSETYRYFDLPFCVPDGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV CKKKLSK +V++FR AV +D+YFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFREEKDSEVYCKKKLSKDEVKQFRRAVEKDFYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E KSDPSE+KY+L+KH+ FEI YNKD ++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  143  ERKSDPSEFKYFLYKHIQFEILYNKDHVIEISARMDPHSLVDLTEDKEVDAEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET  PFEKRMEK+S  S+LP HLEIHWF
Sbjct  203  ETEIPFEKRMEKYSMSSSLPHHLEIHWF  230



>ref|XP_008466877.1| PREDICTED: putative phagocytic receptor 1b [Cucumis melo]
Length=602

 Score =   324 bits (831),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 145/206 (70%), Positives = 180/206 (87%), Gaps = 0/206 (0%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLV  401
            DAS+HRY +GD V LYANKVGPFHNPSETY Y DLPFCSP +V++K EALGEVLNGDRLV
Sbjct  35   DASNHRYSEGDSVPLYANKVGPFHNPSETYRYFDLPFCSPGDVKEKKEALGEVLNGDRLV  94

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             + YKLDF  +K++EV CK KLSK +V +FR AV +DYYFQMYYDDLP+WG+IGKVD+EG
Sbjct  95   SAPYKLDFKREKDTEVACKSKLSKKEVAQFRAAVKKDYYFQMYYDDLPIWGFIGKVDREG  154

Query  582  KSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKET  761
            + DPSEYKY+LFKH+ F+I YN+D+++EI AR DP ++VD+T DK++DV+FMY+VKW+ET
Sbjct  155  RDDPSEYKYFLFKHIQFDISYNRDRVIEISARMDPHSVVDLTEDKDVDVEFMYTVKWRET  214

Query  762  NTPFEKRMEKFSQISALPQHLEIHWF  839
            +TPFEKRM+K+SQ S+LP HLEIHWF
Sbjct  215  DTPFEKRMDKYSQSSSLPHHLEIHWF  240



>ref|XP_006292411.1| hypothetical protein CARUB_v10018624mg [Capsella rubella]
 gb|EOA25309.1| hypothetical protein CARUB_v10018624mg [Capsella rubella]
Length=592

 Score =   324 bits (830),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK  D V LYANKVGPFHNPSETY Y DLPFC P  V+ K EALGEVLNGDR
Sbjct  23   RSDASDHRYKDSDSVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV C+KKLS+ +VE+FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKDSEVYCRKKLSRKEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E KSDPSE+KY+L+KH+ FEI YNKD+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  143  ESKSDPSEFKYFLYKHIQFEILYNKDRVIEINARMDPHSLVDLTEDKEVDAEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRM+K++  S+LP HLEIHWF
Sbjct  203  ETETPFEKRMDKYAMSSSLPHHLEIHWF  230



>ref|XP_010502204.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   324 bits (830),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK  D V LYANKVGPFHNPSETY Y DLPFC P  V+ K EALGEVLNGDR
Sbjct  23   RSDASDHRYKDSDSVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV C+KKLS+ +VE+FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKDSEVYCRKKLSRKEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E KSDPSE+KY+L+KH+ FEI YNKD+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  143  ESKSDPSEFKYFLYKHIQFEILYNKDRVIEINARMDPHSLVDLTEDKEVDAEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRM+K++  S+LP HLEIHWF
Sbjct  203  ETETPFEKRMDKYAMSSSLPHHLEIHWF  230



>ref|XP_004515238.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=592

 Score =   324 bits (830),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 182/208 (88%), Gaps = 1/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD+SDHR+K+GD V L+ANKVGPFHNPSETY Y DLPFC P ++++K EALGEVLNGDR
Sbjct  24   RSDSSDHRFKEGDLVPLFANKVGPFHNPSETYRYFDLPFCIPDHLKEKKEALGEVLNGDR  83

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L++  DKES  VCKKKL+K DV KFR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  84   LVSAPYQLEYRRDKESVSVCKKKLTKEDVGKFRSAVRKDYYFQMYYDDLPIWGFIGKVDK  143

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK DPS+Y+YYL+KH+HF+IFYNKD+++EI  R DP+A+VD+T D E+DV+F Y+VKWK
Sbjct  144  EGK-DPSDYRYYLYKHIHFDIFYNKDRVIEINVRTDPNALVDVTEDNEVDVEFFYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ETNTPF+KRM+K+SQ S+LP HLEIHWF
Sbjct  203  ETNTPFDKRMDKYSQSSSLPHHLEIHWF  230



>ref|XP_010513951.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
 ref|XP_010424990.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   324 bits (830),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK  D V LYANKVGPFHNPSETY Y DLPFC P  V+ K EALGEVLNGDR
Sbjct  23   RSDASDHRYKDSDSVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV C+KKLS+ +VE+FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKDSEVYCRKKLSRKEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E KSDPSE+KY+L+KH+ FEI YNKD+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  143  ESKSDPSEFKYFLYKHIQFEILYNKDRVIEINARMDPHSLVDLTEDKEVDAEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRM+K++  S+LP HLEIHWF
Sbjct  203  ETETPFEKRMDKYAMSSSLPHHLEIHWF  230



>emb|CDY62621.1| BnaC08g46810D [Brassica napus]
Length=592

 Score =   323 bits (829),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 175/207 (85%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  24   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  83

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL +K S+V C+K+LS+ DV +FR  +++DYYFQMYYDDLP+WG++GKV K+
Sbjct  84   VTAPYKLEFLGEKNSQVACRKRLSREDVAQFRDVISKDYYFQMYYDDLPIWGFLGKVVKD  143

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GKSDPSEYKYYLF HL FEIFYNKD+++EII R D S +VD+T DKE++VDF Y+V+WKE
Sbjct  144  GKSDPSEYKYYLFNHLQFEIFYNKDRVIEIIVRTDQSFLVDLTEDKEVEVDFTYTVRWKE  203

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T  PFEKRMEK+S  S+ P HLEIHWF
Sbjct  204  TEIPFEKRMEKYSLASSTPHHLEIHWF  230



>ref|XP_010523409.1| PREDICTED: putative phagocytic receptor 1b [Tarenaya hassleriana]
 ref|XP_010523411.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010523412.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Tarenaya 
hassleriana]
 ref|XP_010523413.1| PREDICTED: putative phagocytic receptor 1b isoform X3 [Tarenaya 
hassleriana]
Length=592

 Score =   323 bits (829),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+ D V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEADSVPLYANKVGPFHNPSETYRYFDLPFCVPDGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV CKKKLSK +V++FR AV +D+YFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFREEKDSEVYCKKKLSKDEVKQFRRAVEKDFYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E KSDPSE+KY+L+KH+ FEI YNKD ++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  143  ERKSDPSEFKYFLYKHIQFEILYNKDHVIEISARMDPHSLVDLTEDKEVDAEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET  PFEKRMEK+S  S+LP HLEIHWF
Sbjct  203  ETEIPFEKRMEKYSMSSSLPHHLEIHWF  230



>ref|XP_010476529.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   323 bits (829),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDAS+HRYK GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASNHRYKDGDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV C KKL+K +V++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKDSEVYCNKKLTKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            + KSDPSE+KY+L+KH+ FEI YNKD+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  143  DIKSDPSEFKYFLYKHIQFEILYNKDRVIEISARMDPHSLVDLTEDKEVDAEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRMEK+S  S+LP HLEIHWF
Sbjct  203  ETETPFEKRMEKYSMSSSLPHHLEIHWF  230



>ref|XP_006448060.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
 gb|ESR61300.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
Length=545

 Score =   322 bits (825),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 179/209 (86%), Gaps = 1/209 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEK-KSEALGEVLNGD  392
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFCSP  + K K EALGEVLNGD
Sbjct  23   RSDASDHRYKVGDVVPLYANKVGPFHNPSETYRYFDLPFCSPDGIIKEKREALGEVLNGD  82

Query  393  RLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVD  572
            RLV + YKL+F  +K+S V C+KKLS+ DV +FR AV +D+YFQMYYDDLP+WG+IGKVD
Sbjct  83   RLVSAPYKLNFRDEKDSAVACRKKLSEQDVAQFRSAVEKDFYFQMYYDDLPIWGFIGKVD  142

Query  573  KEGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKW  752
            KEGK+ P+EYKY+L+KH+ F+I YNKD+++EI AR DP ++VD+T DKE+DV+FMYSVKW
Sbjct  143  KEGKTHPNEYKYFLYKHIQFDILYNKDRVIEISARMDPHSLVDLTEDKEVDVEFMYSVKW  202

Query  753  KETNTPFEKRMEKFSQISALPQHLEIHWF  839
            KET+TPFEKRMEK+S  S+LP HLEIHWF
Sbjct  203  KETDTPFEKRMEKYSLSSSLPHHLEIHWF  231



>ref|NP_178306.1| putative endomembrane protein 70 [Arabidopsis thaliana]
 sp|Q9ZPS7.1|TMN3_ARATH RecName: Full=Transmembrane 9 superfamily member 3; AltName: 
Full=Endomembrane protein 9; AltName: Full=Transmembrane nine 
protein 3; Short=AtTMN3; Flags: Precursor [Arabidopsis thaliana]
 gb|AAD20090.1| putative endosomal protein [Arabidopsis thaliana]
 gb|AAL24256.1| At2g01970/F14H20.4 [Arabidopsis thaliana]
 dbj|BAE98629.1| putative endosomal protein [Arabidopsis thaliana]
 gb|AEC05528.1| putative endomembrane protein 70 [Arabidopsis thaliana]
Length=592

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 176/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFC P  V+ K EALGEVLNGDR
Sbjct  23   RSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV CKKKLS+ +VE FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKDSEVYCKKKLSREEVEHFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E KSDPSE+KY+L+KH+ FEI YNKD+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  143  ESKSDPSEFKYFLYKHIQFEILYNKDRVIEINARMDPHSLVDLTEDKEVDAEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET T FEKRM+K++  S+LP HLEIHWF
Sbjct  203  ETETSFEKRMDKYAMSSSLPHHLEIHWF  230



>ref|XP_010496367.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=592

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDAS+HRYK GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  23   RSDASNHRYKDGDTVPLYANKVGPFHNPSETYRYFDLPFCIPEGVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV C KKL+K +V++FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKDSEVYCNKKLTKEEVKQFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            + KSDPSE+KY+L+KH+ FEI YNKD+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  143  DIKSDPSEFKYFLYKHIQFEILYNKDRVIEISARMDPHSLVDLTEDKEVDAEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRMEK+S  S+LP HLEIHWF
Sbjct  203  ETETPFEKRMEKYSMSSSLPHHLEIHWF  230



>ref|XP_010066537.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW64446.1| hypothetical protein EUGRSUZ_G02064 [Eucalyptus grandis]
Length=598

 Score =   323 bits (829),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 179/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK G+ V LYANKVGPFHNPSETY + DLPFCSP NV+ K EALGEVLNGDR
Sbjct  29   RSDASDHRYKDGEVVPLYANKVGPFHNPSETYRFFDLPFCSPDNVKDKPEALGEVLNGDR  88

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  + +S+VVC KKLSK +V +FR AV +DYYFQMYYDDLP+WG+IGKV+K
Sbjct  89   LVSAPYKLNFKEEHDSKVVCSKKLSKEEVARFRAAVKKDYYFQMYYDDLPIWGFIGKVEK  148

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK DPSEYKY+L+KH+ F+I YNKD+++EI AR DP ++VD+T DK++DV+FMY+VKWK
Sbjct  149  EGKGDPSEYKYFLYKHIQFDILYNKDRVIEISARMDPHSVVDLTEDKDVDVEFMYTVKWK  208

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRM+K+S  S+LP HLEIHWF
Sbjct  209  ETETPFEKRMDKYSHSSSLPHHLEIHWF  236



>ref|XP_008220963.1| PREDICTED: putative phagocytic receptor 1b [Prunus mume]
Length=591

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 179/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRY  GD V LYANKVGPFHNPSETY Y DLPFCS  +V++K EALGEVLNGDR
Sbjct  22   RSDASDHRYNDGDAVPLYANKVGPFHNPSETYRYFDLPFCSAGDVKEKREALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K++EV C++KL+K +V +FR AV +DYYFQMYYDDLP+WG++GKVDK
Sbjct  82   LVSAPYKLEFRKEKDTEVACRRKLTKEEVAQFRTAVKKDYYFQMYYDDLPIWGFLGKVDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKY+L+KH+ FE+ YNKD+++EI A+ DP ++VD+T DK++D DFMY+VKW+
Sbjct  142  EGKTDPSEYKYFLYKHIQFEVMYNKDRVIEIGAKMDPHSVVDLTEDKDVDADFMYTVKWR  201

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ETN PFE RM+K+SQ S+LP HLEIHWF
Sbjct  202  ETNIPFENRMDKYSQSSSLPHHLEIHWF  229



>ref|XP_007152616.1| hypothetical protein PHAVU_004G145000g [Phaseolus vulgaris]
 gb|ESW24610.1| hypothetical protein PHAVU_004G145000g [Phaseolus vulgaris]
Length=594

 Score =   323 bits (828),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 148/208 (71%), Positives = 178/208 (86%), Gaps = 1/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD+SDHRYKQGD V LYANKVGPFHNPSETY Y DLPFC P ++++K EALGEVLNGDR
Sbjct  26   RSDSSDHRYKQGDIVPLYANKVGPFHNPSETYRYFDLPFCPPVDLKEKKEALGEVLNGDR  85

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y L+F  DKES  VC  KLSK DV +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  86   LVSAPYVLEFQRDKESVHVCDAKLSKKDVARFRSAVRKDYYFQMYYDDLPIWGFIGKVDK  145

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK DPSEY+Y+L+KH+HF++FYNKD+++EI  R DP+A+VD+T D E++ +F Y+VKWK
Sbjct  146  EGK-DPSEYRYFLYKHIHFDVFYNKDRVIEINVRTDPNALVDLTEDAEVNAEFQYTVKWK  204

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ETNTPFEKRM+K+SQ S+LP HLEIHWF
Sbjct  205  ETNTPFEKRMDKYSQSSSLPHHLEIHWF  232



>ref|XP_007225615.1| hypothetical protein PRUPE_ppa003229mg [Prunus persica]
 gb|EMJ26814.1| hypothetical protein PRUPE_ppa003229mg [Prunus persica]
Length=591

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 179/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRY  GD V LYANKVGPFHNPSETY Y DLPFCS  +V++K EALGEVLNGDR
Sbjct  22   RSDASDHRYNDGDAVPLYANKVGPFHNPSETYRYFDLPFCSAGDVKEKREALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K++EV C++KL+K +V +FR AV +DYYFQMYYDDLP+WG++GKVDK
Sbjct  82   LVSAPYKLEFRKEKDTEVACRRKLTKEEVAQFRTAVKKDYYFQMYYDDLPIWGFLGKVDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKY+L+KH+ FE+ YNKD+++EI A+ DP ++VD+T DK++D DFMY+VKW+
Sbjct  142  EGKTDPSEYKYFLYKHIQFEVMYNKDRVIEIGAKMDPHSVVDLTEDKDVDADFMYTVKWR  201

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ETN PFE RM+K+SQ S+LP HLEIHWF
Sbjct  202  ETNIPFENRMDKYSQSSSLPHHLEIHWF  229



>ref|XP_006431398.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
 gb|ESR44638.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
Length=545

 Score =   322 bits (824),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 181/209 (87%), Gaps = 1/209 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSP-ANVEKKSEALGEVLNGD  392
            RSD+SDHR+K GD V LYANKVGPFHNPSETY Y DLPFCSP A +++K EALGEVLNGD
Sbjct  23   RSDSSDHRFKVGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDAIIKEKREALGEVLNGD  82

Query  393  RLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVD  572
            RLV + YKL+F  +K+S + C+KKLS+ DV +FR AV +D+YFQMYYDDLP+WG+IGKVD
Sbjct  83   RLVSAPYKLNFRDEKDSALACRKKLSEQDVAQFRSAVEKDFYFQMYYDDLPIWGFIGKVD  142

Query  573  KEGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKW  752
            KEGK+ PSEYKY+L+KH+ F+I YNKD+++EI AR DP ++VD+T DKE+DV+FMYSVKW
Sbjct  143  KEGKTHPSEYKYFLYKHIQFDILYNKDRVIEISARMDPHSLVDLTEDKEVDVEFMYSVKW  202

Query  753  KETNTPFEKRMEKFSQISALPQHLEIHWF  839
            KET+TPFEKRMEK+S  S+LP HLEIHWF
Sbjct  203  KETDTPFEKRMEKYSLSSSLPHHLEIHWF  231



>gb|KHN24548.1| Putative phagocytic receptor 1b [Glycine soja]
Length=586

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 178/208 (86%), Gaps = 1/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P ++++K EALGEVLNGDR
Sbjct  18   RSDPSDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCEPGDLKEKKEALGEVLNGDR  77

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  DKE   VC +KLSK DV +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  78   LVSAPYKLEFQRDKELVSVCDRKLSKQDVARFRSAVRKDYYFQMYYDDLPIWGFIGKVDK  137

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK DPS+Y+Y+L+KH+HF++FYNKD+++EI  R DP+A+VD+T D E+  +F+Y+VKWK
Sbjct  138  EGK-DPSDYRYFLYKHIHFDVFYNKDRVIEINVRTDPNALVDLTEDAEVQAEFLYTVKWK  196

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ETNTPFEKRM+K+SQ S+LP HLEIHWF
Sbjct  197  ETNTPFEKRMDKYSQSSSLPHHLEIHWF  224



>ref|XP_003548324.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=587

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 178/208 (86%), Gaps = 1/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P ++++K EALGEVLNGDR
Sbjct  19   RSDPSDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCEPGDLKEKKEALGEVLNGDR  78

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  DKE   VC +KLSK DV +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  79   LVSAPYKLEFQRDKELVSVCDRKLSKQDVARFRSAVRKDYYFQMYYDDLPIWGFIGKVDK  138

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK DPS+Y+Y+L+KH+HF++FYNKD+++EI  R DP+A+VD+T D E+  +F+Y+VKWK
Sbjct  139  EGK-DPSDYRYFLYKHIHFDVFYNKDRVIEINVRTDPNALVDLTEDAEVQAEFLYTVKWK  197

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ETNTPFEKRM+K+SQ S+LP HLEIHWF
Sbjct  198  ETNTPFEKRMDKYSQSSSLPHHLEIHWF  225



>emb|CDY47549.1| BnaA08g07380D [Brassica napus]
Length=592

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            +SD SDHRYK GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDR
Sbjct  23   KSDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL +K S V C+K+LS+ DV +FR  ++ DYYFQMYYDDLP+WG++GKV K
Sbjct  83   LVTAPYKLEFLGEKNSHVACRKRLSREDVAQFRDVISRDYYFQMYYDDLPIWGFLGKVVK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            +GKSDPSEYKYYLF HL FEIFYNKD+++EII R D S +VD+T DKE++VDF Y+V+WK
Sbjct  143  DGKSDPSEYKYYLFNHLQFEIFYNKDRVIEIIVRTDQSFLVDLTEDKEVEVDFTYTVRWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET  PFEKRMEK+S  S+ P HLEIHWF
Sbjct  203  ETEIPFEKRMEKYSLASSTPHHLEIHWF  230



>ref|XP_006448061.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
 ref|XP_006492286.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Citrus 
sinensis]
 ref|XP_006492287.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Citrus 
sinensis]
 gb|ESR61301.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
Length=593

 Score =   323 bits (827),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 150/209 (72%), Positives = 179/209 (86%), Gaps = 1/209 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEK-KSEALGEVLNGD  392
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFCSP  + K K EALGEVLNGD
Sbjct  23   RSDASDHRYKVGDVVPLYANKVGPFHNPSETYRYFDLPFCSPDGIIKEKREALGEVLNGD  82

Query  393  RLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVD  572
            RLV + YKL+F  +K+S V C+KKLS+ DV +FR AV +D+YFQMYYDDLP+WG+IGKVD
Sbjct  83   RLVSAPYKLNFRDEKDSAVACRKKLSEQDVAQFRSAVEKDFYFQMYYDDLPIWGFIGKVD  142

Query  573  KEGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKW  752
            KEGK+ P+EYKY+L+KH+ F+I YNKD+++EI AR DP ++VD+T DKE+DV+FMYSVKW
Sbjct  143  KEGKTHPNEYKYFLYKHIQFDILYNKDRVIEISARMDPHSLVDLTEDKEVDVEFMYSVKW  202

Query  753  KETNTPFEKRMEKFSQISALPQHLEIHWF  839
            KET+TPFEKRMEK+S  S+LP HLEIHWF
Sbjct  203  KETDTPFEKRMEKYSLSSSLPHHLEIHWF  231



>ref|XP_010917284.1| PREDICTED: transmembrane 9 superfamily member 2-like [Elaeis 
guineensis]
Length=596

 Score =   322 bits (826),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 153/234 (65%), Positives = 194/234 (83%), Gaps = 0/234 (0%)
 Frame = +3

Query  138  MDRRRAMRHYavvlavlllgtatevvRSDASDHRYKQGDEVHLYANKVGPFHNPSETYMY  317
            M R++AM   AV++AV LL      V +DASDHRYK G+ V LYANKVGPFHNPSETY Y
Sbjct  1    MGRKKAMVLVAVLVAVFLLCFGIAGVAADASDHRYKAGEPVPLYANKVGPFHNPSETYRY  60

Query  318  HDLPFCSPANVEKKSEALGEVLNGDRLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRH  497
             DLPFCSP +V++KSEALGEVLNGDRLV + YKLDF  D +S+VVC KKL   +V +FR 
Sbjct  61   FDLPFCSPEHVKEKSEALGEVLNGDRLVDAPYKLDFRVDLDSKVVCTKKLKSEEVAQFRS  120

Query  498  AVAEDYYFQMYYDDLPVWGYIGKVDKEGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIAR  677
            AV +DYYFQMYYDDLP+WG+IGKVD+EGK+D +EYKYYL++H+HF++ YN D+++EI A 
Sbjct  121  AVLKDYYFQMYYDDLPIWGFIGKVDREGKTDENEYKYYLYRHIHFDVLYNGDRVIEINAH  180

Query  678  ADPSAMVDITMDKELDVDFMYSVKWKETNTPFEKRMEKFSQISALPQHLEIHWF  839
             DP+A+VD+T D+E++V+F+YSVKW+ET+TPFE RM+K+SQ S+LP HLEIHWF
Sbjct  181  TDPNALVDVTKDREIEVEFLYSVKWRETSTPFENRMDKYSQTSSLPHHLEIHWF  234



>ref|XP_010440842.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Camelina 
sativa]
Length=386

 Score =   315 bits (808),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 173/207 (84%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  19   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  78

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL  K S V C+K+LS+ DV KFR  + +DYYFQMYYDDLP+WG++GKV K+
Sbjct  79   VSAPYKLEFLNFKISVVACRKRLSREDVAKFRDVILKDYYFQMYYDDLPIWGFLGKVVKD  138

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GK+DPSEYKYYLF HL FEIFYN+D+++E+I R D + +VD+T DKE++VDF Y+V+WKE
Sbjct  139  GKTDPSEYKYYLFNHLQFEIFYNQDRVIEVIVRTDQNFLVDLTEDKEVEVDFTYTVRWKE  198

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T  PFEKRMEK+S  S++P HLEIHWF
Sbjct  199  TEIPFEKRMEKYSLASSMPHHLEIHWF  225



>ref|XP_010445554.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=400

 Score =   316 bits (809),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 173/207 (84%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  19   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  78

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL  K S V C+K+LS+ DV KFR  + +DYYFQMYYDDLP+WG++GKV K+
Sbjct  79   VSAPYKLEFLNFKISVVACRKRLSREDVAKFRDVILKDYYFQMYYDDLPIWGFLGKVVKD  138

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GK+DPSEYKYYLF HL FEIFYN+D+++E+I R D + +VD+T DKE++VDF Y+V+WKE
Sbjct  139  GKTDPSEYKYYLFNHLQFEIFYNQDRVIEVIVRTDQNFLVDLTEDKEVEVDFTYTVRWKE  198

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T  PFEKRMEK+S  S++P HLEIHWF
Sbjct  199  TEIPFEKRMEKYSLASSMPHHLEIHWF  225



>ref|XP_009387842.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=597

 Score =   322 bits (825),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 147/208 (71%), Positives = 175/208 (84%), Gaps = 1/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDAS+HRYK GD V LY NKVGPFHNPSETY Y DLPFC+P +V +K EALGEVLNGDR
Sbjct  29   RSDASNHRYKTGDHVPLYVNKVGPFHNPSETYRYFDLPFCTPEHVTEKKEALGEVLNGDR  88

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF  D+ESEV+CKKKL K DV KFR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  89   LVDAPYKLDFRVDRESEVLCKKKLKKEDVAKFRSAVTKDYYFQMYYDDLPLWGFIGKVDK  148

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK D  EYKYYL+K  HF++ YN D+++EII   DP+ ++D+T D++ +V+F+YSVKWK
Sbjct  149  EGK-DLGEYKYYLYKRFHFDVLYNNDRVIEIIVHTDPNTLLDVTEDRDTEVEFLYSVKWK  207

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+TPFEKRMEK+SQ S+LP HLEIHWF
Sbjct  208  ETSTPFEKRMEKYSQTSSLPHHLEIHWF  235



>ref|XP_006431397.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
 gb|ESR44637.1| hypothetical protein CICLE_v10000657mg [Citrus clementina]
Length=593

 Score =   322 bits (824),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 148/209 (71%), Positives = 181/209 (87%), Gaps = 1/209 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSP-ANVEKKSEALGEVLNGD  392
            RSD+SDHR+K GD V LYANKVGPFHNPSETY Y DLPFCSP A +++K EALGEVLNGD
Sbjct  23   RSDSSDHRFKVGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDAIIKEKREALGEVLNGD  82

