BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2230

Length=859
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009770858.1|  PREDICTED: uncharacterized protein At4g14100...    289   5e-94   Nicotiana sylvestris
ref|XP_009622297.1|  PREDICTED: uncharacterized protein At4g14100...    283   7e-92   Nicotiana tomentosiformis
emb|CDO98295.1|  unnamed protein product                                281   5e-91   Coffea canephora [robusta coffee]
ref|XP_004235857.1|  PREDICTED: uncharacterized protein At4g14100...    281   7e-91   Solanum lycopersicum
ref|XP_010250496.1|  PREDICTED: uncharacterized protein At4g14100...    279   3e-90   Nelumbo nucifera [Indian lotus]
ref|XP_006341466.1|  PREDICTED: uncharacterized protein At4g14100...    278   1e-89   Solanum tuberosum [potatoes]
gb|KJB51308.1|  hypothetical protein B456_008G211200                    276   7e-89   Gossypium raimondii
gb|KJB31562.1|  hypothetical protein B456_005G197200                    269   2e-86   Gossypium raimondii
ref|XP_002299359.2|  hypothetical protein POPTR_0001s12870g             269   2e-86   
gb|KHG03624.1|  hypothetical protein F383_27203                         269   3e-86   Gossypium arboreum [tree cotton]
gb|KJB31561.1|  hypothetical protein B456_005G197200                    269   3e-86   Gossypium raimondii
ref|XP_011036207.1|  PREDICTED: uncharacterized protein At4g14100...    268   6e-86   Populus euphratica
ref|XP_010527438.1|  PREDICTED: uncharacterized protein At4g14100       267   1e-85   Tarenaya hassleriana [spider flower]
ref|XP_008239573.1|  PREDICTED: uncharacterized protein At4g14100...    268   2e-85   Prunus mume [ume]
ref|XP_007226105.1|  hypothetical protein PRUPE_ppa010928mg             267   2e-85   Prunus persica
ref|XP_008385757.1|  PREDICTED: uncharacterized protein At4g14100...    267   2e-85   Malus domestica [apple tree]
ref|XP_007209533.1|  hypothetical protein PRUPE_ppa010693mg             267   3e-85   Prunus persica
ref|XP_011082873.1|  PREDICTED: uncharacterized protein At4g14100...    266   3e-85   Sesamum indicum [beniseed]
gb|ABK96423.1|  unknown                                                 266   4e-85   Populus trichocarpa x Populus deltoides
ref|XP_012090568.1|  PREDICTED: uncharacterized protein At4g14100...    266   4e-85   Jatropha curcas
ref|XP_008222268.1|  PREDICTED: uncharacterized protein At4g14100...    266   5e-85   Prunus mume [ume]
ref|XP_009339023.1|  PREDICTED: uncharacterized protein At4g14100...    266   6e-85   Pyrus x bretschneideri [bai li]
ref|XP_004301755.1|  PREDICTED: uncharacterized protein At4g14100...    265   6e-85   Fragaria vesca subsp. vesca
ref|XP_010104040.1|  hypothetical protein L484_005513                   265   7e-85   Morus notabilis
ref|XP_002322309.1|  hypothetical protein POPTR_0015s11960g             265   7e-85   Populus trichocarpa [western balsam poplar]
ref|XP_007038171.1|  Transferring glycosyl groups, putative             265   1e-84   
gb|KHG21078.1|  hypothetical protein F383_27808                         264   2e-84   Gossypium arboreum [tree cotton]
ref|XP_011040289.1|  PREDICTED: uncharacterized protein At4g14100...    263   8e-84   Populus euphratica
ref|XP_008459918.1|  PREDICTED: uncharacterized protein At4g14100...    262   9e-84   
ref|XP_007043758.1|  Transferases, transferring glycosyl groups         261   4e-83   Theobroma cacao [chocolate]
emb|CBI29275.3|  unnamed protein product                                261   4e-83   Vitis vinifera
ref|XP_010466733.1|  PREDICTED: uncharacterized protein At4g14100...    259   9e-83   Camelina sativa [gold-of-pleasure]
ref|XP_010490084.1|  PREDICTED: uncharacterized protein At4g14100...    259   9e-83   
ref|XP_012090567.1|  PREDICTED: uncharacterized protein At4g14100...    260   1e-82   Jatropha curcas
ref|XP_002268123.2|  PREDICTED: uncharacterized protein At4g14100...    260   1e-82   Vitis vinifera
ref|XP_011086903.1|  PREDICTED: uncharacterized protein At4g14100       260   1e-82   Sesamum indicum [beniseed]
ref|XP_004140561.1|  PREDICTED: uncharacterized protein At4g14100...    258   4e-82   Cucumis sativus [cucumbers]
ref|XP_010512873.1|  PREDICTED: uncharacterized protein At4g14100...    257   5e-82   Camelina sativa [gold-of-pleasure]
ref|XP_008459920.1|  PREDICTED: uncharacterized protein At4g14100...    258   5e-82   Cucumis melo [Oriental melon]
ref|XP_002512689.1|  transferase, transferring glycosyl groups, p...    258   5e-82   Ricinus communis
gb|KDO57640.1|  hypothetical protein CISIN_1g037407mg                   258   6e-82   Citrus sinensis [apfelsine]
ref|XP_010250495.1|  PREDICTED: uncharacterized protein At4g14100...    257   2e-81   Nelumbo nucifera [Indian lotus]
ref|XP_006844416.2|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    256   3e-81   Amborella trichopoda
ref|XP_004140562.2|  PREDICTED: uncharacterized protein At4g14100...    256   3e-81   Cucumis sativus [cucumbers]
ref|XP_008351100.1|  PREDICTED: uncharacterized protein At4g14100...    256   7e-81   Malus domestica [apple tree]
ref|XP_009144684.1|  PREDICTED: uncharacterized protein At4g14100       254   9e-81   Brassica rapa
ref|XP_002870337.1|  transferase, transferring glycosyl groups          254   1e-80   
ref|XP_008369605.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    254   2e-80   Malus domestica [apple tree]
ref|XP_009102584.1|  PREDICTED: uncharacterized protein At4g14100       253   3e-80   Brassica rapa
ref|XP_006414813.1|  hypothetical protein EUTSA_v10026167mg             254   3e-80   Eutrema salsugineum [saltwater cress]
gb|AFK34859.1|  unknown                                                 254   4e-80   Lotus japonicus
gb|EYU28487.1|  hypothetical protein MIMGU_mgv1a013476mg                253   5e-80   Erythranthe guttata [common monkey flower]
ref|XP_009359859.1|  PREDICTED: uncharacterized protein At4g14100...    253   5e-80   Pyrus x bretschneideri [bai li]
emb|CDY63753.1|  BnaAnng19070D                                          252   5e-80   Brassica napus [oilseed rape]
ref|XP_010450128.1|  PREDICTED: uncharacterized protein At4g14100...    253   5e-80   Camelina sativa [gold-of-pleasure]
ref|XP_010435192.1|  PREDICTED: uncharacterized protein At4g14100       252   6e-80   Camelina sativa [gold-of-pleasure]
ref|XP_006436981.1|  hypothetical protein CICLE_v10032720mg             252   9e-80   Citrus clementina [clementine]
ref|NP_566739.1|  uncharacterized protein                               251   1e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004310152.1|  PREDICTED: uncharacterized protein At4g14100...    252   1e-79   Fragaria vesca subsp. vesca
ref|XP_009595221.1|  PREDICTED: uncharacterized protein At4g14100...    252   2e-79   Nicotiana tomentosiformis
emb|CDY08309.1|  BnaA05g13100D                                          251   2e-79   Brassica napus [oilseed rape]
ref|XP_006487570.1|  PREDICTED: uncharacterized protein At4g14100...    251   2e-79   
gb|KFK39672.1|  hypothetical protein AALP_AA3G274300                    251   2e-79   Arabis alpina [alpine rockcress]
ref|XP_006418840.1|  hypothetical protein EUTSA_v10002677mg             250   2e-79   
ref|XP_002885592.1|  hypothetical protein ARALYDRAFT_479891             250   3e-79   
ref|XP_006282716.1|  hypothetical protein CARUB_v10005748mg             250   4e-79   Capsella rubella
emb|CDY68448.1|  BnaCnng59060D                                          251   4e-79   Brassica napus [oilseed rape]
gb|KFK36298.1|  hypothetical protein AALP_AA4G104200                    250   5e-79   Arabis alpina [alpine rockcress]
ref|XP_004503817.1|  PREDICTED: uncharacterized protein At4g14100...    251   5e-79   Cicer arietinum [garbanzo]
ref|NP_567420.1|  uncharacterized protein                               250   6e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009761705.1|  PREDICTED: uncharacterized protein At4g14100...    251   7e-79   Nicotiana sylvestris
gb|AAM64947.1|  unknown                                                 249   7e-79   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006298598.1|  hypothetical protein CARUB_v10014682mg             249   7e-79   
gb|KHN09699.1|  Hypothetical protein glysoja_011973                     250   8e-79   Glycine soja [wild soybean]
gb|EPS68692.1|  transferase, transferring glycosyl groups               250   8e-79   Genlisea aurea
gb|KEH20962.1|  transferring glycosyl group transferase                 249   1e-78   Medicago truncatula
gb|EYU21764.1|  hypothetical protein MIMGU_mgv1a013279mg                250   1e-78   Erythranthe guttata [common monkey flower]
emb|CDY59776.1|  BnaCnng35550D                                          248   1e-78   Brassica napus [oilseed rape]
ref|XP_006485066.1|  PREDICTED: uncharacterized protein At4g14100...    249   2e-78   Citrus sinensis [apfelsine]
ref|XP_006420822.1|  hypothetical protein CICLE_v10005873mg             249   2e-78   Citrus clementina [clementine]
ref|NP_001237129.1|  uncharacterized protein LOC100306330 precursor     249   2e-78   
ref|XP_007137823.1|  hypothetical protein PHAVU_009G158700g             248   5e-78   Phaseolus vulgaris [French bean]
gb|ERN06091.1|  hypothetical protein AMTR_s00016p00017300               247   6e-78   Amborella trichopoda
ref|XP_012088695.1|  PREDICTED: uncharacterized protein At4g14100...    246   7e-78   Jatropha curcas
ref|XP_010942349.1|  PREDICTED: uncharacterized protein At4g14100...    247   1e-77   Elaeis guineensis
ref|XP_004228540.1|  PREDICTED: uncharacterized protein At4g14100       246   2e-77   Solanum lycopersicum
ref|XP_002272515.2|  PREDICTED: uncharacterized protein At4g14100       246   3e-77   Vitis vinifera
ref|XP_004501765.1|  PREDICTED: uncharacterized protein At4g14100...    245   5e-77   Cicer arietinum [garbanzo]
ref|XP_006348535.1|  PREDICTED: uncharacterized protein At4g14100...    244   2e-76   Solanum tuberosum [potatoes]
ref|XP_010907973.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    244   2e-76   Elaeis guineensis
ref|XP_010693863.1|  PREDICTED: uncharacterized protein At4g14100...    244   4e-76   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008459922.1|  PREDICTED: uncharacterized protein At4g14100...    242   8e-76   Cucumis melo [Oriental melon]
ref|XP_003602737.1|  hypothetical protein MTR_3g098490                  241   2e-75   Medicago truncatula
ref|XP_009421020.1|  PREDICTED: uncharacterized protein At4g14100...    240   6e-75   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004140560.2|  PREDICTED: uncharacterized protein At4g14100...    239   9e-75   Cucumis sativus [cucumbers]
ref|XP_009384307.1|  PREDICTED: uncharacterized protein At4g14100...    239   9e-75   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN39920.1|  unknown                                                 237   1e-73   Picea sitchensis
ref|XP_004503816.1|  PREDICTED: uncharacterized protein At4g14100...    236   1e-73   Cicer arietinum [garbanzo]
gb|KEH20960.1|  transferring glycosyl group transferase                 234   1e-72   Medicago truncatula
gb|ABK23648.1|  unknown                                                 234   1e-72   Picea sitchensis
ref|XP_007159947.1|  hypothetical protein PHAVU_002G280800g             234   2e-72   Phaseolus vulgaris [French bean]
dbj|BAB01852.1|  unnamed protein product                                234   2e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010693862.1|  PREDICTED: uncharacterized protein At4g14100...    233   2e-72   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP18994.1|  unnamed protein product                                233   5e-72   Coffea canephora [robusta coffee]
gb|KHN17452.1|  Hypothetical protein glysoja_026995                     232   1e-71   Glycine soja [wild soybean]
ref|XP_010525634.1|  PREDICTED: uncharacterized protein At4g14100...    232   1e-71   Tarenaya hassleriana [spider flower]
ref|XP_004298057.1|  PREDICTED: uncharacterized protein At4g14100...    229   4e-71   Fragaria vesca subsp. vesca
gb|AES72989.2|  transferring glycosyl group transferase                 230   4e-71   Medicago truncatula
ref|XP_010066473.1|  PREDICTED: uncharacterized protein At4g14100...    230   6e-71   Eucalyptus grandis [rose gum]
ref|XP_003602738.1|  hypothetical protein MTR_3g098500                  229   6e-71   
ref|NP_001236654.1|  uncharacterized protein LOC100526970 precursor     228   2e-70   Glycine max [soybeans]
gb|KHN31243.1|  Hypothetical protein glysoja_012893                     227   7e-70   Glycine soja [wild soybean]
emb|CAN78163.1|  hypothetical protein VITISV_040924                     226   7e-70   Vitis vinifera
ref|XP_009771377.1|  PREDICTED: uncharacterized protein At4g14100...    225   2e-69   Nicotiana sylvestris
ref|XP_004241661.1|  PREDICTED: uncharacterized protein At4g14100...    225   4e-69   Solanum lycopersicum
ref|NP_001236399.1|  uncharacterized protein LOC100306534 precursor     225   5e-69   Glycine max [soybeans]
ref|XP_010682629.1|  PREDICTED: uncharacterized protein At4g14100...    224   9e-69   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010250494.1|  PREDICTED: uncharacterized protein At4g14100...    224   1e-68   Nelumbo nucifera [Indian lotus]
ref|XP_009596905.1|  PREDICTED: uncharacterized protein At4g14100...    224   1e-68   Nicotiana tomentosiformis
emb|CBI29276.3|  unnamed protein product                                222   1e-68   Vitis vinifera
ref|XP_008353349.1|  PREDICTED: uncharacterized protein At4g14100...    220   1e-67   Malus domestica [apple tree]
gb|KEH20961.1|  transferring glycosyl group transferase                 221   1e-67   Medicago truncatula
ref|XP_009350628.1|  PREDICTED: uncharacterized protein At4g14100...    219   4e-67   Pyrus x bretschneideri [bai li]
gb|KCW64356.1|  hypothetical protein EUGRSUZ_G01982                     220   4e-67   Eucalyptus grandis [rose gum]
ref|XP_006366285.1|  PREDICTED: uncharacterized protein At4g14100...    219   9e-67   Solanum tuberosum [potatoes]
ref|XP_009350629.1|  PREDICTED: uncharacterized protein At4g14100...    217   3e-66   Pyrus x bretschneideri [bai li]
gb|KGN46408.1|  hypothetical protein Csa_6G091320                       216   7e-66   Cucumis sativus [cucumbers]
ref|XP_010066471.1|  PREDICTED: uncharacterized protein At4g14100...    217   9e-66   Eucalyptus grandis [rose gum]
ref|XP_007014116.1|  Transferring glycosyl groups                       214   4e-65   
ref|XP_008223676.1|  PREDICTED: uncharacterized protein At4g14100...    213   1e-64   Prunus mume [ume]
ref|XP_008797122.1|  PREDICTED: uncharacterized protein At4g14100...    211   8e-64   Phoenix dactylifera
ref|XP_006453439.1|  hypothetical protein CICLE_v10009608mg             208   6e-63   Citrus clementina [clementine]
ref|XP_002532408.1|  transferase, transferring glycosyl groups, p...    208   9e-63   Ricinus communis
gb|EMT33452.1|  hypothetical protein F775_30441                         207   3e-62   
ref|XP_010929713.1|  PREDICTED: uncharacterized protein At4g14100...    206   5e-62   Elaeis guineensis
ref|XP_011462640.1|  PREDICTED: uncharacterized protein At4g14100...    202   1e-60   Fragaria vesca subsp. vesca
ref|XP_002965445.1|  hypothetical protein SELMODRAFT_83843              203   1e-60   
ref|XP_002984546.1|  hypothetical protein SELMODRAFT_120238             202   3e-60   Selaginella moellendorffii
ref|XP_006658351.1|  PREDICTED: uncharacterized protein At4g14100...    202   1e-59   
ref|XP_002965443.1|  hypothetical protein SELMODRAFT_68863              199   1e-59   
ref|XP_002324489.1|  hypothetical protein POPTR_0018s10470g             200   1e-59   Populus trichocarpa [western balsam poplar]
ref|XP_002984548.1|  hypothetical protein SELMODRAFT_16681              198   2e-59   
ref|XP_003557445.1|  PREDICTED: uncharacterized protein At4g14100...    198   1e-58   Brachypodium distachyon [annual false brome]
ref|XP_002459483.1|  hypothetical protein SORBIDRAFT_02g005370          194   1e-56   Sorghum bicolor [broomcorn]
ref|XP_002460796.1|  hypothetical protein SORBIDRAFT_02g035030          193   2e-56   Sorghum bicolor [broomcorn]
ref|XP_010909570.1|  PREDICTED: uncharacterized protein At4g14100...    192   2e-56   Elaeis guineensis
ref|NP_001059085.1|  Os07g0189800                                       190   2e-55   
ref|XP_007223699.1|  hypothetical protein PRUPE_ppa012977mg             187   4e-55   
gb|EAZ03052.1|  hypothetical protein OsI_25194                          190   4e-55   Oryza sativa Indica Group [Indian rice]
ref|XP_001767281.1|  predicted protein                                  189   8e-55   
ref|NP_001059084.1|  Os07g0189700                                       185   1e-53   
ref|XP_011018225.1|  PREDICTED: uncharacterized protein At4g14100...    182   8e-53   Populus euphratica
gb|ABK96668.1|  unknown                                                 180   2e-52   Populus trichocarpa x Populus deltoides
ref|XP_004981035.1|  PREDICTED: uncharacterized protein At4g14100...    176   2e-50   Setaria italica
ref|NP_001143658.1|  hypothetical protein precursor                     177   4e-50   Zea mays [maize]
ref|XP_010525636.1|  PREDICTED: uncharacterized protein At4g14100...    174   4e-50   Tarenaya hassleriana [spider flower]
ref|XP_004955718.1|  PREDICTED: uncharacterized protein At4g14100...    176   6e-50   
ref|XP_004959035.1|  PREDICTED: uncharacterized protein At4g14100...    176   9e-50   Setaria italica
ref|XP_002463512.1|  hypothetical protein SORBIDRAFT_01g001110          175   1e-49   Sorghum bicolor [broomcorn]
ref|NP_001144542.1|  uncharacterized protein LOC100277542 precursor     175   1e-49   Zea mays [maize]
ref|NP_001142641.1|  uncharacterized protein LOC100274921 precursor     174   2e-49   
gb|KHN09700.1|  Hypothetical protein glysoja_011974                     170   1e-48   Glycine soja [wild soybean]
dbj|BAJ98762.1|  predicted protein                                      172   1e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85338.1|  predicted protein                                      172   1e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006581827.1|  PREDICTED: uncharacterized protein At4g14100...    169   3e-48   
gb|KDO62434.1|  hypothetical protein CISIN_1g044660mg                   166   8e-47   Citrus sinensis [apfelsine]
ref|XP_003559144.2|  PREDICTED: uncharacterized protein At4g14100...    167   2e-46   Brachypodium distachyon [annual false brome]
ref|NP_001051909.1|  Os03g0850800                                       166   4e-46   
ref|XP_006650901.1|  PREDICTED: uncharacterized protein At4g14100...    162   3e-45   Oryza brachyantha
dbj|BAJ91045.1|  predicted protein                                      160   7e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010102991.1|  hypothetical protein L484_022870                   162   1e-43   
ref|XP_009596906.1|  PREDICTED: uncharacterized protein At4g14100...    155   1e-42   
emb|CDM81562.1|  unnamed protein product                                156   2e-42   Triticum aestivum [Canadian hard winter wheat]
emb|CDM81558.1|  unnamed protein product                                156   2e-42   Triticum aestivum [Canadian hard winter wheat]
tpg|DAA59888.1|  TPA: hypothetical protein ZEAMMB73_634735              153   3e-41   
ref|NP_001143659.1|  uncharacterized protein LOC100276382 precursor     153   3e-41   
ref|XP_008651206.1|  PREDICTED: uncharacterized protein LOC100276...    153   3e-41   Zea mays [maize]
ref|XP_002459482.1|  hypothetical protein SORBIDRAFT_02g005360          152   6e-41   Sorghum bicolor [broomcorn]
ref|XP_003560226.1|  PREDICTED: uncharacterized protein At4g14100...    153   7e-41   Brachypodium distachyon [annual false brome]
gb|EMT32711.1|  hypothetical protein F775_26165                         152   9e-41   
ref|XP_008653006.1|  PREDICTED: uncharacterized protein At4g14100...    152   1e-40   
gb|EMS47301.1|  hypothetical protein TRIUR3_02605                       150   1e-40   Triticum urartu
ref|NP_001144667.1|  uncharacterized protein LOC100277692 precursor     152   2e-40   
ref|XP_010451539.1|  PREDICTED: uncharacterized protein At4g14100...    149   2e-40   
ref|XP_004955717.1|  PREDICTED: uncharacterized protein At4g14100...    147   5e-39   Setaria italica
ref|XP_004957672.1|  PREDICTED: uncharacterized protein At4g14100...    148   5e-39   Setaria italica
ref|XP_002459480.1|  hypothetical protein SORBIDRAFT_02g005350          145   2e-38   
ref|XP_006658553.1|  PREDICTED: uncharacterized protein LOC102715958    149   3e-38   
gb|EAZ03833.1|  hypothetical protein OsI_25962                          145   4e-38   Oryza sativa Indica Group [Indian rice]
gb|ACN27168.1|  unknown                                                 141   3e-37   Zea mays [maize]
ref|NP_001059620.1|  Os07g0475000                                       141   2e-36   
gb|EAZ39776.1|  hypothetical protein OsJ_24212                          141   2e-36   Oryza sativa Japonica Group [Japonica rice]
emb|CAB10188.1|  hypothetical protein                                   145   3e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002462848.1|  hypothetical protein SORBIDRAFT_02g033060          137   7e-35   Sorghum bicolor [broomcorn]
gb|EMT07112.1|  hypothetical protein F775_52341                         135   1e-34   
ref|XP_005646088.1|  hypothetical protein COCSUDRAFT_17537              134   3e-34   Coccomyxa subellipsoidea C-169
gb|EEE66717.1|  hypothetical protein OsJ_23392                          132   2e-33   Oryza sativa Japonica Group [Japonica rice]
gb|ACN28047.1|  unknown                                                 120   2e-29   Zea mays [maize]
gb|EWM22600.1|  transferase-like protein                                118   6e-28   Nannochloropsis gaditana
ref|XP_004978076.1|  PREDICTED: uncharacterized protein LOC101777237    115   1e-26   
ref|XP_006658352.1|  PREDICTED: uncharacterized protein LOC102711000    108   1e-24   
ref|XP_005766945.1|  hypothetical protein EMIHUDRAFT_196892           81.3    5e-15   Emiliania huxleyi CCMP1516
emb|CBN73943.1|  conserved unknown protein                            74.7    3e-12   Ectocarpus siliculosus
ref|NP_001060768.1|  Os08g0102800                                     72.4    4e-12   
gb|EMT02491.1|  hypothetical protein F775_52486                       65.1    2e-08   
ref|XP_002303742.1|  hypothetical protein POPTR_0003s15990g           49.3    2e-04   