Query  393  RLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVD  572
            RLV + YKL+F  +K+S + C+KKLS+ DV +FR AV +D+YFQMYYDDLP+WG+IGKVD
Sbjct  83   RLVSAPYKLNFRDEKDSALACRKKLSEQDVAQFRSAVEKDFYFQMYYDDLPIWGFIGKVD  142

Query  573  KEGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKW  752
            KEGK+ PSEYKY+L+KH+ F+I YNKD+++EI AR DP ++VD+T DKE+DV+FMYSVKW
Sbjct  143  KEGKTHPSEYKYFLYKHIQFDILYNKDRVIEISARMDPHSLVDLTEDKEVDVEFMYSVKW  202

Query  753  KETNTPFEKRMEKFSQISALPQHLEIHWF  839
            KET+TPFEKRMEK+S  S+LP HLEIHWF
Sbjct  203  KETDTPFEKRMEKYSLSSSLPHHLEIHWF  231



>ref|XP_010105529.1| Putative phagocytic receptor 1b [Morus notabilis]
 gb|EXC05024.1| Putative phagocytic receptor 1b [Morus notabilis]
Length=591

 Score =   321 bits (822),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 176/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK G+ V LYANKVGPFHNPSETY Y DLPFCS  +V++K EALGEVLNGDR
Sbjct  22   RSDDSDHRYKDGNPVPLYANKVGPFHNPSETYRYFDLPFCSGGDVKEKKEALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +KESEV C  KL + DV KFR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  82   LVSAPYKLEFKKEKESEVACTTKLKREDVAKFRDAVKKDYYFQMYYDDLPIWGFIGKVDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKY+L+KH+HFEI YNKD+++EI A+ DP ++VD+T DK++D DF Y+VKW+
Sbjct  142  EGKADPSEYKYFLYKHIHFEILYNKDRVIEISAKMDPQSVVDLTEDKQVDADFTYTVKWR  201

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+ PFEKRM+K+SQ S+ P HLEIHWF
Sbjct  202  ETDIPFEKRMDKYSQSSSQPHHLEIHWF  229



>ref|XP_006372422.1| endomembrane protein 70 [Populus trichocarpa]
 gb|ERP50219.1| endomembrane protein 70 [Populus trichocarpa]
Length=592

 Score =   321 bits (822),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 149/208 (72%), Positives = 176/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD+V LY NKVGPFHNPSETY Y DLPFCS    + K EALGEVLNGDR
Sbjct  23   RSDASDHRYKVGDDVPLYVNKVGPFHNPSETYRYFDLPFCSSGPTKDKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL DK+SEV CK  L+K  V +FR AV++DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVTAPYKLDFLNDKDSEVACKNTLTKEQVAQFREAVSKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E K+DPSEYKYYLFKHLHF IFYNK +++EI A++D + +VD+T DKE++V+FMYSVKWK
Sbjct  143  ERKNDPSEYKYYLFKHLHFTIFYNKYRVIEISAQSDLNNVVDLTEDKEVNVEFMYSVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+  FEKRM+K+SQ S+LP HLEIHWF
Sbjct  203  ETDITFEKRMDKYSQSSSLPHHLEIHWF  230



>ref|XP_009108077.1| PREDICTED: putative phagocytic receptor 1b [Brassica rapa]
Length=592

 Score =   321 bits (822),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 173/207 (84%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  24   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  83

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL +K S V C+K+LS+ DV +FR  ++ DYYFQMYYDDLP+WG++GKV K+
Sbjct  84   VTAPYKLEFLGEKNSHVACRKRLSREDVAQFRDVISRDYYFQMYYDDLPIWGFLGKVVKD  143

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GKSDPSE+KYYLF HL FEIFYNKD+++EII R D S +VD+T DKE++VDF Y+V+WKE
Sbjct  144  GKSDPSEFKYYLFNHLQFEIFYNKDRVIEIIVRTDQSFLVDLTEDKEVEVDFTYTVRWKE  203

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T  PFEKRMEK+S  S+ P HLEIHWF
Sbjct  204  TEIPFEKRMEKYSLASSTPHHLEIHWF  230



>emb|CDY15803.1| BnaC02g34220D [Brassica napus]
Length=592

 Score =   320 bits (821),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V+ K EA GEVLNGDR
Sbjct  23   RSDASDHRYKEGDSVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKDKKEAFGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL F  +K+SE  CKKKLS+ +VE+FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLSFRDEKDSETYCKKKLSRKEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E KSDPSE+KY+L+KH+ FEI YN D+++EI AR DP ++VD+T DKE+  +FMY+VKWK
Sbjct  143  ESKSDPSEFKYFLYKHIQFEILYNNDRVIEINARMDPHSLVDLTEDKEVVAEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRM+K++  S+LP HLEIHWF
Sbjct  203  ETETPFEKRMDKYAMSSSLPHHLEIHWF  230



>ref|XP_006470811.1| PREDICTED: putative phagocytic receptor 1b-like [Citrus sinensis]
Length=593

 Score =   320 bits (820),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 147/209 (70%), Positives = 181/209 (87%), Gaps = 1/209 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSP-ANVEKKSEALGEVLNGD  392
            RSD+SDHR+K GD V LYANKVGPFHNPSETY Y DLPFCSP A +++K EALGEVLNGD
Sbjct  23   RSDSSDHRFKVGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDAIIKEKREALGEVLNGD  82

Query  393  RLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVD  572
            RLV + YKL+F  +K+S + C+KKLS+ DV +FR AV +D+YFQMYYDDLP+WG+IGKVD
Sbjct  83   RLVSAPYKLNFRDEKDSALACRKKLSEQDVAQFRSAVEKDFYFQMYYDDLPIWGFIGKVD  142

Query  573  KEGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKW  752
            KEGK+ P+EYKY+L+KH+ F+I YNKD+++EI AR DP ++VD+T DKE+DV+FMYSVKW
Sbjct  143  KEGKTHPNEYKYFLYKHIQFDILYNKDRVIEISARMDPHSLVDLTEDKEVDVEFMYSVKW  202

Query  753  KETNTPFEKRMEKFSQISALPQHLEIHWF  839
            KET+TPFEKRMEK+S  S+LP HLEIHWF
Sbjct  203  KETDTPFEKRMEKYSLSSSLPHHLEIHWF  231



>ref|XP_009351612.1| PREDICTED: putative phagocytic receptor 1b [Pyrus x bretschneideri]
Length=592

 Score =   319 bits (818),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 176/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRY +GD V LY+NKVGPFHNPSETY Y DLPFCS  +V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYNEGDAVPLYSNKVGPFHNPSETYRYFDLPFCSAGDVKEKREALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  DK+SEV C+KKL+K +V +FR AV +DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVSAPYKLEFRKDKDSEVACRKKLTKEEVAQFRTAVKKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DP EYKY+L+KH+ F+  YNKD+++EI A+ DP ++VD+T D E+D DFMYSVKW 
Sbjct  143  EGKTDPREYKYFLYKHIQFDAQYNKDRVIEITAKMDPHSVVDLTEDNEVDADFMYSVKWS  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            +TN PFE RM+K+SQ S+LP HLEIHWF
Sbjct  203  DTNIPFENRMDKYSQSSSLPHHLEIHWF  230



>ref|XP_003620064.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
 gb|AES76282.1| transmembrane 9 family protein [Medicago truncatula]
Length=588

 Score =   319 bits (818),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 179/208 (86%), Gaps = 1/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD+SD RYK+GD V L+ANKVGPFHNPSETY Y DLPFC P ++++K EALGEVLNGDR
Sbjct  20   RSDSSDKRYKEGDLVPLFANKVGPFHNPSETYRYFDLPFCIPDHLKEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  DK+S  VCKK L+K +V  FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  80   LVSAPYQLEFQKDKDSLSVCKKTLTKEEVANFRSAVRKDYYFQMYYDDLPIWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK DPS+Y+YYL+KH+HF+IFYNKD+++EI  R DP+A+VD+T D E+DV+F Y+VKWK
Sbjct  140  EGK-DPSDYRYYLYKHIHFDIFYNKDRVIEINVRTDPNALVDVTEDNEVDVEFFYTVKWK  198

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ETNTPFEKRM+K+SQ S+LP HLEIHWF
Sbjct  199  ETNTPFEKRMDKYSQPSSLPHHLEIHWF  226



>ref|XP_012072398.1| PREDICTED: transmembrane 9 superfamily member 2-like [Jatropha 
curcas]
 gb|KDP38192.1| hypothetical protein JCGZ_04835 [Jatropha curcas]
Length=591

 Score =   319 bits (817),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P ++++K EALGEVLNGDR
Sbjct  22   RSDGSDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDHLKEKKEALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K S VVC+KKL++ DV +FR A+ +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  82   LVSAPYKLNFRDEKVSAVVCQKKLTQEDVARFRSAIGKDYYFQMYYDDLPIWGFIGKVDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKY L+KH+ F++ YNKD+++E+  R DP +++D+T DKE+D +F+Y+VKWK
Sbjct  142  EGKADPSEYKYLLYKHIQFDVLYNKDRVIEVSVRMDPHSLLDLTEDKEVDAEFLYTVKWK  201

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+TPFEKRM+K+S  S+LP HLEIHWF
Sbjct  202  ETDTPFEKRMDKYSMSSSLPHHLEIHWF  229



>ref|XP_004299493.1| PREDICTED: transmembrane 9 superfamily member 3-like [Fragaria 
vesca subsp. vesca]
Length=599

 Score =   319 bits (817),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 148/207 (71%), Positives = 178/207 (86%), Gaps = 1/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDAS+HRYK+GD V LYANKVGPFHNPSETY Y DLPFCSP  V++K EALGEVLNGDRL
Sbjct  32   SDASNHRYKEGDVVPLYANKVGPFHNPSETYRYFDLPFCSPDAVKEKKEALGEVLNGDRL  91

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL  K+SE VCKK L+K +V KFR AV +DYYFQMYYDDLP+WG+IGKVDKE
Sbjct  92   VSAPYKLEFLKHKDSEQVCKKSLTKEEVAKFRSAVNKDYYFQMYYDDLPIWGFIGKVDKE  151

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             K DPSEYK YL+KH+HF+I YNKD+++EI  + DP A+VD+T DKE+DV+F+Y+VKW+E
Sbjct  152  NK-DPSEYKTYLYKHIHFDILYNKDRVIEINVQTDPHALVDLTEDKEVDVEFLYTVKWRE  210

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            TNTPF+KRM+K+S  S+LP HLEIHWF
Sbjct  211  TNTPFDKRMDKYSHSSSLPHHLEIHWF  237



>ref|XP_008340538.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=592

 Score =   319 bits (817),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRY +GD V LYANKVGPFHNPSETY Y DLPFCS  +V++K EALGEVLNGDR
Sbjct  23   RSDASDHRYNEGDAVPLYANKVGPFHNPSETYRYFDLPFCSAGDVKEKREALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  DK+SEV C++KL+K +V +FR AV +DYYFQMYYDDLP+WG++GKVDK
Sbjct  83   LVSAPYKLEFRKDKDSEVACRRKLTKEEVAQFRTAVKKDYYFQMYYDDLPIWGFLGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DP EYKY+L+KH+ F+  YNKD+++EI A+ DP ++VD+T DK++D DFMYSV+W 
Sbjct  143  EGKTDPREYKYFLYKHIQFDARYNKDRVIEITAKMDPHSVVDLTEDKDVDADFMYSVRWS  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            +TN PFE RM+K+SQ S+LP HLEIHWF
Sbjct  203  DTNIPFENRMDKYSQSSSLPHHLEIHWF  230



>ref|XP_008791844.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=596

 Score =   319 bits (817),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 177/207 (86%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +DASDHRYK G+ V LYANKVGPFHNPSETY Y DLPFC P +V++KSEALGEVLNGDRL
Sbjct  28   ADASDHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCIPEHVKEKSEALGEVLNGDRL  87

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +S+VVC KKL   DV +FR AV +DYYFQMYYDDLP+WG+IGKVD+E
Sbjct  88   VDAPYKLDFRVDLDSKVVCPKKLKGEDVAQFRSAVLKDYYFQMYYDDLPIWGFIGKVDRE  147

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GK+D +EYKYYL++H+HFE+ YN D+++EI A  +P+A+ D+T D+E++V+F+YSVKWKE
Sbjct  148  GKTDENEYKYYLYRHIHFEVLYNSDRVIEINAHTNPNALADVTKDREIEVEFLYSVKWKE  207

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T+TPFE RM+K+SQ S+LP HLEIHWF
Sbjct  208  TSTPFENRMDKYSQTSSLPHHLEIHWF  234



>ref|XP_004504610.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=592

 Score =   318 bits (816),  Expect = 7e-101, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRY  GD V LYANKVGPFHNPSETY Y DLPFC   + ++K+EALGEVLNGDR
Sbjct  23   RSDASDHRYGDGDPVPLYANKVGPFHNPSETYRYLDLPFCVTGHEKEKTEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L F  +K+S VVCKKKL++ +V +FR AV +DYYFQMYYDDLP+WG+IG VDK
Sbjct  83   LVSAPYELHFRKEKDSNVVCKKKLTREEVNQFREAVKKDYYFQMYYDDLPIWGFIGTVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKY+L+KH+ F++ YNKD+++E+ AR DP ++VD+T DKE+DV+FMY+VKWK
Sbjct  143  EGKTDPSEYKYFLYKHIQFDVLYNKDRVIEVSARMDPHSVVDLTEDKEIDVEFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+ PFEKRM+K+SQ S+LP HLEIHWF
Sbjct  203  ETDIPFEKRMDKYSQSSSLPHHLEIHWF  230



>ref|XP_006283389.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 ref|XP_006283390.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 gb|EOA16287.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
 gb|EOA16288.1| hypothetical protein CARUB_v10004434mg [Capsella rubella]
Length=590

 Score =   318 bits (815),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 173/207 (84%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRY  GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  22   SDGSDHRYMVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  81

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL+ K S V C+K+LS+ DV KFR  + +DYYFQMYYDDLP+WG++GKV K+
Sbjct  82   VSAPYKLEFLSYKISVVACRKRLSREDVAKFRDVILKDYYFQMYYDDLPIWGFLGKVVKD  141

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GK+DPSEYKYYLF HL FEIFYNKD+++EII R D + +VD+T DKE++VDF YSV+WKE
Sbjct  142  GKTDPSEYKYYLFNHLQFEIFYNKDRVIEIIVRTDQNILVDLTEDKEVEVDFTYSVRWKE  201

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T  PFEKRMEK+S  S++P HLEIHWF
Sbjct  202  TEIPFEKRMEKYSLASSMPHHLEIHWF  228



>ref|XP_008789222.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789223.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789224.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789225.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008789226.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=595

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 179/207 (86%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +DASDHRYK G+ V LYANKVGPFHNPSETY Y DLPFCSP  +++KSEALGEVLNGDRL
Sbjct  27   ADASDHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCSPEPMKEKSEALGEVLNGDRL  86

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +S+V CKKKL+K +V +FR AV +DYYFQMYYDDLP+WG+IGKVD+E
Sbjct  87   VDAPYKLDFRVDLDSKVACKKKLTKEEVAQFRSAVLKDYYFQMYYDDLPIWGFIGKVDRE  146

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GK+D +E+KYYL++H+HF+I YN D+++EI A  DP+A+VD+T D +++V+F+YSVKWKE
Sbjct  147  GKTDENEFKYYLYRHIHFDILYNGDRVIEINAHTDPNALVDVTEDMDIEVEFLYSVKWKE  206

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T+TPFE RM+K+SQ S+LP HLEIHWF
Sbjct  207  TSTPFENRMDKYSQSSSLPHHLEIHWF  233



>ref|XP_003524839.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
 gb|KHN25962.1| Putative phagocytic receptor 1b [Glycine soja]
Length=601

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 143/208 (69%), Positives = 178/208 (86%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFC   + ++K+EALGEVLNGDR
Sbjct  32   RSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFCVTGHEKEKTEALGEVLNGDR  91

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L F  +K+S+VVCK+KL+K  V +FR AV +DYYFQMYYDDLP+WG+IG +DK
Sbjct  92   LVSAPYELSFKKEKDSKVVCKRKLTKEQVAQFREAVKKDYYFQMYYDDLPIWGFIGTIDK  151

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKY+L+KH+ F+I YNKD+++EI AR DP ++VD+T DK++DV+FMY+ KWK
Sbjct  152  EGKTDPSEYKYFLYKHIQFDILYNKDRVIEISARMDPHSVVDLTEDKDVDVEFMYTAKWK  211

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+T FEKRM+K+SQ S+LP HLEIHWF
Sbjct  212  ETDTSFEKRMDKYSQSSSLPHHLEIHWF  239



>emb|CDP01681.1| unnamed protein product [Coffea canephora]
Length=595

 Score =   318 bits (815),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 148/211 (70%), Positives = 181/211 (86%), Gaps = 3/211 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            +SDASDH YK  D+V LYANKVGPF NPSETY + DLPFCSPA+V++K EALGEVLNGDR
Sbjct  23   KSDASDHTYKPKDQVPLYANKVGPFQNPSETYRFFDLPFCSPAHVKEKREALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL DK+SE+VCKK+L+K DV +FR AVA+DYYF+MYYDDLPVWG++G+V+K
Sbjct  83   LVSAPYKLEFLVDKDSELVCKKQLTKDDVAQFRKAVAKDYYFEMYYDDLPVWGFLGRVEK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARA---DPSAMVDITMDKELDVDFMYSV  746
            +GKSDP E+KYYLFKHLHF+I YNKD ++EI AR    DP++ VDIT DK +DVDF YSV
Sbjct  143  DGKSDPGEHKYYLFKHLHFDISYNKDHVIEIGARTERNDPNSQVDITEDKGVDVDFTYSV  202

Query  747  KWKETNTPFEKRMEKFSQISALPQHLEIHWF  839
            KW++T+ PFEKRM+K+S  S+LP HLEIHWF
Sbjct  203  KWRDTDIPFEKRMDKYSHSSSLPHHLEIHWF  233



>ref|XP_002285238.1| PREDICTED: transmembrane 9 superfamily member 2 [Vitis vinifera]
 emb|CBI26762.3| unnamed protein product [Vitis vinifera]
Length=591

 Score =   318 bits (814),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 152/208 (73%), Positives = 183/208 (88%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDAS HRYK G+ V LYANKVGPFHNPSETY Y DLPFC PA++++K EALGEVLNGDR
Sbjct  22   RSDASSHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCVPAHLKEKKEALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDFL +K+SEVVCKKKL K +V +FR AVA+DYYFQMYYDDLP+WG+IGKVDK
Sbjct  82   LVSAPYKLDFLREKDSEVVCKKKLKKEEVAQFRAAVAKDYYFQMYYDDLPIWGFIGKVDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKY+L+KH+ F+I YNKD+++EI AR DP +MVD+T DK++DV+FMY+VKW 
Sbjct  142  EGKADPSEYKYFLYKHIQFDIRYNKDRVIEINARTDPHSMVDVTDDKDVDVEFMYTVKWT  201

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+ PFEKRMEK+SQ S++P HLEIHWF
Sbjct  202  ETDAPFEKRMEKYSQTSSMPHHLEIHWF  229



>ref|XP_010440841.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Camelina 
sativa]
Length=587

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 173/207 (84%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  19   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  78

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL  K S V C+K+LS+ DV KFR  + +DYYFQMYYDDLP+WG++GKV K+
Sbjct  79   VSAPYKLEFLNFKISVVACRKRLSREDVAKFRDVILKDYYFQMYYDDLPIWGFLGKVVKD  138

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GK+DPSEYKYYLF HL FEIFYN+D+++EII R D + +VD+T DKE++VDF Y+V+WKE
Sbjct  139  GKTDPSEYKYYLFNHLQFEIFYNQDRVIEIIVRTDQNFLVDLTEDKEVEVDFTYTVRWKE  198

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T  PFEKRMEK+S  S++P HLEIHWF
Sbjct  199  TEIPFEKRMEKYSLASSMPHHLEIHWF  225



>ref|XP_010932502.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
 ref|XP_010932503.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=597

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 176/207 (85%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +DASDHRYK G+ V LYANKVGPFHNPSETY Y DLPFC P ++++KSEALGEVLNGDRL
Sbjct  29   ADASDHRYKAGEAVPLYANKVGPFHNPSETYRYFDLPFCPPEHMKEKSEALGEVLNGDRL  88

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +S+ VCKKKL+  +V +FR AV +DYYFQMYYDDLP+WG+IGKVD+E
Sbjct  89   VDAPYKLDFRVDLDSKAVCKKKLTIEEVAQFRSAVLKDYYFQMYYDDLPIWGFIGKVDRE  148

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GK+D  EYKYYL++H+HF+I YN D+++EI    DP+A+ D+T DKE++V+F+YSVKWKE
Sbjct  149  GKTDEDEYKYYLYRHIHFDILYNGDRVIEINVHTDPNALADVTTDKEIEVEFLYSVKWKE  208

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T+TPFE RMEK+SQ S+LP HLEIHWF
Sbjct  209  TSTPFENRMEKYSQSSSLPHHLEIHWF  235



>ref|XP_003531127.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=604

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFC   + + K+EALGEVLNGDR
Sbjct  35   RSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFCVTGHEKDKTEALGEVLNGDR  94

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L F  +K+S+VVCK+KL+K  V +FR AV +DYYFQMYYDDLP+WG+IG VDK
Sbjct  95   LVSAPYELSFKKEKDSKVVCKRKLTKEQVAQFREAVKKDYYFQMYYDDLPIWGFIGTVDK  154

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKY+L+KH+ F+I YNKD+++EI AR DP ++VD+T DK++DV+F+Y+ KWK
Sbjct  155  EGKTDPSEYKYFLYKHIQFDIHYNKDRVIEISARMDPHSVVDLTEDKDVDVEFVYTAKWK  214

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRM+K+SQ S+LP HLEIHWF
Sbjct  215  ETETPFEKRMDKYSQSSSLPHHLEIHWF  242



>ref|XP_006854108.2| PREDICTED: transmembrane 9 superfamily member 2 [Amborella trichopoda]
 ref|XP_011626941.1| PREDICTED: transmembrane 9 superfamily member 2 [Amborella trichopoda]
Length=592

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 178/207 (86%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDH+YKQGD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K E LGEVLNGDRL
Sbjct  24   ADGSDHKYKQGDRVPLYANKVGPFHNPSETYRYYDLPFCSPEHVTEKREDLGEVLNGDRL  83

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L F  ++ESEV+CKKKLSK  V + R AV +DYYFQMYYDDLP+WG+IGKVDK+
Sbjct  84   VDAPYQLQFRLERESEVLCKKKLSKDKVAQLRDAVNKDYYFQMYYDDLPIWGFIGKVDKD  143

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             K+DPSEY+Y LFKH+HFEI YNKD+++EI  + DP+  VDIT DKE++V+F+YSVKWKE
Sbjct  144  NKADPSEYRYLLFKHIHFEISYNKDRVIEINVKTDPNFSVDITEDKEVEVEFLYSVKWKE  203

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T+TPFEKRM+K+S+ S++PQHLEIHWF
Sbjct  204  TDTPFEKRMDKYSKSSSMPQHLEIHWF  230



>gb|KHN28892.1| Putative phagocytic receptor 1b [Glycine soja]
Length=604

 Score =   318 bits (814),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/208 (69%), Positives = 177/208 (85%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFC   + + K+EALGEVLNGDR
Sbjct  35   RSDASDHRYKDGDSVPLYANKVGPFHNPSETYRYFDLPFCVTGHEKDKTEALGEVLNGDR  94

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L F  +K+S+VVCK+KL+K  V +FR AV +DYYFQMYYDDLP+WG+IG VDK
Sbjct  95   LVSAPYELSFKKEKDSKVVCKRKLTKEQVAQFREAVKKDYYFQMYYDDLPIWGFIGTVDK  154

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKY+L+KH+ F+I YNKD+++EI AR DP ++VD+T DK++DV+F+Y+ KWK
Sbjct  155  EGKTDPSEYKYFLYKHIQFDIHYNKDRVIEISARMDPHSVVDLTEDKDVDVEFVYTAKWK  214

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRM+K+SQ S+LP HLEIHWF
Sbjct  215  ETETPFEKRMDKYSQSSSLPHHLEIHWF  242



>ref|XP_010450487.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=593

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 173/207 (84%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  25   SDGSDHRYKVGDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  84

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL  K S V C+K+LS+ DV KFR  + +DYYFQMYYDDLP+WG++GKV K+
Sbjct  85   VSAPYKLEFLNFKISVVACRKRLSREDVAKFRDVILKDYYFQMYYDDLPIWGFLGKVVKD  144

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GK+DPSEYKYYLF HL FEIFYN+D+++EII R D + +VD+T DKE++VDF Y+V+WKE
Sbjct  145  GKTDPSEYKYYLFNHLQFEIFYNQDRVIEIIVRTDQNFLVDLTEDKEVEVDFTYTVRWKE  204

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T  PFEKRMEK+S  S++P HLEIHWF
Sbjct  205  TEIPFEKRMEKYSLASSMPHHLEIHWF  231



>dbj|BAJ89640.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT32275.1| Putative phagocytic receptor 1b [Aegilops tauschii]
Length=593

 Score =   317 bits (813),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 174/207 (84%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK GD V LYANKVGPFHNPSETY Y DLPFCSP  V++KSEALGEVLNGDRL
Sbjct  25   SDGSDHRYKLGDPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVKEKSEALGEVLNGDRL  84

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +S+ VC KKL+K DV KFR+AVA+DYYFQMYYDDLP+WG+IGKV+K 
Sbjct  85   VDAPYKLDFRTDHDSKAVCPKKLTKEDVAKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKG  144