>ref|XP_009770858.1| PREDICTED: uncharacterized protein At4g14100-like isoform X1 
[Nicotiana sylvestris]
 ref|XP_009770859.1| PREDICTED: uncharacterized protein At4g14100-like isoform X2 
[Nicotiana sylvestris]
Length=221

 Score =   289 bits (739),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 159/187 (85%), Gaps = 2/187 (1%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P+PTPWP QFHSILF+N T KG LQ++DLWYD+PNGRNFNIIQNQLG  +YDLEW+NGT
Sbjct  34   DPIPTPWPKQFHSILFMNNT-KGNLQVVDLWYDYPNGRNFNIIQNQLGKRLYDLEWDNGT  92

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            S+ YTLD+++EC+V+  PVGILRP+WL G NYLGQ+YMDGFLCNVWEKV+FIWYYEDVV+
Sbjct  93   SYYYTLDANKECRVMHFPVGILRPNWLQGGNYLGQRYMDGFLCNVWEKVDFIWYYEDVVT  152

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSDAKPLRL-G  731
            KRPVYWAF+TGM+AHVMTFEVGKVL DPNWQAP+YCF  +  + + S +  D    RL G
Sbjct  153  KRPVYWAFFTGMIAHVMTFEVGKVLEDPNWQAPVYCFKEAKEQEIDSFVSHDVSMGRLMG  212

Query  732  RAFDVSV  752
             A DVS+
Sbjct  213  AAMDVSL  219



>ref|XP_009622297.1| PREDICTED: uncharacterized protein At4g14100-like [Nicotiana 
tomentosiformis]
Length=225

 Score =   283 bits (725),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 133/192 (69%), Positives = 162/192 (84%), Gaps = 8/192 (4%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P+PTPWP QFHSILF+N  +KG LQ++DLWYD+PNGRNFNIIQNQLG L+YDLEW+NGT
Sbjct  34   DPIPTPWPKQFHSILFMN-NTKGNLQVVDLWYDYPNGRNFNIIQNQLGKLLYDLEWDNGT  92

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            S+ YTLD+++EC+V+  PVGILRP+WL G  +LGQ+YMDGFLCNVWEKV+FIWYYEDVV+
Sbjct  93   SYYYTLDANKECRVMHFPVGILRPNWLQGGKFLGQRYMDGFLCNVWEKVDFIWYYEDVVT  152

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIV-----SDAKP  719
            KRPVYWAF+TGM+AHVMTFEVGKVL DPNWQAP+YCF  S  + + SP++     +D   
Sbjct  153  KRPVYWAFFTGMIAHVMTFEVGKVLEDPNWQAPVYCFKESKEQEI-SPVIDSFVSNDVSI  211

Query  720  LRL-GRAFDVSV  752
             RL G A DVS+
Sbjct  212  GRLMGAAMDVSL  223



>emb|CDO98295.1| unnamed protein product [Coffea canephora]
Length=222

 Score =   281 bits (719),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 133/186 (72%), Positives = 155/186 (83%), Gaps = 8/186 (4%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P+P PWP QFHSILF+N  S+G+LQ +DLWYDWP GRNFNIIQ QLG L+YDLEW+NGT
Sbjct  35   DPIPVPWPEQFHSILFVN-NSEGSLQKVDLWYDWPGGRNFNIIQYQLGKLLYDLEWDNGT  93

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            S+IYTLDS++EC+VL  PVGILRP+WLDGA YLGQKYMDGFLCNVWEKV+FIWYYEDVV+
Sbjct  94   SYIYTLDSNKECRVLHFPVGILRPNWLDGATYLGQKYMDGFLCNVWEKVDFIWYYEDVVT  153

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVE------SLGSPIVSDAK  716
            KRPVYWAF+TG VAHVMTFEVG VL DP WQAP+YCF  +  E      +LG P VS A 
Sbjct  154  KRPVYWAFFTGTVAHVMTFEVGSVLEDPEWQAPVYCFTEAVEETKPVLDTLGGP-VSRAN  212

Query  717  PLRLGR  734
             ++ G+
Sbjct  213  LMKGGK  218



>ref|XP_004235857.1| PREDICTED: uncharacterized protein At4g14100-like [Solanum lycopersicum]
Length=227

 Score =   281 bits (719),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 136/194 (70%), Positives = 157/194 (81%), Gaps = 7/194 (4%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P+PT WP QFHSILF+N  SKG LQ++DLWYD+PNGRNFNIIQNQLG L+YDLEWNN T
Sbjct  35   DPIPTIWPEQFHSILFMN-NSKGNLQIVDLWYDYPNGRNFNIIQNQLGKLLYDLEWNNHT  93

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            SF YTLD S+EC+V+  PVG+LRP WL   NYLGQ+YMDGFLCNVWEKV+FI YYEDVV+
Sbjct  94   SFYYTLDGSKECRVMHFPVGLLRPTWLQDGNYLGQRYMDGFLCNVWEKVDFITYYEDVVT  153

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNST-VESLGSPIV----SDAKP  719
            KRPVYWAFYTGM+AHVMTFEVGKVL DPNWQAP+YCF  +   E + SP+     +D   
Sbjct  154  KRPVYWAFYTGMIAHVMTFEVGKVLEDPNWQAPVYCFKEAKEEEEISSPVRLVTDNDVSI  213

Query  720  LRL-GRAFDVSVSL  758
             RL G A DVS+ L
Sbjct  214  GRLMGAAMDVSLLL  227



>ref|XP_010250496.1| PREDICTED: uncharacterized protein At4g14100-like [Nelumbo nucifera]
Length=203

 Score =   279 bits (713),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 151/185 (82%), Gaps = 5/185 (3%)
 Frame = +3

Query  168  ESNPNAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLV  347
             S   + +P P PTPWP QFHSILF+N +  G+LQ+IDLWYDWPNGRNFNIIQNQLGNL+
Sbjct  21   SSKSYSTEPVPTPTPWPHQFHSILFMNYS--GSLQIIDLWYDWPNGRNFNIIQNQLGNLL  78

Query  348  YDLEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEF  527
            YDLEWNNGTSF+YTLDSS+EC+   + VGILRP+WLDGANYLGQKY+DGFLCNVWEKV+F
Sbjct  79   YDLEWNNGTSFLYTLDSSKECKTSQLEVGILRPNWLDGANYLGQKYVDGFLCNVWEKVDF  138

Query  528  IWYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCF---NNSTVESLGSP  698
            IWYYEDVV+KRPV+W FYTG  AHVMTFEVG VL D  WQAP+YCF          L S 
Sbjct  139  IWYYEDVVNKRPVHWVFYTGRAAHVMTFEVGAVLEDAKWQAPIYCFEKKEEEKNNKLQSL  198

Query  699  IVSDA  713
            IVSD+
Sbjct  199  IVSDS  203



>ref|XP_006341466.1| PREDICTED: uncharacterized protein At4g14100-like [Solanum tuberosum]
Length=226

 Score =   278 bits (710),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 131/187 (70%), Positives = 151/187 (81%), Gaps = 7/187 (4%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P+PTPWP QFHSILF+N  SKG LQ++DLWYD+PNGRNFNIIQNQLG L+YDLEWNN T
Sbjct  34   DPIPTPWPEQFHSILFMN-NSKGNLQIVDLWYDFPNGRNFNIIQNQLGKLLYDLEWNNHT  92

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            SF YTLD+++EC+V   PVG+LRP WL   NYLGQ+YMDGFLCNVWEKVEFI YYEDVV+
Sbjct  93   SFYYTLDANKECRVTHFPVGLLRPTWLQDGNYLGQRYMDGFLCNVWEKVEFITYYEDVVT  152

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSDAKPLRLGR  734
            KRPVYWAFYTGM+AHVMTFEVGKVL DP WQAP+YCF  +  E         + P+RL  
Sbjct  153  KRPVYWAFYTGMIAHVMTFEVGKVLEDPKWQAPVYCFKEAKEEQ------EISYPVRLVT  206

Query  735  AFDVSVS  755
              DVS+ 
Sbjct  207  DNDVSIG  213



>gb|KJB51308.1| hypothetical protein B456_008G211200 [Gossypium raimondii]
Length=219

 Score =   276 bits (705),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 132/192 (69%), Positives = 153/192 (80%), Gaps = 13/192 (7%)
 Frame = +3

Query  171  SNPNAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVY  350
            S PN    +P P+ WPLQFHS+LF+N  + GTLQ +DLWYDWPNGRNFNIIQNQLG L+Y
Sbjct  24   SKPN----DPTPSTWPLQFHSVLFMN--NSGTLQKVDLWYDWPNGRNFNIIQNQLGKLLY  77

Query  351  DLEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFI  530
            DLEW+NGTSFIYTLDS++EC+VL   VGILRP+WLDGANYLGQ+  DGFLCNVWEKV+FI
Sbjct  78   DLEWDNGTSFIYTLDSNKECRVLHFDVGILRPNWLDGANYLGQQQKDGFLCNVWEKVDFI  137

Query  531  WYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCF-------NNSTVESL  689
            WYYEDVV+KRPV+WAFY+G  AHVMTFEVG VL D  WQAP+YCF       N + +ESL
Sbjct  138  WYYEDVVTKRPVFWAFYSGYTAHVMTFEVGAVLEDSKWQAPVYCFKEADGKRNQALIESL  197

Query  690  GSPIVSDAKPLR  725
            GS      K +R
Sbjct  198  GSSDHLHGKLMR  209



>gb|KJB31562.1| hypothetical protein B456_005G197200 [Gossypium raimondii]
Length=218

 Score =   269 bits (688),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 142/166 (86%), Gaps = 2/166 (1%)
 Frame = +3

Query  189  DPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNN  368
            D +P PTPWPLQFHSIL +N +  G LQ+IDLWYDWPNGRNFNIIQ+QLGN++YDLEWNN
Sbjct  37   DKDPTPTPWPLQFHSILVMNYS--GILQVIDLWYDWPNGRNFNIIQHQLGNVLYDLEWNN  94

Query  369  GTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
            GTSF YTLDSS+ C    V VGILRP+WL+GA YLGQ+++DGFLCNVWEKVEFIWY+EDV
Sbjct  95   GTSFFYTLDSSKTCSSAHVEVGILRPNWLEGATYLGQQHVDGFLCNVWEKVEFIWYFEDV  154

Query  549  VSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
            V+KRPV+W FYTG  AHVMTFEVG VL D  WQAP+YCF+N+T  +
Sbjct  155  VTKRPVHWVFYTGREAHVMTFEVGAVLEDSKWQAPVYCFHNTTAST  200



>ref|XP_002299359.2| hypothetical protein POPTR_0001s12870g [Populus trichocarpa]
 gb|EEE84164.2| hypothetical protein POPTR_0001s12870g [Populus trichocarpa]
Length=214

 Score =   269 bits (688),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 125/190 (66%), Positives = 149/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  189  DPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNN  368
            + +P P PWP QFH+ILF+N +  GTLQ IDLWYDW NGRNFNIIQ+QLG L+YDLEWNN
Sbjct  29   EGDPTPAPWPHQFHAILFMNYS--GTLQKIDLWYDWTNGRNFNIIQHQLGKLMYDLEWNN  86

Query  369  GTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
            GTSF YTLDS++EC    + VGILRP+WLDGANYLGQ+++DGFLCNVWEKV+FIWYYEDV
Sbjct  87   GTSFFYTLDSNKECSTAHLEVGILRPNWLDGANYLGQRHVDGFLCNVWEKVDFIWYYEDV  146

Query  549  VSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSDAKPLRL  728
            ++KRPVYW FYTG  AHVMTFEVG  L D  WQAP+YCF N  +   G PI + ++   L
Sbjct  147  ITKRPVYWVFYTGREAHVMTFEVGAALEDAKWQAPVYCFGN--IPEAGYPISATSRENLL  204

Query  729  GRAFDVSVSL  758
            G     S++L
Sbjct  205  GGVLRGSLAL  214



>gb|KHG03624.1| hypothetical protein F383_27203 [Gossypium arboreum]
Length=219

 Score =   269 bits (688),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/181 (71%), Positives = 148/181 (82%), Gaps = 13/181 (7%)
 Frame = +3

Query  171  SNPNAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVY  350
            S PN    +P P+ WPLQFHS+LF+N  + GTLQ +DLWYDWPNGRNFNIIQNQLG L+Y
Sbjct  24   SKPN----DPTPSTWPLQFHSVLFMN--NSGTLQKVDLWYDWPNGRNFNIIQNQLGKLLY  77

Query  351  DLEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFI  530
            DLEW+NGTSFIYTLDS++EC+VL   VGILRP+WLDGANYLGQ+  DGFLCNVWEKV+FI
Sbjct  78   DLEWDNGTSFIYTLDSNKECRVLHFDVGILRPNWLDGANYLGQQQKDGFLCNVWEKVDFI  137

Query  531  WYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCF-------NNSTVESL  689
            WYYEDVV+KRPV+WAFYTG  AHVMT+EVG VL    WQAP+YCF       N + +ESL
Sbjct  138  WYYEDVVTKRPVFWAFYTGYTAHVMTYEVGAVLEGSKWQAPVYCFKEADGKRNQALIESL  197

Query  690  G  692
            G
Sbjct  198  G  198



>gb|KJB31561.1| hypothetical protein B456_005G197200 [Gossypium raimondii]
Length=219

 Score =   269 bits (688),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 142/166 (86%), Gaps = 2/166 (1%)
 Frame = +3

Query  189  DPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNN  368
            D +P PTPWPLQFHSIL +N +  G LQ+IDLWYDWPNGRNFNIIQ+QLGN++YDLEWNN
Sbjct  37   DKDPTPTPWPLQFHSILVMNYS--GILQVIDLWYDWPNGRNFNIIQHQLGNVLYDLEWNN  94

Query  369  GTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
            GTSF YTLDSS+ C    V VGILRP+WL+GA YLGQ+++DGFLCNVWEKVEFIWY+EDV
Sbjct  95   GTSFFYTLDSSKTCSSAHVEVGILRPNWLEGATYLGQQHVDGFLCNVWEKVEFIWYFEDV  154

Query  549  VSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
            V+KRPV+W FYTG  AHVMTFEVG VL D  WQAP+YCF+N+T  +
Sbjct  155  VTKRPVHWVFYTGREAHVMTFEVGAVLEDSKWQAPVYCFHNTTAST  200



>ref|XP_011036207.1| PREDICTED: uncharacterized protein At4g14100-like [Populus euphratica]
Length=214

 Score =   268 bits (685),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 124/190 (65%), Positives = 148/190 (78%), Gaps = 4/190 (2%)
 Frame = +3

Query  189  DPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNN  368
            + +P P PWP QFH+ILF+N +  G LQ IDLWYDW NGRNFNIIQ+QLG L+YDLEWNN
Sbjct  29   EGDPTPAPWPHQFHAILFMNYS--GILQKIDLWYDWTNGRNFNIIQHQLGKLMYDLEWNN  86

Query  369  GTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
            GTSF YTLDS++EC    + VGILRP+WLDGANYLGQ+++DGFLCNVWEKVEFIWYYEDV
Sbjct  87   GTSFFYTLDSNKECSTAHLEVGILRPNWLDGANYLGQRHVDGFLCNVWEKVEFIWYYEDV  146

Query  549  VSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSDAKPLRL  728
            ++KRPV+W FYTG  AHVMTFEVG  L D  WQAP+YCF N  +   G PI + ++   L
Sbjct  147  ITKRPVHWVFYTGREAHVMTFEVGAALEDAKWQAPVYCFGN--IPEAGYPISATSRENLL  204

Query  729  GRAFDVSVSL  758
            G     S++L
Sbjct  205  GGVLRGSLAL  214



>ref|XP_010527438.1| PREDICTED: uncharacterized protein At4g14100 [Tarenaya hassleriana]
Length=208

 Score =   267 bits (683),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 123/178 (69%), Positives = 141/178 (79%), Gaps = 2/178 (1%)
 Frame = +3

Query  189  DPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNN  368
            D EPVP PWP QFH++LF+N +  G+L+MIDLWYDW NGRNFNIIQ QLG L YDLEWNN
Sbjct  30   DAEPVPAPWPHQFHALLFMNYS--GSLEMIDLWYDWINGRNFNIIQKQLGILTYDLEWNN  87

Query  369  GTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
            GTSF Y LD SREC+ + V VGILRP+WLDGA YLGQ+YMDGFLCNVWEKVEFIWYYEDV
Sbjct  88   GTSFFYRLDESRECRTVQVEVGILRPNWLDGAKYLGQRYMDGFLCNVWEKVEFIWYYEDV  147

Query  549  VSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSDAKPL  722
            V+KRPV+W FYTG  AHVMT+EVG VL D  WQAP+YCF+      L    + + K +
Sbjct  148  VTKRPVHWVFYTGREAHVMTYEVGAVLEDEKWQAPVYCFDQERESFLSEGGLREFKGI  205



>ref|XP_008239573.1| PREDICTED: uncharacterized protein At4g14100-like [Prunus mume]
Length=237

 Score =   268 bits (684),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEW  362
            +   +P P  WP QFHS+LF+N  SKG LQ++DLWYDWPNGRNFNIIQ+QLG L YDLEW
Sbjct  44   SASDDPAPAAWPHQFHSVLFMN-NSKGALQIVDLWYDWPNGRNFNIIQSQLGKLTYDLEW  102

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            +NGTSFIYTLD++REC+ L  PVGILRP+WLDGA YLGQ+++DGFLCNVWEKV+FIWYYE
Sbjct  103  DNGTSFIYTLDANRECKTLHFPVGILRPNWLDGATYLGQRHVDGFLCNVWEKVDFIWYYE  162