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GK DPSE+KYYL++H+ F+I YN D+++EI    D SA+VD+T DKE++VDF+Y+VKWKE
Sbjct  145  GKPDPSEWKYYLYRHIIFDILYNNDRVIEINVHTDQSALVDLTEDKEVNVDFLYTVKWKE  204

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T TPFEKRMEK+S  S +P HLE+HWF
Sbjct  205  TPTPFEKRMEKYSSSSNMPHHLEVHWF  231



>ref|XP_012072397.1| PREDICTED: transmembrane 9 superfamily member 2 [Jatropha curcas]
 gb|KDP38191.1| hypothetical protein JCGZ_04834 [Jatropha curcas]
Length=591

 Score =   317 bits (811),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 181/208 (87%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFC P ++++K+EALGEVLNGDR
Sbjct  22   RSDASDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDHLKEKTEALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K++ VVC+KKL+K +V KFR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  82   LVSAPYKLNFRDEKDTAVVCRKKLTKEEVAKFRSAVDKDYYFQMYYDDLPIWGFIGKVDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPS+YKY+L+KH+ ++I YNKD+++E+  R DP +++D++ DKE+D +F+Y+VKWK
Sbjct  142  EGKADPSDYKYFLYKHIQYDILYNKDRVIEVSNRMDPHSLLDLSEDKEVDAEFLYTVKWK  201

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+TPFEKRM+K+S  S+LP HLEIHWF
Sbjct  202  ETDTPFEKRMDKYSLSSSLPHHLEIHWF  229



>ref|XP_008375035.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=611

 Score =   317 bits (812),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 145/208 (70%), Positives = 177/208 (85%), Gaps = 1/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DLPFCS   V++K EALGEVLNGDR
Sbjct  43   RSDGSDHRYKEGDFVPLYANKVGPFHNPSETYRYFDLPFCSRDAVKEKREALGEVLNGDR  102

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL  K++EV CKK L+K +V +FR AV +DYYFQMYYDDLP WG+IGKVDK
Sbjct  103  LVSAPYKLEFLRHKDTEVACKKXLTKEEVARFRSAVNKDYYFQMYYDDLPXWGFIGKVDK  162

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK DPSEYK YL+ H+HF+++YNKD+++E+  R DP+A+VD+T D E+DV+FMY+V+WK
Sbjct  163  EGK-DPSEYKTYLYXHIHFDLYYNKDRVIEVNVRTDPNALVDLTXDXEVDVEFMYTVEWK  221

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPF+KRM+K+SQ S+LP HLEIHWF
Sbjct  222  ETTTPFDKRMDKYSQSSSLPHHLEIHWF  249



>gb|ERN15575.1| hypothetical protein AMTR_s00048p00146310 [Amborella trichopoda]
Length=631

 Score =   317 bits (812),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 145/207 (70%), Positives = 178/207 (86%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDH+YKQGD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K E LGEVLNGDRL
Sbjct  63   ADGSDHKYKQGDRVPLYANKVGPFHNPSETYRYYDLPFCSPEHVTEKREDLGEVLNGDRL  122

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L F  ++ESEV+CKKKLSK  V + R AV +DYYFQMYYDDLP+WG+IGKVDK+
Sbjct  123  VDAPYQLQFRLERESEVLCKKKLSKDKVAQLRDAVNKDYYFQMYYDDLPIWGFIGKVDKD  182

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             K+DPSEY+Y LFKH+HFEI YNKD+++EI  + DP+  VDIT DKE++V+F+YSVKWKE
Sbjct  183  NKADPSEYRYLLFKHIHFEISYNKDRVIEINVKTDPNFSVDITEDKEVEVEFLYSVKWKE  242

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T+TPFEKRM+K+S+ S++PQHLEIHWF
Sbjct  243  TDTPFEKRMDKYSKSSSMPQHLEIHWF  269



>ref|XP_008389133.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=591

 Score =   316 bits (809),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 141/208 (68%), Positives = 175/208 (84%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRY +GD V LYANKVGPFHNPSETY Y DLPFCS  +V++K EALGEVLNGDR
Sbjct  22   RSDASDHRYNEGDAVPLYANKVGPFHNPSETYRYFDLPFCSAGDVKEKREALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y L+F  DK+SEV C++ L+K +V +FR AV +DYYFQMYYDDLP+WG++GKVDK
Sbjct  82   LVSAPYNLEFRKDKDSEVACRRMLTKEEVAQFRTAVKKDYYFQMYYDDLPIWGFLGKVDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DP EYKY+L+KH+ F+  YNKD+++EI A+ DP ++VD+T DK++D DFMYSVKW 
Sbjct  142  EGKTDPREYKYFLYKHIQFDARYNKDRVIEITAKMDPHSVVDLTEDKDVDADFMYSVKWA  201

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            +TN PFE RM+K+SQ S+LP HLEIHWF
Sbjct  202  DTNIPFENRMDKYSQSSSLPHHLEIHWF  229



>ref|XP_009380058.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=587

 Score =   315 bits (808),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 146/207 (71%), Positives = 171/207 (83%), Gaps = 1/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDASDHRYKQGD V LYANKVGPFHNPSETY Y DLPFC P +V +K EALGEVLNGDRL
Sbjct  20   SDASDHRYKQGDPVPLYANKVGPFHNPSETYRYFDLPFCVPEHVTEKKEALGEVLNGDRL  79

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D++SE +CKKKL+K DV KFR AV +DYYFQMYYDDLP+WG+IGKVDKE
Sbjct  80   VEAPYKLDFRVDRDSEPLCKKKLTKEDVAKFRSAVTKDYYFQMYYDDLPIWGFIGKVDKE  139

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             K D SEYKYYL++H+HF+I YN D ++EI    DP+++ D+T DK+++  F YSVKWKE
Sbjct  140  RK-DLSEYKYYLYRHIHFDILYNSDHVIEISVHTDPNSLADLTEDKDIEASFFYSVKWKE  198

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T TPFEKRM K+SQ S+LP HLEIHWF
Sbjct  199  TTTPFEKRMNKYSQTSSLPHHLEIHWF  225



>ref|XP_010936838.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=592

 Score =   315 bits (808),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 177/207 (86%), Gaps = 1/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDASDHRYK  D V LYANKVGPF NPSETY Y DLPFC+P +V +K E LGEVLNGDRL
Sbjct  25   SDASDHRYKPEDPVPLYANKVGPFQNPSETYRYFDLPFCTPEHVTEKKEDLGEVLNGDRL  84

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D++S+VVCKK+L+K DV KFR+AV +DYYFQMYYDDLP+WG+IGKVDKE
Sbjct  85   VVAPYKLDFRVDQDSQVVCKKQLTKEDVAKFRNAVIKDYYFQMYYDDLPIWGFIGKVDKE  144

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            G+ DPSEYKY+L+KH+HF+I YN D+++EI    DP+A+VD+T D++++V+F+YSVKWKE
Sbjct  145  GR-DPSEYKYFLYKHIHFDILYNNDRVIEINVHTDPNALVDVTEDRDIEVEFLYSVKWKE  203

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T TPF KRM+K+SQ S+LP HLEIHWF
Sbjct  204  TTTPFSKRMDKYSQSSSLPHHLEIHWF  230



>ref|XP_004985073.1| PREDICTED: putative phagocytic receptor 1b-like [Setaria italica]
Length=593

 Score =   315 bits (808),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 146/206 (71%), Positives = 171/206 (83%), Gaps = 0/206 (0%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLV  401
            D SDHRYK G+ V LYANKVGPFHNPSETY Y DLPFCSP  V +KSEALGEVLNGDRLV
Sbjct  26   DGSDHRYKAGEPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVREKSEALGEVLNGDRLV  85

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             + YKLDF  D +S  VC KKL+  DV KFR+AVA+DYYFQMYYDDLP+WG+IGKVDKEG
Sbjct  86   DAPYKLDFRVDLDSRSVCSKKLTTEDVAKFRNAVAKDYYFQMYYDDLPLWGFIGKVDKEG  145

Query  582  KSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKET  761
            K+DPSE+KYYL+KH+ F+I +N D+++EI    D SA+VD+T DKE +V+F+YSVKWKET
Sbjct  146  KADPSEWKYYLYKHIIFDILFNNDRVIEINVHTDQSALVDLTEDKETNVEFLYSVKWKET  205

Query  762  NTPFEKRMEKFSQISALPQHLEIHWF  839
             TPFEKRMEK+S  S LP HLE+HWF
Sbjct  206  LTPFEKRMEKYSSSSNLPHHLEVHWF  231



>ref|XP_009389646.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=599

 Score =   315 bits (806),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 173/207 (84%), Gaps = 1/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDASDHRYK GD V LY NKVGPFHNPSETY Y DLPFC+P +V +K EALGEVLNGDRL
Sbjct  32   SDASDHRYKTGDHVPLYVNKVGPFHNPSETYRYFDLPFCTPEHVTEKREALGEVLNGDRL  91

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D ESEV+CKK+L++ +V KFR AV +DYYFQMYYDDLP+WG+IGKVDKE
Sbjct  92   VDAPYKLDFRVDHESEVLCKKRLTREEVSKFRSAVTKDYYFQMYYDDLPLWGFIGKVDKE  151

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GK D  EYKYYL+K  HF++ YN D+++EI+   DP+ ++D+T D++++ +F+YSVKWKE
Sbjct  152  GK-DLGEYKYYLYKRFHFDVLYNNDRVIEIVVHTDPNMLLDVTEDRDIEAEFLYSVKWKE  210

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T TPFEKRMEK+SQ S+LP HLEIHWF
Sbjct  211  TATPFEKRMEKYSQTSSLPHHLEIHWF  237



>ref|XP_010435562.1| PREDICTED: putative phagocytic receptor 1b [Camelina sativa]
Length=589

 Score =   314 bits (804),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 172/207 (83%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK  D+V LYANKVGPFHNPSETY Y DLPFCS A V++K EALGEVLNGDRL
Sbjct  21   SDGSDHRYKVSDDVPLYANKVGPFHNPSETYRYFDLPFCSSAPVKEKKEALGEVLNGDRL  80

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL  K S V C+K+LS+ DV KFR  + +DYYFQMYYDDLP+WG++GKV K+
Sbjct  81   VSAPYKLEFLNFKISVVACRKRLSREDVAKFRDVILKDYYFQMYYDDLPIWGFLGKVVKD  140

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GK+DPSEYKYYLF HL FEIFYN+D+++EI+ R D + +VD+T DKE++VDF Y+V+WKE
Sbjct  141  GKTDPSEYKYYLFNHLQFEIFYNQDRVIEIVVRTDQNFLVDLTEDKEVEVDFTYTVRWKE  200

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T  PFEKRMEK+S  S++P HLEIHWF
Sbjct  201  TEIPFEKRMEKYSLASSMPHHLEIHWF  227



>ref|XP_008798135.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=592

 Score =   313 bits (802),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 144/207 (70%), Positives = 175/207 (85%), Gaps = 1/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDASDHRYK  D V LYANKVGPFHNPSETY Y DLPFC+P ++ +K E LGEVLNGDRL
Sbjct  25   SDASDHRYKPDDPVPLYANKVGPFHNPSETYRYFDLPFCTPEHLTEKKEDLGEVLNGDRL  84

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D++S+VVCKK L+K D  KFR+AV +DYYFQMYYDDLP+WG+IGKVDKE
Sbjct  85   VVAPYKLDFRVDQDSQVVCKKHLTKEDAAKFRNAVMKDYYFQMYYDDLPIWGFIGKVDKE  144

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GK DPSEYKY+L+KH+HF+I YN D+++EI    DP+A+VD+T D+++DV+F+YSVKWKE
Sbjct  145  GK-DPSEYKYFLYKHIHFDILYNNDRVIEINVHTDPNALVDVTEDRDIDVEFLYSVKWKE  203

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T TPF KRM+K+SQ S+ P HLEIHWF
Sbjct  204  TTTPFSKRMDKYSQSSSQPHHLEIHWF  230



>emb|CDY41095.1| BnaC05g10860D [Brassica napus]
Length=589

 Score =   313 bits (801),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DL FC P  V++K EA GEVLNGDR
Sbjct  23   RSDASDHRYKEGDTVPLYANKVGPFHNPSETYRYFDLAFCVPEGVKEKKEAFGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV CKKKLSK +V++FR AV + YYFQMYYDDLP+WG+IGKVDK
Sbjct  83   LVSAPYKLNFRDEKDSEVYCKKKLSKEEVKQFRKAVEKAYYFQMYYDDLPIWGFIGKVDK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E KSDPSE++Y L+KH+ FEI YN D+++EI AR DP ++VD+T DKE+D +FMY+VK K
Sbjct  143  EIKSDPSEHRYVLYKHIQFEILYNNDRVIEISARMDPHSLVDLTEDKEVDAEFMYTVKLK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRMEK+S  S+LP HLEIHWF
Sbjct  203  ETETPFEKRMEKYSMSSSLPHHLEIHWF  230



>ref|XP_008787888.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Phoenix 
dactylifera]
Length=555

 Score =   311 bits (797),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 175/205 (85%), Gaps = 1/205 (0%)
 Frame = +3

Query  225  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVH  404
            ASD RYK  D V LYANKVGPFHNPSETY Y DLPFC+P +V +K E LGEVLNGDRLV 
Sbjct  27   ASDRRYKPEDPVPLYANKVGPFHNPSETYRYFDLPFCTPEHVTEKKEDLGEVLNGDRLVI  86

Query  405  SLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGK  584
            + YKLDF  D++S+VVCKK+L K DV KFR+A+ +DYYFQMYYDDLP+WGYIGKVDKEGK
Sbjct  87   APYKLDFRVDRDSKVVCKKQLKKEDVAKFRNAIIKDYYFQMYYDDLPIWGYIGKVDKEGK  146

Query  585  SDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKETN  764
             DPSE+KY+L+KH+HF+I YN D+++EI    DP+A+VD+T D++++V+F+YSVKWKET 
Sbjct  147  -DPSEFKYFLYKHIHFDILYNDDRVIEINVHTDPNALVDVTEDRDIEVEFLYSVKWKETT  205

Query  765  TPFEKRMEKFSQISALPQHLEIHWF  839
            TPFEKRM+K+SQ S+LP HLEIHWF
Sbjct  206  TPFEKRMDKYSQSSSLPHHLEIHWF  230



>gb|ADQ43185.1| endomemebrane protein 70 [Schrenkiella parvula]
Length=587

 Score =   312 bits (799),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 146/208 (70%), Positives = 175/208 (84%), Gaps = 2/208 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNP ETY Y DLPFC P  V+ K EALGEVLNGDR
Sbjct  23   RSDASDHRYKEGDSVPLYANKVGPFHNP-ETYRYFDLPFCVP-GVKDKKEALGEVLNGDR  80

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL F  +K+SE  CKKKLS+ +VE+FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  81   LVSAPYKLSFRDEKDSETYCKKKLSREEVEQFRRAVEKDYYFQMYYDDLPIWGFIGKVDK  140

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            E K+DPSE+KY+L+KH+ FEI YNKD+++EI AR DP ++VD+T DKE+D +FMY+VKWK
Sbjct  141  ESKADPSEFKYFLYKHIQFEILYNKDRVIEINARMDPHSLVDLTEDKEVDAEFMYTVKWK  200

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET T FEKRM+K++  S+LP HLEIHWF
Sbjct  201  ETETSFEKRMDKYAMSSSLPHHLEIHWF  228



>tpg|DAA44289.1| TPA: hypothetical protein ZEAMMB73_547933 [Zea mays]
Length=526

 Score =   310 bits (793),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = +3

Query  228  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHS  407
            SDHRYK  + V LYANKVGPFHNPSETY Y DLPFCSP  V++KSEALGEVLNGDRLV +
Sbjct  28   SDHRYKMYEPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVKEKSEALGEVLNGDRLVDA  87

Query  408  LYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKS  587
             YKLDF ++ ES+ VC KKL+K DV KFR+AVA+DYYFQMYYDDLP+WG+IGKV+K GK+
Sbjct  88   PYKLDFRSEVESKAVCSKKLTKEDVVKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKGGKA  147

Query  588  DPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKETNT  767
            DPSE+KYYL++H+ F+I YN D+++EI    D SA+VD+T DKE +VDF+YSVKWKET T
Sbjct  148  DPSEWKYYLYRHIIFDILYNNDRVIEINVHTDQSALVDLTEDKETNVDFLYSVKWKETPT  207

Query  768  PFEKRMEKFSQISALPQHLEIHWF  839
            PFEKRMEK+S  S +P HLE+HWF
Sbjct  208  PFEKRMEKYSSSSNMPHHLEVHWF  231



>ref|XP_008787887.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Phoenix 
dactylifera]
Length=592

 Score =   311 bits (798),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 143/205 (70%), Positives = 175/205 (85%), Gaps = 1/205 (0%)
 Frame = +3

Query  225  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVH  404
            ASD RYK  D V LYANKVGPFHNPSETY Y DLPFC+P +V +K E LGEVLNGDRLV 
Sbjct  27   ASDRRYKPEDPVPLYANKVGPFHNPSETYRYFDLPFCTPEHVTEKKEDLGEVLNGDRLVI  86

Query  405  SLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGK  584
            + YKLDF  D++S+VVCKK+L K DV KFR+A+ +DYYFQMYYDDLP+WGYIGKVDKEGK
Sbjct  87   APYKLDFRVDRDSKVVCKKQLKKEDVAKFRNAIIKDYYFQMYYDDLPIWGYIGKVDKEGK  146

Query  585  SDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKETN  764
             DPSE+KY+L+KH+HF+I YN D+++EI    DP+A+VD+T D++++V+F+YSVKWKET 
Sbjct  147  -DPSEFKYFLYKHIHFDILYNDDRVIEINVHTDPNALVDVTEDRDIEVEFLYSVKWKETT  205

Query  765  TPFEKRMEKFSQISALPQHLEIHWF  839
            TPFEKRM+K+SQ S+LP HLEIHWF
Sbjct  206  TPFEKRMDKYSQSSSLPHHLEIHWF  230



>ref|XP_003558407.1| PREDICTED: putative phagocytic receptor 1b [Brachypodium distachyon]
Length=593

 Score =   310 bits (793),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 141/207 (68%), Positives = 172/207 (83%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRYK  + V LYANKVGPFHNPSETY Y DLPFCSP  V++KSEALGEVLNGDRL
Sbjct  25   SDGSDHRYKSSEPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVKEKSEALGEVLNGDRL  84

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +S+ VC KKL+K DV KFR++VA+DYYFQMYYDDLP+WG+IGK++K 
Sbjct  85   VDAPYKLDFRVDLDSKPVCSKKLTKEDVAKFRNSVAKDYYFQMYYDDLPLWGFIGKLEKT  144

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             K+DPSE+KYYL++H+ F+I YN D+++EI    D SA+VD+T DKE +V+F+Y+VKWKE
Sbjct  145  AKADPSEWKYYLYRHIIFDILYNNDRVIEITVHTDQSALVDLTEDKEANVEFLYTVKWKE  204

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T TPFEKRMEK+S  S LP HLE+HWF
Sbjct  205  TATPFEKRMEKYSSSSNLPHHLEVHWF  231



>ref|NP_001148980.1| LOC100282600 precursor [Zea mays]
 gb|ACG33705.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 tpg|DAA44288.1| TPA: transmembrane 9 family protein member 1 [Zea mays]
Length=593

 Score =   310 bits (793),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 143/204 (70%), Positives = 172/204 (84%), Gaps = 0/204 (0%)
 Frame = +3

Query  228  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHS  407
            SDHRYK  + V LYANKVGPFHNPSETY Y DLPFCSP  V++KSEALGEVLNGDRLV +
Sbjct  28   SDHRYKMYEPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVKEKSEALGEVLNGDRLVDA  87

Query  408  LYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKS  587
             YKLDF ++ ES+ VC KKL+K DV KFR+AVA+DYYFQMYYDDLP+WG+IGKV+K GK+
Sbjct  88   PYKLDFRSEVESKAVCSKKLTKEDVVKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKGGKA  147

Query  588  DPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKETNT  767
            DPSE+KYYL++H+ F+I YN D+++EI    D SA+VD+T DKE +VDF+YSVKWKET T
Sbjct  148  DPSEWKYYLYRHIIFDILYNNDRVIEINVHTDQSALVDLTEDKETNVDFLYSVKWKETPT  207

Query  768  PFEKRMEKFSQISALPQHLEIHWF  839
            PFEKRMEK+S  S +P HLE+HWF
Sbjct  208  PFEKRMEKYSSSSNMPHHLEVHWF  231



>ref|XP_010920043.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X3 [Elaeis guineensis]
Length=524

 Score =   307 bits (786),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 172/208 (83%), Gaps = 1/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            ++D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K EALGEVLNGDR
Sbjct  20   KADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCSPDHVIEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  D+ES  +C+K LS+ D+ K R+AVA+DYYFQMYYDDLP WG+IGKVDK
Sbjct  80   LVDAPYELNFREDRESTTICEKSLSEKDIAKLRNAVAKDYYFQMYYDDLPFWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            +   DPSEYKY LFKH+HF+IFYN D+++EI  + DP+  VDIT DK +DV F YSV WK
Sbjct  140  D-NLDPSEYKYLLFKHIHFDIFYNDDRVIEISVQTDPNLTVDITEDKAVDVMFAYSVTWK  198

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
             T+ PFEKRMEK+S+ S+LPQHLEIHWF
Sbjct  199  NTDIPFEKRMEKYSKSSSLPQHLEIHWF  226



>ref|XP_010920044.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X4 [Elaeis guineensis]
Length=516

 Score =   306 bits (785),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 172/208 (83%), Gaps = 1/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            ++D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K EALGEVLNGDR
Sbjct  20   KADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCSPDHVIEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  D+ES  +C+K LS+ D+ K R+AVA+DYYFQMYYDDLP WG+IGKVDK
Sbjct  80   LVDAPYELNFREDRESTTICEKSLSEKDIAKLRNAVAKDYYFQMYYDDLPFWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            +   DPSEYKY LFKH+HF+IFYN D+++EI  + DP+  VDIT DK +DV F YSV WK
Sbjct  140  D-NLDPSEYKYLLFKHIHFDIFYNDDRVIEISVQTDPNLTVDITEDKAVDVMFAYSVTWK  198

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
             T+ PFEKRMEK+S+ S+LPQHLEIHWF
Sbjct  199  NTDIPFEKRMEKYSKSSSLPQHLEIHWF  226



>ref|NP_001049492.1| Os03g0237000 [Oryza sativa Japonica Group]
 gb|AAO06970.1| Putative endosomal protein [Oryza sativa Japonica Group]
 gb|ABF94848.1| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11406.1| Os03g0237000 [Oryza sativa Japonica Group]
 gb|EAZ26202.1| hypothetical protein OsJ_10070 [Oryza sativa Japonica Group]
 dbj|BAG89207.1| unnamed protein product [Oryza sativa Japonica Group]
Length=595

 Score =   309 bits (791),  Expect = 5e-97, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 171/207 (83%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK  + V LYANKVGPFHNPSETY Y DLPFCSP  V++KSEALGEVLNGDRL
Sbjct  27   ADGSDHRYKANELVPLYANKVGPFHNPSETYRYFDLPFCSPEKVKEKSEALGEVLNGDRL  86

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +S+ VC KKL+K +V KFR+AVA+DYYFQMYYDDLP+WG+IGKV+K 
Sbjct  87   VDAPYKLDFRVDYDSKPVCSKKLTKEEVAKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKG  146

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GK+DP E+KYYL++H+ F+I YN D+++EI    D SA+VD+T DKE DV F+YSVKWKE
Sbjct  147  GKTDPKEWKYYLYRHIIFDILYNNDRVIEINVHTDQSALVDLTEDKEADVQFLYSVKWKE  206

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T TPFEKRMEK+S  S LP HLE+HWF
Sbjct  207  TPTPFEKRMEKYSSSSNLPHHLEVHWF  233



>ref|XP_009419338.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=593

 Score =   308 bits (790),  Expect = 6e-97, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 173/207 (84%), Gaps = 1/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDASDHRYK+ D V LYANKVGPFHNPSETY Y DLPFC+P +V +  EALGEVLNGDRL
Sbjct  26   SDASDHRYKKRDSVPLYANKVGPFHNPSETYRYFDLPFCAPEHVTEIREALGEVLNGDRL  85

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL D +S+ +CKKKL+K DV KFR AV +DYYFQMY+DDLP+WG+IGKVDKE
Sbjct  86   VDAPYKLNFLVDLDSKQLCKKKLTKEDVAKFRSAVTKDYYFQMYFDDLPIWGFIGKVDKE  145

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GK D  +YKYYL++H+HF++ YN D+++EI    DPSA+VD+T DKE++VDFMYSVKWKE
Sbjct  146  GK-DLGDYKYYLYRHIHFDVLYNGDRVIEITVHTDPSALVDLTDDKEIEVDFMYSVKWKE  204

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T+TPFEKRMEK+S   +   HLEIHWF
Sbjct  205  TSTPFEKRMEKYSLTYSQTHHLEIHWF  231



>ref|XP_009404153.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=587

 Score =   308 bits (789),  Expect = 7e-97, Method: Compositional matrix adjust.
 Identities = 142/207 (69%), Positives = 172/207 (83%), Gaps = 1/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            S+ASDHRYKQGD V LYANKVGPFHNPSETY + DLPFC P +V +K EALGEVLNGDRL
Sbjct  20   SEASDHRYKQGDPVPLYANKVGPFHNPSETYRFFDLPFCIPDHVTEKKEALGEVLNGDRL  79

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +SE++CKKKL+K DV KFR AV +DYYFQMYYDDLP+WG+IGKVDKE
Sbjct  80   VGAPYKLDFRVDYDSELLCKKKLTKGDVGKFRDAVTKDYYFQMYYDDLPIWGFIGKVDKE  139

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GK D S   YYL++H+HF+I YN D+++EI    DP+++ D+T DK+++ +F+YSVKWKE
Sbjct  140  GK-DLSNDNYYLYRHIHFDILYNNDRVIEITVHTDPNSVADLTEDKDIEAEFLYSVKWKE  198

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T  PFEKRMEK+SQ S+LP HLEIHWF
Sbjct  199  TTMPFEKRMEKYSQSSSLPHHLEIHWF  225



>ref|XP_010939968.1| PREDICTED: transmembrane 9 superfamily member 3-like [Elaeis 
guineensis]
Length=609

 Score =   308 bits (790),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 143/207 (69%), Positives = 174/207 (84%), Gaps = 1/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            S ASDHRYK  D V LYANKVGPF NPSETY Y DLPFC+P +V +K E LGEVLNGDRL
Sbjct  42   SSASDHRYKPEDPVPLYANKVGPFQNPSETYRYFDLPFCTPEHVTEKKEDLGEVLNGDRL  101

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  +++S+VVCKK+L+K DV KFR+AV +DYYFQMYYDDLP+WG+IGKVDKE
Sbjct  102  VVAPYKLDFHVNQDSKVVCKKQLTKEDVAKFRNAVIKDYYFQMYYDDLPIWGFIGKVDKE  161

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            GK DPSEYKY+L+KH+HF+I YN D++VEI    DP+A+VD+T D +++V+F+YS  WKE
Sbjct  162  GK-DPSEYKYFLYKHIHFDILYNDDRVVEINVHTDPNALVDVTEDGDIEVEFLYSATWKE  220

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T TPFEKRM+K+SQ S+LP HLEIHWF
Sbjct  221  TTTPFEKRMDKYSQSSSLPHHLEIHWF  247



>gb|KJB10378.1| hypothetical protein B456_001G198000 [Gossypium raimondii]
Length=500

 Score =   305 bits (781),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 140/208 (67%), Positives = 170/208 (82%), Gaps = 12/208 (6%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RS ASDHRY  GDEV LYANKVGPFHNPSETY   D PFCS A V++K EALGEVLNGDR
Sbjct  23   RSSASDHRYTAGDEVPLYANKVGPFHNPSETYRLFDFPFCSSAPVKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+LDFL            L+K +V KFR AV+++YYFQMYY+DLP+WG++GKVD 
Sbjct  83   LVSAPYRLDFL------------LAKEEVAKFRTAVSKNYYFQMYYNDLPIWGFLGKVDN  130

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKYYLFKHL FEI YNKD+++EI  R+DP+++VD+T D+ ++VDFMY+VKWK
Sbjct  131  EGKADPSEYKYYLFKHLIFEILYNKDRVIEITVRSDPNSLVDLTQDEPVNVDFMYTVKWK  190

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET TPFEKRM+K+SQ S++P HLEIHWF
Sbjct  191  ETETPFEKRMDKYSQSSSMPHHLEIHWF  218



>ref|XP_002468203.1| hypothetical protein SORBIDRAFT_01g041650 [Sorghum bicolor]
 gb|EER95201.1| hypothetical protein SORBIDRAFT_01g041650 [Sorghum bicolor]
Length=595

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 170/206 (83%), Gaps = 0/206 (0%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLV  401
            D SDHRYK  + V LYANKVGPFHNPSETY Y DLPFCSP  V +KSEALGEVLNGDRLV
Sbjct  28   DGSDHRYKMNEPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVREKSEALGEVLNGDRLV  87

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             + YKLDF  + ES+ VC KKL+  DV KFR+AVA+DYYFQMYYDDLP+WG+IGKV+K G
Sbjct  88   DAPYKLDFRLEVESKAVCSKKLTVEDVVKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKGG  147

Query  582  KSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKET  761
            K+DPSE+KYYL++H+ F+I YN D+++EI    D SA+VD+T DKE +V+F+YSVKWKET
Sbjct  148  KADPSEWKYYLYRHIIFDILYNNDRVIEINVHTDQSALVDLTEDKETNVEFLYSVKWKET  207

Query  762  NTPFEKRMEKFSQISALPQHLEIHWF  839
             TPFEKRMEK+S  S +P HLE+HWF
Sbjct  208  PTPFEKRMEKYSSSSNMPHHLEVHWF  233



>gb|AGT15903.1| transmembrane 9 superfamily protein [Saccharum hybrid cultivar 
R570]
Length=593

 Score =   308 bits (788),  Expect = 1e-96, Method: Compositional matrix adjust.
 Identities = 142/206 (69%), Positives = 170/206 (83%), Gaps = 0/206 (0%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLV  401
            D SDHRYK  + V LYANKVGPFHNPSETY Y DLPFCSP  V +KSEALGEVLNGDRLV
Sbjct  26   DGSDHRYKMNEPVPLYANKVGPFHNPSETYRYFDLPFCSPEKVREKSEALGEVLNGDRLV  85

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             + YKLDF  + ES+ VC KKL+  DV KFR+AVA+DYYFQMYYDDLP+WG+IGKV+K G
Sbjct  86   DAPYKLDFRFEVESKAVCSKKLTVEDVVKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKGG  145

Query  582  KSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKET  761
            K+DPSE+KYYL++H+ F+I YN D+++EI    D SA+VD+T DKE +V+F+YSVKWKET
Sbjct  146  KADPSEWKYYLYRHIIFDILYNNDRVIEINVHTDQSALVDLTEDKETNVEFLYSVKWKET  205

Query  762  NTPFEKRMEKFSQISALPQHLEIHWF  839
             TPFEKRMEK+S  S +P HLE+HWF
Sbjct  206  PTPFEKRMEKYSSSSNMPHHLEVHWF  231



>ref|XP_008356702.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Malus domestica]
 ref|XP_008356703.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Malus domestica]
 ref|XP_008356704.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Malus domestica]
 ref|XP_008356705.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X1 [Malus domestica]
Length=433

 Score =   302 bits (774),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 136/200 (68%), Positives = 169/200 (85%), Gaps = 0/200 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V LYANKVGPFHNPSE Y Y DLPFCSP  V +K EALGEVLNGDR
Sbjct  25   RSDGSDHRYKEGDFVPLYANKVGPFHNPSEAYGYFDLPFCSPDAVTEKGEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL  K+ EV CKK L+K +V +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVSAPYKLEFLRHKDPEVACKKTLTKEEVGRFRSAVNKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK  PSEYK YL+KH+HF+++YNKD+++E+  R DP+A+ D++ DKE+DV+FMY+V+WK
Sbjct  145  EGKDPPSEYKTYLYKHIHFDLYYNKDRVIEVNVRTDPNALADLSEDKEVDVEFMYTVEWK  204

Query  756  ETNTPFEKRMEKFSQISALP  815
            ET TPF+KRM+K++Q S+LP
Sbjct  205  ETTTPFDKRMDKYAQSSSLP  224



>ref|XP_002521899.1| transporter, putative [Ricinus communis]
 gb|EEF40535.1| transporter, putative [Ricinus communis]
Length=592

 Score =   307 bits (787),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 138/208 (66%), Positives = 174/208 (84%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V  YANKVGPFHNPSETY Y DLPFC P ++++K EALGEVLNGDR
Sbjct  23   RSDTSDHRYKEGDPVPFYANKVGPFHNPSETYRYFDLPFCVPDHLKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y L+F  DK S  VC+KKLSK DV +FR A+A+DYYFQMYYDDLP+WG+IGKV K
Sbjct  83   LVSAPYTLNFRDDKVSAPVCQKKLSKEDVAQFRSAIAKDYYFQMYYDDLPIWGFIGKVVK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            +GK DPSEYKY+L++H+ F++ YNKD+++E+  R DP++M+D+T DKE+DV+F+Y+VKWK
Sbjct  143  DGKDDPSEYKYFLYQHVQFDVLYNKDRVIEVGVRMDPNSMLDLTEDKEVDVEFLYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+  FE RM+K+S  S+LP HLEIHWF
Sbjct  203  ETDNTFENRMKKYSLSSSLPHHLEIHWF  230



>ref|XP_010920041.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Elaeis guineensis]
Length=588

 Score =   306 bits (784),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 172/208 (83%), Gaps = 1/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            ++D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K EALGEVLNGDR
Sbjct  20   KADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCSPDHVIEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  D+ES  +C+K LS+ D+ K R+AVA+DYYFQMYYDDLP WG+IGKVDK
Sbjct  80   LVDAPYELNFREDRESTTICEKSLSEKDIAKLRNAVAKDYYFQMYYDDLPFWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            +   DPSEYKY LFKH+HF+IFYN D+++EI  + DP+  VDIT DK +DV F YSV WK
Sbjct  140  D-NLDPSEYKYLLFKHIHFDIFYNDDRVIEISVQTDPNLTVDITEDKAVDVMFAYSVTWK  198

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
             T+ PFEKRMEK+S+ S+LPQHLEIHWF
Sbjct  199  NTDIPFEKRMEKYSKSSSLPQHLEIHWF  226



>ref|XP_010920042.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X2 [Elaeis guineensis]
Length=582

 Score =   306 bits (783),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 142/208 (68%), Positives = 172/208 (83%), Gaps = 1/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            ++D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K EALGEVLNGDR
Sbjct  20   KADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCSPDHVIEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  D+ES  +C+K LS+ D+ K R+AVA+DYYFQMYYDDLP WG+IGKVDK
Sbjct  80   LVDAPYELNFREDRESTTICEKSLSEKDIAKLRNAVAKDYYFQMYYDDLPFWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            +   DPSEYKY LFKH+HF+IFYN D+++EI  + DP+  VDIT DK +DV F YSV WK
Sbjct  140  D-NLDPSEYKYLLFKHIHFDIFYNDDRVIEISVQTDPNLTVDITEDKAVDVMFAYSVTWK  198

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
             T+ PFEKRMEK+S+ S+LPQHLEIHWF
Sbjct  199  NTDIPFEKRMEKYSKSSSLPQHLEIHWF  226



>gb|ABK25212.1| unknown [Picea sitchensis]
Length=355

 Score =   298 bits (763),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 165/207 (80%), Gaps = 4/207 (2%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
              ASDHRY +GD V LYANKVGPFHNPSETY Y DLPFC P  V +K E LGEVLNGDR+
Sbjct  21   GSASDHRYSKGDHVPLYANKVGPFHNPSETYRYFDLPFCPPDKVTEKREDLGEVLNGDRM  80

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL F  DK SE++C+KKL+K D+EKFR AV +DYYFQMYYDDLP+WG+IGK D+E
Sbjct  81   VDARYKLHFQDDKNSELLCRKKLTKDDLEKFREAVKKDYYFQMYYDDLPIWGFIGKTDRE  140

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
              +DP    + L+KHLHFEI YN D+++EI  R DP+  VDIT DKE++VDF YSVKW E
Sbjct  141  TNADP----FLLYKHLHFEILYNNDRVIEITVRTDPNFTVDITEDKEIEVDFTYSVKWVE  196

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T TPFE+RM+K+S+ S+LPQHLEIHWF
Sbjct  197  TQTPFERRMDKYSKSSSLPQHLEIHWF  223



>gb|ACG42357.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
Length=593

 Score =   303 bits (777),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 169/206 (82%), Gaps = 0/206 (0%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLV  401
            D SDHRYK  + V LYANKVGPFHNPSETY Y DLPFCSP  V++KSEALGEVLNGDRLV
Sbjct  26   DGSDHRYKIREPVPLYANKVGPFHNPSETYRYFDLPFCSPDKVKEKSEALGEVLNGDRLV  85

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             + YKLDF  + ES+ VC KKL+  DV KFR+AVA+DYYFQMYYDDLP+WG+IGKV+K G
Sbjct  86   DAPYKLDFRDEVESKAVCSKKLTTEDVVKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKGG  145

Query  582  KSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKET  761
            K DPSE+KYYL++H+ F+I YN D+++EI    D SA+VD+T DKE +V+F+YS KWKET
Sbjct  146  KDDPSEWKYYLYRHIIFDILYNNDRVIEINVHTDQSALVDLTEDKETNVEFLYSAKWKET  205

Query  762  NTPFEKRMEKFSQISALPQHLEIHWF  839
             TPFEKRMEK+S  S +P HLE+HWF
Sbjct  206  PTPFEKRMEKYSSSSNMPHHLEVHWF  231



>ref|NP_001151315.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACN28721.1| unknown [Zea mays]
 gb|AFW89069.1| transmembrane 9 family protein member 1 [Zea mays]
Length=593

 Score =   303 bits (777),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 141/206 (68%), Positives = 169/206 (82%), Gaps = 0/206 (0%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLV  401
            D SDHRYK  + V LYANKVGPFHNPSETY Y DLPFCSP  V++KSEALGEVLNGDRLV
Sbjct  26   DGSDHRYKIREPVPLYANKVGPFHNPSETYRYFDLPFCSPDKVKEKSEALGEVLNGDRLV  85

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             + YKLDF  + ES+ VC KKL+  DV KFR+AVA+DYYFQMYYDDLP+WG+IGKV+K G
Sbjct  86   DAPYKLDFRDEVESKAVCSKKLTTEDVVKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKGG  145

Query  582  KSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKET  761
            K DPSE+KYYL++H+ F+I YN D+++EI    D SA+VD+T DKE +V+F+YS KWKET
Sbjct  146  KDDPSEWKYYLYRHIIFDILYNNDRVIEINVHTDQSALVDLTEDKETNVEFLYSAKWKET  205

Query  762  NTPFEKRMEKFSQISALPQHLEIHWF  839
             TPFEKRMEK+S  S +P HLE+HWF
Sbjct  206  PTPFEKRMEKYSSSSNMPHHLEVHWF  231



>ref|XP_010099693.1| Putative phagocytic receptor 1b [Morus notabilis]
 gb|EXB80270.1| Putative phagocytic receptor 1b [Morus notabilis]
Length=637

 Score =   303 bits (777),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 140/204 (69%), Positives = 170/204 (83%), Gaps = 1/204 (0%)
 Frame = +3

Query  228  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHS  407
            SDHRY +GD V LYANKVGPF NPSETY Y DLPFCSP  V++K EALGEVLNGDRLV +
Sbjct  26   SDHRYHEGDSVPLYANKVGPFQNPSETYRYFDLPFCSPDGVKEKKEALGEVLNGDRLVSA  85

Query  408  LYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKS  587
             YKL+F  +KES+V CK KL K +V +FR AV +DYYFQMYYDDLPVWG+IGKV KEGK 
Sbjct  86   PYKLEFQKNKESKVACKSKLKKEEVARFRSAVNKDYYFQMYYDDLPVWGFIGKVVKEGK-  144

Query  588  DPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKETNT  767
            +PSEYKYYL++H+HF+I YN D+++EI  R DP A++D+T DKE++V F+Y+V WKETNT
Sbjct  145  EPSEYKYYLYRHIHFDISYNNDRVIEINVRTDPKAVLDLTEDKEVEVKFLYTVNWKETNT  204

Query  768  PFEKRMEKFSQISALPQHLEIHWF  839
            P+EKRM+K+S  S+LP HLEIHWF
Sbjct  205  PYEKRMDKYSLSSSLPHHLEIHWF  228



>ref|XP_008788644.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
 ref|XP_008788651.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=588

 Score =   301 bits (770),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 139/207 (67%), Positives = 169/207 (82%), Gaps = 1/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K EALGEVLNGDRL
Sbjct  21   ADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCSPDHVTEKKEALGEVLNGDRL  80

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  D+ES  +CKK LS+ D+ K R AVA+DYYFQM+YDDLP WG+IGK+DK+
Sbjct  81   VDAPYELNFREDRESTTICKKSLSEEDIAKLRDAVAKDYYFQMFYDDLPFWGFIGKIDKD  140

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
               DPSE KY LFKH+HF+IFYN D+++EI  + DP+  VDIT +K +DV+F YSV WK 
Sbjct  141  -NLDPSENKYLLFKHIHFDIFYNDDRVIEINVQTDPNLAVDITEEKAVDVEFAYSVTWKN  199

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T  PFEKRMEK+S+ S+LPQHLEIHWF
Sbjct  200  TAVPFEKRMEKYSKSSSLPQHLEIHWF  226



>ref|XP_007141945.1| hypothetical protein PHAVU_008G239300g [Phaseolus vulgaris]
 gb|ESW13939.1| hypothetical protein PHAVU_008G239300g [Phaseolus vulgaris]
Length=596

 Score =   301 bits (771),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 169/207 (82%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDA+DHRY +GD V  YANKVGPFHNPSETY Y DLPFCSPANVE+K E LGEVLNGDRL
Sbjct  28   SDAADHRYNKGDSVPFYANKVGPFHNPSETYKYFDLPFCSPANVEEKKEDLGEVLNGDRL  87

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+F  DKE E +CKK+L+K +V +FRHAV +DY++QMYYDDLP+WG++GK D E
Sbjct  88   VVAPYKLNFQIDKEPESICKKRLTKKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGKFDSE  147

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             K DP+    +LF H+HFEI YN D+I+++  R DP A+VD+T ++E++VDF+YS KW E
Sbjct  148  DKDDPTGATVHLFTHVHFEILYNNDRIIDVFIRNDPRAVVDLTQNREVEVDFIYSAKWIE  207

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T+TPFEKR+EK+SQ S+L  +LEIHWF
Sbjct  208  TDTPFEKRLEKYSQTSSLSHNLEIHWF  234



>ref|XP_010276746.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=590

 Score =   300 bits (769),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 134/207 (65%), Positives = 174/207 (84%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D S+H+YK+ D V LYANKVGPFHNPSETY Y+DLPFCSP +V++K EALGEVLNGDRL
Sbjct  22   ADGSNHKYKERDLVPLYANKVGPFHNPSETYRYYDLPFCSPDHVKEKREALGEVLNGDRL  81

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  DK+S+++C+KKL+K +V + R AV +DYYFQMYYDDLP WG++GKV+K+
Sbjct  82   VDAPYELNFRVDKQSKIICQKKLTKEEVAQLRTAVLKDYYFQMYYDDLPFWGFVGKVEKD  141

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             K DP+EYKY LFKH+HF++ YN D+++EI A+ DP+   DIT DKE+ VDF YSV WKE
Sbjct  142  NKEDPNEYKYLLFKHIHFDVLYNNDRVIEINAQTDPNLSADITEDKEVVVDFTYSVNWKE  201

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T+ PFEKRM+K+S+ S++PQHLEIHWF
Sbjct  202  TDIPFEKRMDKYSKSSSMPQHLEIHWF  228



>ref|XP_009782678.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009782682.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009782687.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
Length=592

 Score =   300 bits (767),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 134/209 (64%), Positives = 173/209 (83%), Gaps = 1/209 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            +SDAS H+YK G++V LYANKVGPF NPSETY Y+DLPFC P N+EKK E+LGEVLNGDR
Sbjct  22   QSDASTHQYKSGEKVPLYANKVGPFFNPSETYSYYDLPFCRPDNLEKKKESLGEVLNGDR  81

Query  396  LVHSLYKLDFLADK-ESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVD  572
            L  + YKL+FLADK +++VVCKK+L+K +V +FR AV  DYY QMYYDDLP+W +IGK+D
Sbjct  82   LTFAPYKLEFLADKKDAKVVCKKRLTKEEVAQFRTAVTLDYYIQMYYDDLPIWAFIGKID  141

Query  573  KEGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKW  752
            KEG  DP+E+KY+++   HFEIFY+KD+++EI  RADP    ++T+D+E+DV+F+Y+V W
Sbjct  142  KEGSYDPNEFKYHIYTMFHFEIFYHKDRVIEINLRADPYVTANVTIDEEVDVEFLYTVVW  201

Query  753  KETNTPFEKRMEKFSQISALPQHLEIHWF  839
            K TNTPFEKRM+K+   S+LP HLEIHWF
Sbjct  202  KATNTPFEKRMDKYKMSSSLPHHLEIHWF  230



>ref|XP_009628015.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009628016.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
tomentosiformis]
Length=592

 Score =   299 bits (766),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 135/209 (65%), Positives = 171/209 (82%), Gaps = 1/209 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            +SDAS HRYK G+EV LYANKVGPF NPSETY Y DLPFC P N+EKK E+LGE+LNGDR
Sbjct  22   QSDASTHRYKSGEEVPLYANKVGPFFNPSETYAYFDLPFCRPDNMEKKKESLGELLNGDR  81

Query  396  LVHSLYKLDFLADK-ESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVD  572
            L  + YKL+FLADK +++VVCKK+L+K +V +FR AVA DYY QMYYDDLP+W +IGK+D
Sbjct  82   LTFAPYKLEFLADKKDAKVVCKKRLTKEEVAQFRTAVALDYYIQMYYDDLPIWAFIGKID  141

Query  573  KEGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKW  752
            KEG  DP+E+KY+++   HFEIFY+KD+++EI  RADP    ++T D+E+DV+F+Y+V W
Sbjct  142  KEGSYDPNEFKYHIYTMFHFEIFYHKDRVIEINLRADPYVTANVTNDEEVDVEFLYTVMW  201

Query  753  KETNTPFEKRMEKFSQISALPQHLEIHWF  839
            K TN PFEKRM+K+   S+LP HLEIHWF
Sbjct  202  KATNIPFEKRMDKYKMSSSLPHHLEIHWF  230



>gb|ABK24901.1| unknown [Picea sitchensis]
Length=585

 Score =   298 bits (764),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 138/207 (67%), Positives = 165/207 (80%), Gaps = 4/207 (2%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
              ASDHRY +GD V LYANKVGPFHNPSETY Y DLPFC P  V +K E LGEVLNGDR+
Sbjct  21   GSASDHRYSKGDHVPLYANKVGPFHNPSETYRYFDLPFCPPDKVTEKREDLGEVLNGDRM  80

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL F  DK SE++C+KKL+K D+EKFR AV +DYYFQMYYDDLP+WG+IGK D+E
Sbjct  81   VDARYKLHFQDDKNSELLCRKKLTKDDLEKFREAVKKDYYFQMYYDDLPIWGFIGKTDRE  140

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
              +DP    + L+KHLHFEI YN D+++EI  R DP+  VDIT DKE++VDF YSVKW E
Sbjct  141  TNADP----FLLYKHLHFEILYNNDRVIEITVRTDPNFTVDITEDKEIEVDFTYSVKWVE  196

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T TPFE+RM+K+S+ S+LPQHLEIHWF
Sbjct  197  TQTPFERRMDKYSKSSSLPQHLEIHWF  223



>emb|CDP05457.1| unnamed protein product [Coffea canephora]
Length=607

 Score =   298 bits (764),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 134/208 (64%), Positives = 176/208 (85%), Gaps = 1/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDAS+HRY+ G+ V LYANK+GPFHNPSETY Y DLPFC P ++++K EALGEVLNGDR
Sbjct  21   RSDASNHRYQPGEPVPLYANKIGPFHNPSETYRYFDLPFCIPDHIKEKKEALGEVLNGDR  80

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV   Y LDFL DKES+++CKKKL+K +V +FR AV +DYYFQMYYDDLP+WG IG+VD+
Sbjct  81   LVSGPYSLDFLVDKESDLLCKKKLTKEEVSQFRKAVEKDYYFQMYYDDLPIWGLIGRVDR  140

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EG+++  +Y+YYL++H+HF+I YNKD++++I AR D  +++D+T DKE+D +F YSVKW 
Sbjct  141  EGRAE-KDYRYYLYEHVHFDIQYNKDRVIDITARMDLHSVLDLTEDKEVDAEFTYSVKWN  199

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+ PFEKRM+K++Q S+LP HLEIHWF
Sbjct  200  ETDIPFEKRMDKYAQNSSLPHHLEIHWF  227



>ref|XP_004240860.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Solanum 
lycopersicum]
 ref|XP_010322124.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Solanum 
lycopersicum]
Length=591

 Score =   298 bits (762),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 170/208 (82%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            +SDAS HRYK GD+V  YANKVGPF NPSETY Y DLPFC P N+EKK E+ GE LNGDR
Sbjct  22   QSDASTHRYKSGDDVPFYANKVGPFSNPSETYAYFDLPFCQPDNLEKKKESFGEPLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            L+ + YKL+FLA+K+++V+CKK+L+K +V +FR AVA DYY QMYYDDLP+W ++GKV+K
Sbjct  82   LIFAPYKLEFLAEKDAKVICKKRLTKEEVAQFRTAVALDYYVQMYYDDLPIWAFLGKVEK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            +G  DP+EY+Y+++    FEI+Y+KD ++EI+ R DPS   D+T D+E+DV+F+Y+V WK
Sbjct  142  DGIDDPNEYRYHIYTFYQFEIYYHKDHVIEILVRVDPSFTADVTNDEEVDVEFLYTVVWK  201

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ETN PFEKRM+K++  SALP HLEIHWF
Sbjct  202  ETNIPFEKRMDKYTSSSALPHHLEIHWF  229



>ref|XP_010036999.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW48635.1| hypothetical protein EUGRSUZ_K02293 [Eucalyptus grandis]
Length=592

 Score =   298 bits (762),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 169/207 (82%), Gaps = 1/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            S  S+HRY++ D V LYANKVGPFHNPSETY Y DLP+C+P  ++ K EALGEVLNGDRL
Sbjct  25   SSPSNHRYEERDPVPLYANKVGPFHNPSETYRYFDLPYCTPDQMKDKKEALGEVLNGDRL  84

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + + L+FL +KE EVVCKK LSK++V +FR A+ +DYYFQMYYDDLP+WG+IGKVDKE
Sbjct  85   VSAPFDLNFLTNKEYEVVCKKTLSKAEVARFRSAIIQDYYFQMYYDDLPIWGFIGKVDKE  144

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             + DPSEYKY L+KH+ FEIFYNK++++EI  R DP+++ D+T DKE+D  FMYS KWKE
Sbjct  145  DR-DPSEYKYLLYKHIIFEIFYNKNRVIEINVRTDPNSVADLTEDKEVDFQFMYSAKWKE  203