Query  543  DVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCF  665
            DV++KRPV+W FYTG  AHVMTFEVG VL D  W+AP+YCF
Sbjct  163  DVLTKRPVHWVFYTGFNAHVMTFEVGAVLGDAKWEAPVYCF  203



>ref|XP_007226105.1| hypothetical protein PRUPE_ppa010928mg [Prunus persica]
 gb|EMJ27304.1| hypothetical protein PRUPE_ppa010928mg [Prunus persica]
Length=230

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 140/168 (83%), Gaps = 2/168 (1%)
 Frame = +3

Query  174  NPNAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYD  353
            N    D +P PTPWP QFHSIL +N T  GTLQ+IDLWYDWPNGRNFNIIQ+QLG+++YD
Sbjct  29   NSTISDEDPSPTPWPHQFHSILVMNYT--GTLQLIDLWYDWPNGRNFNIIQHQLGSVLYD  86

Query  354  LEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIW  533
            LEWNNGTSF YTLDS+REC+ + + VGILRPDWLDGA YLG++++DGFLC+VWEK +FI 
Sbjct  87   LEWNNGTSFFYTLDSARECRTVQIEVGILRPDWLDGAKYLGRRHVDGFLCDVWEKADFIS  146

Query  534  YYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNST  677
            YYEDV +KRPV+W FYTG  AHVMTFEVG VL D  WQAP+YCF+  T
Sbjct  147  YYEDVATKRPVHWVFYTGREAHVMTFEVGAVLEDAKWQAPVYCFDKKT  194



>ref|XP_008385757.1| PREDICTED: uncharacterized protein At4g14100-like [Malus domestica]
Length=239

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 123/193 (64%), Positives = 144/193 (75%), Gaps = 10/193 (5%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEW  362
            +   +P P  WP QFHS+LF+N  SKG LQ++DLWYDWPNGRNFNIIQ+QLG L YDLEW
Sbjct  37   SASDDPAPAAWPHQFHSVLFMN-NSKGALQVVDLWYDWPNGRNFNIIQSQLGKLTYDLEW  95

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            +NGTS+IYTLDS REC  +  PVGILRPDWLDGANYLGQ+++DGFLCNVWEKV+FIWYYE
Sbjct  96   DNGTSYIYTLDSDRECNTMHFPVGILRPDWLDGANYLGQQHVDGFLCNVWEKVDFIWYYE  155

Query  543  DVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES---------LGS  695
            DV+++RPV+W FYTG  AHVMTFEVG VL D  W AP +CF     +S         L  
Sbjct  156  DVLTRRPVHWVFYTGYTAHVMTFEVGAVLEDAKWDAPAHCFGEEKTDSAQRGRSPPLLLE  215

Query  696  PIVSDAKPLRLGR  734
             + SD    RL R
Sbjct  216  SVTSDYSHGRLMR  228



>ref|XP_007209533.1| hypothetical protein PRUPE_ppa010693mg [Prunus persica]
 gb|EMJ10732.1| hypothetical protein PRUPE_ppa010693mg [Prunus persica]
Length=240

 Score =   267 bits (683),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 138/161 (86%), Gaps = 1/161 (1%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEW  362
            +   +P P  WP QFHS+LF+N  SKG LQ++DLWYDWPNGRNFNIIQ+QLG L YDLEW
Sbjct  45   SASDDPAPAAWPHQFHSVLFMN-NSKGALQIVDLWYDWPNGRNFNIIQSQLGKLTYDLEW  103

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            +NGTSFIYTLD++REC+ L  PVGILRP+WLDGA YLGQ+++DGFLCNVWEKV+FIWYYE
Sbjct  104  DNGTSFIYTLDANRECKTLHFPVGILRPNWLDGATYLGQRHVDGFLCNVWEKVDFIWYYE  163

Query  543  DVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCF  665
            DV+++RPV+W FYTG  AHVMTFEVG VL D  W+AP+YCF
Sbjct  164  DVLTRRPVHWVFYTGFNAHVMTFEVGAVLGDAKWEAPVYCF  204



>ref|XP_011082873.1| PREDICTED: uncharacterized protein At4g14100-like [Sesamum indicum]
Length=217

 Score =   266 bits (680),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 142/164 (87%), Gaps = 1/164 (1%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +PVPTPWPLQFHSIL +N  +KG LQ++DLWYDWPNGRNFNIIQ+QLG  +YDLEW+NGT
Sbjct  31   DPVPTPWPLQFHSILLMN-NTKGLLQVVDLWYDWPNGRNFNIIQHQLGKKLYDLEWDNGT  89

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            S+ YTLD+++EC++   PVGILRP+WLDGA YLGQ Y DGFLCNVWEKV+FIWYYEDV +
Sbjct  90   SYYYTLDANKECKIRHFPVGILRPNWLDGAKYLGQVYRDGFLCNVWEKVDFIWYYEDVAT  149

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
            KRPV WAF++GM+ HVMTFEVG+VL DPNWQAP+YCF  +  E 
Sbjct  150  KRPVSWAFFSGMIGHVMTFEVGQVLDDPNWQAPVYCFEGAKQEH  193



>gb|ABK96423.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96676.1| unknown [Populus trichocarpa x Populus deltoides]
Length=219

 Score =   266 bits (680),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 140/160 (88%), Gaps = 2/160 (1%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P P PWP QFHSILF++  + G+LQ++DLWYDW NGRNFNIIQNQLG L+YDLEW+NGT
Sbjct  30   DPTPAPWPHQFHSILFMD--NNGSLQVVDLWYDWTNGRNFNIIQNQLGKLLYDLEWDNGT  87

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            S+IYTLDS++EC VL  PVG+LRP+WL+GA YLGQ+ +DGFLCNVW+KV+FIWYYEDV++
Sbjct  88   SYIYTLDSNKECSVLHFPVGVLRPNWLEGATYLGQQEVDGFLCNVWQKVDFIWYYEDVIT  147

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            KRPVYW FYTGM AHVMTFEVG VL DP WQAP+YCF  S
Sbjct  148  KRPVYWVFYTGMTAHVMTFEVGAVLEDPKWQAPVYCFKES  187



>ref|XP_012090568.1| PREDICTED: uncharacterized protein At4g14100-like isoform X2 
[Jatropha curcas]
 dbj|BAJ53117.1| JHL07K02.7 [Jatropha curcas]
 gb|KDP22523.1| hypothetical protein JCGZ_26354 [Jatropha curcas]
Length=218

 Score =   266 bits (680),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 125/171 (73%), Positives = 143/171 (84%), Gaps = 5/171 (3%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P P PWPLQFHSILF+N  S G LQ+ DLWYDWPNGRNFNIIQNQLG L+YDLEW+NGT
Sbjct  32   DPTPAPWPLQFHSILFMN-DSTGQLQVTDLWYDWPNGRNFNIIQNQLGKLLYDLEWDNGT  90

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            S+ YTLDS++EC+V   PVGILRP++LDGA YLGQK +DGFLCNVWEKV+FIWYYEDVV+
Sbjct  91   SYYYTLDSNQECKVRHFPVGILRPNFLDGATYLGQKQVDGFLCNVWEKVDFIWYYEDVVT  150

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS----TVESLGS  695
            KRPVYW FYTGMV HVMTFEVG VL D  WQAP+YCF  +     +ESL +
Sbjct  151  KRPVYWVFYTGMVIHVMTFEVGAVLEDEKWQAPVYCFKENNPYPVIESLST  201



>ref|XP_008222268.1| PREDICTED: uncharacterized protein At4g14100-like [Prunus mume]
Length=230

 Score =   266 bits (680),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 141/168 (84%), Gaps = 2/168 (1%)
 Frame = +3

Query  174  NPNAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYD  353
            N +  D +P PTPWP QFHSIL +N T  GTLQ+IDLWYDWPNGRNFNIIQ+QLG+++YD
Sbjct  29   NSSISDEDPSPTPWPHQFHSILVMNYT--GTLQLIDLWYDWPNGRNFNIIQHQLGSVLYD  86

Query  354  LEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIW  533
            LEWNNGTSF YTLDS+REC+ + + VGILRP+WLDGA YLG++++DGFLC+VWEK +FI 
Sbjct  87   LEWNNGTSFFYTLDSARECRTVQIEVGILRPNWLDGAKYLGRRHVDGFLCDVWEKADFIS  146

Query  534  YYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNST  677
            YYEDV +KRPV+W FYTG  AHVMTFEVG VL D  WQAPLYCF+  T
Sbjct  147  YYEDVATKRPVHWVFYTGREAHVMTFEVGAVLEDAKWQAPLYCFDKKT  194



>ref|XP_009339023.1| PREDICTED: uncharacterized protein At4g14100-like [Pyrus x bretschneideri]
Length=240

 Score =   266 bits (681),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 119/171 (70%), Positives = 137/171 (80%), Gaps = 1/171 (1%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEW  362
            +   +P P  WP QFHS+LF+N  SKG LQ++DLWYDWPNGRNFNIIQ+QLG L YDLEW
Sbjct  38   SASDDPAPAAWPHQFHSVLFMN-NSKGALQVVDLWYDWPNGRNFNIIQSQLGKLTYDLEW  96

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            +NGTS+IYTLDS REC  +  PVGILRPDWLDGANYLGQ+ +DGFLCNVWEKV+FIWYYE
Sbjct  97   DNGTSYIYTLDSDRECNTMHFPVGILRPDWLDGANYLGQRRVDGFLCNVWEKVDFIWYYE  156

Query  543  DVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGS  695
            DV++KRPV+W FYTG  AHVMTFEVG VL D  W AP +CF     +S  S
Sbjct  157  DVLTKRPVHWVFYTGYNAHVMTFEVGAVLEDAKWDAPAHCFGEEKTDSAQS  207



>ref|XP_004301755.1| PREDICTED: uncharacterized protein At4g14100-like [Fragaria vesca 
subsp. vesca]
Length=215

 Score =   265 bits (678),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 125/185 (68%), Positives = 142/185 (77%), Gaps = 7/185 (4%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P P  WP QFHS+LF+N  + G LQM+DLWYDWPNGRNFNIIQNQLG L YDLEW+NGT
Sbjct  28   DPTPATWPHQFHSVLFMN--NSGALQMLDLWYDWPNGRNFNIIQNQLGKLKYDLEWDNGT  85

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            SFIYTLDS REC+VL   VGILRP+WL+GA YLGQ+++DGFLCNVWEKV+FIWYYEDVV+
Sbjct  86   SFIYTLDSDRECRVLHFEVGILRPNWLEGATYLGQRHVDGFLCNVWEKVDFIWYYEDVVT  145

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNST-----VESLGSPIVSDAKP  719
            KRPV+W FYTGM AHVMTFEVG  L D  W AP+YCF  +        SL     SD   
Sbjct  146  KRPVHWLFYTGMSAHVMTFEVGAQLEDKEWNAPVYCFGEAVKLERKKSSLTEATASDYSH  205

Query  720  LRLGR  734
             RL R
Sbjct  206  GRLVR  210



>ref|XP_010104040.1| hypothetical protein L484_005513 [Morus notabilis]
 gb|EXB98024.1| hypothetical protein L484_005513 [Morus notabilis]
Length=215

 Score =   265 bits (678),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 141/172 (82%), Gaps = 2/172 (1%)
 Frame = +3

Query  189  DPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNN  368
            +P P PTPWP QFHSIL + +   GT Q+IDLWYDWPNGRNFNIIQ+QLGN++YDLEWNN
Sbjct  29   EPVPTPTPWPHQFHSILVMQL--NGTYQIIDLWYDWPNGRNFNIIQHQLGNVLYDLEWNN  86

Query  369  GTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
            GTSF YTLDSSR+C    +  GILRP+WLDGANYLGQ+ +DGFLCNVWEKV+FIWYYEDV
Sbjct  87   GTSFFYTLDSSRQCSSAQLEFGILRPNWLDGANYLGQRNVDGFLCNVWEKVDFIWYYEDV  146

Query  549  VSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIV  704
            ++KRPV W FYTG  AHVMTFEVG VL D NWQAP+YCF +   +S   P++
Sbjct  147  LTKRPVLWVFYTGREAHVMTFEVGAVLEDENWQAPVYCFESDGKKSASRPLL  198



>ref|XP_002322309.1| hypothetical protein POPTR_0015s11960g [Populus trichocarpa]
 gb|ABK94230.1| unknown [Populus trichocarpa]
 gb|EEF06436.1| hypothetical protein POPTR_0015s11960g [Populus trichocarpa]
Length=219

 Score =   265 bits (678),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 141/160 (88%), Gaps = 2/160 (1%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P P PWP QFHSILF++  + G+LQ++DLWYDW NGRNFNIIQNQLG L+YDLEW+NGT
Sbjct  30   DPTPAPWPHQFHSILFMD--NNGSLQVVDLWYDWTNGRNFNIIQNQLGKLLYDLEWDNGT  87

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            S+IYTLDS++EC+VL  PVG+LRP+WL+GA +LGQ+ +DGFLCNVW+KV+FIWYYEDV++
Sbjct  88   SYIYTLDSNKECRVLHFPVGVLRPNWLEGATHLGQQEVDGFLCNVWQKVDFIWYYEDVIT  147

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            KRPVYW FYTGM AHVMTFEVG VL DP WQAP+YCF  S
Sbjct  148  KRPVYWVFYTGMTAHVMTFEVGAVLEDPKWQAPVYCFKES  187



>ref|XP_007038171.1| Transferring glycosyl groups, putative [Theobroma cacao]
 gb|EOY22672.1| Transferring glycosyl groups, putative [Theobroma cacao]
Length=216

 Score =   265 bits (676),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 143/172 (83%), Gaps = 8/172 (5%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P P  WPLQFHSILF+N  + GTLQ +DLWYDWPNGRNFNIIQNQLG LVYDLEW+NGT
Sbjct  28   DPTPAAWPLQFHSILFMN--NSGTLQKVDLWYDWPNGRNFNIIQNQLGKLVYDLEWDNGT  85

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            S+IY+ DS +EC+VL  PVGILRP+WLDGANYLGQ+  DGFLCNVWEKV+FI YYEDV++
Sbjct  86   SYIYSPDSDKECRVLHFPVGILRPNWLDGANYLGQQEKDGFLCNVWEKVDFIRYYEDVIT  145

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS------TVESLG  692
            KRPVYWAFYTG  AHVMTFEVG VL D +WQAP+YCF  +       +ES+G
Sbjct  146  KRPVYWAFYTGYTAHVMTFEVGAVLGDSHWQAPVYCFEEAEENRKPVIESVG  197



>gb|KHG21078.1| hypothetical protein F383_27808 [Gossypium arboreum]
Length=218

 Score =   264 bits (675),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 141/166 (85%), Gaps = 2/166 (1%)
 Frame = +3

Query  189  DPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNN  368
            D +P PTPWPLQFHSIL +N +  G LQ+IDLWYDWPNGRNFNIIQ+QLGN++YDLEWNN
Sbjct  37   DKDPTPTPWPLQFHSILVMNYS--GILQVIDLWYDWPNGRNFNIIQHQLGNVLYDLEWNN  94

Query  369  GTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
            GTSF YTLDS + C    + VGILRP+WL+GA YLGQ+++DGFLCNVWEKVEFIWY+EDV
Sbjct  95   GTSFFYTLDSFKTCSSAHLEVGILRPNWLEGATYLGQQHVDGFLCNVWEKVEFIWYFEDV  154

Query  549  VSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
            V+KRPV+W FYTG  AHVMTF+VG VL D  WQAP+YCF+N+T  +
Sbjct  155  VTKRPVHWVFYTGREAHVMTFDVGAVLEDSKWQAPVYCFHNTTAST  200



>ref|XP_011040289.1| PREDICTED: uncharacterized protein At4g14100-like [Populus euphratica]
Length=219

 Score =   263 bits (671),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 139/160 (87%), Gaps = 2/160 (1%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P P PWP QFHSI+F+N  + G+LQ +DLWYDW NGRNFNIIQNQLG L+YDLEW+NGT
Sbjct  30   DPTPAPWPHQFHSIIFMN--NNGSLQAVDLWYDWINGRNFNIIQNQLGKLLYDLEWDNGT  87

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            S+IYTLDS++EC+VL  PVG+LRP+WL+GA YLGQ+ +DGF CNVW+KV+FIWYYEDV++
Sbjct  88   SYIYTLDSNKECRVLHFPVGVLRPNWLEGATYLGQQEVDGFFCNVWQKVDFIWYYEDVIT  147

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            KRPV+W FYTGM AHVMTFEVG VL DP WQAP+YCF  S
Sbjct  148  KRPVHWVFYTGMTAHVMTFEVGAVLEDPKWQAPVYCFKES  187



>ref|XP_008459918.1| PREDICTED: uncharacterized protein At4g14100-like [Cucumis melo]
 ref|XP_008459919.1| PREDICTED: uncharacterized protein At4g14100-like [Cucumis melo]
Length=213

 Score =   262 bits (670),  Expect = 9e-84, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 140/160 (88%), Gaps = 2/160 (1%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +PVPTPWPLQFHSIL +N +  G LQ+I+LWYDWPNGRNFNI+Q+QLG++VYDLEWNNGT
Sbjct  25   DPVPTPWPLQFHSILLMNYS--GILQIINLWYDWPNGRNFNIMQHQLGHVVYDLEWNNGT  82

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            SF+YTLDSS+ C    + VGILRP+WLDGA YLGQ+++DGFLCNVWEKV+FIWYYEDV +
Sbjct  83   SFVYTLDSSKTCSSAQLEVGILRPNWLDGAKYLGQRHVDGFLCNVWEKVDFIWYYEDVET  142

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            KRPV+W FYTG  AHVMTFEVG VL D NWQAP+YCF+ +
Sbjct  143  KRPVHWLFYTGRQAHVMTFEVGAVLEDENWQAPVYCFDGT  182



>ref|XP_007043758.1| Transferases, transferring glycosyl groups [Theobroma cacao]
 gb|EOX99589.1| Transferases, transferring glycosyl groups [Theobroma cacao]
Length=211

 Score =   261 bits (666),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/176 (69%), Positives = 144/176 (82%), Gaps = 3/176 (2%)
 Frame = +3

Query  189  DPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNN  368
            D +P PTPWP QFHSIL +N +  G LQ+IDLWYDWPNGRNFNIIQ+QLGN++YDLEWNN
Sbjct  30   DQDPTPTPWPHQFHSILVMNYS--GILQVIDLWYDWPNGRNFNIIQHQLGNVLYDLEWNN  87

Query  369  GTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
            GTSF YTLDSS++C    + VGILRP+WLDGA YLGQ+++DGFLCNVWEKV+FIWYYEDV
Sbjct  88   GTSFFYTLDSSKKCSSAQLEVGILRPNWLDGAKYLGQQHVDGFLCNVWEKVDFIWYYEDV  147

Query  549  VSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFN-NSTVESLGSPIVSDA  713
            V+KRPV+W FYTG  AHVMTFEVG  L D  WQAP+YCF+ N ++ S+    + D 
Sbjct  148  VTKRPVHWVFYTGREAHVMTFEVGAALEDAKWQAPVYCFDKNDSLTSIPVETMVDG  203



>emb|CBI29275.3| unnamed protein product [Vitis vinifera]
Length=228

 Score =   261 bits (667),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  171  SNPNAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVY  350
            S  ++   +P PTPWP QFHSILF+N +  G L++IDLWYDWPNGRNFNI+Q+QLG LVY
Sbjct  32   SVSSSKSTDPTPTPWPHQFHSILFMNYS--GALEIIDLWYDWPNGRNFNIMQDQLGELVY  89

Query  351  DLEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFI  530
            DLEWNNGTSF+YTLD+   C    + VGILRP+WLDGANYLGQ  +DGFLCN+WEKV+FI
Sbjct  90   DLEWNNGTSFVYTLDAPNRCHTAQLEVGILRPNWLDGANYLGQHQVDGFLCNLWEKVDFI  149

Query  531  WYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPI-VS  707
            WYYEDVV+KRPV+W FYTG  AHVMTFEVG VL D  WQAP+YCF   T     + +  +
Sbjct  150  WYYEDVVTKRPVHWRFYTGRTAHVMTFEVGAVLEDTKWQAPVYCFEKKTDTDTDTALPKA  209

Query  708  DAKPLRL  728
            D   +RL
Sbjct  210  DIGSMRL  216



>ref|XP_010466733.1| PREDICTED: uncharacterized protein At4g14100-like [Camelina sativa]
Length=189

 Score =   259 bits (661),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 115/165 (70%), Positives = 136/165 (82%), Gaps = 2/165 (1%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEW  362
            AGD EPVP PWP QFH+++ +N    G+L+++DLWYDW NGRNFNIIQ QLG L YDLEW
Sbjct  21   AGDDEPVPAPWPEQFHALMLMN--KSGSLEIVDLWYDWVNGRNFNIIQKQLGKLKYDLEW  78