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T   FEKRM+K+S  S+LP HLEIHWF
Sbjct  204  TTITFEKRMDKYSHSSSLPHHLEIHWF  230



>gb|ERN11066.1| hypothetical protein AMTR_s00024p00115620 [Amborella trichopoda]
Length=591

 Score =   297 bits (761),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 174/211 (82%), Gaps = 3/211 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            +SDAS+H+YK GD V LY NKVGPFHNPSETY Y DLPFC PA++ +K EALGEVLNGDR
Sbjct  19   QSDASNHKYKPGDPVPLYVNKVGPFHNPSETYRYFDLPFCPPAHLTEKKEALGEVLNGDR  78

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF  DK+S+VVCKK+LS+ +V  FR+AV +DYYFQM YDDLP+WG++GK++K
Sbjct  79   LVEAAYKLDFRVDKDSDVVCKKRLSRDEVASFRNAVIKDYYFQMIYDDLPLWGFVGKIEK  138

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARA---DPSAMVDITMDKELDVDFMYSV  746
            + K+D  E++Y L+KH+HFE  YNKD+I+EI  +A   +P+ +VD+T DK +D++  YSV
Sbjct  139  DIKADVPEFRYLLYKHIHFEAIYNKDRIIEISVQAIQGEPNHLVDVTEDKGIDLELTYSV  198

Query  747  KWKETNTPFEKRMEKFSQISALPQHLEIHWF  839
            KWKET+TPFEKRM K+S+ SALP HLEIHWF
Sbjct  199  KWKETDTPFEKRMGKYSKTSALPHHLEIHWF  229



>ref|XP_006849485.2| PREDICTED: transmembrane 9 superfamily member 2 [Amborella trichopoda]
 ref|XP_011625259.1| PREDICTED: transmembrane 9 superfamily member 2 [Amborella trichopoda]
 ref|XP_011625260.1| PREDICTED: transmembrane 9 superfamily member 2 [Amborella trichopoda]
Length=595

 Score =   297 bits (761),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 136/211 (64%), Positives = 174/211 (82%), Gaps = 3/211 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            +SDAS+H+YK GD V LY NKVGPFHNPSETY Y DLPFC PA++ +K EALGEVLNGDR
Sbjct  23   QSDASNHKYKPGDPVPLYVNKVGPFHNPSETYRYFDLPFCPPAHLTEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF  DK+S+VVCKK+LS+ +V  FR+AV +DYYFQM YDDLP+WG++GK++K
Sbjct  83   LVEAAYKLDFRVDKDSDVVCKKRLSRDEVASFRNAVIKDYYFQMIYDDLPLWGFVGKIEK  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARA---DPSAMVDITMDKELDVDFMYSV  746
            + K+D  E++Y L+KH+HFE  YNKD+I+EI  +A   +P+ +VD+T DK +D++  YSV
Sbjct  143  DIKADVPEFRYLLYKHIHFEAIYNKDRIIEISVQAIQGEPNHLVDVTEDKGIDLELTYSV  202

Query  747  KWKETNTPFEKRMEKFSQISALPQHLEIHWF  839
            KWKET+TPFEKRM K+S+ SALP HLEIHWF
Sbjct  203  KWKETDTPFEKRMGKYSKTSALPHHLEIHWF  233



>gb|KHN41041.1| Putative phagocytic receptor 1b [Glycine soja]
Length=588

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 166/207 (80%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDASDHRY +GD V  YANKVGPFHNPSETY Y DLPFCSPANVE+K E LGEVLNGDRL
Sbjct  20   SDASDHRYMKGDSVPFYANKVGPFHNPSETYRYFDLPFCSPANVEEKREDLGEVLNGDRL  79

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D E E  CKK+L+  +V +FRHAV +DY++QMYYDDLP+WG++GK D E
Sbjct  80   VAAPYKLDFQIDIEPESYCKKRLTIKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGKFDSE  139

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             K D S    +LFKH+HFEI YNKD+I+++  R DP A+VD+T +KE++VDF YS KW E
Sbjct  140  DKDDQSGAIVHLFKHVHFEILYNKDRIIDVFIRNDPQAVVDLTENKEVEVDFTYSAKWVE  199

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T+TPFEKR+EK+SQ S+L  +LEIHWF
Sbjct  200  TDTPFEKRLEKYSQTSSLSHNLEIHWF  226



>ref|XP_003518365.2| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Glycine 
max]
Length=592

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/207 (66%), Positives = 166/207 (80%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDASDHRY +GD V  YANKVGPFHNPSETY Y DLPFCSPANVE+K E LGEVLNGDRL
Sbjct  24   SDASDHRYMKGDSVPFYANKVGPFHNPSETYRYFDLPFCSPANVEEKREDLGEVLNGDRL  83

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D E E  CKK+L+  +V +FRHAV +DY++QMYYDDLP+WG++GK D E
Sbjct  84   VAAPYKLDFQIDIEPESYCKKRLTIKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGKFDSE  143

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             K D S    +LFKH+HFEI YNKD+I+++  R DP A+VD+T +KE++VDF YS KW E
Sbjct  144  DKDDQSGAIVHLFKHVHFEILYNKDRIIDVFIRNDPQAVVDLTENKEVEVDFTYSAKWVE  203

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T+TPFEKR+EK+SQ S+L  +LEIHWF
Sbjct  204  TDTPFEKRLEKYSQTSSLSHNLEIHWF  230



>ref|XP_004490795.1| PREDICTED: putative phagocytic receptor 1b-like [Cicer arietinum]
Length=593

 Score =   296 bits (759),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/208 (63%), Positives = 171/208 (82%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            +SD+ DHRYK+GD V  YANKVGPFHNPSETY Y DLPFC+P NVE+K E LGEVLNGDR
Sbjct  24   KSDSLDHRYKEGDFVPFYANKVGPFHNPSETYRYFDLPFCAPDNVEEKKEDLGEVLNGDR  83

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YK+DFL +K+ E +C KKL++++V +FRHAV +DY++QMYYDDLP+WG++G+ + 
Sbjct  84   LVVAPYKMDFLINKKPESICGKKLTRNEVAQFRHAVLKDYFYQMYYDDLPIWGFLGRFEN  143

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            + K D +E   YLF+H+HFEI YNKD I+++  R DP+A+VD+T D+E+DVDF YSV+W 
Sbjct  144  DDKDDTNEATVYLFRHVHFEILYNKDNIIDVFIRNDPNAVVDLTEDREVDVDFTYSVRWT  203

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            +T+ PFEKR+EK+SQ S+L  HLEIHWF
Sbjct  204  QTDIPFEKRLEKYSQTSSLSHHLEIHWF  231



>ref|XP_006358745.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=591

 Score =   294 bits (753),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 168/208 (81%), Gaps = 0/208 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            +SDAS HRYK GD+V  YANKVGP+ NPSETY Y DLPFC P N+EKK E+ GE LNGD 
Sbjct  22   QSDASTHRYKSGDDVPFYANKVGPYFNPSETYAYFDLPFCQPDNLEKKKESFGEALNGDH  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            L  + YKL+FLADK+++V+CKK+L+K +V +FR AVA DYY QMYYDDLP+W ++GKVDK
Sbjct  82   LTFAPYKLEFLADKDAKVICKKRLTKEEVAQFRTAVALDYYVQMYYDDLPIWAFLGKVDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            +G  DP+EY+Y+++    FEI+Y+KD ++EI+ R DPS   D+T D+E+D++F+Y+V WK
Sbjct  142  DGIDDPNEYRYHIYTFYQFEIYYHKDHVIEILVRVDPSFTADVTNDEEVDIEFLYTVVWK  201

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ETN PFEKRM+K++  S+LP HLEIHWF
Sbjct  202  ETNIPFEKRMDKYTSSSSLPHHLEIHWF  229



>ref|XP_010910475.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X3 [Elaeis guineensis]
Length=515

 Score =   291 bits (744),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 169/207 (82%), Gaps = 1/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K EALGEVLNGDRL
Sbjct  23   ADGSDHRYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCSPEHVTEKKEALGEVLNGDRL  82

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  DK+S  +C K LSK +V + R+AV++DYYFQMYYDDLP WG++GKV+K+
Sbjct  83   VDAPYELNFREDKQSISLCTKTLSKENVAELRNAVSKDYYFQMYYDDLPFWGFLGKVEKD  142

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             K DP+E KY LFKH+HFEI YN D+++EI  + DP+  VDIT DKE+DV+F YSV WK+
Sbjct  143  -KLDPNENKYLLFKHIHFEILYNDDRVIEINVQTDPNLSVDITEDKEVDVEFSYSVTWKK  201

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T+ PFE RM+K+ + S +PQHLEIHWF
Sbjct  202  TDIPFENRMDKYKKSSFMPQHLEIHWF  228



>ref|XP_002521900.1| transporter, putative [Ricinus communis]
 gb|EEF40536.1| transporter, putative [Ricinus communis]
Length=588

 Score =   292 bits (747),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 132/208 (63%), Positives = 172/208 (83%), Gaps = 6/208 (3%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK GD V LYANKVGPFHNPSETY Y DLPFC P ++++K+EALGEVLNGDR
Sbjct  25   RSDASDHRYKDGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDHLKEKTEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K++ VVC+KKL+K +V +FR AV +DYYFQMYYDDLPVWG+IGK+DK
Sbjct  85   LVSAPYKLNFRDEKDTAVVCRKKLTKEEVGRFRSAVDKDYYFQMYYDDLPVWGFIGKIDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            +      + KY+L+KH+ F++ YNKD+++E+  R DP +++D+T DK +D +F+Y+VKWK
Sbjct  145  Q------DNKYFLYKHIQFDVLYNKDRVIEVNTRMDPQSLLDLTEDKNVDAEFLYTVKWK  198

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+ PFEKRM+K+S  S+LP HLEIHWF
Sbjct  199  ETDIPFEKRMDKYSFSSSLPHHLEIHWF  226



>ref|XP_010910474.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X2 [Elaeis guineensis]
Length=554

 Score =   291 bits (744),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 169/207 (82%), Gaps = 1/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K EALGEVLNGDRL
Sbjct  23   ADGSDHRYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCSPEHVTEKKEALGEVLNGDRL  82

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  DK+S  +C K LSK +V + R+AV++DYYFQMYYDDLP WG++GKV+K+
Sbjct  83   VDAPYELNFREDKQSISLCTKTLSKENVAELRNAVSKDYYFQMYYDDLPFWGFLGKVEKD  142

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             K DP+E KY LFKH+HFEI YN D+++EI  + DP+  VDIT DKE+DV+F YSV WK+
Sbjct  143  -KLDPNENKYLLFKHIHFEILYNDDRVIEINVQTDPNLSVDITEDKEVDVEFSYSVTWKK  201

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T+ PFE RM+K+ + S +PQHLEIHWF
Sbjct  202  TDIPFENRMDKYKKSSFMPQHLEIHWF  228



>ref|XP_006575472.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Glycine 
max]
Length=594

 Score =   291 bits (746),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/209 (66%), Positives = 166/209 (79%), Gaps = 2/209 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPA--NVEKKSEALGEVLNGD  392
            SDASDHRY +GD V  YANKVGPFHNPSETY Y DLPFCSPA  NVE+K E LGEVLNGD
Sbjct  24   SDASDHRYMKGDSVPFYANKVGPFHNPSETYRYFDLPFCSPAAANVEEKREDLGEVLNGD  83

Query  393  RLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVD  572
            RLV + YKLDF  D E E  CKK+L+  +V +FRHAV +DY++QMYYDDLP+WG++GK D
Sbjct  84   RLVAAPYKLDFQIDIEPESYCKKRLTIKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGKFD  143

Query  573  KEGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKW  752
             E K D S    +LFKH+HFEI YNKD+I+++  R DP A+VD+T +KE++VDF YS KW
Sbjct  144  SEDKDDQSGAIVHLFKHVHFEILYNKDRIIDVFIRNDPQAVVDLTENKEVEVDFTYSAKW  203

Query  753  KETNTPFEKRMEKFSQISALPQHLEIHWF  839
             ET+TPFEKR+EK+SQ S+L  +LEIHWF
Sbjct  204  VETDTPFEKRLEKYSQTSSLSHNLEIHWF  232



>ref|XP_008813153.1| PREDICTED: putative phagocytic receptor 1b [Phoenix dactylifera]
Length=590

 Score =   291 bits (745),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/207 (66%), Positives = 170/207 (82%), Gaps = 1/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K EALGEVLNGDRL
Sbjct  23   ADESDHRYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCSPEHVTEKKEALGEVLNGDRL  82

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  DK+S  +CKK LSK  V + R+AV++DYYFQMYYDDLP WG++GKV+K+
Sbjct  83   VDAPYELNFREDKQSMSLCKKTLSKEKVAELRNAVSKDYYFQMYYDDLPFWGFLGKVEKD  142

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             K DPSE KY LFKH+HF+I Y+ D+++EI  + DP+  VDIT DKE+DV+F YSV WK+
Sbjct  143  -KPDPSENKYLLFKHIHFDILYSGDRVIEINVQTDPNLSVDITEDKEVDVEFSYSVTWKK  201

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T+ PFEKRM+K+ + S +PQHLEIHWF
Sbjct  202  TDIPFEKRMDKYKKSSFMPQHLEIHWF  228



>ref|XP_010910473.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Elaeis guineensis]
Length=590

 Score =   291 bits (744),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 169/207 (82%), Gaps = 1/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFCSP +V +K EALGEVLNGDRL
Sbjct  23   ADGSDHRYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCSPEHVTEKKEALGEVLNGDRL  82

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  DK+S  +C K LSK +V + R+AV++DYYFQMYYDDLP WG++GKV+K+
Sbjct  83   VDAPYELNFREDKQSISLCTKTLSKENVAELRNAVSKDYYFQMYYDDLPFWGFLGKVEKD  142

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             K DP+E KY LFKH+HFEI YN D+++EI  + DP+  VDIT DKE+DV+F YSV WK+
Sbjct  143  -KLDPNENKYLLFKHIHFEILYNDDRVIEINVQTDPNLSVDITEDKEVDVEFSYSVTWKK  201

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T+ PFE RM+K+ + S +PQHLEIHWF
Sbjct  202  TDIPFENRMDKYKKSSFMPQHLEIHWF  228



>ref|XP_003544357.1| PREDICTED: putative phagocytic receptor 1b-like [Glycine max]
Length=593

 Score =   290 bits (743),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 165/207 (80%), Gaps = 0/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDASDHRY +GD V  YANKVGPFHNPSETY Y DLPFCSPANVE+K E LGEVLNGDRL
Sbjct  24   SDASDHRYMKGDFVPFYANKVGPFHNPSETYRYFDLPFCSPANVEEKREDLGEVLNGDRL  83

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D E E +C K+L+  +V +FRHAV +DY++QMYYDDLP+WG++GK D E
Sbjct  84   VVAPYKLDFQIDIEPESICTKRLTIKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGKFDSE  143

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             K D +    +LFKH+HFEI YNKD+I+++  + DP A+VD+T +KE++VDF YS  W E
Sbjct  144  DKDDQTGAIVHLFKHVHFEILYNKDRIIDVFIQNDPQAVVDLTENKEVEVDFTYSATWVE  203

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T+TPFEKR+EK+SQ S+L  +LEIHWF
Sbjct  204  TDTPFEKRLEKYSQTSSLSHNLEIHWF  230



>gb|AES99151.2| transmembrane 9 family protein [Medicago truncatula]
Length=591

 Score =   290 bits (743),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 170/208 (82%), Gaps = 1/208 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDASDHRYK+GD V  YANKVGPFHNPSETY Y DLPFCSP NVE+K E LGEVLNGDRL
Sbjct  22   SDASDHRYKEGDFVPFYANKVGPFHNPSETYRYFDLPFCSPENVEEKKEDLGEVLNGDRL  81

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL DK+ E +C+K L++ +V +FRHAV +DY++QMYYDDLP+WG++G+ + +
Sbjct  82   VVAPYKLEFLIDKKPESICQKMLTRKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGRFETD  141

Query  579  GK-SDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
             K  D +E   YLF+++HFEI YN D+I+++  + DP+A+VD+T D+E++VDF YSVKW 
Sbjct  142  EKDVDTNEATVYLFRNVHFEILYNNDRIIDVFVKNDPNAVVDLTEDREVNVDFTYSVKWI  201

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+ PFEKR+EK+SQ S+L  HLEIHWF
Sbjct  202  ETDIPFEKRLEKYSQTSSLSHHLEIHWF  229



>gb|KHG20583.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=589

 Score =   290 bits (741),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 166/208 (80%), Gaps = 3/208 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RS ASDHRYK GDEV LYANKVGPF NPSETY Y D PFCS   +++K EA GEVLNGDR
Sbjct  23   RSSASDHRYKAGDEVPLYANKVGPFGNPSETYRYFDFPFCSSVPLKEKKEAFGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV   Y++DFL +K++E+ CK+KLSK +V +FR A+++DYYFQMY+DDLP WG+ GKVD 
Sbjct  83   LVSGPYRIDFLREKDAEIACKRKLSKEEVARFRTAISKDYYFQMYFDDLPFWGFFGKVDN  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
             GK+DPS+ KYYL+KHL FEIFYNKD+++EI  R DP A+VD+T D+ +DVDFMY+VKWK
Sbjct  143  VGKADPSDCKYYLYKHLVFEIFYNKDRVIEINVRIDPRAVVDVTGDEPVDVDFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            E + PFEKR++K+   S+L Q   I WF
Sbjct  203  EIDVPFEKRLDKYKSSSSLRQ---IQWF  227



>ref|XP_009408099.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=589

 Score =   289 bits (740),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 135/207 (65%), Positives = 168/207 (81%), Gaps = 1/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D  DHRYK+GD V LYANKVGPFHNPSETY ++DLPFCSP +V +K EALGEVLNGDRL
Sbjct  22   ADGRDHRYKEGDHVPLYANKVGPFHNPSETYRFYDLPFCSPDHVTEKKEALGEVLNGDRL  81

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  +K S+ +CKK LSK DV K R AV++DYYFQMYYDDLP+WG++G++ K+
Sbjct  82   VDAPYELNFREEKRSKSLCKKALSKKDVGKLRDAVSKDYYFQMYYDDLPLWGFLGRIKKD  141

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             K+D S+ KY LFKH+HFEI YN D ++EI  +ADP+  VDIT DKE++V+F YSV WK+
Sbjct  142  -KTDSSKSKYLLFKHIHFEILYNGDHVIEINVQADPNLSVDITDDKEINVEFSYSVSWKK  200

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T  PFEKRMEK+S+ S LP HLEIHWF
Sbjct  201  TEVPFEKRMEKYSKSSFLPHHLEIHWF  227



>ref|XP_003616193.1| Transmembrane 9 superfamily protein member [Medicago truncatula]
Length=682

 Score =   291 bits (744),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 170/208 (82%), Gaps = 1/208 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SDASDHRYK+GD V  YANKVGPFHNPSETY Y DLPFCSP NVE+K E LGEVLNGDRL
Sbjct  22   SDASDHRYKEGDFVPFYANKVGPFHNPSETYRYFDLPFCSPENVEEKKEDLGEVLNGDRL  81

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKL+FL DK+ E +C+K L++ +V +FRHAV +DY++QMYYDDLP+WG++G+ + +
Sbjct  82   VVAPYKLEFLIDKKPESICQKMLTRKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGRFETD  141

Query  579  GK-SDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
             K  D +E   YLF+++HFEI YN D+I+++  + DP+A+VD+T D+E++VDF YSVKW 
Sbjct  142  EKDVDTNEATVYLFRNVHFEILYNNDRIIDVFVKNDPNAVVDLTEDREVNVDFTYSVKWI  201

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+ PFEKR+EK+SQ S+L  HLEIHWF
Sbjct  202  ETDIPFEKRLEKYSQTSSLSHHLEIHWF  229



>gb|KJB15313.1| hypothetical protein B456_002G170500 [Gossypium raimondii]
Length=560

 Score =   288 bits (736),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 158/182 (87%), Gaps = 0/182 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFCSP +V++K EALGEVLNGDR
Sbjct  25   RSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCSPDHVKEKKEALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+S VVCKKKLSK +V  FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  85   LVSAPYKLNFREEKDSSVVCKKKLSKDEVVFFRKAVEKDYYFQMYYDDLPIWGFIGKVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK+DPSEYKYYL+KH+ F++ YNKD+++EI AR DP  +VD+T DKE+D +FMY+VKWK
Sbjct  145  EGKADPSEYKYYLYKHIQFDVLYNKDRVIEISARMDPHLLVDLTEDKEVDAEFMYTVKWK  204

Query  756  ET  761
            ET
Sbjct  205  ET  206



>ref|XP_009784369.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
sylvestris]
Length=595

 Score =   288 bits (737),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 133/209 (64%), Positives = 170/209 (81%), Gaps = 4/209 (2%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSP--ANVEKKSEALGEVLNGDR  395
            DASDHRYK+GD V LYANKVGPFHNPSE+Y Y+DLPFC P    +E+K EALGEVLNGDR
Sbjct  26   DASDHRYKRGDPVPLYANKVGPFHNPSESYRYYDLPFCIPDKVKLEEKKEALGEVLNGDR  85

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKV-D  572
            LV   Y LDFL +K+ E++C+KKL+K +V +FR AV +DYYF+MYYD+LP+WG IG+V +
Sbjct  86   LVSGPYALDFLVEKDMEILCRKKLTKEEVAQFRRAVDKDYYFEMYYDELPIWGLIGRVEN  145

Query  573  KEGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKW  752
            +E   DP +YKYYL+KH+HF+I YNKD+++EI AR DP +++D+T DKE+D +F Y+ KW
Sbjct  146  REETDDPKDYKYYLYKHIHFDILYNKDRVIEITARTDPHSVLDLTEDKEVDGEFTYTAKW  205

Query  753  KETNTPFEKRMEKFSQISALPQHLEIHWF  839
            K+T+  FE RM+KFSQ S LP HLEIHWF
Sbjct  206  KQTDILFENRMDKFSQTS-LPHHLEIHWF  233



>ref|XP_009388099.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
 ref|XP_009388100.1| PREDICTED: putative phagocytic receptor 1b [Musa acuminata subsp. 
malaccensis]
Length=586

 Score =   288 bits (736),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 168/207 (81%), Gaps = 1/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK+GD V LYANKVGPFHNPSETY ++DLPFCSP +V +K EALGEVLNGDRL
Sbjct  19   ADGSDHRYKEGDHVPLYANKVGPFHNPSETYRFYDLPFCSPGHVTEKKEALGEVLNGDRL  78

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  +K+++ +CK+ LS+ DV K R AV++DYYFQMYYDDLP+WG++G+++K 
Sbjct  79   VDAPYELNFREEKQAKSLCKRTLSEGDVGKLRDAVSKDYYFQMYYDDLPLWGFLGRIEKN  138

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             K D SE+KY LF H+HFEI YN D+++ I  + DP+  VDIT DKE+DV+F YSV WK+
Sbjct  139  -KLDSSEFKYLLFLHIHFEILYNDDRVIVINVQTDPNLSVDITDDKEVDVEFSYSVSWKK  197

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T  PFEKRMEK+S+ S +P HLEIHWF
Sbjct  198  TEIPFEKRMEKYSKTSFMPHHLEIHWF  224



>ref|XP_003573450.1| PREDICTED: putative phagocytic receptor 1b [Brachypodium distachyon]
Length=588

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/207 (64%), Positives = 167/207 (81%), Gaps = 2/207 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFC+P + + K EALGEVLNGDRL
Sbjct  22   ADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCAPEHPKDKKEALGEVLNGDRL  81

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  DK S+ +CKK LSK +V K R AVA+DYYFQMYYDDLP+WG++GK++K+
Sbjct  82   VDAPYELNFKEDKNSKTLCKKTLSKEEVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLEKD  141

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             +      KY LFKH+HF+I YN D++VEI  + DP+  VDIT DKE+ V+F YSV WK+
Sbjct  142  KEQGAG--KYLLFKHIHFDIMYNNDRVVEINVQTDPNVAVDITEDKEVPVEFSYSVAWKK  199

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T+ PFEKRMEK+S+ S++PQHLEIHWF
Sbjct  200  TDIPFEKRMEKYSKSSSMPQHLEIHWF  226



>gb|EEC82941.1| hypothetical protein OsI_27915 [Oryza sativa Indica Group]
Length=592

 Score =   287 bits (734),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 168/208 (81%), Gaps = 2/208 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            R+D SDHRYK GD V LYANKVGPFHNPSETY Y+DLPFC+P + + K EALGEVLNGDR
Sbjct  25   RADGSDHRYKDGDYVPLYANKVGPFHNPSETYRYYDLPFCAPDHPKDKREALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  D+ S+V+C+K LSK +V K R AVA+DYYFQMYYDDLP+WG++GK+DK
Sbjct  85   LVDAPYELNFKEDRNSKVLCQKSLSKVEVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            +   +    KY LFKH+HF+I YN D+++EI  + DP+  VDIT DKE+ V+F YSV WK
Sbjct  145  D--KEQGNAKYLLFKHIHFDIMYNGDRVIEINVQTDPNVAVDITEDKEVQVEFSYSVTWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            +T+ PFEKRMEK+S+ S++PQHLEIHWF
Sbjct  203  KTDIPFEKRMEKYSKSSSMPQHLEIHWF  230



>gb|KJB43179.1| hypothetical protein B456_007G188200 [Gossypium raimondii]
 gb|KJB43180.1| hypothetical protein B456_007G188200 [Gossypium raimondii]
Length=589

 Score =   285 bits (729),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 131/208 (63%), Positives = 166/208 (80%), Gaps = 3/208 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RS ASDHRYK GDEV LYANKVGPF NPSETY Y D PFCSP  +++K EALGEVLNGDR
Sbjct  23   RSSASDHRYKAGDEVPLYANKVGPFGNPSETYRYFDFPFCSPVPLKEKKEALGEVLNGDR  82