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            NNGTSF Y+LD SR C+ L+  VGILRP+WLDGA Y+GQ++++GFLCNVWEKVEF+WYYE
Sbjct  79   NNGTSFYYSLDQSRTCRTLNFEVGILRPNWLDGAKYMGQRHVNGFLCNVWEKVEFLWYYE  138

Query  543  DVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNST  677
            DVV+KRPV W FYTG  AHVMTFEVG VL D  WQAP+YCF+N  
Sbjct  139  DVVTKRPVQWIFYTGREAHVMTFEVGAVLEDEKWQAPVYCFHNEK  183



>ref|XP_010490084.1| PREDICTED: uncharacterized protein At4g14100-like, partial [Camelina 
sativa]
Length=198

 Score =   259 bits (662),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 138/170 (81%), Gaps = 2/170 (1%)
 Frame = +3

Query  168  ESNPNAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLV  347
            +S+  AGD EPVP PWP QFH+++ +N    G+L+++DLWYDW NGRNFNIIQ QLG L 
Sbjct  25   QSSAAAGDDEPVPAPWPEQFHALMLMN--KSGSLEIVDLWYDWVNGRNFNIIQKQLGRLK  82

Query  348  YDLEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEF  527
            YDLEWNNGTSF Y+LD SR C+ +   VGILRP+WLDGA YLGQ++++GFLCNVWEKVEF
Sbjct  83   YDLEWNNGTSFYYSLDESRTCRTVHFEVGILRPNWLDGAKYLGQRHVNGFLCNVWEKVEF  142

Query  528  IWYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNST  677
            +WYYEDVV+KRPV W FYTG  AHVMTFEVG VL D  WQAP+YCF+N  
Sbjct  143  LWYYEDVVTKRPVQWIFYTGREAHVMTFEVGAVLEDEKWQAPVYCFHNEK  192



>ref|XP_012090567.1| PREDICTED: uncharacterized protein At4g14100-like isoform X1 
[Jatropha curcas]
Length=222

 Score =   260 bits (664),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 143/175 (82%), Gaps = 9/175 (5%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P P PWPLQFHSILF+N  S G LQ+ DLWYDWPNGRNFNIIQNQLG L+YDLEW+NGT
Sbjct  32   DPTPAPWPLQFHSILFMN-DSTGQLQVTDLWYDWPNGRNFNIIQNQLGKLLYDLEWDNGT  90

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            S+ YTLDS++EC+V   PVGILRP++LDGA YLGQK +DGFLCNVWEKV+FIWYYEDVV+
Sbjct  91   SYYYTLDSNQECKVRHFPVGILRPNFLDGATYLGQKQVDGFLCNVWEKVDFIWYYEDVVT  150

Query  555  KRPVYWAFYT----GMVAHVMTFEVGKVLSDPNWQAPLYCFNNS----TVESLGS  695
            KRPVYW FYT    GMV HVMTFEVG VL D  WQAP+YCF  +     +ESL +
Sbjct  151  KRPVYWVFYTVCFSGMVIHVMTFEVGAVLEDEKWQAPVYCFKENNPYPVIESLST  205



>ref|XP_002268123.2| PREDICTED: uncharacterized protein At4g14100-like [Vitis vinifera]
Length=220

 Score =   260 bits (664),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 121/187 (65%), Positives = 144/187 (77%), Gaps = 3/187 (2%)
 Frame = +3

Query  171  SNPNAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVY  350
            S  ++   +P PTPWP QFHSILF+N +  G L++IDLWYDWPNGRNFNI+Q+QLG LVY
Sbjct  24   SVSSSKSTDPTPTPWPHQFHSILFMNYS--GALEIIDLWYDWPNGRNFNIMQDQLGELVY  81

Query  351  DLEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFI  530
            DLEWNNGTSF+YTLD+   C    + VGILRP+WLDGANYLGQ  +DGFLCN+WEKV+FI
Sbjct  82   DLEWNNGTSFVYTLDAPNRCHTAQLEVGILRPNWLDGANYLGQHQVDGFLCNLWEKVDFI  141

Query  531  WYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPI-VS  707
            WYYEDVV+KRPV+W FYTG  AHVMTFEVG VL D  WQAP+YCF   T     + +  +
Sbjct  142  WYYEDVVTKRPVHWRFYTGRTAHVMTFEVGAVLEDTKWQAPVYCFEKKTDTDTDTALPKA  201

Query  708  DAKPLRL  728
            D   +RL
Sbjct  202  DIGSMRL  208



>ref|XP_011086903.1| PREDICTED: uncharacterized protein At4g14100 [Sesamum indicum]
Length=237

 Score =   260 bits (665),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 139/166 (84%), Gaps = 3/166 (2%)
 Frame = +3

Query  177  PNAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDL  356
            P   +P P PTPWPLQFHSILF+N +  G+L +IDLWYDWPNGRNFNIIQ+QLG L+YDL
Sbjct  44   PAMAEP-PKPTPWPLQFHSILFVNYS--GSLSLIDLWYDWPNGRNFNIIQDQLGELLYDL  100

Query  357  EWNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWY  536
            EWNNGTSF+YTLDSS++C+   + VGILRP+WLDGA YLGQ+ +DGFLCNVW+KV+FIWY
Sbjct  101  EWNNGTSFLYTLDSSKKCRSAQLEVGILRPNWLDGAVYLGQENVDGFLCNVWQKVDFIWY  160

Query  537  YEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            YEDVV+KRPV+W FYTG   HVMTFEVG VL D  WQAP+YCF   
Sbjct  161  YEDVVTKRPVHWVFYTGRSIHVMTFEVGAVLEDAKWQAPVYCFEKK  206



>ref|XP_004140561.1| PREDICTED: uncharacterized protein At4g14100-like [Cucumis sativus]
 gb|KGN46406.1| hypothetical protein Csa_6G091300 [Cucumis sativus]
Length=213

 Score =   258 bits (659),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 139/160 (87%), Gaps = 2/160 (1%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +PVPTPWPLQFHSIL +N +  G  Q+I+LWYDWPNGRNFNIIQ+QLG+++YDLEWNNGT
Sbjct  25   DPVPTPWPLQFHSILLMNYS--GIPQIINLWYDWPNGRNFNIIQHQLGHVLYDLEWNNGT  82

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            SF YTLDSS+ C    + VGILRP+WLDGA YLGQ+++DGFLCNVWEKV+FIWYYEDV +
Sbjct  83   SFFYTLDSSKTCSSAQLEVGILRPNWLDGAKYLGQRHVDGFLCNVWEKVDFIWYYEDVET  142

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            KRPV+W FYTG  AHVMTFEVG VL D NWQAP+YCF+++
Sbjct  143  KRPVHWLFYTGRQAHVMTFEVGAVLDDENWQAPVYCFDST  182



>ref|XP_010512873.1| PREDICTED: uncharacterized protein At4g14100-like [Camelina sativa]
Length=190

 Score =   257 bits (657),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 135/165 (82%), Gaps = 2/165 (1%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEW  362
            AGD EPVP PWP QFH+++ +N    G+L+++DLWYDW NGRNFNIIQ QLG L YDLEW
Sbjct  22   AGDDEPVPAPWPEQFHALMLMN--KSGSLEIVDLWYDWVNGRNFNIIQKQLGRLKYDLEW  79

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            NNGTSF Y+LD SR C+ +   VGILRP+WLDGA Y+GQ++++GFLCNVWEKVEF+WYYE
Sbjct  80   NNGTSFYYSLDESRTCRTVHFEVGILRPNWLDGAKYMGQRHVNGFLCNVWEKVEFLWYYE  139

Query  543  DVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNST  677
            DVV+KRPV W FYTG  AHVMTFEVG VL D  WQAP+YCF+N  
Sbjct  140  DVVTKRPVQWVFYTGREAHVMTFEVGAVLEDEKWQAPVYCFHNEK  184



>ref|XP_008459920.1| PREDICTED: uncharacterized protein At4g14100-like [Cucumis melo]
Length=226

 Score =   258 bits (660),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +PVPTPWPLQFHSIL +N +  G  Q+I+LWYDWPNGRNFNIIQ+QLGN++YDLEWNNGT
Sbjct  38   DPVPTPWPLQFHSILLMNYS--GIPQIINLWYDWPNGRNFNIIQHQLGNVLYDLEWNNGT  95

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            SF YTLDSS+ C    + VGILRP+WLDGA YLGQ+++DGFLCNVWEKV+FIWYYEDV +
Sbjct  96   SFFYTLDSSKTCSSAQLEVGILRPNWLDGAKYLGQRHVDGFLCNVWEKVDFIWYYEDVET  155

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            KRPV+W FYTG  AHVMTFEVG VL D  WQAP+YCF+ +
Sbjct  156  KRPVHWLFYTGRQAHVMTFEVGAVLEDEKWQAPVYCFDGT  195



>ref|XP_002512689.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF50141.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=208

 Score =   258 bits (658),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 118/173 (68%), Positives = 140/173 (81%), Gaps = 4/173 (2%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEW  362
            A   EP P PWP QFH+ILF+N    G L+ IDLWYDW NGRNFNIIQ+QLG+++YDLEW
Sbjct  22   AEGGEPAPAPWPHQFHAILFMN--KSGILEKIDLWYDWTNGRNFNIIQHQLGDVLYDLEW  79

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            NNGTSF YTLDS++EC    + VGILRP+WLDGA YLGQ+++DGFLCNVWEKV+FIWYYE
Sbjct  80   NNGTSFFYTLDSNKECSSAQLEVGILRPNWLDGAKYLGQRHVDGFLCNVWEKVDFIWYYE  139

Query  543  DVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCF--NNSTVESLGS  695
            DVV+KRPV+W FY+G  AHVMTFEVG  L D NWQAP+YCF  N + V +L +
Sbjct  140  DVVTKRPVHWVFYSGREAHVMTFEVGAALEDANWQAPVYCFDPNAAAVSTLST  192



>gb|KDO57640.1| hypothetical protein CISIN_1g037407mg [Citrus sinensis]
Length=216

 Score =   258 bits (658),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 121/172 (70%), Positives = 142/172 (83%), Gaps = 3/172 (2%)
 Frame = +3

Query  222  QFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTSFIYTLDSS  401
            QFH+ILF+N  + GTLQ +DLWYDWPNGRNFNIIQNQLG L YDLEW+NGTS+IYTLD++
Sbjct  41   QFHAILFMN--NSGTLQKVDLWYDWPNGRNFNIIQNQLGKLTYDLEWDNGTSYIYTLDAN  98

Query  402  RECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYWAFY  581
            +EC+VL  PVGILRP WLDGA YLGQKY+D FLCNVW KV+FIWYYEDVV+KRPV+WAFY
Sbjct  99   KECRVLHFPVGILRPSWLDGAEYLGQKYVDKFLCNVWTKVDFIWYYEDVVTKRPVHWAFY  158

Query  582  TGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES-LGSPIVSDAKPLRLGR  734
            TG  A V+TFEVG VL DP WQAP+YCF N   E  L + +V+D+   +L R
Sbjct  159  TGYTADVITFEVGAVLEDPKWQAPVYCFGNEGEERPLLNSVVTDSSSGKLIR  210



>ref|XP_010250495.1| PREDICTED: uncharacterized protein At4g14100-like [Nelumbo nucifera]
Length=226

 Score =   257 bits (656),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 134/150 (89%), Gaps = 2/150 (1%)
 Frame = +3

Query  222  QFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTSFIYTLDSS  401
            QFHS+L++N  S GTLQ++DLWYDWPNGRNFNIIQNQLG L+YDLEWNNGTSF YTLDS+
Sbjct  47   QFHSLLYMN--SSGTLQIVDLWYDWPNGRNFNIIQNQLGKLLYDLEWNNGTSFYYTLDSN  104

Query  402  RECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYWAFY  581
            +EC++    VGILRP+WLDGANYLGQ+Y+DGFLCNVWEKV+FIWYYEDVV+KRPV+W F+
Sbjct  105  QECRIRHFEVGILRPNWLDGANYLGQEYVDGFLCNVWEKVDFIWYYEDVVTKRPVHWLFF  164

Query  582  TGMVAHVMTFEVGKVLSDPNWQAPLYCFNN  671
            TGM AHVMTFEVG VL D  WQAP+YCF N
Sbjct  165  TGMSAHVMTFEVGAVLEDEKWQAPVYCFKN  194



>ref|XP_006844416.2| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At4g14100 
[Amborella trichopoda]
Length=230

 Score =   256 bits (655),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 117/162 (72%), Positives = 135/162 (83%), Gaps = 2/162 (1%)
 Frame = +3

Query  189  DPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNN  368
            + +PVPTPWP QFHSILF N +  G+L +IDLWYDWPNGRNFNIIQ+QLG L+YDLEWNN
Sbjct  29   NSDPVPTPWPDQFHSILFTNYS--GSLSLIDLWYDWPNGRNFNIIQDQLGKLLYDLEWNN  86

Query  369  GTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
            GTSF YTLDS REC+  +V VGILR DWLDGA YLG++ +DGFLCNVW+KV+FIWYYEDV
Sbjct  87   GTSFFYTLDSKRECRSAEVGVGILRKDWLDGAQYLGREMVDGFLCNVWKKVDFIWYYEDV  146

Query  549  VSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
             + RPV+W FYTG  AHVMTFEVG VL D  WQAP+YCF  +
Sbjct  147  ETNRPVHWVFYTGRSAHVMTFEVGAVLEDEKWQAPVYCFQGA  188



>ref|XP_004140562.2| PREDICTED: uncharacterized protein At4g14100-like [Cucumis sativus]
 gb|KGN46407.1| hypothetical protein Csa_6G091310 [Cucumis sativus]
Length=226

 Score =   256 bits (654),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 137/160 (86%), Gaps = 2/160 (1%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +PVPTPWPLQFHS+L +N +  G  Q+I+LWYDWPNGRNFNIIQ+QLGN++YDLEWNNGT
Sbjct  38   DPVPTPWPLQFHSVLLMNYS--GIPQIINLWYDWPNGRNFNIIQHQLGNVLYDLEWNNGT  95

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            SF YTLDS++ C    + VGILRP+WLDGA YLGQ+++DGFLCNVWEKV+FIWYYEDV +
Sbjct  96   SFFYTLDSTKTCSPAQLEVGILRPNWLDGAKYLGQRHVDGFLCNVWEKVDFIWYYEDVET  155

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            KRPV+W FYTG  AHVMTFEVG VL D  WQAP+YCF+ +
Sbjct  156  KRPVHWLFYTGRQAHVMTFEVGAVLEDEKWQAPVYCFDGT  195



>ref|XP_008351100.1| PREDICTED: uncharacterized protein At4g14100-like [Malus domestica]
Length=228

 Score =   256 bits (653),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 138/166 (83%), Gaps = 3/166 (2%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +PVP PWP QFHSIL +N T  GTLQ+IDLWYDWPNGRNFNII++QLG++ YDLEWNNGT
Sbjct  30   DPVPAPWPHQFHSILVMNYT--GTLQLIDLWYDWPNGRNFNIIRHQLGSVAYDLEWNNGT  87

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMD-GFLCNVWEKVEFIWYYEDVV  551
            SF YTLDS+REC+ + V VGILRPDWLDGA YLG++++D GFLCNVWEK +FI YYEDV 
Sbjct  88   SFFYTLDSARECRTVQVEVGILRPDWLDGAKYLGRRHVDGGFLCNVWEKADFITYYEDVD  147

Query  552  SKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESL  689
            +KRPV+W FYTG  AHVMTFEVG  L D  WQAP+YCF+    ++L
Sbjct  148  TKRPVHWIFYTGREAHVMTFEVGAALEDAKWQAPVYCFDKKKTDTL  193



>ref|XP_009144684.1| PREDICTED: uncharacterized protein At4g14100 [Brassica rapa]
Length=206

 Score =   254 bits (650),  Expect = 9e-81, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 132/164 (80%), Gaps = 2/164 (1%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEW  362
            A   EPVP PWP QFH++LF+N +  G L MIDLWYDWPNGRNFNIIQ QLG + YDLEW
Sbjct  23   ATADEPVPAPWPHQFHALLFMNYS--GDLSMIDLWYDWPNGRNFNIIQEQLGAITYDLEW  80

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            NNGTSF YTLDSS+ C+   + VGILRP+WLDGANYLGQ+ ++GF CNVWEKV+FIWYYE
Sbjct  81   NNGTSFFYTLDSSKSCRSAQLEVGILRPNWLDGANYLGQQLVNGFHCNVWEKVDFIWYYE  140

Query  543  DVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            DV +KRPV W FYTG  AHVMTFEVG VL D  WQAP+YCFN  
Sbjct  141  DVETKRPVQWIFYTGREAHVMTFEVGAVLEDEKWQAPVYCFNKE  184



>ref|XP_002870337.1| transferase, transferring glycosyl groups [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH46596.1| transferase, transferring glycosyl groups [Arabidopsis lyrata 
subsp. lyrata]
Length=206

 Score =   254 bits (649),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 132/164 (80%), Gaps = 2/164 (1%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEW  362
            A   EPVPTPWP QFH++LF+N +  G L MIDLWYDW NGRNFNIIQ QLG + YDLEW
Sbjct  23   ATADEPVPTPWPHQFHALLFMNYS--GDLSMIDLWYDWINGRNFNIIQEQLGGITYDLEW  80

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            NNGTSFIY+LD S+ C+   + VGILRP+WLDGA YLGQK + GFLCNVWEKV+FIWYYE
Sbjct  81   NNGTSFIYSLDESKSCRSAQLEVGILRPNWLDGAKYLGQKNVSGFLCNVWEKVDFIWYYE  140

Query  543  DVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            DV++KRPV W FYTG  AHVMT+EVG VL D  WQAP+YCFN  
Sbjct  141  DVITKRPVQWIFYTGREAHVMTYEVGAVLEDEKWQAPVYCFNKE  184



>ref|XP_008369605.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At4g14100-like 
[Malus domestica]
Length=226

 Score =   254 bits (649),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 136/165 (82%), Gaps = 3/165 (2%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +PVP PWP QFHSIL +N T  GTLQ+IDLWYDWPNGRNFNII++QLG++ YDLEWNNGT
Sbjct  30   DPVPAPWPHQFHSILMMNYT--GTLQLIDLWYDWPNGRNFNIIRHQLGSVTYDLEWNNGT  87

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMD-GFLCNVWEKVEFIWYYEDVV  551
            SF YTLDS+REC+ + V VGILRPDWLDGA YLG++ +D GFLCNVWEK +FI YYEDV 
Sbjct  88   SFFYTLDSARECRTVHVEVGILRPDWLDGAKYLGRRLVDGGFLCNVWEKADFITYYEDVD  147

Query  552  SKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
            + RPV W FYTG  AHVMTFEVG VL D  WQAP+YCF+N   ++
Sbjct  148  TNRPVLWVFYTGREAHVMTFEVGAVLEDAKWQAPVYCFDNKKTDT  192



>ref|XP_009102584.1| PREDICTED: uncharacterized protein At4g14100 [Brassica rapa]
Length=193

 Score =   253 bits (646),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 134/164 (82%), Gaps = 2/164 (1%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            EPVP PWP QFH+++F+N    G+++++DLWYDW NGRNFNIIQ QLG L YDLEWNNGT
Sbjct  31   EPVPAPWPEQFHALMFMN--KSGSIEIVDLWYDWINGRNFNIIQKQLGKLTYDLEWNNGT  88

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            SF YTLD+S+ C+ +   VGILRP+WLDGANYLGQ+ + GFLCNVWEKV+F+WYYEDVV+
Sbjct  89   SFYYTLDASKTCRTVHFEVGILRPNWLDGANYLGQRNVSGFLCNVWEKVDFLWYYEDVVT  148

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
            KRPV W FYTG  AHVMTFEVG VL D  WQAP+YCF+N    S
Sbjct  149  KRPVQWTFYTGREAHVMTFEVGAVLEDEKWQAPVYCFHNENKSS  192



>ref|XP_006414813.1| hypothetical protein EUTSA_v10026167mg [Eutrema salsugineum]
 gb|ESQ56266.1| hypothetical protein EUTSA_v10026167mg [Eutrema salsugineum]
Length=226

 Score =   254 bits (648),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 115/164 (70%), Positives = 132/164 (80%), Gaps = 2/164 (1%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEW  362
            A   EP+P+PW  QFH++LF+N +  G L MIDLWYDW NGRNFNIIQ QLG + YDLEW
Sbjct  42   ATTDEPIPSPWQHQFHALLFMNYS--GDLSMIDLWYDWKNGRNFNIIQEQLGGITYDLEW  99

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            NNGTSFIY+LD SR C+   + VGILRP+WLDGA YLGQ++++GFLCNVWEKV+FIWYYE
Sbjct  100  NNGTSFIYSLDESRSCRSAQLEVGILRPNWLDGAKYLGQQHVNGFLCNVWEKVDFIWYYE  159