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV   Y++DFL++K++E+ CK+KLSK +V +FR A+++DYYFQMY+DDLP WG+ GKV  
Sbjct  83   LVSGPYRIDFLSEKDAEIACKRKLSKEEVARFRTAISKDYYFQMYFDDLPFWGFFGKVYN  142

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
             GK+DPS+ KYYL+KH  F+IFYNKD+++EI  R D  A+VD+T D+ +DVDFMY+VKWK
Sbjct  143  VGKADPSDCKYYLYKHPVFQIFYNKDRVIEINVRMDTRAVVDVTGDEPVDVDFMYTVKWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            E + PFEKR++K+   S+L Q   I WF
Sbjct  203  EIDVPFEKRLDKYKSSSSLRQ---IQWF  227



>ref|XP_010037000.1| PREDICTED: putative phagocytic receptor 1b [Eucalyptus grandis]
 gb|KCW48638.1| hypothetical protein EUGRSUZ_K02296 [Eucalyptus grandis]
Length=592

 Score =   285 bits (728),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 162/207 (78%), Gaps = 1/207 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            S  S  RYK+G+ V LYANKVGPFHNPSETY Y DLP+C+P  V++K E LGEVLNGDRL
Sbjct  25   SSPSGQRYKEGEPVPLYANKVGPFHNPSETYRYFDLPYCTPDRVKEKKETLGEVLNGDRL  84

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + +KL+FL  KE EV C+K LSK +V +FR A+ +DYYFQMYYDDLP+WG+IG +DK+
Sbjct  85   VSAPFKLEFLVSKEDEVACRKTLSKVEVARFRTAIIQDYYFQMYYDDLPIWGFIGMIDKD  144

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
            G+ DP+EYKY LFK + FEIFYNKD+++EI  R DP ++ D+T DKE+D  FMYS KWKE
Sbjct  145  GR-DPNEYKYLLFKRVIFEIFYNKDRVIEITVRTDPKSIADLTEDKEVDFQFMYSAKWKE  203

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T  P+EKRM+K++  S  P HLEIH F
Sbjct  204  TIIPYEKRMDKYTWSSFSPYHLEIHLF  230



>ref|NP_001148367.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACG31130.1| transmembrane 9 superfamily protein member 1 precursor [Zea mays]
 gb|ACN29105.1| unknown [Zea mays]
 gb|AFW57246.1| putative Transmembrane 9 family protein member 1 [Zea mays]
Length=589

 Score =   283 bits (723),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/208 (62%), Positives = 168/208 (81%), Gaps = 2/208 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            R+D SDH+YK+GD V LYANKVGPFHNPSETY Y+DLPFC+P + + K EALGEVLNGDR
Sbjct  22   RADGSDHKYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCAPEHPKDKKEALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  D+ S+V+CKK LSK  V K R AVA+DYYFQMYYDDLP+WG++GK+DK
Sbjct  82   LVDAPYELNFKEDRNSKVLCKKVLSKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            +   +  + KY LFKH+HF+I YN ++++EI  + DP+  VDIT DKE+ ++F YS  WK
Sbjct  142  D--KEQGDVKYLLFKHIHFDIMYNDNRVIEINVQTDPNVAVDITEDKEVPIEFSYSATWK  199

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            +T+ PFEKRM+K+S+ S++PQHLEIHWF
Sbjct  200  KTDIPFEKRMDKYSKSSSMPQHLEIHWF  227



>gb|ABR16201.1| unknown [Picea sitchensis]
Length=585

 Score =   282 bits (722),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/204 (65%), Positives = 161/204 (79%), Gaps = 3/204 (1%)
 Frame = +3

Query  228  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHS  407
            SDH+Y +GD V LYANKVGPF NPSETY Y DLPFC P ++ +K E LGEVLNGDR+V +
Sbjct  23   SDHKYSKGDHVPLYANKVGPFQNPSETYRYFDLPFCQPEHMTEKREDLGEVLNGDRMVDA  82

Query  408  LYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKS  587
             YKLDF  DKESEV+CKKK    DV KFR AV   YYFQMYYDDLP+WG+IGKV+KE K 
Sbjct  83   QYKLDFNVDKESEVLCKKKFKAEDVAKFREAVKNSYYFQMYYDDLPLWGFIGKVEKESKI  142

Query  588  DPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKETNT  767
            D    KY LF HLHF+I +NKD+++EI  R DPS  VDIT DKE++++F+YSVKW ET+ 
Sbjct  143  DQ---KYSLFTHLHFDIKFNKDRVIEISVRTDPSFTVDITEDKEVEIEFVYSVKWAETDV  199

Query  768  PFEKRMEKFSQISALPQHLEIHWF  839
            PF++RM+ +S+ S+LPQHLEIHWF
Sbjct  200  PFKRRMDVYSKSSSLPQHLEIHWF  223



>gb|EEE68090.1| hypothetical protein OsJ_26137 [Oryza sativa Japonica Group]
Length=864

 Score =   288 bits (738),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 133/208 (64%), Positives = 168/208 (81%), Gaps = 2/208 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            R+D SDHRYK GD V LYANKVGPFHNPSETY Y+DLPFC+P + + K EALGEVLNGDR
Sbjct  25   RADGSDHRYKDGDYVPLYANKVGPFHNPSETYRYYDLPFCAPDHPKDKREALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  D+ S+V+C+K LSK +V K R AVA+DYYFQMYYDDLP+WG++GK+DK
Sbjct  85   LVDAPYELNFKEDRNSKVLCQKSLSKVEVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            +   +    KY LFKH+HF+I YN D+++EI  + DP+  VDIT DKE+ V+F YSV WK
Sbjct  145  D--KEQGNAKYLLFKHIHFDIMYNGDRVIEINVQTDPNVAVDITEDKEVQVEFSYSVTWK  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            +T+ PFEKRMEK+S+ S++PQHLEIHWF
Sbjct  203  KTDIPFEKRMEKYSKSSSMPQHLEIHWF  230



>ref|XP_009615617.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Nicotiana 
tomentosiformis]
Length=596

 Score =   283 bits (723),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 133/210 (63%), Positives = 169/210 (80%), Gaps = 5/210 (2%)
 Frame = +3

Query  222  DASD-HRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSP--ANVEKKSEALGEVLNGD  392
            DASD HRYK+GD V LYANKVGPFHNPSE+Y Y+DLPFC P    +E+K EALGEVLNGD
Sbjct  26   DASDDHRYKRGDPVPLYANKVGPFHNPSESYRYYDLPFCIPDKVKLEEKKEALGEVLNGD  85

Query  393  RLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKV-  569
            RLV   Y LDFL +K+SE++C+KKL+K +V +FR AV +DYYF+MYYDDLP+WG IG+V 
Sbjct  86   RLVSGPYALDFLVEKDSEILCRKKLTKEEVAQFRKAVDKDYYFEMYYDDLPIWGLIGRVE  145

Query  570  DKEGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVK  749
            +KE   DP +YKY+++KH+HF+I YNKD ++EI AR DP +++D+T DKE+D +F Y+ K
Sbjct  146  NKEETEDPKDYKYFMYKHIHFDIHYNKDHVIEITARTDPHSVLDLTEDKEVDAEFTYTAK  205

Query  750  WKETNTPFEKRMEKFSQISALPQHLEIHWF  839
            WK+T+  FE RM+KF Q S LP HLEIHWF
Sbjct  206  WKQTDILFENRMDKFLQTS-LPHHLEIHWF  234



>ref|XP_008356706.1| PREDICTED: transmembrane 9 superfamily member 3-like isoform 
X2 [Malus domestica]
Length=421

 Score =   276 bits (707),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 127/200 (64%), Positives = 159/200 (80%), Gaps = 12/200 (6%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V LYANKVGPFHNPSE Y Y DLPFCSP  V +K EALG       
Sbjct  25   RSDGSDHRYKEGDFVPLYANKVGPFHNPSEAYGYFDLPFCSPDAVTEKGEALG-------  77

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
                 YKL+FL  K+ EV CKK L+K +V +FR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  78   -----YKLEFLRHKDPEVACKKTLTKEEVGRFRSAVNKDYYFQMYYDDLPIWGFIGKVDK  132

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK  PSEYK YL+KH+HF+++YNKD+++E+  R DP+A+ D++ DKE+DV+FMY+V+WK
Sbjct  133  EGKDPPSEYKTYLYKHIHFDLYYNKDRVIEVNVRTDPNALADLSEDKEVDVEFMYTVEWK  192

Query  756  ETNTPFEKRMEKFSQISALP  815
            ET TPF+KRM+K++Q S+LP
Sbjct  193  ETTTPFDKRMDKYAQSSSLP  212



>ref|XP_006659860.1| PREDICTED: putative phagocytic receptor 1b-like [Oryza brachyantha]
Length=590

 Score =   281 bits (719),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 167/207 (81%), Gaps = 2/207 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK  D V LYANKVGPFHNPSETY Y+DLPFC+P + + K EALGEVLNGDRL
Sbjct  24   ADGSDHRYKDRDYVPLYANKVGPFHNPSETYRYYDLPFCAPDHPKDKREALGEVLNGDRL  83

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  D+ S+++C+K LSK++V K R AVA+DYYFQMYYDDLP+WG++GK+DK+
Sbjct  84   VDAPYELNFKEDRTSKILCQKTLSKAEVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDKD  143

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
               +    KY LFKH+HF+I YN D+++EI  + DP+  VDIT DKE+ V+F YSV WK+
Sbjct  144  --KEQGNAKYLLFKHIHFDIMYNDDRVIEINVQTDPNVAVDITEDKEVQVEFSYSVTWKK  201

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T+ PFEKRMEK+S+ S++PQHLEIHWF
Sbjct  202  TDIPFEKRMEKYSKPSSMPQHLEIHWF  228



>ref|XP_004972769.1| PREDICTED: putative phagocytic receptor 1b-like isoform X2 [Setaria 
italica]
Length=589

 Score =   280 bits (717),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 168/208 (81%), Gaps = 2/208 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            R+D SDH+YK+GD V LYANKVGPFHNPSETY Y+DLPFC+P + + K EALGEVLNGDR
Sbjct  22   RADGSDHKYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCAPEHPKDKKEALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  DK S+++C+K L+K  V K R AVA+DYYFQMYYDDLP+WG++GK+DK
Sbjct  82   LVDAPYELNFKEDKNSKILCEKTLTKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKMDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            +   +  + KY LFKH+HF+I YN ++++EI  + DP+  VDIT DKE+ ++F YSV WK
Sbjct  142  D--REQGDAKYLLFKHIHFDIMYNDNRVIEINVQTDPNVAVDITEDKEVPIEFSYSVTWK  199

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            +T+  FEKRMEK+S+ S++PQHLEIHWF
Sbjct  200  KTDISFEKRMEKYSKSSSMPQHLEIHWF  227



>gb|EMT19161.1| Putative phagocytic receptor 1b [Aegilops tauschii]
Length=590

 Score =   280 bits (715),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 163/207 (79%), Gaps = 2/207 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK+GD V LYANKVGPFHNPSETY Y+DLPFC+P + + K EALGEVLNGDRL
Sbjct  24   ADGSDHRYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCAPEHPKDKREALGEVLNGDRL  83

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  D  S+ +CKK LSK  V K R AVA+DYYFQMYYDDLP+WG++GK+D+ 
Sbjct  84   VDAPYELNFKEDTNSKTLCKKTLSKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDRN  143

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             +      K  LFKH+HF+I YN D+++EI  + DP+  VDIT DKE+ V+F YSV WK+
Sbjct  144  KEHGGG--KCLLFKHIHFDIMYNNDRVIEINVQTDPNVAVDITEDKEVPVEFSYSVTWKK  201

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T+ PFEKRMEK+S+ S++PQHLEIHWF
Sbjct  202  TDIPFEKRMEKYSKSSSMPQHLEIHWF  228



>ref|NP_001064040.1| Os10g0112600 [Oryza sativa Japonica Group]
 gb|AAP51848.2| Endomembrane protein 70 containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF25954.1| Os10g0112600 [Oryza sativa Japonica Group]
 dbj|BAG94270.1| unnamed protein product [Oryza sativa Japonica Group]
Length=585

 Score =   279 bits (714),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 162/207 (78%), Gaps = 3/207 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            + A  HRY+ GD V LYANKVGPFHNPSETY Y DLPFC+P  V+ K EALGEVLNGDRL
Sbjct  20   AAADSHRYRPGDAVPLYANKVGPFHNPSETYRYFDLPFCAPEKVKDKIEALGEVLNGDRL  79

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +++ VC ++LSK DV KFRHAV++DYYFQMYYDDLP WG+IG   K 
Sbjct  80   VDAPYKLDFRVDFDAKSVCSRRLSKDDVVKFRHAVSKDYYFQMYYDDLPFWGFIGT--KP  137

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             K+D  + KYYL++H+ F+I YNKD+++EI    D +A+VD+T DKELDV+F+Y+ KWKE
Sbjct  138  EKADAGD-KYYLYRHIIFDILYNKDRVIEINVHTDQNAVVDLTEDKELDVEFLYTAKWKE  196

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T  PFEKRMEK+S  S +P HLE+HWF
Sbjct  197  TQIPFEKRMEKYSSSSVMPHHLEVHWF  223



>gb|AAK52585.1|AC079685_16 Putative endosomal protein [Oryza sativa Japonica Group]
 gb|AAM44876.1|AC098694_15 Putative endosomal protein [Oryza sativa Japonica Group]
 gb|EAZ15105.1| hypothetical protein OsJ_30519 [Oryza sativa Japonica Group]
Length=627

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 162/207 (78%), Gaps = 3/207 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            + A  HRY+ GD V LYANKVGPFHNPSETY Y DLPFC+P  V+ K EALGEVLNGDRL
Sbjct  17   AAADSHRYRPGDAVPLYANKVGPFHNPSETYRYFDLPFCAPEKVKDKIEALGEVLNGDRL  76

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +++ VC ++LSK DV KFRHAV++DYYFQMYYDDLP WG+IG   K 
Sbjct  77   VDAPYKLDFRVDFDAKSVCSRRLSKDDVVKFRHAVSKDYYFQMYYDDLPFWGFIGT--KP  134

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             K+D  + KYYL++H+ F+I YNKD+++EI    D +A+VD+T DKELDV+F+Y+ KWKE
Sbjct  135  EKADAGD-KYYLYRHIIFDILYNKDRVIEINVHTDQNAVVDLTEDKELDVEFLYTAKWKE  193

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T  PFEKRMEK+S  S +P HLE+HWF
Sbjct  194  TQIPFEKRMEKYSSSSVMPHHLEVHWF  220



>gb|EEC66468.1| hypothetical protein OsI_32547 [Oryza sativa Indica Group]
Length=631

 Score =   279 bits (714),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/207 (63%), Positives = 162/207 (78%), Gaps = 3/207 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            + A  HRY+ GD V LYANKVGPFHNPSETY Y DLPFC+P  V+ K EALGEVLNGDRL
Sbjct  21   AAADSHRYRPGDAVPLYANKVGPFHNPSETYRYFDLPFCAPEKVKDKIEALGEVLNGDRL  80

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +++ VC ++LSK DV KFRHAV++DYYFQMYYDDLP WG+IG   K 
Sbjct  81   VDAPYKLDFRVDFDAKSVCSRRLSKDDVVKFRHAVSKDYYFQMYYDDLPFWGFIGT--KP  138

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             K+D  + KYYL++H+ F+I YNKD+++EI    D +A+VD+T DKELDV+F+Y+ KWKE
Sbjct  139  EKADAGD-KYYLYRHIIFDILYNKDRVIEINVHTDQNAVVDLTEDKELDVEFLYTAKWKE  197

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T  PFEKRMEK+S  S +P HLE+HWF
Sbjct  198  TQIPFEKRMEKYSSSSVMPHHLEVHWF  224



>gb|EMS60954.1| Putative phagocytic receptor 1b [Triticum urartu]
Length=590

 Score =   278 bits (711),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/207 (62%), Positives = 163/207 (79%), Gaps = 2/207 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDH+YK+GD V LYANKVGPFHNPSETY Y+DLPFC+P + + K EALGEVLNGDRL
Sbjct  24   ADGSDHKYKEGDRVPLYANKVGPFHNPSETYRYYDLPFCAPEHPKDKREALGEVLNGDRL  83

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  D  S+ +CKK LSK  V K R AVA+DYYFQMYYDDLP+WG++GK+D+ 
Sbjct  84   VDAPYELNFKEDTNSKTLCKKTLSKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDRN  143

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             +      K  LFKH+HF+I YN D+++EI  + DP+  VDIT DKE+ V+F YSV WK+
Sbjct  144  KEHGGG--KCLLFKHIHFDIMYNNDRVIEINVQTDPNVAVDITEDKEVPVEFSYSVTWKK  201

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T+ PFEKRMEK+S+ S++PQHLEIHWF
Sbjct  202  TDIPFEKRMEKYSKSSSMPQHLEIHWF  228



>ref|XP_004972768.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Setaria 
italica]
Length=768

 Score =   281 bits (720),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/208 (62%), Positives = 168/208 (81%), Gaps = 2/208 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            R+D SDH+YK+GD V LYANKVGPFHNPSETY Y+DLPFC+P + + K EALGEVLNGDR
Sbjct  201  RADGSDHKYKEGDHVPLYANKVGPFHNPSETYRYYDLPFCAPEHPKDKKEALGEVLNGDR  260

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  DK S+++C+K L+K  V K R AVA+DYYFQMYYDDLP+WG++GK+DK
Sbjct  261  LVDAPYELNFKEDKNSKILCEKTLTKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKMDK  320

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            +   +  + KY LFKH+HF+I YN ++++EI  + DP+  VDIT DKE+ ++F YSV WK
Sbjct  321  D--REQGDAKYLLFKHIHFDIMYNDNRVIEINVQTDPNVAVDITEDKEVPIEFSYSVTWK  378

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            +T+  FEKRMEK+S+ S++PQHLEIHWF
Sbjct  379  KTDISFEKRMEKYSKSSSMPQHLEIHWF  406



>ref|XP_006661606.1| PREDICTED: putative phagocytic receptor 1b-like [Oryza brachyantha]
Length=586

 Score =   277 bits (708),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 130/207 (63%), Positives = 161/207 (78%), Gaps = 3/207 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            + A  HR++ GD V LYANKVGPFHNPSETY Y DLPFC+P  V+ K EALGEVLNGDRL
Sbjct  21   ATADSHRFRPGDAVPLYANKVGPFHNPSETYRYFDLPFCAPDKVKDKIEALGEVLNGDRL  80

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + YKLDF  D +++ VC KKL+K DV KFRHAV++DYYFQMYYDDLP+WG+IG   K 
Sbjct  81   VDAPYKLDFRVDYDAKFVCSKKLTKDDVIKFRHAVSKDYYFQMYYDDLPLWGFIGT--KP  138

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             K+D  + KYYL++HL F+I YN D ++EI    D + +VD+T DKE+DV+F+Y+ KWKE
Sbjct  139  EKADGGD-KYYLYRHLIFDILYNNDHVIEINVHTDQNTVVDLTEDKEVDVEFLYTAKWKE  197

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T TPFEKRMEK+S  S +P HLE+HWF
Sbjct  198  TQTPFEKRMEKYSSSSVMPHHLEVHWF  224



>ref|XP_007045412.1| Endomembrane protein 70 protein family isoform 2, partial [Theobroma 
cacao]
 gb|EOY01244.1| Endomembrane protein 70 protein family isoform 2, partial [Theobroma 
cacao]
Length=383

 Score =   270 bits (689),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 122/182 (67%), Positives = 153/182 (84%), Gaps = 0/182 (0%)
 Frame = +3

Query  294  NPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHSLYKLDFLADKESEVVCKKKLSK  473
             P   Y Y DLPFCSP ++++K EALGEVLNGDRLV++ YKL+F  +++S VVCK KLSK
Sbjct  29   TPXXXYRYFDLPFCSPDHLKEKKEALGEVLNGDRLVNAPYKLNFREERDSYVVCKTKLSK  88

Query  474  SDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKSDPSEYKYYLFKHLHFEIFYNKD  653
             +V  FR AV +DYYFQMYYDDLP+WG+IGKVDKEGK+DPSEYKY+L+KH+ F+I YNKD
Sbjct  89   DEVAIFRKAVDKDYYFQMYYDDLPIWGFIGKVDKEGKADPSEYKYFLYKHIQFDILYNKD  148

Query  654  QIVEIIARADPSAMVDITMDKELDVDFMYSVKWKETNTPFEKRMEKFSQISALPQHLEIH  833
            +++EI AR DP ++VD+T DKE+D +FMY+VKWKET TPFEKRM+K+S  S+LP HLEIH
Sbjct  149  RVIEISARMDPHSLVDLTEDKEVDAEFMYTVKWKETETPFEKRMDKYSMSSSLPHHLEIH  208

Query  834  WF  839
            WF
Sbjct  209  WF  210



>gb|KHN39489.1| Putative phagocytic receptor 1b [Glycine soja]
Length=561

 Score =   274 bits (701),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 125/198 (63%), Positives = 157/198 (79%), Gaps = 0/198 (0%)
 Frame = +3

Query  246  QGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHSLYKLDF  425
            +GD V  YANKVGPFHNPSETY Y DLPFCSPANVE+K E LGEVLNGDRLV + YKLDF
Sbjct  2    KGDFVPFYANKVGPFHNPSETYRYFDLPFCSPANVEEKREDLGEVLNGDRLVVAPYKLDF  61

Query  426  LADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKSDPSEYK  605
              D E E +C K+L+  +V +FRHAV +DY++QMYYDDLP+WG++GK D E K D +   
Sbjct  62   QIDIEPESICTKRLTIKEVAQFRHAVLKDYFYQMYYDDLPIWGFLGKFDSEDKDDQTGAI  121

Query  606  YYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKETNTPFEKRM  785
             +LFKH+HFEI YNKD+I+++  + DP A+VD+T +KE++VDF YS  W ET+TPFEKR+
Sbjct  122  VHLFKHVHFEILYNKDRIIDVFIQNDPQAVVDLTENKEVEVDFTYSATWVETDTPFEKRL  181

Query  786  EKFSQISALPQHLEIHWF  839
            EK+SQ S+L  +LEIHWF
Sbjct  182  EKYSQTSSLSHNLEIHWF  199



>gb|EPS73142.1| hypothetical protein M569_01612 [Genlisea aurea]
Length=540

 Score =   272 bits (696),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/179 (71%), Positives = 151/179 (84%), Gaps = 3/179 (2%)
 Frame = +3

Query  303  ETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHSLYKLDFLADKESEVVCKKKLSKSDV  482
            ETY Y DLPFCSP +V+ KSEALGEVLNGDRLV + YKL+FL DK+SEV+C KKLSK +V
Sbjct  3    ETYRYFDLPFCSPGDVKDKSEALGEVLNGDRLVSAPYKLEFLVDKDSEVICTKKLSKKEV  62

Query  483  EKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKSDPSEYKYYLFKHLHFEIFYNKDQIV  662
             +FR AVA+DYYFQMYYDDLPVWG++GKVD    +DP++ KYYLFKHLHFEI YNKD+++
Sbjct  63   SEFRTAVAKDYYFQMYYDDLPVWGFLGKVD---TTDPADNKYYLFKHLHFEILYNKDRVI  119

Query  663  EIIARADPSAMVDITMDKELDVDFMYSVKWKETNTPFEKRMEKFSQISALPQHLEIHWF  839
            EI A  DP+ +VDIT DKE DVDF+YSVKWKET  PFE RM+K+S  S+LP+HLEIHWF
Sbjct  120  EISAHTDPNVLVDITDDKEADVDFVYSVKWKETTIPFENRMQKYSHSSSLPRHLEIHWF  178



>dbj|BAJ89513.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=590

 Score =   273 bits (699),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/207 (61%), Positives = 162/207 (78%), Gaps = 2/207 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +D SDHRYK GD V LYANK+GPFHNPSETY Y+DL FC+P + + K EALGEVLNGDRL
Sbjct  24   ADGSDHRYKAGDRVPLYANKIGPFHNPSETYRYYDLSFCAPDHPKDKREALGEVLNGDRL  83

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V + Y+L+F  D  S+ +CKK LSK  V K R AVA+DYYFQMYYDDLP+WG++GK++K+
Sbjct  84   VDAPYELNFKEDMNSKTLCKKTLSKEQVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLEKD  143

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
             +      K  LFKH+HF+I YN D+++EI  + DP+  VDIT DKE+ V+F YSV WK+
Sbjct  144  KERGGG--KCLLFKHIHFDIMYNSDRVIEINVQTDPNVAVDITEDKEVPVEFSYSVTWKK  201

Query  759  TNTPFEKRMEKFSQISALPQHLEIHWF  839
            T+ PF+KRMEK+S+ S++PQHLEIHWF
Sbjct  202  TDIPFQKRMEKYSKSSSMPQHLEIHWF  228



>gb|EPS73381.1| hypothetical protein M569_01372, partial [Genlisea aurea]
Length=584

 Score =   269 bits (687),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 117/203 (58%), Positives = 160/203 (79%), Gaps = 0/203 (0%)
 Frame = +3

Query  231  DHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHSL  410
            +H YK GD V LYANKVGPF NPSETY Y+ LPFCSP ++E+K EALGEVLNGDRLV + 
Sbjct  17   NHVYKAGDLVPLYANKVGPFRNPSETYRYYYLPFCSPGDIEEKKEALGEVLNGDRLVSAP  76

Query  411  YKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKSD  590
            YKL F  D E++ VCKKKL+  +   FR+A+++ Y F+MY+DDLP+WG++GK++ EGK+ 
Sbjct  77   YKLHFKQDVETKTVCKKKLTMKEGALFRYAISKSYTFEMYFDDLPIWGFVGKIEGEGKTV  136