Query  543  DVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            DV +KRPV W FYTG  AHVMTFEVG VL D  WQAPLYCFN  
Sbjct  160  DVETKRPVQWIFYTGREAHVMTFEVGAVLEDEKWQAPLYCFNKE  203



>gb|AFK34859.1| unknown [Lotus japonicus]
Length=226

 Score =   254 bits (648),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 132/167 (79%), Gaps = 3/167 (2%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            P PT WP QFHS+LFIN  S G LQ  DLWYDWPNGRNFNIIQ+QLG L YDLEWNNGTS
Sbjct  32   PTPTAWPHQFHSVLFIN--SSGNLQKTDLWYDWPNGRNFNIIQHQLGVLKYDLEWNNGTS  89

Query  378  FIYTLDS-SRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            F YTLD  +  C+V+   VGILRP+WLDGANYLGQ Y D FLCNVWEKV+FIWYYEDV++
Sbjct  90   FYYTLDPFNHTCKVIHFDVGILRPNWLDGANYLGQHYADNFLCNVWEKVDFIWYYEDVLT  149

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGS  695
            +RPV W FY+GM+AHVMTFEVG VL D  WQAP+YCFN +      S
Sbjct  150  RRPVKWIFYSGMIAHVMTFEVGAVLEDAQWQAPVYCFNEAETHEKSS  196



>gb|EYU28487.1| hypothetical protein MIMGU_mgv1a013476mg [Erythranthe guttata]
Length=219

 Score =   253 bits (646),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 136/163 (83%), Gaps = 2/163 (1%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            P PTPWPLQFHSIL +N +  G+L +IDLWYDWP GRNFNIIQ+QLG L+YDLEWNNGTS
Sbjct  32   PKPTPWPLQFHSILLVNFS--GSLSLIDLWYDWPKGRNFNIIQSQLGELLYDLEWNNGTS  89

Query  378  FIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSK  557
            F YTLDS+++C+   + VGILRP+WLDGA YLGQ+ +DGFLCNVW+KV+FIWYYEDVV+K
Sbjct  90   FFYTLDSNKKCRSAQLEVGILRPNWLDGAVYLGQENVDGFLCNVWQKVDFIWYYEDVVTK  149

Query  558  RPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
            RPV+W FYTG   HVMTFEVG VL D  WQAP+YCF+    ++
Sbjct  150  RPVHWVFYTGRSIHVMTFEVGAVLEDAKWQAPIYCFDKKDTQT  192



>ref|XP_009359859.1| PREDICTED: uncharacterized protein At4g14100-like [Pyrus x bretschneideri]
Length=224

 Score =   253 bits (647),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 116/169 (69%), Positives = 140/169 (83%), Gaps = 3/169 (2%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +PVPTPWP QFHSIL +N T  GTL++IDLWYDWPNGRNFNII++QLG++ YDLEWNNGT
Sbjct  30   DPVPTPWPHQFHSILMMNYT--GTLELIDLWYDWPNGRNFNIIRHQLGSVTYDLEWNNGT  87

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMD-GFLCNVWEKVEFIWYYEDVV  551
            SF+YTLDS+REC+ + V VGILRPDWLDGA Y+G++ +D GFLC+VWEK +FI YYEDV 
Sbjct  88   SFVYTLDSARECKTVHVEVGILRPDWLDGARYVGRRLVDGGFLCDVWEKADFITYYEDVD  147

Query  552  SKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSP  698
            + RPV W FYTG  AHVMTFEVG VL D  WQAP+YCF+N   +++  P
Sbjct  148  TNRPVNWVFYTGREAHVMTFEVGAVLEDAKWQAPVYCFDNKKTDTVPEP  196



>emb|CDY63753.1| BnaAnng19070D [Brassica napus]
Length=193

 Score =   252 bits (643),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 134/164 (82%), Gaps = 2/164 (1%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            EPVP PWP QFH+++F+N    G+++++DLWYDW NGRNFNIIQ QLG L YDLEWNNGT
Sbjct  31   EPVPAPWPEQFHALMFMN--KSGSIEIVDLWYDWINGRNFNIIQKQLGKLTYDLEWNNGT  88

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            SF YTLD+S+ C+ +   VGILRP+WLDGANYLGQ+ + GFLCNVWEKV+F+WYYEDVV+
Sbjct  89   SFYYTLDASKTCRTVHFEVGILRPNWLDGANYLGQRNVSGFLCNVWEKVDFLWYYEDVVT  148

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
            KRPV W FYTG  AHVMTFEVG VL D  WQAP+YCF+N    S
Sbjct  149  KRPVQWIFYTGREAHVMTFEVGAVLEDEKWQAPVYCFHNENKSS  192



>ref|XP_010450128.1| PREDICTED: uncharacterized protein At4g14100-like [Camelina sativa]
Length=206

 Score =   253 bits (645),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 130/164 (79%), Gaps = 2/164 (1%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEW  362
            A   EPVPTPWP QFH+++F+N +  G L MIDLWYDW NGRNFNIIQ QLG + YDLEW
Sbjct  23   ATADEPVPTPWPHQFHALMFMNYS--GDLSMIDLWYDWTNGRNFNIIQEQLGGITYDLEW  80

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            NNGTSF+YTLD S+ C+   + VGILRP+WLDGA YLGQK + GFLCN WEKV+FIWYYE
Sbjct  81   NNGTSFVYTLDESKSCRSAQLEVGILRPNWLDGAKYLGQKNVSGFLCNEWEKVDFIWYYE  140

Query  543  DVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            DV +KRPV W FYTG  AH+MTFEVG VL D  WQAP+YCFN  
Sbjct  141  DVATKRPVQWIFYTGREAHIMTFEVGAVLEDEKWQAPVYCFNKE  184



>ref|XP_010435192.1| PREDICTED: uncharacterized protein At4g14100 [Camelina sativa]
Length=206

 Score =   252 bits (644),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 119/188 (63%), Positives = 139/188 (74%), Gaps = 8/188 (4%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            EPVPTPWP QFH+++F+N +  G L MIDLWYDW NGRNFNIIQ QLG + YDLEWNNGT
Sbjct  27   EPVPTPWPHQFHALMFMNYS--GDLSMIDLWYDWTNGRNFNIIQEQLGGITYDLEWNNGT  84

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            SF+YTLD S+ C+   + VGILRP+WLDGA YLGQK + GFLCN WEKV+FIWYYEDV +
Sbjct  85   SFVYTLDESKSCRSAQLEVGILRPNWLDGAKYLGQKNVSGFLCNEWEKVDFIWYYEDVAT  144

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSDAKPLRLGR  734
            KRPV W FYTG  AH+MTFEVG VL D  WQAP+YCFN    E  G   +S    LR  R
Sbjct  145  KRPVQWIFYTGREAHIMTFEVGAVLEDEKWQAPVYCFNK---EKKG---LSTKGALREFR  198

Query  735  AFDVSVSL  758
             +    ++
Sbjct  199  GYKEKAAM  206



>ref|XP_006436981.1| hypothetical protein CICLE_v10032720mg [Citrus clementina]
 gb|ESR50221.1| hypothetical protein CICLE_v10032720mg [Citrus clementina]
Length=216

 Score =   252 bits (644),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 118/172 (69%), Positives = 140/172 (81%), Gaps = 3/172 (2%)
 Frame = +3

Query  222  QFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTSFIYTLDSS  401
            QFH+ILF+N  + GTLQ +DLWYDWPNGRN NIIQNQLG L YDLEW+NGTS+IYTLD++
Sbjct  41   QFHAILFMN--NSGTLQKVDLWYDWPNGRNINIIQNQLGKLTYDLEWDNGTSYIYTLDAN  98

Query  402  RECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYWAFY  581
            +EC+VL  PVGILRP WLDGA YLGQKY+D FLCNVW KV+FIWYYEDVV+KRPV+W FY
Sbjct  99   KECRVLHFPVGILRPSWLDGAEYLGQKYVDKFLCNVWTKVDFIWYYEDVVTKRPVHWVFY  158

Query  582  TGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES-LGSPIVSDAKPLRLGR  734
            TG  A V+TF+VG VL DP WQAP+YCF N   E  L + +V+D+   +L R
Sbjct  159  TGYTADVITFKVGAVLEDPKWQAPVYCFGNEGEERPLLNSVVTDSSSGKLIR  210



>ref|NP_566739.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM65823.1| unknown [Arabidopsis thaliana]
 gb|AEE76810.1| uncharacterized protein AT3G23760 [Arabidopsis thaliana]
Length=194

 Score =   251 bits (641),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 134/165 (81%), Gaps = 2/165 (1%)
 Frame = +3

Query  189  DPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNN  368
            + EPVP  WP QFH+++ +N    G+L+++DLWYDW NGRNFNIIQ QLG L YDLEWNN
Sbjct  30   EKEPVPAVWPEQFHALMLMN--KSGSLEIVDLWYDWVNGRNFNIIQKQLGKLTYDLEWNN  87

Query  369  GTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
            GTSF YTLD+S+ C+ +   VGILRP+WLDGA Y+GQ++++GFLCNVWEKVEF+WYYEDV
Sbjct  88   GTSFYYTLDASKTCRTVHFEVGILRPNWLDGAKYMGQRHVNGFLCNVWEKVEFLWYYEDV  147

Query  549  VSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVE  683
            V+KRPV W FYTG  AHVMTFEVG VL D  WQAP+YCF+N   E
Sbjct  148  VTKRPVQWIFYTGREAHVMTFEVGAVLEDEKWQAPVYCFHNEKKE  192



>ref|XP_004310152.1| PREDICTED: uncharacterized protein At4g14100-like [Fragaria vesca 
subsp. vesca]
Length=221

 Score =   252 bits (644),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 114/163 (70%), Positives = 137/163 (84%), Gaps = 2/163 (1%)
 Frame = +3

Query  189  DPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNN  368
            + +P PTPWP QFHSIL +N T  GTL++I+LWYDWPNGRNFNIIQ+QLG+++YDLEWNN
Sbjct  33   EQDPRPTPWPHQFHSILMMNYT--GTLEIINLWYDWPNGRNFNIIQHQLGSILYDLEWNN  90

Query  369  GTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
            GTSF Y+LDSS+ C    + VGILRP+WLDGA YLGQ+++DGFLCNVW KV+F+ YYEDV
Sbjct  91   GTSFFYSLDSSKTCTSSQLEVGILRPNWLDGAEYLGQRHVDGFLCNVWNKVDFLLYYEDV  150

Query  549  VSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNST  677
            V+KRPV+WAFYTG  AHVMTFEVG VL D  WQAP+YCF+   
Sbjct  151  VTKRPVHWAFYTGREAHVMTFEVGAVLEDATWQAPVYCFDQKA  193



>ref|XP_009595221.1| PREDICTED: uncharacterized protein At4g14100-like [Nicotiana 
tomentosiformis]
Length=223

 Score =   252 bits (643),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 132/164 (80%), Gaps = 2/164 (1%)
 Frame = +3

Query  180  NAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLE  359
            +A    P P PWP QFHS+LF+N +  G+L +IDLWYDW NGRNFNIIQ+QLG L+YDLE
Sbjct  31   SAESSAPKPAPWPHQFHSLLFVNYS--GSLSLIDLWYDWTNGRNFNIIQHQLGKLLYDLE  88

Query  360  WNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYY  539
            WNNGTSF YTLD ++EC+   + VGILRP+WLDGA YLGQ+  DGFLCNVW+KV+FIWYY
Sbjct  89   WNNGTSFFYTLDDNKECRSAQLDVGILRPNWLDGATYLGQRSFDGFLCNVWQKVDFIWYY  148

Query  540  EDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNN  671
            EDVV+KRPV+W FYTG   HVMTFEVG  L D  WQAP+YCF N
Sbjct  149  EDVVTKRPVHWVFYTGRSIHVMTFEVGAALEDAKWQAPVYCFEN  192



>emb|CDY08309.1| BnaA05g13100D [Brassica napus]
Length=207

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEW  362
            A   EPVP PWP QFH++LF+N +  G L MIDLWYDWPNGRNFNIIQ QLG + YDLEW
Sbjct  24   ATADEPVPAPWPHQFHALLFMNYS--GDLSMIDLWYDWPNGRNFNIIQEQLGGITYDLEW  81

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            NNGTSF YTL SS+ C+   + VGILRP+WLDGANYLGQ+ ++GF CNVWEKV+FIWYYE
Sbjct  82   NNGTSFFYTLHSSKSCRSAQLEVGILRPNWLDGANYLGQQLVNGFHCNVWEKVDFIWYYE  141

Query  543  DVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            DV +KRPV W FYTG  AHVMTFEVG VL D  WQAP+YCFN  
Sbjct  142  DVETKRPVQWIFYTGREAHVMTFEVGAVLEDEKWQAPVYCFNKE  185



>ref|XP_006487570.1| PREDICTED: uncharacterized protein At4g14100-like isoform X1 
[Citrus sinensis]
 ref|XP_006487571.1| PREDICTED: uncharacterized protein At4g14100-like isoform X2 
[Citrus sinensis]
 ref|XP_006487572.1| PREDICTED: uncharacterized protein At4g14100-like isoform X3 
[Citrus sinensis]
Length=213

 Score =   251 bits (642),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 135/159 (85%), Gaps = 2/159 (1%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            P P  WPLQFHSIL++N    G+L+MIDLWYDWPNGRNFNIIQ+QLG L+YDLEWNNGTS
Sbjct  32   PKPKAWPLQFHSILWMNYN--GSLEMIDLWYDWPNGRNFNIIQSQLGKLLYDLEWNNGTS  89

Query  378  FIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSK  557
            F YTLDS++EC+   + VGILRP+WLDGA YLGQ+++DGFLCNVWEK +FI YYEDV++K
Sbjct  90   FFYTLDSNKECRTAQLEVGILRPNWLDGAKYLGQRHVDGFLCNVWEKADFIVYYEDVLTK  149

Query  558  RPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            RPV+W FYTG  AHV+TFEVG VL D  WQAP+YCF+ +
Sbjct  150  RPVHWVFYTGRQAHVITFEVGAVLEDAKWQAPVYCFDKT  188



>gb|KFK39672.1| hypothetical protein AALP_AA3G274300 [Arabis alpina]
Length=193

 Score =   251 bits (640),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 136/172 (79%), Gaps = 2/172 (1%)
 Frame = +3

Query  171  SNPNAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVY  350
            S  N  + EPVP PWP QFH++L +N    G+L+++DLWYDW NGRNFNIIQ QLG L Y
Sbjct  23   SAVNEPETEPVPAPWPEQFHAVLLMN--KSGSLEIVDLWYDWVNGRNFNIIQKQLGKLSY  80

Query  351  DLEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFI  530
            DLEWNNGTSF YTLD+S+ C+ +   VGILRP+WLDGANYLGQ+ ++ FLCNVWEKVEF+
Sbjct  81   DLEWNNGTSFYYTLDASKTCRTVHFEVGILRPNWLDGANYLGQRQVNRFLCNVWEKVEFL  140

Query  531  WYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
            WYYEDV++ RPV W FYTG  AHVMTFEVG VL D  WQAP+YCF+N   +S
Sbjct  141  WYYEDVITNRPVQWIFYTGREAHVMTFEVGAVLEDEKWQAPVYCFHNDEKKS  192



>ref|XP_006418840.1| hypothetical protein EUTSA_v10002677mg [Eutrema salsugineum]
 gb|ESQ37276.1| hypothetical protein EUTSA_v10002677mg [Eutrema salsugineum]
Length=189

 Score =   250 bits (639),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 133/164 (81%), Gaps = 2/164 (1%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            EPVP PWP QFH+++ +N    G+L+++DLWYDW N RNFNIIQ QLG L YDLEWNNGT
Sbjct  27   EPVPAPWPEQFHALMLMN--KSGSLEIVDLWYDWVNDRNFNIIQKQLGKLTYDLEWNNGT  84

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            SF YTLD+SR C+ +   VGILRP+WLDGA YLGQ++++GFLCNVWEKV+F+WYYEDVVS
Sbjct  85   SFYYTLDASRTCRTVHFEVGILRPNWLDGAKYLGQRHVNGFLCNVWEKVDFLWYYEDVVS  144

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
            KRPV W FYTG  AHVMTFEVG VL D  WQAP+YCF+N    S
Sbjct  145  KRPVQWIFYTGREAHVMTFEVGAVLEDEKWQAPVYCFHNDNKNS  188



>ref|XP_002885592.1| hypothetical protein ARALYDRAFT_479891 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61851.1| hypothetical protein ARALYDRAFT_479891 [Arabidopsis lyrata subsp. 
lyrata]
Length=195

 Score =   250 bits (639),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 111/165 (67%), Positives = 133/165 (81%), Gaps = 2/165 (1%)
 Frame = +3

Query  189  DPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNN  368
            + EPVP  WP QFH+++ +N    G L+++DLWYDW NGRNFNIIQ QLG L YDLEWNN
Sbjct  31   EMEPVPAVWPEQFHALMLMN--KSGALEIVDLWYDWVNGRNFNIIQKQLGKLTYDLEWNN  88

Query  369  GTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
            GTSF YTLD+SR C+ +   VGILRP+WLDGA YLGQ++++GFLCNVWEKVEF+WYYED+
Sbjct  89   GTSFYYTLDASRTCRTVHFEVGILRPNWLDGAKYLGQRHVNGFLCNVWEKVEFLWYYEDI  148

Query  549  VSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVE  683
            V+KRPV W FYTG  AHVMTF+VG VL D  WQAP+YCF+N   E
Sbjct  149  VTKRPVQWIFYTGREAHVMTFDVGAVLEDEKWQAPVYCFHNEKKE  193



>ref|XP_006282716.1| hypothetical protein CARUB_v10005748mg [Capsella rubella]
 gb|EOA15614.1| hypothetical protein CARUB_v10005748mg [Capsella rubella]
Length=206

 Score =   250 bits (639),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 117/192 (61%), Positives = 138/192 (72%), Gaps = 8/192 (4%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEW  362
            A   +PVP PWP QFH+++F+N +  G L MIDLWYDW NGRNFNIIQ QLG + YDLEW
Sbjct  23   ATADDPVPMPWPHQFHALMFMNYS--GDLSMIDLWYDWTNGRNFNIIQEQLGGITYDLEW  80

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            NNGTSF+YTLD SR C+   + VGILRP+WLDGA YLGQ+ + GFLCNVWEKV+FIWYYE
Sbjct  81   NNGTSFLYTLDESRSCRSAQLEVGILRPNWLDGAKYLGQRNVSGFLCNVWEKVDFIWYYE  140

Query  543  DVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSDAKPL  722
            DV +KRPV W FYTG  AH+MT+EVG VL D  WQAP+YCF+     S      S    L
Sbjct  141  DVATKRPVQWIFYTGREAHIMTYEVGAVLEDEKWQAPVYCFDKEKKSS------STKGAL  194

Query  723  RLGRAFDVSVSL  758
            R  R +    +L
Sbjct  195  REFRGYKEKAAL  206



>emb|CDY68448.1| BnaCnng59060D [Brassica napus]
Length=220

 Score =   251 bits (640),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 114/164 (70%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEW  362
            A   EPVP PWP QFH++LF+N +  G L MIDLWYDWPNGRNFNIIQ QLG + YDLEW
Sbjct  37   ATADEPVPAPWPHQFHALLFMNYS--GNLSMIDLWYDWPNGRNFNIIQEQLGGITYDLEW  94

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            NNGTSF YTLD+ + C+   + VGILRP+WLDGANYLGQ+ ++GF CNVWEKV+FIWYYE
Sbjct  95   NNGTSFFYTLDNYKSCRSAQLEVGILRPNWLDGANYLGQQLVNGFHCNVWEKVDFIWYYE  154

Query  543  DVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            DV +KRPV W FYTG  AHVMTFEVG VL D  WQ+P+YCFN  
Sbjct  155  DVETKRPVQWIFYTGREAHVMTFEVGAVLEDEKWQSPVYCFNKE  198



>gb|KFK36298.1| hypothetical protein AALP_AA4G104200 [Arabis alpina]
Length=209

 Score =   250 bits (639),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 131/162 (81%), Gaps = 2/162 (1%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEW  362
            A   +P+P PWP QFH+++F+N +  G L MIDLWYDW NGRNFNIIQ QLG + YDLEW
Sbjct  23   AAANDPIPAPWPHQFHALMFMNYS--GDLSMIDLWYDWTNGRNFNIIQEQLGGITYDLEW  80

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            NNGTSF YTLD S+ C+   + VGILRP+WLDGA YLGQK+++GFLCNVWEKV+FIWYYE
Sbjct  81   NNGTSFFYTLDHSKSCRSAQLQVGILRPNWLDGAKYLGQKHVNGFLCNVWEKVDFIWYYE  140