Query  591  PSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKETNTP  770
            PSE++YYLF HLHF+I Y+ D+++E+ AR +  A +DIT D E++++F YS KW +T+T 
Sbjct  137  PSEFRYYLFNHLHFDILYHDDRVIEVNARVNSDAAMDITQDMEMEIEFTYSAKWNQTSTT  196

Query  771  FEKRMEKFSQISALPQHLEIHWF  839
            F+KRMEK+S+ ++LP  LEI WF
Sbjct  197  FDKRMEKYSRTASLPHRLEIRWF  219



>ref|XP_011003770.1| PREDICTED: transmembrane 9 superfamily member 2-like isoform 
X1 [Populus euphratica]
Length=586

 Score =   267 bits (683),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/205 (59%), Positives = 160/205 (78%), Gaps = 6/205 (3%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD SDHRY+QGD+V  Y NKVGPFHNPSETY Y DLP+C P   ++K  +LGEVLNGDRL
Sbjct  25   SDESDHRYRQGDQVPFYVNKVGPFHNPSETYRYFDLPYCLPDKTKEKRLSLGEVLNGDRL  84

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V   + ++FL ++ S  VCKKKLSK DV KFR  + EDYY+QMY+DDLP+WG++G V+KE
Sbjct  85   VSRPFPIEFLRERNSVPVCKKKLSKEDVAKFRAVIHEDYYYQMYFDDLPIWGFLGMVNKE  144

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
                  + +YYLF H+   I+YNKD+++EI +R+D  AMV++T DKE+DV+F+Y+V+WKE
Sbjct  145  ------QQRYYLFNHILLNIYYNKDRVIEITSRSDTKAMVELTEDKEVDVEFLYTVEWKE  198

Query  759  TNTPFEKRMEKFSQISALPQHLEIH  833
            T+ PFEKRM K+SQ  +LP+HL+IH
Sbjct  199  TDVPFEKRMAKYSQSYSLPRHLDIH  223



>ref|XP_002521898.1| transporter, putative [Ricinus communis]
 gb|EEF40534.1| transporter, putative [Ricinus communis]
Length=525

 Score =   258 bits (660),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 147/173 (85%), Gaps = 0/173 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P +V++K EALGEVLNGDR
Sbjct  22   RSDASDHRYKEGDPVPLYANKVGPFHNPSETYRYFDLPFCVPDHVKEKKEALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  +K SE VC+KKLSK DV  FR A+ +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  82   LVSAPYQLNFRDEKSSEGVCRKKLSKEDVAHFRSAIDKDYYFQMYYDDLPIWGFIGKVDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDF  734
            +GK+DPSEYKY+L+KH+ F++ YNKD+++E+  R DP A++D+T DKE++ ++
Sbjct  142  DGKTDPSEYKYFLYKHIQFDVLYNKDRVIEVSVRMDPQALLDLTEDKEVEAEY  194



>ref|XP_005650990.1| EMP/nonaspanin domain family protein [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26446.1| EMP/nonaspanin domain family protein [Coccomyxa subellipsoidea 
C-169]
Length=624

 Score =   261 bits (667),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/211 (57%), Positives = 158/211 (75%), Gaps = 7/211 (3%)
 Frame = +3

Query  228  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSP-ANVEKKSEALGEVLNGDRLVH  404
            SDHRY   D + LYANKVGPF NPSETY Y++LPFC+P    E K+E LGEVL GDRLV+
Sbjct  52   SDHRYDMHDPIKLYANKVGPFSNPSETYQYYNLPFCTPEGGKEYKTEGLGEVLEGDRLVN  111

Query  405  SLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK---  575
            + Y + F  DKE+E++C ++L+  D++KFR AV +DYYFQM+YDDLP+WG+IGKV+K   
Sbjct  112  TPYSIKFRVDKENEILCSRELTAKDLKKFRKAVKKDYYFQMFYDDLPIWGFIGKVEKIMS  171

Query  576  --EGKS-DPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSV  746
               GK+ +  + +YYLF H+HF+I YN D+++E+    DPS  VDIT  +   VD+ YSV
Sbjct  172  QPGGKTWEKHDLRYYLFTHIHFDILYNGDRVIEVNVSTDPSRTVDITEGENTIVDYTYSV  231

Query  747  KWKETNTPFEKRMEKFSQISALPQHLEIHWF  839
            KW+ET  PFEKRM+K+S+ S LPQHLEIHWF
Sbjct  232  KWRETTIPFEKRMDKYSRYSFLPQHLEIHWF  262



>ref|XP_001770691.1| predicted protein [Physcomitrella patens]
 gb|EDQ64515.1| predicted protein [Physcomitrella patens]
Length=590

 Score =   259 bits (663),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 121/208 (58%), Positives = 157/208 (75%), Gaps = 5/208 (2%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSP-ANVEKKSEALGEVLNGDR  395
              +S+H+Y  GD V LYANKVGPFHNPSETY Y DLPFC P   V +K EALGEVLNGDR
Sbjct  25   GSSSNHKYGAGDPVPLYANKVGPFHNPSETYKYFDLPFCHPKGEVTEKREALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            +V +LY+L F  DKE E++C+K L+K+D++KFR AV  DYYFQMYYDDLP+WG++GK++K
Sbjct  85   MVEALYELKFKQDKEMEILCEKPLTKNDIKKFRDAVKNDYYFQMYYDDLPIWGFVGKIEK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
             G+    + KY L  H+HF+I YN ++++EI    + + +VDIT+DKE  V F Y+ KWK
Sbjct  145  SGQ----DVKYSLNTHVHFDIQYNDNRVIEISVDYEATNLVDITLDKEQTVKFTYTAKWK  200

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
             T+ PF +RM K+S+ S LPQHLEIHWF
Sbjct  201  ATDKPFSQRMAKYSRNSFLPQHLEIHWF  228



>emb|CDY52038.1| BnaA08g31510D [Brassica napus]
Length=480

 Score =   255 bits (651),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 140/167 (84%), Gaps = 0/167 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSDASDHRYK+GD V LYANKVGPFHNPSETY Y DLPFC P  V++K EALGEVLNGDR
Sbjct  20   RSDASDHRYKEGDIVPLYANKVGPFHNPSETYRYFDLPFCVPEGVKEKKEALGEVLNGDR  79

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+F  +K+SEV CKKKLSK +V KFR AV +DYYFQMYYDDLP+WG+IGKVDK
Sbjct  80   LVSAPYKLNFREEKDSEVYCKKKLSKEEVRKFRQAVEKDYYFQMYYDDLPIWGFIGKVDK  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDK  716
            E KSDPSEYKY+L+KH+ FEI YN D+++EI AR DP ++  IT+ K
Sbjct  140  EIKSDPSEYKYFLYKHIEFEILYNNDRVIEISARMDPHSLCFITLLK  186



>dbj|BAC57816.1| putative syntaxin SYP111 [Oryza sativa Japonica Group]
Length=589

 Score =   257 bits (657),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 125/208 (60%), Positives = 158/208 (76%), Gaps = 5/208 (2%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            R+D SDHRYK GD V LYANKVGPFHNPS +     L    P   + K EALGEVLNGDR
Sbjct  25   RADGSDHRYKDGDYVPLYANKVGPFHNPSFSVFNCSLVIDHP---KDKREALGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + Y+L+F  D+ S+V+C+K LSK +V K R AVA+DYYFQMYYDDLP+WG++GK+DK
Sbjct  82   LVDAPYELNFKEDRNSKVLCQKSLSKVEVAKLRDAVAKDYYFQMYYDDLPLWGFLGKLDK  141

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            +   +    KY LFKH+HF+I YN D+++EI  + DP+  VDIT DKE+ V+F YSV WK
Sbjct  142  D--KEQGNAKYLLFKHIHFDIMYNGDRVIEINVQTDPNVAVDITEDKEVQVEFSYSVTWK  199

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            +T+ PFEKRMEK+S+ S++PQHLEIHWF
Sbjct  200  KTDIPFEKRMEKYSKSSSMPQHLEIHWF  227



>gb|EEC74833.1| hypothetical protein OsI_10676 [Oryza sativa Indica Group]
Length=1316

 Score =   265 bits (677),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/180 (68%), Positives = 149/180 (83%), Gaps = 0/180 (0%)
 Frame = +3

Query  300  SETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHSLYKLDFLADKESEVVCKKKLSKSD  479
            SETY Y DLPFCSP  V++KSEALGEVLNGDRLV + YKLDF  D +S+ VC KKL+K +
Sbjct  609  SETYRYFDLPFCSPEKVKEKSEALGEVLNGDRLVDAPYKLDFRVDYDSKPVCSKKLTKEE  668

Query  480  VEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKSDPSEYKYYLFKHLHFEIFYNKDQI  659
            V KFR+AVA+DYYFQMYYDDLP+WG+IGKV+K GK+DP E+KYYL++H+ F+I YN D++
Sbjct  669  VAKFRNAVAKDYYFQMYYDDLPLWGFIGKVEKGGKTDPKEWKYYLYRHIIFDILYNNDRV  728

Query  660  VEIIARADPSAMVDITMDKELDVDFMYSVKWKETNTPFEKRMEKFSQISALPQHLEIHWF  839
            +EI    D SA+VD+T DKE DV F+YSVKWKET TPFEKRMEK+S  S LP HLE+HWF
Sbjct  729  IEINVHTDQSALVDLTEDKEADVQFLYSVKWKETPTPFEKRMEKYSSSSNLPHHLEVHWF  788



>ref|XP_001775546.1| predicted protein [Physcomitrella patens]
 gb|EDQ59629.1| predicted protein [Physcomitrella patens]
Length=590

 Score =   256 bits (654),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 120/208 (58%), Positives = 153/208 (74%), Gaps = 5/208 (2%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPAN-VEKKSEALGEVLNGDR  395
            +  S+H+Y  GD V LYANKVGPFHNPSETY Y DLPFC P   V +K EALGEVLNGDR
Sbjct  25   ASGSNHKYATGDPVPLYANKVGPFHNPSETYKYFDLPFCHPVGEVTEKREALGEVLNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            +V +LY+L F  DKE + +C+K L+K D++KF+ AV  DY+F+MYYDDLP+WGY+GK + 
Sbjct  85   MVEALYELRFRVDKEMKTLCEKTLTKDDIKKFQDAVKNDYFFEMYYDDLPIWGYVGKKED  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
             G+    + KY+L+ H+HFEI YN+D+++EI    DP   VDIT  KE  V F YS KWK
Sbjct  145  SGQ----DVKYFLYTHVHFEILYNQDRVIEINVGFDPMYTVDITESKEQTVKFTYSAKWK  200

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
             T+  F +RMEK+S+ S +PQHLEIHWF
Sbjct  201  VTDKLFSQRMEKYSKSSFMPQHLEIHWF  228



>ref|XP_010261665.1| PREDICTED: putative phagocytic receptor 1b [Nelumbo nucifera]
Length=644

 Score =   257 bits (657),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 149/181 (82%), Gaps = 0/181 (0%)
 Frame = +3

Query  297  PSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHSLYKLDFLADKESEVVCKKKLSKS  476
            P ETY Y+DLPFCSP +V++K E LGEVLNGDRLV + Y+L+F  DK +E++CKK LSK 
Sbjct  102  PPETYRYYDLPFCSPEHVKEKREDLGEVLNGDRLVDAPYELNFRVDKHNEILCKKTLSKE  161

Query  477  DVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKSDPSEYKYYLFKHLHFEIFYNKDQ  656
            +V + R AV +DYYFQMYYDDLP WG++GKV+++ K DPSEYKY LFKH+HF++ YN D+
Sbjct  162  EVAQLRTAVLKDYYFQMYYDDLPFWGFLGKVERDDKMDPSEYKYLLFKHIHFDVLYNNDR  221

Query  657  IVEIIARADPSAMVDITMDKELDVDFMYSVKWKETNTPFEKRMEKFSQISALPQHLEIHW  836
            ++EI  + DP+  VDIT DKE++ +F YSVKWKET+ PFEKRMEK+S+ S++PQHLEIHW
Sbjct  222  VIEINVQTDPNMSVDITEDKEVEAEFTYSVKWKETDIPFEKRMEKYSKSSSMPQHLEIHW  281

Query  837  F  839
            F
Sbjct  282  F  282



>ref|XP_007512838.1| predicted protein [Bathycoccus prasinos]
 emb|CCO17438.1| predicted protein [Bathycoccus prasinos]
Length=632

 Score =   256 bits (654),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 155/208 (75%), Gaps = 5/208 (2%)
 Frame = +3

Query  231  DHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPAN--VEKKSEALGEVLNGDRLVH  404
            DH YK  ++V LYANK+GPFHNPSETY ++DLPFC PA+  +  KSE LGEVL GDR+V 
Sbjct  63   DHSYKIHEKVPLYANKIGPFHNPSETYQHYDLPFCLPADNQIGYKSEDLGEVLEGDRMVG  122

Query  405  SLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK---  575
            + Y + F  D+++E +CKK L+  D++KFR AV +DYYFQMYYDDLP+WG+IGK++K   
Sbjct  123  TPYDISFRVDRDNESLCKKTLNSKDLKKFRKAVKDDYYFQMYYDDLPIWGFIGKIEKILR  182

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
                +  E +YYLF H+HF+I YN D+I+EI    DP   VDIT   E+ V+F YSVKWK
Sbjct  183  HTHGNGPELRYYLFTHVHFDISYNGDKIIEINVSTDPLRTVDITDGDEVAVEFSYSVKWK  242

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET  PFE+RMEK+S+ S LPQHLEIHWF
Sbjct  243  ETRIPFERRMEKYSRYSFLPQHLEIHWF  270



>ref|XP_012077856.1| PREDICTED: transmembrane 9 superfamily member 5 isoform X2 [Jatropha 
curcas]
Length=396

 Score =   249 bits (637),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 148/208 (71%), Gaps = 1/208 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            S  +DHRY   D V L+ NK+GP HNPSETY Y+DLPFC P NV  K E LGEVLNGDRL
Sbjct  21   SSPTDHRYNVRDNVPLFVNKIGPLHNPSETYQYYDLPFCRPDNVISKKETLGEVLNGDRL  80

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
              SLY L F  DK    +CKKKL K ++ +FR A+  D+YFQMYYDDLP+WG+IGK +++
Sbjct  81   SSSLYDLKFREDKTGVTLCKKKLEKDELLRFRDAIINDFYFQMYYDDLPLWGFIGKFEEQ  140

Query  579  G-KSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
                   + KYYLFKH+HF++ YN ++++E+ A +DP+  VDIT D ++DV+F YSV W 
Sbjct  141  SWILGEKKLKYYLFKHVHFDVLYNGNRVIEVSAFSDPNHAVDITEDIDIDVEFTYSVLWN  200

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
             T+ PFE RM K+S+ S LP H +IHWF
Sbjct  201  ATSAPFEIRMNKYSRASLLPIHQKIHWF  228



>ref|XP_002317710.2| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
 gb|EEE95930.2| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
Length=594

 Score =   255 bits (651),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 155/205 (76%), Gaps = 6/205 (3%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD  DHRY+QGD+V  Y NKVGPFHNPSETY Y DLP+C P   ++K  +LGEVLNGDRL
Sbjct  26   SDEPDHRYRQGDQVPFYVNKVGPFHNPSETYRYFDLPYCLPDRAKEKRLSLGEVLNGDRL  85

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V   + ++FL +++S  VCKKKLSK DV KFR  V EDYY+QMY+DDLP W ++G VDK 
Sbjct  86   VSGPFPIEFLRERKSVPVCKKKLSKEDVAKFRAVVHEDYYYQMYFDDLPNWVFLGMVDKR  145

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
                  + +YYLF H+H  I+YNKD+++EI +    +A+V++T DKE+DV+F+ +V+W E
Sbjct  146  ------QQRYYLFNHIHLNIYYNKDRVIEITSHTHTNAVVELTEDKEVDVEFLSTVEWNE  199

Query  759  TNTPFEKRMEKFSQISALPQHLEIH  833
            T+ PFEKRM K+SQ S+LP+HLEIH
Sbjct  200  TDFPFEKRMTKYSQSSSLPRHLEIH  224



>ref|XP_003059958.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55910.1| predicted protein [Micromonas pusilla CCMP1545]
Length=614

 Score =   255 bits (652),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 151/209 (72%), Gaps = 1/209 (0%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPA-NVEKKSEALGEVLNGD  392
            R  AS H Y   D+V LYANKVGPFHNPSETY Y+DLPFC PA     K E LGEVL GD
Sbjct  44   RLLASSHSYLVRDDVPLYANKVGPFHNPSETYQYYDLPFCEPADGAVSKREDLGEVLEGD  103

Query  393  RLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVD  572
            R+  + Y++ F  D+E+E +C++ LS +D++KFR AV +DYYFQMYYDDLP+WG++GK++
Sbjct  104  RMSSTPYQVPFRVDRENESLCERTLSANDLKKFRRAVKDDYYFQMYYDDLPIWGFVGKIE  163

Query  573  KEGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKW  752
            K       E +YYLF H+HF++ YN D+++EI    DP   VDIT    + V+F +SVKW
Sbjct  164  KILNPGAPELRYYLFTHVHFDVAYNGDKVIEINVSTDPLRTVDITDGDSVRVEFSFSVKW  223

Query  753  KETNTPFEKRMEKFSQISALPQHLEIHWF  839
            KET  PF +RMEK+S+ S LPQHLEIHWF
Sbjct  224  KETRIPFNRRMEKYSRYSFLPQHLEIHWF  252



>ref|XP_006364083.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=597

 Score =   254 bits (650),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/206 (60%), Positives = 159/206 (77%), Gaps = 4/206 (2%)
 Frame = +3

Query  231  DHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANV--EKKSEALGEVLNGDRLVH  404
            DH YK GD V L A+K+GPFHNPSE+Y Y+DLPFC P +V  E+K E LGEVLN DRLV 
Sbjct  32   DHFYKHGDHVRLSASKIGPFHNPSESYRYYDLPFCIPDHVKLEEKKEDLGEVLNEDRLVS  91

Query  405  SLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKV-DKEG  581
              Y+LDFL DK+SE++C+KKL+K +V +FR AV +DYYF+MYYD+LPVWG IG+V ++E 
Sbjct  92   GPYELDFLVDKDSEMLCRKKLTKDEVAQFRRAVDKDYYFEMYYDELPVWGLIGRVENREE  151

Query  582  KSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKET  761
              D   YKY+L+KH+HF+I YN D+++EI AR DP +++D+T DKE+D +F Y+ KWK T
Sbjct  152  TEDTKYYKYFLYKHIHFDIHYNMDRVIEITARMDPYSVLDLTEDKEVDAEFSYTAKWKGT  211

Query  762  NTPFEKRMEKFSQISALPQHLEIHWF  839
            +  FE RM+KF Q S LP  LEIHWF
Sbjct  212  DILFENRMDKFMQTS-LPHILEIHWF  236



>ref|XP_006376703.1| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
 gb|ERP54500.1| hypothetical protein POPTR_0012s03920g [Populus trichocarpa]
Length=625

 Score =   255 bits (651),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 118/205 (58%), Positives = 155/205 (76%), Gaps = 6/205 (3%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            SD  DHRY+QGD+V  Y NKVGPFHNPSETY Y DLP+C P   ++K  +LGEVLNGDRL
Sbjct  57   SDEPDHRYRQGDQVPFYVNKVGPFHNPSETYRYFDLPYCLPDRAKEKRLSLGEVLNGDRL  116

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
            V   + ++FL +++S  VCKKKLSK DV KFR  V EDYY+QMY+DDLP W ++G VDK 
Sbjct  117  VSGPFPIEFLRERKSVPVCKKKLSKEDVAKFRAVVHEDYYYQMYFDDLPNWVFLGMVDKR  176

Query  579  GKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKE  758
                  + +YYLF H+H  I+YNKD+++EI +    +A+V++T DKE+DV+F+ +V+W E
Sbjct  177  ------QQRYYLFNHIHLNIYYNKDRVIEITSHTHTNAVVELTEDKEVDVEFLSTVEWNE  230

Query  759  TNTPFEKRMEKFSQISALPQHLEIH  833
            T+ PFEKRM K+SQ S+LP+HLEIH
Sbjct  231  TDFPFEKRMTKYSQSSSLPRHLEIH  255



>ref|XP_010322125.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Solanum 
lycopersicum]
Length=560

 Score =   251 bits (642),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/180 (61%), Positives = 147/180 (82%), Gaps = 0/180 (0%)
 Frame = +3

Query  300  SETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHSLYKLDFLADKESEVVCKKKLSKSD  479
            SETY Y DLPFC P N+EKK E+ GE LNGDRL+ + YKL+FLA+K+++V+CKK+L+K +
Sbjct  19   SETYAYFDLPFCQPDNLEKKKESFGEPLNGDRLIFAPYKLEFLAEKDAKVICKKRLTKEE  78

Query  480  VEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKSDPSEYKYYLFKHLHFEIFYNKDQI  659
            V +FR AVA DYY QMYYDDLP+W ++GKV+K+G  DP+EY+Y+++    FEI+Y+KD +
Sbjct  79   VAQFRTAVALDYYVQMYYDDLPIWAFLGKVEKDGIDDPNEYRYHIYTFYQFEIYYHKDHV  138

Query  660  VEIIARADPSAMVDITMDKELDVDFMYSVKWKETNTPFEKRMEKFSQISALPQHLEIHWF  839
            +EI+ R DPS   D+T D+E+DV+F+Y+V WKETN PFEKRM+K++  SALP HLEIHWF
Sbjct  139  IEILVRVDPSFTADVTNDEEVDVEFLYTVVWKETNIPFEKRMDKYTSSSALPHHLEIHWF  198



>ref|XP_001699211.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
 gb|EDO98851.1| EMP/nonaspanin domain family protein [Chlamydomonas reinhardtii]
Length=594

 Score =   252 bits (643),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 116/206 (56%), Positives = 153/206 (74%), Gaps = 3/206 (1%)
 Frame = +3

Query  225  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANV-EKKSEALGEVLNGDRLV  401
             SDH++K G ++ LYANKVGPF NP+ETY Y++LPFC P +  E K+E LGEVL GDRLV
Sbjct  29   GSDHKFKPGSDIMLYANKVGPFQNPTETYQYYNLPFCQPTDGKEYKTEFLGEVLEGDRLV  88

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             + YKL F  D E+ V+CK+ L+  D++KFR AV +DYYFQM+YDDLPVWG+IGKV+K  
Sbjct  89   TTPYKLQFRTDVENAVLCKRTLTAGDLKKFRDAVKQDYYFQMFYDDLPVWGFIGKVEKIV  148

Query  582  KSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKET  761
            +     +KY+LF H HF++ YN D+I+EI   +DP   VDIT    LDV F YSVKWK++
Sbjct  149  QQ--GTHKYFLFTHFHFDLSYNDDRIIEINVSSDPMRTVDITTADTLDVQFSYSVKWKQS  206

Query  762  NTPFEKRMEKFSQISALPQHLEIHWF  839
            +  F+ RM+++++ S LPQHLEIHWF
Sbjct  207  SVTFDHRMDRYARYSFLPQHLEIHWF  232



>ref|XP_010322438.1| PREDICTED: putative phagocytic receptor 1b isoform X2 [Solanum 
lycopersicum]
Length=507

 Score =   249 bits (636),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 152/208 (73%), Gaps = 1/208 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +  +DHRY  GDEV L+ NKVGP  NPSETY Y+DLPFC P  +  + E+LGEVLNGDRL
Sbjct  23   ASLNDHRYNIGDEVPLFVNKVGPLSNPSETYQYYDLPFCQPGELLPEKESLGEVLNGDRL  82

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
             ++LY+L F  +K+  V+C KKL ++DV KFR A+ +DYY+QMY+DDLP WG++GK++ E
Sbjct  83   TNTLYQLKFGVEKDGVVLCHKKLDQNDVSKFRTAIIKDYYYQMYFDDLPFWGFVGKIEDE  142

Query  579  GKS-DPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
              + D    KY+LFKH+ F++ YN +Q++EI A  DPS +VDIT D +L V F Y+V+W 
Sbjct  143  LWTLDGKGPKYFLFKHVQFDVLYNGNQVIEIHALGDPSNVVDITEDIDLTVTFTYTVRWN  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+ PFE R+ ++S+ S  P + +IHWF
Sbjct  203  ETSIPFENRIARYSRASGKPVNRQIHWF  230



>emb|CDP05446.1| unnamed protein product [Coffea canephora]
Length=585

 Score =   251 bits (640),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 112/206 (54%), Positives = 151/206 (73%), Gaps = 3/206 (1%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            +SDA  H+Y++GD V LYAN VGPFHNPSETY Y+ LPFC P + E+K    GEVLNGDR
Sbjct  22   KSDAFTHKYEKGDPVPLYANTVGPFHNPSETYPYYSLPFCPPDHWEEKKGTFGEVLNGDR  81

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKLDF  D+ES+V+C+K L++ +V +FR  +A+DYY QMYYDDLP+W +IGK+  
Sbjct  82   LVSAPYKLDFRVDRESQVLCRKNLTREEVSQFRTVIAQDYYLQMYYDDLPMWAFIGKI--  139

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
                 P+  +Y+++  +HFEI+YN D I+EI  R DPS   D+T DK ++V+F+YSVKWK
Sbjct  140  -ANGSPNGSRYFIYTKMHFEIYYNGDHIIEINHRTDPSFETDLTEDKVIEVEFLYSVKWK  198

Query  756  ETNTPFEKRMEKFSQISALPQHLEIH  833
            ET  PFE+R  K+   + LP+H+ IH
Sbjct  199  ETTAPFEERTLKYLHSAILPRHMSIH  224



>ref|XP_012077855.1| PREDICTED: transmembrane 9 superfamily member 5 isoform X1 [Jatropha 
curcas]
 gb|KDP33127.1| hypothetical protein JCGZ_13574 [Jatropha curcas]
Length=587

 Score =   250 bits (639),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 115/208 (55%), Positives = 148/208 (71%), Gaps = 1/208 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            S  +DHRY   D V L+ NK+GP HNPSETY Y+DLPFC P NV  K E LGEVLNGDRL
Sbjct  21   SSPTDHRYNVRDNVPLFVNKIGPLHNPSETYQYYDLPFCRPDNVISKKETLGEVLNGDRL  80

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
              SLY L F  DK    +CKKKL K ++ +FR A+  D+YFQMYYDDLP+WG+IGK +++
Sbjct  81   SSSLYDLKFREDKTGVTLCKKKLEKDELLRFRDAIINDFYFQMYYDDLPLWGFIGKFEEQ  140

Query  579  G-KSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
                   + KYYLFKH+HF++ YN ++++E+ A +DP+  VDIT D ++DV+F YSV W 
Sbjct  141  SWILGEKKLKYYLFKHVHFDVLYNGNRVIEVSAFSDPNHAVDITEDIDIDVEFTYSVLWN  200

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
             T+ PFE RM K+S+ S LP H +IHWF
Sbjct  201  ATSAPFEIRMNKYSRASLLPIHQKIHWF  228



>ref|XP_006448062.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
 gb|ESR61302.1| hypothetical protein CICLE_v10014688mg [Citrus clementina]
Length=531

 Score =   249 bits (635),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 143/164 (87%), Gaps = 0/164 (0%)
 Frame = +3

Query  348  VEKKSEALGEVLNGDRLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQM  527
            +++K EALGEVLNGDRLV + YKL+F  +K+S V C+KKLS+ DV +FR AV +D+YFQM
Sbjct  6    IKEKREALGEVLNGDRLVSAPYKLNFRDEKDSAVACRKKLSEQDVAQFRSAVEKDFYFQM  65

Query  528  YYDDLPVWGYIGKVDKEGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDIT  707
            YYDDLP+WG+IGKVDKEGK+ P+EYKY+L+KH+ F+I YNKD+++EI AR DP ++VD+T
Sbjct  66   YYDDLPIWGFIGKVDKEGKTHPNEYKYFLYKHIQFDILYNKDRVIEISARMDPHSLVDLT  125

Query  708  MDKELDVDFMYSVKWKETNTPFEKRMEKFSQISALPQHLEIHWF  839
             DKE+DV+FMYSVKWKET+TPFEKRMEK+S  S+LP HLEIHWF
Sbjct  126  EDKEVDVEFMYSVKWKETDTPFEKRMEKYSLSSSLPHHLEIHWF  169



>ref|XP_004228944.1| PREDICTED: putative phagocytic receptor 1b [Solanum lycopersicum]
Length=594

 Score =   250 bits (638),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 117/206 (57%), Positives = 158/206 (77%), Gaps = 7/206 (3%)
 Frame = +3

Query  231  DHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANV--EKKSEALGEVLNGDRLVH  404
            DH YKQGD V L+ANK+GPFHNPSE+Y Y+DLPFC P +V  E+  E +GEVLNGDRL+ 
Sbjct  32   DHFYKQGDHVPLFANKIGPFHNPSESYRYYDLPFCIPDHVKLEENKEDVGEVLNGDRLMS  91

Query  405  SLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKV-DKEG  581
              Y LDFL DK+SE++C+KKL+K +V +FR AV +DYYF+MYYD+LP+WG IG+V ++E 
Sbjct  92   GPYALDFLVDKDSEILCRKKLTKDEVAQFRRAVDKDYYFEMYYDELPIWGLIGRVENREV  151

Query  582  KSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKET  761
              D   Y Y+L+KH+HF+I YN+D+++EI AR DP +++D+T D+E+D +F Y+ KWK T
Sbjct  152  TEDTKYYSYFLYKHIHFDIHYNRDRVIEITARMDPHSVLDLTEDREVDAEFTYTAKWKGT  211

Query  762  NTPFEKRMEKFSQISALPQHLEIHWF  839
            +  FE RM+KF Q + LP    IHWF
Sbjct  212  DILFENRMDKFLQ-TTLPH---IHWF  233



>ref|XP_006361076.1| PREDICTED: putative phagocytic receptor 1b-like [Solanum tuberosum]
Length=589

 Score =   249 bits (636),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 156/208 (75%), Gaps = 1/208 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +  +DHRY  GDEV L+ NKVGP +NPSETY Y+DLPFC P  +  + E+LGEVLNGDRL
Sbjct  23   ASLNDHRYNIGDEVPLFVNKVGPLNNPSETYQYYDLPFCQPGELLPEKESLGEVLNGDRL  82

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
             ++LY+L F A+K+  V+C KKL ++DV KFR A+ +DYY+QMY+DDLP WG++GK++ E
Sbjct  83   TNTLYQLKFGAEKDGVVLCHKKLDQNDVSKFRAAIIKDYYYQMYFDDLPFWGFVGKIEDE  142

Query  579  GKS-DPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
              + D    KY+LFKH+ F++ YN +Q++EI A +DPS +VDIT D +L++ F Y+V+W 
Sbjct  143  LWTLDGKGPKYFLFKHVQFDVLYNGNQVIEIHALSDPSNVVDITEDIDLNITFTYNVRWN  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+ PF+ RM ++S+  A P + +IHWF
Sbjct  203  ETSIPFKNRMARYSRALAKPVNHQIHWF  230



>ref|XP_007208295.1| hypothetical protein PRUPE_ppa003325mg [Prunus persica]
 gb|EMJ09494.1| hypothetical protein PRUPE_ppa003325mg [Prunus persica]
Length=585

 Score =   249 bits (635),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 114/204 (56%), Positives = 152/204 (75%), Gaps = 1/204 (0%)
 Frame = +3

Query  231  DHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHSL  410
            D  Y  GD V L+ NKVGP +NPSETY Y+DLPFC P  V +K E++GEVLNGDRL ++L
Sbjct  24   DRSYNVGDHVPLFVNKVGPLNNPSETYQYYDLPFCCPDPVIQKKESIGEVLNGDRLANTL  83

Query  411  YKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKSD  590
            Y+L+F  DK  E +C+KKL  ++V KFR A+  D+YFQMYYDDLPVWG+IGKV+ E  + 
Sbjct  84   YQLNFRQDKNGESLCQKKLKVAEVAKFRDAIVNDFYFQMYYDDLPVWGFIGKVEDESWTI  143

Query  591  PSE-YKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKETNT  767
              +  KYYLFKH+ F++FYN +QI+EI A +DP+ + DIT D ++DV+F YSVKW  T+ 
Sbjct  144  SDKGTKYYLFKHVLFDVFYNGNQIIEIRAFSDPNHVADITEDVDIDVEFTYSVKWNATSI  203

Query  768  PFEKRMEKFSQISALPQHLEIHWF  839
             F+ RM+++S+ S LP  L+IHWF
Sbjct  204  QFQNRMDRYSKASLLPVRLKIHWF  227



>ref|XP_004241321.1| PREDICTED: putative phagocytic receptor 1b isoform X1 [Solanum 
lycopersicum]
Length=589

 Score =   249 bits (635),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/208 (53%), Positives = 152/208 (73%), Gaps = 1/208 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            +  +DHRY  GDEV L+ NKVGP  NPSETY Y+DLPFC P  +  + E+LGEVLNGDRL
Sbjct  23   ASLNDHRYNIGDEVPLFVNKVGPLSNPSETYQYYDLPFCQPGELLPEKESLGEVLNGDRL  82

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
             ++LY+L F  +K+  V+C KKL ++DV KFR A+ +DYY+QMY+DDLP WG++GK++ E
Sbjct  83   TNTLYQLKFGVEKDGVVLCHKKLDQNDVSKFRTAIIKDYYYQMYFDDLPFWGFVGKIEDE  142

Query  579  GKS-DPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
              + D    KY+LFKH+ F++ YN +Q++EI A  DPS +VDIT D +L V F Y+V+W 
Sbjct  143  LWTLDGKGPKYFLFKHVQFDVLYNGNQVIEIHALGDPSNVVDITEDIDLTVTFTYTVRWN  202

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
            ET+ PFE R+ ++S+ S  P + +IHWF
Sbjct  203  ETSIPFENRIARYSRASGKPVNRQIHWF  230



>ref|XP_008228600.1| PREDICTED: putative phagocytic receptor 1b [Prunus mume]
Length=592

 Score =   248 bits (634),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 113/204 (55%), Positives = 151/204 (74%), Gaps = 1/204 (0%)
 Frame = +3

Query  231  DHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHSL  410
            D  Y  GD V LY NKVGP +NPSETY Y+DLPFC P  + +K E++GEVLNGDRL ++L
Sbjct  31   DRSYNVGDHVPLYVNKVGPLNNPSETYQYYDLPFCCPDPIIQKKESIGEVLNGDRLANTL  90

Query  411  YKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKSD  590
            Y+L+F  DK  E +C+KKL  ++V KFR  +  D+YFQMYYDDLP WG+IGKV+ E  + 
Sbjct  91   YQLNFRQDKNGESLCQKKLKVAEVAKFRDVIVNDFYFQMYYDDLPAWGFIGKVEDESWTI  150

Query  591  PSE-YKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKETNT  767
              +  KYYLFKH+ F++FYN +QI+EI A +DP+ +VDIT D ++DV+F YSVKW  T+ 
Sbjct  151  SDKGTKYYLFKHVLFDVFYNGNQIIEIRAFSDPNHVVDITEDVDIDVEFTYSVKWNATSI  210

Query  768  PFEKRMEKFSQISALPQHLEIHWF  839
             F+ RM+++S+ S LP  L+IHWF
Sbjct  211  QFQNRMDRYSKASILPVRLKIHWF  234



>gb|KJB60873.1| hypothetical protein B456_009G329300 [Gossypium raimondii]
Length=537

 Score =   247 bits (630),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 146/176 (83%), Gaps = 1/176 (1%)
 Frame = +3

Query  312  MYHDLPFCSPANVEKKSEALGEVLNGDRLVHSLYKLDFLADKESEVVCKKKLSKSDVEKF  491
            M ++ P+ +  +V +K EALGEVLNGDRLV + YKL+F  +K+S VVCKKKL K +V  F
Sbjct  1    MLYNFPW-NLDHVTEKREALGEVLNGDRLVSAPYKLNFKEEKDSSVVCKKKLLKDEVAFF  59

Query  492  RHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKSDPSEYKYYLFKHLHFEIFYNKDQIVEII  671
            R AV +DYYFQMYYDDLP+WG+IGKVDKEGK+DPSEYKY+LFKH+ F++ YNKD+++E+ 
Sbjct  60   RKAVDKDYYFQMYYDDLPIWGFIGKVDKEGKTDPSEYKYFLFKHIQFDVLYNKDRVIEVN  119

Query  672  ARADPSAMVDITMDKELDVDFMYSVKWKETNTPFEKRMEKFSQISALPQHLEIHWF  839
            AR DP ++VD+T DKE+D +FMYS KWKET TPFEKRM+K+S  S+LP HLEIHWF
Sbjct  120  ARMDPHSLVDLTEDKEVDAEFMYSAKWKETETPFEKRMDKYSMSSSLPHHLEIHWF  175



>gb|KHG11801.1| Putative phagocytic receptor 1b [Gossypium arboreum]
Length=592

 Score =   248 bits (632),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/212 (54%), Positives = 154/212 (73%), Gaps = 4/212 (2%)
 Frame = +3

Query  216  RSDAS---DHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLN  386
            RS AS   +HRY  GD V L+ NKVGP +NPSETY Y++LPFC P  V KK E+LGEVL+
Sbjct  22   RSIASSPHNHRYNVGDHVPLFVNKVGPLNNPSETYQYYELPFCGPDPVVKKEESLGEVLS  81

Query  387  GDRLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGK  566
            GDRL  +LYKL+F  +K +E +C KKL   DV KFR AV  D+YFQMYYDDLP WG++GK
Sbjct  82   GDRLTTALYKLNFRENKVAETLCHKKLEGDDVAKFRDAVINDFYFQMYYDDLPFWGFVGK  141

Query  567  VDKEGKS-DPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYS  743
            ++++  + +    KY+LFKH+ F++ YN +QI+E+ A  DP+ +VDIT D  +DV F YS
Sbjct  142  IEEDSWTLEKKSLKYFLFKHVQFDVLYNGNQIIEVHAIGDPNQVVDITEDVGVDVQFTYS  201

Query  744  VKWKETNTPFEKRMEKFSQISALPQHLEIHWF  839
            V W  T+  F+ RM+++S+ S+LP HL+IHWF
Sbjct  202  VVWNTTSAAFDTRMDRYSRASSLPIHLKIHWF  233



>ref|XP_008356712.1| PREDICTED: putative phagocytic receptor 1b [Malus domestica]
Length=301

 Score =   239 bits (610),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 119/200 (60%), Positives = 143/200 (72%), Gaps = 32/200 (16%)
 Frame = +3

Query  216  RSDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDR  395
            RSD SDHRYK+GD V LYANKVGPFHNPSETY Y DLPFCSP  V++K EALGE LNGDR
Sbjct  25   RSDGSDHRYKEGDFVPLYANKVGPFHNPSETYRYFDLPFCSPDAVKEKREALGEALNGDR  84

Query  396  LVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDK  575
            LV + YKL+FL  K++EV CKK L+K +V +FR AV +DYYFQMYYDDLP WG+IG VDK
Sbjct  85   LVSAPYKLEFLRHKDTEVACKKTLTKEEVARFRSAVNKDYYFQMYYDDLPTWGFIGXVDK  144

Query  576  EGKSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
            EGK D SEYK YL++H+HF+++YNK+                               +WK
Sbjct  145  EGK-DXSEYKTYLYEHIHFDLYYNKE-------------------------------RWK  172

Query  756  ETNTPFEKRMEKFSQISALP  815
            ET TPF+KRM+K+SQ S+LP
Sbjct  173  ETTTPFDKRMDKYSQSSSLP  192



>gb|KJB55631.1| hypothetical protein B456_009G086000 [Gossypium raimondii]
Length=543

 Score =   246 bits (627),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 111/208 (53%), Positives = 151/208 (73%), Gaps = 1/208 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            S   +HRY  GD V L+ NKVGP +NPSETY Y++LPFC P  V +K E+LGEVL+GDRL
Sbjct  26   SSPDNHRYNVGDHVPLFVNKVGPLNNPSETYQYYELPFCGPDPVVQKKESLGEVLSGDRL  85

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
              +LYKL+F  +K +E +C KKL   DV KFR AV  D+YFQMYYDDLP WG++GK++++
Sbjct  86   TSALYKLNFRENKVAETLCHKKLEGDDVAKFRDAVINDFYFQMYYDDLPFWGFVGKIEED  145

Query  579  GKS-DPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
              + +    KY+LFKH+ F++ YN +QI+E+ A  DP+ +VDIT D  +DV F YSV W 
Sbjct  146  SWTLEKKSLKYFLFKHVQFDVLYNGNQIIEVHAIGDPNQVVDITEDVGVDVQFTYSVVWN  205

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
             T+  F+ RM+++S+ S+LP HL+IHWF
Sbjct  206  TTSAAFDTRMDRYSRASSLPIHLKIHWF  233



>gb|KJB55630.1| hypothetical protein B456_009G086000 [Gossypium raimondii]
Length=592

 Score =   246 bits (629),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/212 (54%), Positives = 154/212 (73%), Gaps = 4/212 (2%)
 Frame = +3

Query  216  RSDAS---DHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLN  386
            RS AS   +HRY  GD V L+ NKVGP +NPSETY Y++LPFC P  V +K E+LGEVL+
Sbjct  22   RSIASSPDNHRYNVGDHVPLFVNKVGPLNNPSETYQYYELPFCGPDPVVQKKESLGEVLS  81

Query  387  GDRLVHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGK  566
            GDRL  +LYKL+F  +K +E +C KKL   DV KFR AV  D+YFQMYYDDLP WG++GK
Sbjct  82   GDRLTSALYKLNFRENKVAETLCHKKLEGDDVAKFRDAVINDFYFQMYYDDLPFWGFVGK  141

Query  567  VDKEGKS-DPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYS  743
            ++++  + +    KY+LFKH+ F++ YN +QI+E+ A  DP+ +VDIT D  +DV F YS
Sbjct  142  IEEDSWTLEKKSLKYFLFKHVQFDVLYNGNQIIEVHAIGDPNQVVDITEDVGVDVQFTYS  201

Query  744  VKWKETNTPFEKRMEKFSQISALPQHLEIHWF  839
            V W  T+  F+ RM+++S+ S+LP HL+IHWF
Sbjct  202  VVWNTTSAAFDTRMDRYSRASSLPIHLKIHWF  233



>ref|XP_002974646.1| hypothetical protein SELMODRAFT_101645 [Selaginella moellendorffii]
 gb|EFJ24166.1| hypothetical protein SELMODRAFT_101645 [Selaginella moellendorffii]
Length=589

 Score =   246 bits (627),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 147/206 (71%), Gaps = 3/206 (1%)
 Frame = +3

Query  222  DASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLV  401
             A DH Y + D+V LYANKVGPFHNPSETY Y DLPFC P+N++ KSE LGEVL GDR+V
Sbjct  27   SARDHTYGENDKVPLYANKVGPFHNPSETYQYFDLPFCEPSNLKHKSEDLGEVLEGDRMV  86

Query  402  HSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEG  581
             + Y + F  DKE+E +C  KL      KFR A+ +DYYFQM++DDLP+WG++GK+  + 
Sbjct  87   TTRYNITFKTDKETEELCSFKLEPETKRKFRSAIEQDYYFQMFFDDLPLWGFVGKLQTDE  146

Query  582  KSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKET  761
            K    E +Y LF H+HFEI +N ++++E+    DP   VDIT D+  DV F YSVKWK+T
Sbjct  147  K---KEERYMLFTHVHFEIAFNDNRVIEVTVSTDPDHAVDITDDEPTDVKFTYSVKWKKT  203

Query  762  NTPFEKRMEKFSQISALPQHLEIHWF  839
               F++RMEK+ + S LPQHLEIHWF
Sbjct  204  PITFDRRMEKYQKYSFLPQHLEIHWF  229



>ref|XP_002523798.1| transporter, putative [Ricinus communis]
 gb|EEF38524.1| transporter, putative [Ricinus communis]
Length=499

 Score =   243 bits (620),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 109/208 (52%), Positives = 148/208 (71%), Gaps = 1/208 (0%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            S  ++HRY  GD V L+ NKVGP HNPSETY Y++ PFC P NV  K E LGEVLNGDRL
Sbjct  21   SSPANHRYNVGDHVPLFVNKVGPLHNPSETYPYYNFPFCCPDNVILKKETLGEVLNGDRL  80

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
              +LY+ +F  DK    +CKKKL + +V +FR A+  D+YFQMYYDDLP+WG+IGKV+++
Sbjct  81   SSTLYEANFREDKTGVTLCKKKLKRDEVLRFRDAIVNDFYFQMYYDDLPLWGFIGKVEEQ  140

Query  579  G-KSDPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWK  755
                   +++YYLFKHL F++ YN D+++E+ A +DP+  VDI+ D +LDV+F YSV W 
Sbjct  141  SWVVGERKFRYYLFKHLQFDVLYNGDRVIEVSAFSDPNHAVDISEDADLDVEFTYSVLWN  200

Query  756  ETNTPFEKRMEKFSQISALPQHLEIHWF  839
             T+  +  RM ++S+ S LP H +IHWF
Sbjct  201  ATSASYGTRMVRYSRASLLPIHQQIHWF  228



>ref|XP_002274254.1| PREDICTED: transmembrane 9 superfamily member 5 [Vitis vinifera]
Length=608

 Score =   246 bits (627),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 151/206 (73%), Gaps = 1/206 (0%)
 Frame = +3

Query  225  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVH  404
            A DHRY  GD V L+ NKVGP +NPSETY Y+DLPFC P  V ++  +LGEVLNGD L +
Sbjct  44   AQDHRYNVGDHVSLFVNKVGPLNNPSETYHYYDLPFCRPDQVIRRKASLGEVLNGDCLTN  103

Query  405  SLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGK  584
            +LY+L F  +K  E +C+KKL   +V KFR+AV+ D+YFQMYYDDLP+WG+IGKV+ E  
Sbjct  104  ALYELKFRENKIGETLCQKKLKGDEVAKFRNAVSNDFYFQMYYDDLPLWGFIGKVEDENW  163

Query  585  S-DPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKET  761
            + + +  KYYLFKH+ F+  YN +QI+EI A +DP+ +VDIT D ++ V F YS+ WKET
Sbjct  164  TVNENGPKYYLFKHVQFDALYNGNQIIEIRAFSDPNHVVDITEDVDISVKFTYSILWKET  223

Query  762  NTPFEKRMEKFSQISALPQHLEIHWF  839
            +T FE RM+K+S+ S  P H +I WF
Sbjct  224  STQFENRMDKYSRASLFPTHQQIRWF  249



>emb|CBI28324.3| unnamed protein product [Vitis vinifera]
Length=636

 Score =   246 bits (628),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/206 (55%), Positives = 151/206 (73%), Gaps = 1/206 (0%)
 Frame = +3

Query  225  ASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVH  404
            A DHRY  GD V L+ NKVGP +NPSETY Y+DLPFC P  V ++  +LGEVLNGD L +
Sbjct  72   AQDHRYNVGDHVSLFVNKVGPLNNPSETYHYYDLPFCRPDQVIRRKASLGEVLNGDCLTN  131

Query  405  SLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGK  584
            +LY+L F  +K  E +C+KKL   +V KFR+AV+ D+YFQMYYDDLP+WG+IGKV+ E  
Sbjct  132  ALYELKFRENKIGETLCQKKLKGDEVAKFRNAVSNDFYFQMYYDDLPLWGFIGKVEDENW  191

Query  585  S-DPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKET  761
            + + +  KYYLFKH+ F+  YN +QI+EI A +DP+ +VDIT D ++ V F YS+ WKET
Sbjct  192  TVNENGPKYYLFKHVQFDALYNGNQIIEIRAFSDPNHVVDITEDVDISVKFTYSILWKET  251

Query  762  NTPFEKRMEKFSQISALPQHLEIHWF  839
            +T FE RM+K+S+ S  P H +I WF
Sbjct  252  STQFENRMDKYSRASLFPTHQQIRWF  277



>ref|XP_006487943.1| PREDICTED: putative phagocytic receptor 1b-like isoform X1 [Citrus 
sinensis]
Length=590

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 118/209 (56%), Positives = 148/209 (71%), Gaps = 3/209 (1%)
 Frame = +3

Query  219  SDASDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRL  398
            S   DHRY  GD V L  NKVGP +NPSETY Y+DLPFC P  ++ K E LGEVLNGDRL
Sbjct  24   SSPHDHRYNAGDLVPLLVNKVGPLNNPSETYQYYDLPFCRPEPIKWKKETLGEVLNGDRL  83

Query  399  VHSLYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKE  578
              +LY+L FL  K    +C KKL   +V KFR AVA+D+YFQMYYDDLP+WGYIGK++ +
Sbjct  84   ASALYELKFLEAKTGVTLCSKKLKVDEVAKFRKAVADDFYFQMYYDDLPIWGYIGKIE-D  142

Query  579  GKSDPSE--YKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKW  752
            G    SE   KYYLF ++ F+  YN DQ+VEI A +DP++ VDIT D E++V F YS+ W
Sbjct  143  GSLVLSEKGNKYYLFTNVQFDALYNGDQVVEIRAFSDPTSAVDITDDIEINVKFTYSIVW  202

Query  753  KETNTPFEKRMEKFSQISALPQHLEIHWF  839
             ET+  FE RM+K+S+ S+LP   +IHWF
Sbjct  203  SETSAQFETRMDKYSRASSLPTLHKIHWF  231



>ref|XP_002973969.1| hypothetical protein SELMODRAFT_173941 [Selaginella moellendorffii]
 gb|EFJ24924.1| hypothetical protein SELMODRAFT_173941 [Selaginella moellendorffii]
Length=591

 Score =   244 bits (624),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/204 (54%), Positives = 145/204 (71%), Gaps = 4/204 (2%)
 Frame = +3

Query  228  SDHRYKQGDEVHLYANKVGPFHNPSETYMYHDLPFCSPANVEKKSEALGEVLNGDRLVHS  407
            + H Y  GD+V LYANKVGPFHNPSETY Y+DLPFC+PA V+ K EA+GE+L GDRLV +
Sbjct  32   AAHSYNDGDKVPLYANKVGPFHNPSETYQYYDLPFCAPAEVKHKKEAMGELLEGDRLVST  91

Query  408  LYKLDFLADKESEVVCKKKLSKSDVEKFRHAVAEDYYFQMYYDDLPVWGYIGKVDKEGKS  587
            +Y+++F   K+ + +C   L + D E+FR AV  DYYFQM++DDLP+WG+IG+ +   K 
Sbjct  92   VYEINFKEKKDVQKLCSATLDRKDKERFRKAVENDYYFQMFFDDLPLWGFIGRFELFDKQ  151

Query  588  DPSEYKYYLFKHLHFEIFYNKDQIVEIIARADPSAMVDITMDKELDVDFMYSVKWKETNT  767
                  Y LF H+HFE+ YN  +++EI    DP+  +DIT D  + VDF YSV W ET  
Sbjct  152  K----HYMLFTHVHFEVRYNGKRVIEIAVSTDPAKAIDITNDDPVPVDFTYSVTWAETTV  207

Query  768  PFEKRMEKFSQISALPQHLEIHWF  839
            PFE+RMEK+ + S LPQHLEIHWF
Sbjct  208  PFERRMEKYQKYSFLPQHLEIHWF  231



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1812563152356