Query  543  DVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFN  668
            DV +KRPV W FYTG  AHVMT+EVG VL D  WQAP+YCF+
Sbjct  141  DVATKRPVQWIFYTGREAHVMTYEVGAVLEDEKWQAPVYCFD  182



>ref|XP_004503817.1| PREDICTED: uncharacterized protein At4g14100-like [Cicer arietinum]
Length=227

 Score =   251 bits (640),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 120/180 (67%), Positives = 141/180 (78%), Gaps = 3/180 (2%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P+P+ WP QFHS+LFIN    G LQ  DLWYDWPNGRNFNIIQ+QLG L YDLEWNNGT
Sbjct  36   DPIPSAWPEQFHSVLFIN--RSGNLQKTDLWYDWPNGRNFNIIQHQLGILKYDLEWNNGT  93

Query  375  SFIYTLDS-SRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVV  551
            SFIYTLD  +  C++L   VGILRP+WLDGA YLGQ+Y+D FLCNVWEKV+FIWYYEDV+
Sbjct  94   SFIYTLDPFNHTCKLLHFDVGILRPNWLDGATYLGQQYVDNFLCNVWEKVDFIWYYEDVL  153

Query  552  SKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSDAKPLRLG  731
            ++RPV W FY+GM+AHVMTFEVG VL D +WQAP+YCF+ S  E       SD+    LG
Sbjct  154  TQRPVKWIFYSGMIAHVMTFEVGAVLDDAHWQAPVYCFSESEPELQTHNRRSDSLLSDLG  213



>ref|NP_567420.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q67YC9.1|Y4141_ARATH RecName: Full=Uncharacterized protein At4g14100; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAD43453.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44302.1| unknown protein [Arabidopsis thaliana]
 gb|ABD42988.1| At4g14100 [Arabidopsis thaliana]
 gb|AEE83369.1| uncharacterized protein AT4G14100 [Arabidopsis thaliana]
Length=206

 Score =   250 bits (638),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 136/186 (73%), Gaps = 2/186 (1%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEW  362
            A   EPVPTPWP QFH+++F+N +  G L MIDLWYDW NGRNFNIIQ QLG + YDLEW
Sbjct  23   AAADEPVPTPWPHQFHALMFMNYS--GDLSMIDLWYDWTNGRNFNIIQEQLGGITYDLEW  80

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            NNGTSF YTLD S+ C+   + VGILRP+WLDGA YLGQ+ + GFLCNVWEKV+FIWYYE
Sbjct  81   NNGTSFFYTLDESKSCRSGQLEVGILRPNWLDGAKYLGQQNVSGFLCNVWEKVDFIWYYE  140

Query  543  DVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSDAKPL  722
            DV +KRPV W FYTG  AH+MT+EVG VL D  WQAP+YCFN           +S+ K  
Sbjct  141  DVETKRPVQWIFYTGREAHIMTYEVGAVLEDEKWQAPVYCFNKEKKSLSTKGALSEFKGY  200

Query  723  RLGRAF  740
            +   A 
Sbjct  201  KEKAAL  206



>ref|XP_009761705.1| PREDICTED: uncharacterized protein At4g14100-like [Nicotiana 
sylvestris]
Length=240

 Score =   251 bits (640),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 112/162 (69%), Positives = 131/162 (81%), Gaps = 2/162 (1%)
 Frame = +3

Query  189  DPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNN  368
            + +P P PWP QFHS+LF+N +  G+L +IDLWYDW NGRNFNIIQNQLG L+YDLEWNN
Sbjct  51   ESDPKPAPWPPQFHSLLFVNYS--GSLSLIDLWYDWTNGRNFNIIQNQLGKLLYDLEWNN  108

Query  369  GTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
            GTSF YTLD ++EC+   + VGILRP+WLDGA YLGQ+  DGFLCNVW+KV+FIWYYEDV
Sbjct  109  GTSFFYTLDDNKECRSAQLDVGILRPNWLDGATYLGQRSFDGFLCNVWQKVDFIWYYEDV  168

Query  549  VSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
             +KRPV+W FYTG   HVMTFEVG  L D  WQAP+YCF N 
Sbjct  169  FTKRPVHWVFYTGRSIHVMTFEVGAALEDAKWQAPVYCFENK  210



>gb|AAM64947.1| unknown [Arabidopsis thaliana]
Length=206

 Score =   249 bits (637),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 136/186 (73%), Gaps = 2/186 (1%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEW  362
            A   EPVPTPWP QFH+++F+N +  G L MIDLWYDW NGRNFNIIQ QLG + YDLEW
Sbjct  23   AAADEPVPTPWPHQFHALMFMNYS--GDLSMIDLWYDWTNGRNFNIIQEQLGGITYDLEW  80

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            NNGTSF YTLD S+ C+   + VGILRP+WLDGA YLGQ+ + GFLCNVWEKV+FIWYYE
Sbjct  81   NNGTSFFYTLDESKSCRSGQLEVGILRPNWLDGAKYLGQQNVSGFLCNVWEKVDFIWYYE  140

Query  543  DVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSDAKPL  722
            DV +KRPV W FYTG  AH+MT+EVG VL D  WQAP+YCFN           +S+ K  
Sbjct  141  DVETKRPVQWIFYTGREAHIMTYEVGAVLEDEKWQAPVYCFNKEKKSLSTKGALSEFKGY  200

Query  723  RLGRAF  740
            +   A 
Sbjct  201  KEKAAL  206



>ref|XP_006298598.1| hypothetical protein CARUB_v10014682mg, partial [Capsella rubella]
 gb|EOA31496.1| hypothetical protein CARUB_v10014682mg, partial [Capsella rubella]
Length=198

 Score =   249 bits (636),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 134/165 (81%), Gaps = 2/165 (1%)
 Frame = +3

Query  180  NAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLE  359
            +A   EPVPTPWP QFH++L +N    G+L+++DLWYDW NGRNFNIIQ QLG L YDLE
Sbjct  29   SAAADEPVPTPWPEQFHALLVMN--KSGSLEVLDLWYDWVNGRNFNIIQKQLGKLTYDLE  86

Query  360  WNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYY  539
            WNNGTSF Y+LD SR C+ +   VGILRP+WLDGANYLGQ+ ++GFLCNVWEKVEF+ YY
Sbjct  87   WNNGTSFYYSLDESRTCRTVHFEVGILRPNWLDGANYLGQQQVNGFLCNVWEKVEFLQYY  146

Query  540  EDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            EDVV+KRPV W F+TG  AHVMTFEVG VL D  WQAP+YCF+N 
Sbjct  147  EDVVTKRPVQWIFHTGREAHVMTFEVGAVLEDEKWQAPVYCFHNE  191



>gb|KHN09699.1| Hypothetical protein glysoja_011973 [Glycine soja]
Length=222

 Score =   250 bits (638),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/177 (68%), Positives = 142/177 (80%), Gaps = 5/177 (3%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLV-YDLEWNNG  371
            EP+P  WP QFH+++F+N    GTLQ +DLWYDWPNGRNFNIIQNQL +LV YDLEWNNG
Sbjct  32   EPIPAEWPHQFHALMFMN--QSGTLQKLDLWYDWPNGRNFNIIQNQLDHLVTYDLEWNNG  89

Query  372  TSFIYTLDSSR-ECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
            TSF+YTLD S   CQVL V VGILRP+WL GA YLGQ+++  FLCNVWEKV+FI YYEDV
Sbjct  90   TSFVYTLDPSEPTCQVLHVEVGILRPNWLHGATYLGQQHVGNFLCNVWEKVDFIVYYEDV  149

Query  549  VSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSDAKP  719
            +++RPV W FYTG  AHVMTFEVG VL DPNWQAP+YCF+ +  E+  SPI+  A P
Sbjct  150  LTRRPVKWVFYTGYTAHVMTFEVGAVLEDPNWQAPVYCFSENGKEN-NSPILRHAVP  205



>gb|EPS68692.1| transferase, transferring glycosyl groups [Genlisea aurea]
Length=213

 Score =   250 bits (638),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 137/167 (82%), Gaps = 2/167 (1%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            PVP  WP QFHSIL++N +  G+L +IDLWYDWPNGRNFNIIQ+QLG+++YDLEWNNGT 
Sbjct  23   PVPAIWPHQFHSILYVNYS--GSLSLIDLWYDWPNGRNFNIIQSQLGSVLYDLEWNNGTQ  80

Query  378  FIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSK  557
            F+Y+LDS+R+C+ + + VGILRPDWLDGA YLG++ +DGFLCNVWEKV+FIWYYEDVV+ 
Sbjct  81   FVYSLDSTRKCRAVQLEVGILRPDWLDGAVYLGREKVDGFLCNVWEKVDFIWYYEDVVTG  140

Query  558  RPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSP  698
            RPV+W FYTG   HVMTFEVG VL D  WQAP+YCF+        SP
Sbjct  141  RPVHWVFYTGRSIHVMTFEVGAVLEDAKWQAPVYCFDKEKSNPERSP  187



>gb|KEH20962.1| transferring glycosyl group transferase [Medicago truncatula]
Length=220

 Score =   249 bits (637),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/163 (72%), Positives = 134/163 (82%), Gaps = 3/163 (2%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            P+P+PWP QFHS+LFIN    G LQ  DLWYDWP GRNFNIIQ QLG L YDLEWNNGTS
Sbjct  29   PIPSPWPEQFHSVLFIN--RSGNLQKTDLWYDWPKGRNFNIIQYQLGVLKYDLEWNNGTS  86

Query  378  FIYTLDS-SRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            F+YTLD  +  C+ L   VGILRP+WLDGANYLGQ+Y+D FLCNVWEKV+FIWYYEDVV+
Sbjct  87   FLYTLDPFNHTCKRLHFDVGILRPNWLDGANYLGQQYVDNFLCNVWEKVDFIWYYEDVVT  146

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVE  683
            KRPV W FY+GM+AHVMTFEVG VL D +WQAP+YCF+ +  E
Sbjct  147  KRPVKWIFYSGMIAHVMTFEVGAVLDDEHWQAPVYCFSEAEPE  189



>gb|EYU21764.1| hypothetical protein MIMGU_mgv1a013279mg [Erythranthe guttata]
Length=225

 Score =   250 bits (638),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 131/155 (85%), Gaps = 1/155 (1%)
 Frame = +3

Query  222  QFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTSFIYTLDSS  401
            QFHSILFIN +SKG LQ+ DLWYDWPN RNFNIIQNQLG  +YDLEW NGTS+ YTLD++
Sbjct  45   QFHSILFIN-SSKGVLQVTDLWYDWPNRRNFNIIQNQLGKKLYDLEWGNGTSYYYTLDAN  103

Query  402  RECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYWAFY  581
            +EC+ +   VGIL P+WLDGANYLGQ   DGFLCNVWEKV+FIWYYEDV +KRPVYWAFY
Sbjct  104  KECRTMHFAVGILSPNWLDGANYLGQVDKDGFLCNVWEKVDFIWYYEDVATKRPVYWAFY  163

Query  582  TGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
            TG  AHVMTFEVGKVL DP+WQAP+YCF  + V +
Sbjct  164  TGQTAHVMTFEVGKVLDDPDWQAPVYCFEETEVNT  198



>emb|CDY59776.1| BnaCnng35550D [Brassica napus]
Length=193

 Score =   248 bits (634),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 133/164 (81%), Gaps = 2/164 (1%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +PVP PWP QFH+++ +N    G+++++DLWYDW NGRNFNIIQ QLG L YDLEWNNGT
Sbjct  31   DPVPAPWPEQFHALMLMN--KSGSIEIVDLWYDWINGRNFNIIQKQLGKLTYDLEWNNGT  88

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            SF YTLD+S+ C+ +   VGILRP+WLDGANYLGQ+ + GFLCNVWEKV+F+WYYEDVV+
Sbjct  89   SFYYTLDASKTCRTVHFEVGILRPNWLDGANYLGQRNVSGFLCNVWEKVDFLWYYEDVVT  148

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
            KRPV W FYTG  AHVMTFEVG VL D  WQAP+YCF+N    S
Sbjct  149  KRPVQWIFYTGREAHVMTFEVGAVLEDEKWQAPVYCFHNENKSS  192



>ref|XP_006485066.1| PREDICTED: uncharacterized protein At4g14100-like [Citrus sinensis]
Length=216

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 139/172 (81%), Gaps = 3/172 (2%)
 Frame = +3

Query  222  QFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTSFIYTLDSS  401
            QFH+ILF+N  + GTLQ +DLWYDWPNGRN NIIQNQLG L YDLEW+NGTS+IYTLD++
Sbjct  41   QFHAILFMN--NSGTLQKVDLWYDWPNGRNINIIQNQLGKLTYDLEWDNGTSYIYTLDAN  98

Query  402  RECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYWAFY  581
            +EC+VL  PVGILRP WLDGA YLGQKY+D FLCNVW KV+FIWYYEDVV+KRPV+W F 
Sbjct  99   KECRVLHFPVGILRPSWLDGAEYLGQKYVDKFLCNVWTKVDFIWYYEDVVTKRPVHWVFC  158

Query  582  TGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES-LGSPIVSDAKPLRLGR  734
            TG  A V+TF+VG VL DP WQAP+YCF N   E  L + +V+D+   +L R
Sbjct  159  TGYTADVITFKVGAVLEDPKWQAPVYCFGNEGEERPLLNSVVTDSSSGKLIR  210



>ref|XP_006420822.1| hypothetical protein CICLE_v10005873mg [Citrus clementina]
 gb|ESR34062.1| hypothetical protein CICLE_v10005873mg [Citrus clementina]
Length=213

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 111/159 (70%), Positives = 134/159 (84%), Gaps = 2/159 (1%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            P P  WPLQFHSIL++N    G+L+MIDLWYDW NGRNFNIIQ+QLG L+YDLEWNNGTS
Sbjct  32   PKPKAWPLQFHSILWMNYN--GSLEMIDLWYDWSNGRNFNIIQSQLGKLLYDLEWNNGTS  89

Query  378  FIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSK  557
            F +TLDS++EC+   + VGILRP+WLDGA YLGQ+++DGFLCNVWEK +FI YYEDV++K
Sbjct  90   FFFTLDSNKECRTAQLEVGILRPNWLDGAKYLGQRHVDGFLCNVWEKADFIVYYEDVLTK  149

Query  558  RPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            RPV+W FYTG  AHV+TFEVG VL D  WQAP+YCF+ +
Sbjct  150  RPVHWVFYTGRQAHVITFEVGAVLEDAKWQAPVYCFDKT  188



>ref|NP_001237129.1| uncharacterized protein LOC100306330 precursor [Glycine max]
 gb|ACU14455.1| unknown [Glycine max]
Length=222

 Score =   249 bits (636),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 142/178 (80%), Gaps = 5/178 (3%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLV-YDLEWNNG  371
            EP+P  WP QFH+++F+N    GTLQ +DLWYDWPNGRNFNIIQNQL +LV YDLEWNNG
Sbjct  32   EPIPAEWPHQFHALMFMN--QSGTLQKLDLWYDWPNGRNFNIIQNQLDHLVTYDLEWNNG  89

Query  372  TSFIYTLDSSR-ECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
            TSF+YTLD S   CQVL V VGILRP+WL GA YLGQ+++  FLCNVWEKV+FI YYEDV
Sbjct  90   TSFVYTLDPSEPTCQVLHVEVGILRPNWLHGATYLGQQHVGNFLCNVWEKVDFIVYYEDV  149

Query  549  VSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSDAKPL  722
            +++RPV W FYTG  AHVMTFEVG VL DPNWQAP+YCF+ +  E+  SPI+    P+
Sbjct  150  LTRRPVKWVFYTGYTAHVMTFEVGAVLEDPNWQAPVYCFSENGKEN-NSPILRHGVPV  206



>ref|XP_007137823.1| hypothetical protein PHAVU_009G158700g [Phaseolus vulgaris]
 gb|ESW09817.1| hypothetical protein PHAVU_009G158700g [Phaseolus vulgaris]
Length=221

 Score =   248 bits (633),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 118/166 (71%), Positives = 137/166 (83%), Gaps = 4/166 (2%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLV-YDLE  359
            A   +P+P  WP QFH+++F+N T  GTLQ +DLWYDWPNGRNFNIIQNQL N+V YDLE
Sbjct  27   AATEDPIPADWPHQFHALMFMNRT--GTLQKLDLWYDWPNGRNFNIIQNQLDNVVTYDLE  84

Query  360  WNNGTSFIYTLDSSR-ECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWY  536
            WNNGTSF YTLDSS   CQV+ V VGILRP+WL GA YLGQ+ +D FLCNVWEKV+FIWY
Sbjct  85   WNNGTSFFYTLDSSDPTCQVMQVEVGILRPNWLQGATYLGQQKVDNFLCNVWEKVDFIWY  144

Query  537  YEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            YEDV+++RPV W FYTG  AHVMTFEVG VL DPNWQAP+YCF+ +
Sbjct  145  YEDVLTRRPVKWIFYTGYTAHVMTFEVGAVLEDPNWQAPVYCFSEN  190



>gb|ERN06091.1| hypothetical protein AMTR_s00016p00017300 [Amborella trichopoda]
Length=196

 Score =   247 bits (630),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 133/168 (79%), Gaps = 2/168 (1%)
 Frame = +3

Query  189  DPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNN  368
            + +PVPTPWP QFHSILF N +  G+L +IDLWYDWPNGRNFNIIQ+QLG L+YDLEWNN
Sbjct  29   NSDPVPTPWPDQFHSILFTNYS--GSLSLIDLWYDWPNGRNFNIIQDQLGKLLYDLEWNN  86

Query  369  GTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
            GTSF YTLDS REC+  +V VGILR DWLDGA YLG++ +DGFLCNVW+KV+FIWYYEDV
Sbjct  87   GTSFFYTLDSKRECRSAEVGVGILRKDWLDGAQYLGREMVDGFLCNVWKKVDFIWYYEDV  146

Query  549  VSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLG  692
             + RPV+W FYTG  AHVMTFEVG VL D  WQ+    F  S  +  G
Sbjct  147  ETNRPVHWVFYTGRSAHVMTFEVGAVLEDEKWQSTRLLFPRSQKQRRG  194



>ref|XP_012088695.1| PREDICTED: uncharacterized protein At4g14100-like [Jatropha curcas]
 gb|KDP23249.1| hypothetical protein JCGZ_23082 [Jatropha curcas]
Length=189

 Score =   246 bits (629),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 132/163 (81%), Gaps = 2/163 (1%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            EP P PWP QFH+IL++N +  G LQ IDLWYDWPNGRN N+IQ+QLG LVYD+EWNNGT
Sbjct  25   EPSPAPWPQQFHAILWMNYS--GILQKIDLWYDWPNGRNLNLIQHQLGKLVYDVEWNNGT  82

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            SF ++LD+ +EC    + VGILRP+WLDGA YLGQ+++DGFLCNVWEKV+FIWY ED V+
Sbjct  83   SFFFSLDADKECSSAQLEVGILRPNWLDGAKYLGQRHVDGFLCNVWEKVDFIWYCEDAVT  142

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVE  683
            KRPV+W FYTG  AHVMTFEVG VL D  WQAP YCF+  + +
Sbjct  143  KRPVHWVFYTGREAHVMTFEVGAVLEDAKWQAPDYCFDKKSAK  185



>ref|XP_010942349.1| PREDICTED: uncharacterized protein At4g14100-like [Elaeis guineensis]
Length=228

 Score =   247 bits (631),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 113/166 (68%), Positives = 128/166 (77%), Gaps = 2/166 (1%)
 Frame = +3

Query  189  DPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNN  368
            +  P PT WPLQFHS+L+ N  + G L ++DLWYDWPN RNFNIIQ+QLG L+YDLEW+N
Sbjct  33   ESSPTPTAWPLQFHSLLYTN--NSGELSVVDLWYDWPNSRNFNIIQHQLGTLLYDLEWDN  90

Query  369  GTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
            GTSF YTLD SR CQ     VGILRPDWLDGANYLGQ+ +DGFLCNVWEKV+FIWYYEDV
Sbjct  91   GTSFYYTLDDSRHCQTYHFDVGILRPDWLDGANYLGQQRVDGFLCNVWEKVQFIWYYEDV  150

Query  549  VSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
             +K PV W FYTG   HVMTFEVG VL +  WQAP YCF     E+
Sbjct  151  ETKHPVQWVFYTGRSVHVMTFEVGAVLEEAQWQAPEYCFEKKEGEN  196



>ref|XP_004228540.1| PREDICTED: uncharacterized protein At4g14100 [Solanum lycopersicum]
Length=217

 Score =   246 bits (629),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 133/167 (80%), Gaps = 3/167 (2%)
 Frame = +3

Query  186  GDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWN  365
             D +P P PWP QFHSILF+N +  G+L +IDLWYDW NGRNFNIIQ+QLG L+YDLEWN
Sbjct  31   SDSDPTPAPWPHQFHSILFVNFS--GSLSLIDLWYDWTNGRNFNIIQDQLGELLYDLEWN  88

Query  366  NGTSFIYTLD-SSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            NGT F YTLD   ++C    V VGILRP+WLDGA YLGQ+++DGF CNVW+KV+FIWYYE
Sbjct  89   NGTVFRYTLDDGKKKCSSALVDVGILRPNWLDGATYLGQQFIDGFHCNVWQKVDFIWYYE  148

Query  543  DVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVE  683
            D+V+KRPV+W FYTG   HVMTFEVG VL D  WQAP+YCF+   V+
Sbjct  149  DIVTKRPVHWVFYTGRSIHVMTFEVGAVLEDIKWQAPVYCFDKKQVQ  195



>ref|XP_002272515.2| PREDICTED: uncharacterized protein At4g14100 [Vitis vinifera]
Length=218

 Score =   246 bits (627),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 134/169 (79%), Gaps = 2/169 (1%)
 Frame = +3

Query  168  ESNPNAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLV  347
             S+  + D  P P PWP QF+S+L++N+   G+ Q+IDLWYDWP GRN NIIQNQLG  +
Sbjct  23   RSSSKSTDLTPTPAPWPPQFYSLLYMNVN--GSNQIIDLWYDWPKGRNLNIIQNQLGKRL  80

Query  348  YDLEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEF  527
            YDLEW+NGTSF YTLDS++EC+     VGILRPDWLDGA+YLGQ+ +DGFLCNVWEKV+F
Sbjct  81   YDLEWDNGTSFFYTLDSTQECRTKHFEVGILRPDWLDGAHYLGQREVDGFLCNVWEKVDF  140

Query  528  IWYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            IWYYEDVV+KRPV+W F+ GM AHVMTF+ G V  D  WQAP+YCF  +
Sbjct  141  IWYYEDVVTKRPVHWRFFNGMSAHVMTFKEGAVREDEKWQAPVYCFGTT  189



>ref|XP_004501765.1| PREDICTED: uncharacterized protein At4g14100-like [Cicer arietinum]
Length=209

 Score =   245 bits (625),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 116/162 (72%), Positives = 134/162 (83%), Gaps = 4/162 (2%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLV-YDLEWNNG  371
            EP+P  WP QFHS+LF+N    G+LQ +DLWYDWPNGRNFNIIQ+QL  +V YDLEWNNG
Sbjct  24   EPIPADWPEQFHSVLFMN--RSGSLQKLDLWYDWPNGRNFNIIQDQLNPVVDYDLEWNNG  81

Query  372  TSFIYTLD-SSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
            TSFIYTL  S R C+V+ V VGILRP+WLDGA YLGQ+ +D FLCNVWEKV+FI YYEDV
Sbjct  82   TSFIYTLHPSDRHCEVVHVSVGILRPNWLDGATYLGQEQVDNFLCNVWEKVDFIVYYEDV  141

Query  549  VSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            +++RPV W FYTG  AHVMTFEVG VL DPNWQAP+YCFN +
Sbjct  142  LTRRPVKWIFYTGYTAHVMTFEVGAVLEDPNWQAPVYCFNGT  183



>ref|XP_006348535.1| PREDICTED: uncharacterized protein At4g14100-like [Solanum tuberosum]
Length=217

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 110/167 (66%), Positives = 132/167 (79%), Gaps = 3/167 (2%)
 Frame = +3

Query  186  GDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWN  365
             + +P P PWP QFHSILF+N T  G+L +IDLWYDW NGRNFNIIQ+QLG L+YDLEWN
Sbjct  31   SNSDPTPAPWPHQFHSILFVNFT--GSLSLIDLWYDWTNGRNFNIIQDQLGELLYDLEWN  88

Query  366  NGTSFIYTLDS-SRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            NGT F YTLD   ++C    + VGILRP+WLDGA YLGQ+++DGF C+VW+KV+FIWYYE
Sbjct  89   NGTVFRYTLDDDKKKCSSALIDVGILRPNWLDGATYLGQQFIDGFHCSVWQKVDFIWYYE  148

Query  543  DVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVE  683
            D+V+KRPV+W FYTG   HVMTFEVG VL D  WQAP+YCF+   V 
Sbjct  149  DIVTKRPVHWVFYTGRSIHVMTFEVGAVLEDAKWQAPVYCFDKKQVH  195



>ref|XP_010907973.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein At4g14100-like 
[Elaeis guineensis]
Length=234

 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/168 (68%), Positives = 132/168 (79%), Gaps = 4/168 (2%)
 Frame = +3

Query  171  SNPNAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQL-GNLV  347
            S+P +G  EP PTPWPLQFH++LF+N +  G L MIDLWYDWPNGRN NIIQ+QL G  +
Sbjct  38   SSPASGT-EPTPTPWPLQFHALLFMNYS--GALSMIDLWYDWPNGRNXNIIQDQLDGPPL  94

Query  348  YDLEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEF  527
            YDLEWNNGTSF YTL S   C+   + VGILRP+WL GA YLGQ+Y+DGFLCNVW KV+F
Sbjct  95   YDLEWNNGTSFFYTLSSPLSCRSAQIDVGILRPNWLAGATYLGQEYVDGFLCNVWTKVDF  154

Query  528  IWYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNN  671
            IWYYEDV + RPV+W FYTG  AHVMTFEVG  L D  WQAP+YCF+ 
Sbjct  155  IWYYEDVATNRPVHWVFYTGRAAHVMTFEVGAALEDAKWQAPVYCFDK  202



>ref|XP_010693863.1| PREDICTED: uncharacterized protein At4g14100-like [Beta vulgaris 
subsp. vulgaris]
Length=243

 Score =   244 bits (623),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 108/171 (63%), Positives = 131/171 (77%), Gaps = 1/171 (1%)
 Frame = +3

Query  171  SNPNAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVY  350
            S     + EP P  WP QFHS++ +N +   T+Q+IDLWYDWPNGRN N+I+NQLG L+Y
Sbjct  50   STSEKQESEPKPKAWPEQFHSLIVMNNSKTNTMQVIDLWYDWPNGRNLNLIRNQLGKLLY  109

Query  351  DLEWNNGTSFIYTLDSSR-ECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEF  527
            D+EW NGTS+ YTL     EC+ L   VGIL P WL+GA YLGQ+Y+DGFLCNVW KV+F
Sbjct  110  DVEWTNGTSYYYTLHPDVPECRTLHFEVGILSPSWLEGATYLGQRYIDGFLCNVWTKVDF  169

Query  528  IWYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTV  680
            IWYYEDVV++RPVYW FYTGM +HVMTFE+G VL D  WQAP+YCFN+ T 
Sbjct  170  IWYYEDVVTQRPVYWMFYTGMESHVMTFELGAVLEDSKWQAPIYCFNDETA  220



>ref|XP_008459922.1| PREDICTED: uncharacterized protein At4g14100-like [Cucumis melo]
 gb|ADN33696.1| glycosyl transferase [Cucumis melo subsp. melo]
Length=214

 Score =   242 bits (617),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 115/188 (61%), Positives = 139/188 (74%), Gaps = 8/188 (4%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +PVPTPWP QFHSI   N +  G LQ+ DLWYDWPNGRNFNI+Q+QLG+L+Y LE NNGT
Sbjct  26   DPVPTPWPPQFHSIYLTNFS--GNLQITDLWYDWPNGRNFNILQHQLGSLLYGLECNNGT  83

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
             F+YTLDSS+ C  +   VG+L P+WLDGA+YLGQ+++DGFLCNVWEKV+FIWYYEDV +
Sbjct  84   EFLYTLDSSKTCNTMQFEVGLLPPNWLDGAHYLGQRHVDGFLCNVWEKVDFIWYYEDVET  143

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFN------NSTVESLGSPIVSDAK  716
            K PVYW FY G  AHVMTFEVG VL D  WQAP+YCF+      N        P+++D K
Sbjct  144  KIPVYWVFYDGRDAHVMTFEVGAVLEDEKWQAPVYCFDGTGNTANDVALHQNLPLMADVK  203

Query  717  PLRLGRAF  740
               L + F
Sbjct  204  KRLLHQNF  211



>ref|XP_003602737.1| hypothetical protein MTR_3g098490 [Medicago truncatula]
 gb|AES72988.1| transferring glycosyl group transferase [Medicago truncatula]
Length=212

 Score =   241 bits (614),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 131/163 (80%), Gaps = 4/163 (2%)
 Frame = +3

Query  192  PEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLV-YDLEWNN  368
             EPVP  WP QFHS+LF+N    G+LQ +DLWYDWPNGRNFNIIQ+QL ++V YDLEW N
Sbjct  25   AEPVPAAWPEQFHSVLFMN--RSGSLQKLDLWYDWPNGRNFNIIQDQLNDVVDYDLEWTN  82

Query  369  GTSFIYTLD-SSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYED  545
            GTSF+YTL  S R C+V+ V VGILRP+WLDGA YLGQ+ +D FLCNVWEKV+FI YYED
Sbjct  83   GTSFMYTLHPSDRHCKVVHVEVGILRPNWLDGATYLGQEQVDNFLCNVWEKVDFIVYYED  142

Query  546  VVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            V+++RPV W FYTG  AHVMTFEVG VL D  WQAP YCFN +
Sbjct  143  VLTRRPVKWIFYTGYTAHVMTFEVGAVLEDAQWQAPEYCFNQT  185



>ref|XP_009421020.1| PREDICTED: uncharacterized protein At4g14100-like [Musa acuminata 
subsp. malaccensis]
Length=227

 Score =   240 bits (613),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 126/162 (78%), Gaps = 2/162 (1%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            P PTPWP QFHS+L+IN +  G L  +DLWYDWPN RNFNIIQ+QLG L+YDLEW NGTS
Sbjct  44   PTPTPWPPQFHSLLYINYS--GALSFVDLWYDWPNSRNFNIIQHQLGELLYDLEWGNGTS  101

Query  378  FIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSK  557
            F YTLD +  C+ +D  VGILRPDWLDGA YLG++ +DGF+C+VWEK +FIWYYEDV ++
Sbjct  102  FYYTLDGNCRCRTVDFDVGILRPDWLDGATYLGREAVDGFICDVWEKAQFIWYYEDVETR  161

Query  558  RPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVE  683
            RPV+W FYTG   HVMTFEVG  L D  WQAP YCF+    E
Sbjct  162  RPVHWLFYTGRSVHVMTFEVGAALEDAKWQAPAYCFDKDEEE  203



>ref|XP_004140560.2| PREDICTED: uncharacterized protein At4g14100-like [Cucumis sativus]
Length=214

 Score =   239 bits (611),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 130/160 (81%), Gaps = 2/160 (1%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +PVPTPWP QFHSI   N +  G L++ DLWYDWPNGRNFNI+Q+QLG L+Y +EWNNGT
Sbjct  26   DPVPTPWPPQFHSIYVTNFS--GVLEITDLWYDWPNGRNFNIVQHQLGTLLYGIEWNNGT  83

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
             F+YTLDSS+ C  +   VG+L P WLDGA+YLGQ+++DGFLCNVWEKV+FIWYYEDV +
Sbjct  84   EFLYTLDSSKTCDTIQFEVGLLPPKWLDGAHYLGQRHVDGFLCNVWEKVDFIWYYEDVET  143

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            K PVYW FY G  AHVMTFEVG VL D  WQAP+YCF+++
Sbjct  144  KIPVYWLFYDGRDAHVMTFEVGAVLEDEKWQAPVYCFDST  183



>ref|XP_009384307.1| PREDICTED: uncharacterized protein At4g14100-like [Musa acuminata 
subsp. malaccensis]
Length=215

 Score =   239 bits (611),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 111/172 (65%), Positives = 131/172 (76%), Gaps = 3/172 (2%)
 Frame = +3

Query  174  NPNAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQL-GNLVY  350
            + +A   +P P PWP QFH++LF+N +  G L +IDLWYDWP GRNFNII++QL G   Y
Sbjct  19   SASAAVGDPTPAPWPHQFHAVLFMNYS--GALSLIDLWYDWPGGRNFNIIRDQLDGPPFY  76

Query  351  DLEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFI  530
            DLEWNNGTSF YTLDS R C+ + V VGILRP+WLDGA YLGQ+ +DGFLCNVW K +FI
Sbjct  77   DLEWNNGTSFFYTLDSPRSCRSVQVGVGILRPNWLDGATYLGQQTVDGFLCNVWTKADFI  136

Query  531  WYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
            WYYEDVV+KRPV+W FYTG  AHVM +E G VL D  WQAP+YCF     ES
Sbjct  137  WYYEDVVTKRPVHWVFYTGRAAHVMIYEEGAVLEDAKWQAPVYCFQKGKEES  188



>gb|ACN39920.1| unknown [Picea sitchensis]
Length=230

 Score =   237 bits (605),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 112/178 (63%), Positives = 134/178 (75%), Gaps = 6/178 (3%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            E  PTPWP QFHS+L+IN  + G+LQ+ DLWYDW  GRNFNIIQ QLG  +YDLEWNNGT
Sbjct  31   ETTPTPWPEQFHSVLYIN--NSGSLQVTDLWYDWSKGRNFNIIQKQLGRKLYDLEWNNGT  88

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            SF Y LD   EC+ +   VGILRP+WL+GA YLG KY+DGFLCN WEKV+FIWYYED ++
Sbjct  89   SFYYYLDKD-ECKRMHFDVGILRPNWLEGAKYLGMKYVDGFLCNEWEKVDFIWYYEDAIT  147

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS-TVESLGSPIVSDAKPLR  725
             RPVYW F++GM  HVMTFEVG VL D  WQAP+YCF+ +  VE L     + A P++
Sbjct  148  NRPVYWRFFSGMSVHVMTFEVGAVLEDAEWQAPIYCFDKAVAVEDLKEK--TKASPVK  203



>ref|XP_004503816.1| PREDICTED: uncharacterized protein At4g14100-like [Cicer arietinum]
Length=213

 Score =   236 bits (603),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 128/160 (80%), Gaps = 3/160 (2%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P+P PWP QFHS++F+N    G L   DLWYDWPNGRNFNI Q QLG L YD+EWNNGT
Sbjct  18   DPIPAPWPEQFHSVMFVN--RSGDLHQTDLWYDWPNGRNFNINQYQLGILKYDIEWNNGT  75

Query  375  SFIYTLDS-SRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVV  551
            SFIYTLD  +  CQ+L   VGILRP+WL GANYLGQ+Y+D FLCNVWEKVEFIWYYEDV+
Sbjct  76   SFIYTLDPFNHTCQLLHFEVGILRPNWLLGANYLGQQYVDNFLCNVWEKVEFIWYYEDVL  135

Query  552  SKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNN  671
            ++ PV W FY GM  HVMTFEVG VL D +WQAPLYCF++
Sbjct  136  TRTPVKWIFYDGMTFHVMTFEVGAVLDDAHWQAPLYCFSD  175



>gb|KEH20960.1| transferring glycosyl group transferase [Medicago truncatula]
Length=222

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 128/164 (78%), Gaps = 3/164 (2%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P+P PWP QFHS+LF+N    G+L+  DLWYDWPNGRNFNIIQ QL  L YDLEWNNGT
Sbjct  30   DPIPAPWPEQFHSVLFLN--RSGSLRKQDLWYDWPNGRNFNIIQYQLDVLKYDLEWNNGT  87

Query  375  SFIYTLDS-SRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVV  551
            +F+YTLD  +  CQV    VGI RP+WLDGANYLGQ+Y D FLCNVWEKV FIWYYEDV+
Sbjct  88   TFLYTLDPFNHTCQVTQYDVGIPRPNWLDGANYLGQQYADNFLCNVWEKVGFIWYYEDVL  147

Query  552  SKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVE  683
            +KRPV W FY GM+  VMTFEVG VL D +WQAP YCFN +  E
Sbjct  148  TKRPVKWIFYDGMITDVMTFEVGAVLDDAHWQAPDYCFNKAEPE  191



>gb|ABK23648.1| unknown [Picea sitchensis]
Length=230

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 126/162 (78%), Gaps = 3/162 (2%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            E  PTPWP QFHS+L+IN  + G+LQ+ DLWYDW  GRNFNIIQ QLG  +YDLEWNNGT
Sbjct  31   ETTPTPWPEQFHSVLYIN--NSGSLQVTDLWYDWSKGRNFNIIQKQLGRKLYDLEWNNGT  88

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            SF Y LD   EC+ +   VGILRP+WL+GA YLG KY+DGFLCN WEKV+FIWYYED ++
Sbjct  89   SFYYYLDKD-ECKRMHFDVGILRPNWLEGAKYLGMKYVDGFLCNEWEKVDFIWYYEDAIT  147

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTV  680
             RPV+W F++GM  HVMTFEVG VL D  WQAP+YCF+ +  
Sbjct  148  NRPVHWRFFSGMSVHVMTFEVGAVLEDAEWQAPIYCFDKAVA  189



>ref|XP_007159947.1| hypothetical protein PHAVU_002G280800g [Phaseolus vulgaris]
 gb|ESW31941.1| hypothetical protein PHAVU_002G280800g [Phaseolus vulgaris]
Length=226

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 129/169 (76%), Gaps = 3/169 (2%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEW  362
            A D  PVP  WP QFHS+LFIN    G LQ  DLWYDWPNGRNFNIIQ+QLG L +DLEW
Sbjct  25   ANDSIPVPGDWPHQFHSVLFIN--RSGNLQKTDLWYDWPNGRNFNIIQHQLGVLTFDLEW  82

Query  363  NNGTSFIYTLDS-SRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYY  539
            +NGTSF YTL    + C+++   VGILRP+WL GANYLGQ+Y+D FLCN WEKV+FI YY
Sbjct  83   DNGTSFYYTLQPFDKTCKIIHFDVGILRPNWLHGANYLGQEYVDNFLCNAWEKVDFITYY  142

Query  540  EDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
            EDV+++RPV W F +GMVAHVMTFEVG VL D  WQAP+YCF     ES
Sbjct  143  EDVLTRRPVKWIFSSGMVAHVMTFEVGAVLEDEYWQAPVYCFGEIENES  191



>dbj|BAB01852.1| unnamed protein product [Arabidopsis thaliana]
Length=229

 Score =   234 bits (597),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/200 (56%), Positives = 134/200 (67%), Gaps = 37/200 (19%)
 Frame = +3

Query  189  DPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNN  368
            + EPVP  WP QFH+++ +N    G+L+++DLWYDW NGRNFNIIQ QLG L YDLEWNN
Sbjct  30   EKEPVPAVWPEQFHALMLMN--KSGSLEIVDLWYDWVNGRNFNIIQKQLGKLTYDLEWNN  87

Query  369  GTSFIYTLDSSRECQV-----------------------------------LDVPVGILR  443
            GTSF YTLD+S+ C+                                    L   VGILR
Sbjct  88   GTSFYYTLDASKTCRTVHFEMDVFVSMWECSINIRFHGIVFSDTLTDSSICLGKVVGILR  147

Query  444  PDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYWAFYTGMVAHVMTFEVGK  623
            P+WLDGA Y+GQ++++GFLCNVWEKVEF+WYYEDVV+KRPV W FYTG  AHVMTFEVG 
Sbjct  148  PNWLDGAKYMGQRHVNGFLCNVWEKVEFLWYYEDVVTKRPVQWIFYTGREAHVMTFEVGA  207

Query  624  VLSDPNWQAPLYCFNNSTVE  683
            VL D  WQAP+YCF+N   E
Sbjct  208  VLEDEKWQAPVYCFHNEKKE  227



>ref|XP_010693862.1| PREDICTED: uncharacterized protein At4g14100-like [Beta vulgaris 
subsp. vulgaris]
Length=222

 Score =   233 bits (595),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/182 (60%), Positives = 136/182 (75%), Gaps = 3/182 (2%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P PTPWP QFHS+L +N TS   +Q+  LWYDWPN RN ++IQ QLG L+YD+EW+NGT
Sbjct  39   DPKPTPWPDQFHSLLIMNNTSTNEVQVAHLWYDWPNRRNIHLIQYQLGKLLYDVEWSNGT  98

Query  375  SFIYTLDSS-RECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVV  551
            S+ YTL     EC+   + VGILRP+WLDGA+YLGQ+++DGFLCNVW K +FIWYYEDVV
Sbjct  99   SYFYTLHPDIPECRTAHLEVGILRPNWLDGASYLGQQHVDGFLCNVWTKADFIWYYEDVV  158

Query  552  SKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES--LGSPIVSDAKPLR  725
            ++RPV+W FYTG   +VMTF+VG VL D  WQAP+YCF+  TVES  +G P  S    L 
Sbjct  159  TRRPVHWVFYTGRAVNVMTFDVGAVLEDSKWQAPIYCFDKDTVESQTVGHPQASLRSSLP  218

Query  726  LG  731
            L 
Sbjct  219  LS  220



>emb|CDP18994.1| unnamed protein product [Coffea canephora]
Length=241

 Score =   233 bits (595),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 133/173 (77%), Gaps = 12/173 (7%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGN---LVYDLEWNN  368
            P+P PWP QFHSILF+N T  G+L +IDLWYDWPNGRNFNII++QL +   ++YDLEWNN
Sbjct  55   PIPRPWPHQFHSILFVNFT--GSLSLIDLWYDWPNGRNFNIIRDQLQDSDSILYDLEWNN  112

Query  369  GTSFIYTLDSSRE-------CQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEF  527
            GTSF YTL            C+   + VGILRP+WLDGA+YLGQ+++DGFLCNVWEK++F
Sbjct  113  GTSFFYTLPDHHHPSSTPPSCRSAQLDVGILRPNWLDGASYLGQRHVDGFLCNVWEKLDF  172

Query  528  IWYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
            IWYYEDVV+KRPV+W FYTG   HVMTFEVG VL D  WQAP+YCF     E+
Sbjct  173  IWYYEDVVTKRPVHWLFYTGRSIHVMTFEVGAVLEDAKWQAPVYCFEEVEEET  225



>gb|KHN17452.1| Hypothetical protein glysoja_026995 [Glycine soja]
Length=220

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/168 (65%), Positives = 133/168 (79%), Gaps = 4/168 (2%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            PVP  WP QFHS+LFIN    G LQ  DLWYDWPNGRNFNIIQ+QLG L YDLEW+NGTS
Sbjct  34   PVPADWPQQFHSVLFIN--RSGDLQKTDLWYDWPNGRNFNIIQHQLGVLKYDLEWDNGTS  91

Query  378  FIYTLDS-SRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            F YTL+   + C+++   VGILRP+WL GANYLGQ+++D FLCNVWEKV+FI YYEDV++
Sbjct  92   FYYTLEPFDKTCKIVHFEVGILRPNWLHGANYLGQEHVDNFLCNVWEKVDFISYYEDVLT  151

Query  555  KRPVYWAF-YTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGS  695
            +RPV W F  +GMVAHVMTFEVG VL D +WQAP+YCF ++  ++  S
Sbjct  152  RRPVKWIFSSSGMVAHVMTFEVGAVLEDKHWQAPVYCFGDAETQNKTS  199



>ref|XP_010525634.1| PREDICTED: uncharacterized protein At4g14100-like isoform X1 
[Tarenaya hassleriana]
Length=223

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/179 (61%), Positives = 132/179 (74%), Gaps = 6/179 (3%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            P P  WPLQFH++LFIN  + G+LQ  DLWYDW NGRNFNIIQ QLG L YDLEWNNGTS
Sbjct  42   PKPQQWPLQFHAVLFIN--NSGSLQKTDLWYDWVNGRNFNIIQKQLGELTYDLEWNNGTS  99

Query  378  FIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSK  557
            F YTL  S +C+ +   VGILRP+WL+ A Y+G +++DGFLCN W KV+FIWYYEDV SK
Sbjct  100  FYYTLGESGKCREITFEVGILRPNWLEDAEYVGVRHVDGFLCNAWTKVDFIWYYEDVESK  159

Query  558  RPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSDAKPLRLGR  734
             PV W FYTGM AHVMT+EVG  L D  WQAP+YCF+++ + S   P    +  +RL R
Sbjct  160  LPVSWVFYTGMEAHVMTYEVGAALEDEKWQAPIYCFDDTGMASDIDP----SDRMRLDR  214



>ref|XP_004298057.1| PREDICTED: uncharacterized protein At4g14100-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=192

 Score =   229 bits (585),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 124/159 (78%), Gaps = 0/159 (0%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            P PTPWP QFH++L++N+TS G LQ+ D+WYDWP GRN NI Q QLG L+YD+EWNNGTS
Sbjct  28   PTPTPWPEQFHALLYMNLTSSGHLQLSDVWYDWPRGRNVNIFQKQLGELLYDVEWNNGTS  87

Query  378  FIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSK  557
            + +TL     CQV++  VGI RPD+LDGANYLG +  DGFLCNVWEKV+FIWYYEDV +K
Sbjct  88   YYFTLGEGGHCQVMEFEVGIPRPDFLDGANYLGTEVTDGFLCNVWEKVDFIWYYEDVQTK  147

Query  558  RPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            RPV W FY G+  HVMTF+VG VL D   QAP YCFN +
Sbjct  148  RPVRWDFYDGITNHVMTFDVGAVLPDSVTQAPAYCFNQN  186



>gb|AES72989.2| transferring glycosyl group transferase [Medicago truncatula]
Length=222

 Score =   230 bits (587),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 110/177 (62%), Positives = 136/177 (77%), Gaps = 6/177 (3%)
 Frame = +3

Query  192  PEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLV-YDLEWNN  368
             EP+P  WP QFH+++F+N    G LQ +DLWYDWPNGRNFNIIQNQL ++V YDLEW N
Sbjct  33   AEPIPAVWPEQFHALMFMN--KSGVLQKVDLWYDWPNGRNFNIIQNQLNDVVVYDLEWTN  90

Query  369  GTSFIYTLD-SSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYED  545
            GTSFIYTL  S R C+V+  PVGIL P++LD A YLGQ+++D FLCNVW KV+FI YYED
Sbjct  91   GTSFIYTLHPSDRHCKVVHFPVGILCPNFLDDATYLGQEHVDNFLCNVWTKVDFIVYYED  150

Query  546  VVSKRPVYWAFYT--GMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSD  710
            V+++RPV W FY+  G  AHVMTFEVG VL DP+WQAP+YCFN + +  + S  V +
Sbjct  151  VLTRRPVKWFFYSDGGYTAHVMTFEVGAVLEDPHWQAPIYCFNQTEIIIIESTTVHE  207



>ref|XP_010066473.1| PREDICTED: uncharacterized protein At4g14100-like [Eucalyptus 
grandis]
 gb|KCW64357.1| hypothetical protein EUGRSUZ_G01982 [Eucalyptus grandis]
Length=225

 Score =   230 bits (586),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 106/180 (59%), Positives = 131/180 (73%), Gaps = 4/180 (2%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLG-NLVYDLEWNNG  371
             P  TPWP QFH+ LF+N  SKGTLQ++DLWYD PNGRN N I++QL  ++++D+EW+NG
Sbjct  34   APAATPWPPQFHAALFMN-NSKGTLQLVDLWYDLPNGRNLNAIRDQLSPSVLHDVEWDNG  92

Query  372  TSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVV  551
            TS+ YTL     CQ +  PVGILRPDWLDGA+YLG+  +DGFLC+ W KV+FI YYEDV 
Sbjct  93   TSYYYTLGDGGSCQTMHFPVGILRPDWLDGASYLGRSRVDGFLCDGWAKVDFIRYYEDVA  152

Query  552  SKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSDAKPLRLG  731
            +KRPV+WAF+ GM AHVMTFEVG VL D  WQAP YCF     E    P ++ A  +  G
Sbjct  153  TKRPVFWAFFNGMTAHVMTFEVGAVLEDAGWQAPAYCFGKK--EGADGPKLAAASGVSRG  210



>ref|XP_003602738.1| hypothetical protein MTR_3g098500 [Medicago truncatula]
Length=216

 Score =   229 bits (585),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/176 (63%), Positives = 136/176 (77%), Gaps = 6/176 (3%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLV-YDLEWNNG  371
            EP+P  WP QFH+++F+N    G LQ +DLWYDWPNGRNFNIIQNQL ++V YDLEW NG
Sbjct  28   EPIPAVWPEQFHALMFMN--KSGVLQKVDLWYDWPNGRNFNIIQNQLNDVVVYDLEWTNG  85

Query  372  TSFIYTLD-SSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
            TSFIYTL  S R C+V+  PVGIL P++LD A YLGQ+++D FLCNVW KV+FI YYEDV
Sbjct  86   TSFIYTLHPSDRHCKVVHFPVGILCPNFLDDATYLGQEHVDNFLCNVWTKVDFIVYYEDV  145

Query  549  VSKRPVYWAFYT--GMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSD  710
            +++RPV W FY+  G  AHVMTFEVG VL DP+WQAP+YCFN + +  + S  V +
Sbjct  146  LTRRPVKWFFYSDGGYTAHVMTFEVGAVLEDPHWQAPIYCFNQTEIIIIESTTVHE  201



>ref|NP_001236654.1| uncharacterized protein LOC100526970 precursor [Glycine max]
 gb|ACU16005.1| unknown [Glycine max]
Length=220

 Score =   228 bits (582),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 132/168 (79%), Gaps = 4/168 (2%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            PVP  WP QFHS+LFIN    G LQ  DLWYDWPNGRNFNIIQ+QLG L YDLEW+NGTS
Sbjct  34   PVPADWPQQFHSVLFIN--RSGDLQKTDLWYDWPNGRNFNIIQHQLGVLKYDLEWDNGTS  91

Query  378  FIYTLDS-SRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            F YTL+   + C+++   VGILRP+WL GANYLGQ+++D FLCNVWEKV+FI YYEDV++
Sbjct  92   FYYTLEPFDKTCKIVHFEVGILRPNWLHGANYLGQEHVDNFLCNVWEKVDFISYYEDVLT  151

Query  555  KRPVYWAF-YTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGS  695
            +RPV   F  +GMVAHVMTFEVG VL D +WQAP+YCF ++  ++  S
Sbjct  152  RRPVKRIFSSSGMVAHVMTFEVGAVLEDKHWQAPVYCFGDAETQNKTS  199



>gb|KHN31243.1| Hypothetical protein glysoja_012893 [Glycine soja]
Length=223

 Score =   227 bits (579),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 111/183 (61%), Positives = 136/183 (74%), Gaps = 8/183 (4%)
 Frame = +3

Query  171  SNPNAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLV-  347
            SN  A   +P+P  WP QFH+ +F+N    G LQ +DLWYDWPNGRNFNIIQNQL ++V 
Sbjct  25   SNAGAVTGQPIPPEWPHQFHAFMFMN--ESGILQKLDLWYDWPNGRNFNIIQNQLDHVVS  82

Query  348  YDLEWNNGTSFIYTLD-SSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVE  524
            YDLEW NGTSF+YTLD S   C+V+D  VGILRP+WLDGA YLGQ+++D FLCNVW KV+
Sbjct  83   YDLEWTNGTSFVYTLDPSDPTCKVVDFGVGILRPNWLDGATYLGQQHVDNFLCNVWAKVD  142

Query  525  FIWYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES----LG  692
            FI YYE+V+++RPV W F +G    VMTFEVG VL D NWQAP+YCF+ +  E     LG
Sbjct  143  FIVYYEEVLTRRPVRWDFSSGYTGRVMTFEVGAVLEDANWQAPVYCFDENEKEKNIPILG  202

Query  693  SPI  701
            S +
Sbjct  203  SAV  205



>emb|CAN78163.1| hypothetical protein VITISV_040924 [Vitis vinifera]
Length=199

 Score =   226 bits (577),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 102/148 (69%), Positives = 123/148 (83%), Gaps = 2/148 (1%)
 Frame = +3

Query  222  QFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTSFIYTLDSS  401
            QF+S+L++N+   G+ Q+IDLWYDWP GRN N IQNQLG  +YDLEW+NGTSF YTLDS+
Sbjct  41   QFYSLLYMNVN--GSNQIIDLWYDWPKGRNLNXIQNQLGKRLYDLEWDNGTSFFYTLDST  98

Query  402  RECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYWAFY  581
            +EC+     VGILRPDWLDGA+YLGQ+ +DGFLCNVWEKV+FIWYYEDVV+KRPV+W F+
Sbjct  99   QECRTKHFEVGILRPDWLDGAHYLGQREVDGFLCNVWEKVDFIWYYEDVVTKRPVHWRFF  158

Query  582  TGMVAHVMTFEVGKVLSDPNWQAPLYCF  665
             GM AHVMTF+ G V  D  WQAP+YCF
Sbjct  159  NGMSAHVMTFKEGAVREDEKWQAPVYCF  186



>ref|XP_009771377.1| PREDICTED: uncharacterized protein At4g14100-like [Nicotiana 
sylvestris]
Length=199

 Score =   225 bits (573),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/164 (62%), Positives = 123/164 (75%), Gaps = 2/164 (1%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P+P PWP QFH+I  +N T    L+ +DLWYDWPN R  +I Q QLG  +YD+EW NGT
Sbjct  29   DPIPAPWPHQFHAITIMNYTQG--LRKVDLWYDWPNKRYMHINQYQLGKTLYDVEWQNGT  86

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            SF +TLDS++EC V   PVGILRP+WL+G+NY+GQ+Y DGFLCNVWEKV F+ YYED V+
Sbjct  87   SFYFTLDSTQECTVRHFPVGILRPNWLEGSNYIGQRYKDGFLCNVWEKVGFLRYYEDAVT  146

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
            K PVYW FY G+V H+MTFEVGKVL    WQAP YCF     ES
Sbjct  147  KIPVYWHFYDGLVEHIMTFEVGKVLEGSKWQAPAYCFKEVKKES  190



>ref|XP_004241661.1| PREDICTED: uncharacterized protein At4g14100-like [Solanum lycopersicum]
Length=216

 Score =   225 bits (573),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 99/159 (62%), Positives = 124/159 (78%), Gaps = 2/159 (1%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P+P+PWP QFH+   +N T  G L+ +DLWYDWPN R  +I Q QLG  +YD+EW NGT
Sbjct  29   DPIPSPWPHQFHATTIMNYT--GGLRKVDLWYDWPNKRYLHINQYQLGKKLYDVEWQNGT  86

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            SF +TLDS++EC V   PVGILRP+WL+GANYLGQ+Y DGFLCNVWEK++F+ YYEDV +
Sbjct  87   SFYFTLDSTQECTVKHFPVGILRPNWLEGANYLGQRYKDGFLCNVWEKIDFLHYYEDVAT  146

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNN  671
            + PVYW FY G++ H++TFEVGKVL D  WQAP YCF  
Sbjct  147  QIPVYWQFYDGLIEHIITFEVGKVLEDSKWQAPAYCFKE  185



>ref|NP_001236399.1| uncharacterized protein LOC100306534 precursor [Glycine max]
 gb|ACU14746.1| unknown [Glycine max]
Length=223

 Score =   225 bits (573),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/183 (60%), Positives = 136/183 (74%), Gaps = 8/183 (4%)
 Frame = +3

Query  171  SNPNAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLV-  347
            SN  A   +P+P  WP QFH+ +F+N    G LQ +DLWYDWPNGRNFNII+NQL ++V 
Sbjct  25   SNAGAVTGQPIPPEWPHQFHAFMFMN--ESGILQKLDLWYDWPNGRNFNIIRNQLDHVVS  82

Query  348  YDLEWNNGTSFIYTLD-SSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVE  524
            YDLEW NGTSF+YTLD S   C+V+D  VGILRP+WLDGA YLGQ+++D FLCNVW KV+
Sbjct  83   YDLEWTNGTSFVYTLDPSDPTCKVVDFGVGILRPNWLDGATYLGQQHVDNFLCNVWAKVD  142

Query  525  FIWYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES----LG  692
            FI YYE+V+++RPV   F +G   HVMTFEVG VL D NWQAP+YCF+ +  E     LG
Sbjct  143  FIVYYEEVLTRRPVRRDFSSGYTGHVMTFEVGAVLEDANWQAPVYCFDGNEKEKNIPILG  202

Query  693  SPI  701
            S +
Sbjct  203  SAV  205



>ref|XP_010682629.1| PREDICTED: uncharacterized protein At4g14100-like [Beta vulgaris 
subsp. vulgaris]
Length=222

 Score =   224 bits (571),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = +3

Query  192  PEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNG  371
              P P  WP QFHS+L I       +Q++DLWYDW NGRN N++Q+QLG L+YD+EWNNG
Sbjct  36   KHPKPKTWPKQFHSVLVIKNPKTEEMQVVDLWYDWYNGRNLNLVQHQLGKLLYDVEWNNG  95

Query  372  TSFIYTL-DSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
            TS+ +TL DS  EC+ +   VGILRP+WL+GA YLGQ+Y+DGFLCNVW KV+FIWYYEDV
Sbjct  96   TSYYFTLNDSYSECRTVIFEVGILRPNWLEGATYLGQRYIDGFLCNVWYKVDFIWYYEDV  155

Query  549  VSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNN  671
            +++RPV+W F TG   HVMTFEVG VL    WQAP YCFN 
Sbjct  156  LTRRPVHWVFSTGRAVHVMTFEVGAVLEGSKWQAPDYCFNK  196



>ref|XP_010250494.1| PREDICTED: uncharacterized protein At4g14100-like [Nelumbo nucifera]
Length=207

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = +3

Query  186  GDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWN  365
            G+  PVP  WP +FH++L++N+ S G LQ+ DLWYDWP GRN NI+Q QLG L YD+EWN
Sbjct  27   GESTPVPVAWPERFHALLYMNL-STGHLQITDLWYDWPKGRNVNIMQKQLGELFYDIEWN  85

Query  366  NGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYED  545
            NGTSF YTL    +C++++  VGI RPD+LDGA+YLG  Y DGF CNVWEKV+FIWYYED
Sbjct  86   NGTSFYYTLGRKGKCEMMEFEVGIPRPDFLDGASYLGTDYTDGFWCNVWEKVDFIWYYED  145

Query  546  VVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFN  668
            VV++RPV W FY G+  HVMTFEVG VL D   QAP YCF 
Sbjct  146  VVTRRPVRWDFYDGISTHVMTFEVGAVLEDSQTQAPAYCFG  186



>ref|XP_009596905.1| PREDICTED: uncharacterized protein At4g14100-like isoform X1 
[Nicotiana tomentosiformis]
Length=213

 Score =   224 bits (570),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 102/166 (61%), Positives = 124/166 (75%), Gaps = 2/166 (1%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P+P PWP QFH+I  +N T    L+ +DLWYDWPN R  +I Q QLG  +Y +EW NGT
Sbjct  29   DPIPEPWPHQFHAITIMNYTQG--LRKVDLWYDWPNKRYMHINQYQLGKTLYGVEWQNGT  86

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            SF +TLDS++EC V   PVGILRP+WL+G+NY+GQKY DGFLCNVW+KV F+ YYED V+
Sbjct  87   SFYFTLDSTQECTVRHFPVGILRPNWLEGSNYVGQKYKDGFLCNVWDKVGFLRYYEDAVT  146

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLG  692
            K PVYW FY G+V H+MTFEVGKVL D  WQAP YCF     ES+ 
Sbjct  147  KIPVYWHFYDGLVEHIMTFEVGKVLEDSKWQAPAYCFKEVEKESIS  192



>emb|CBI29276.3| unnamed protein product [Vitis vinifera]
Length=171

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 119/150 (79%), Gaps = 4/150 (3%)
 Frame = +3

Query  261  GTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTSFIYTLDSSRECQVLDVPVGIL  440
            G+ Q+IDLWYDWP GRN NIIQNQLG  +YDLEW+NGTSF YTLDS++EC+     VGIL
Sbjct  5    GSNQIIDLWYDWPKGRNLNIIQNQLGKRLYDLEWDNGTSFFYTLDSTQECRTKHFEVGIL  64

Query  441  RPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYWAFYTGMVAHVMTFEVG  620
            RPDWLDGA+YLGQ+ +DGFLCNVWEKV+FIWYYEDVV+KRPV+W F+ GM AHVMTF+ G
Sbjct  65   RPDWLDGAHYLGQREVDGFLCNVWEKVDFIWYYEDVVTKRPVHWRFFNGMSAHVMTFKEG  124

Query  621  KVLSDPNWQAPLYCFN----NSTVESLGSP  698
             V  D  WQAP+YCF      +   S G+P
Sbjct  125  AVREDEKWQAPVYCFGTTDPKAETTSAGNP  154



>ref|XP_008353349.1| PREDICTED: uncharacterized protein At4g14100-like [Malus domestica]
Length=188

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 124/164 (76%), Gaps = 1/164 (1%)
 Frame = +3

Query  180  NAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLE  359
               +  P P+PWPLQFH++LF+N+T+   LQ+ DLWYDWP GRN NI Q QLG ++YD+E
Sbjct  22   TCSNSNPTPSPWPLQFHALLFMNLTTTH-LQLSDLWYDWPRGRNVNIFQKQLGEVLYDIE  80

Query  360  WNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYY  539
            WNNGTSF Y++  +  C+V++  VGI RPD+LDGA YLG +  DGFLCNVWEKV+FIWYY
Sbjct  81   WNNGTSFYYSVGDNGSCEVMEFEVGIPRPDFLDGAEYLGTEVTDGFLCNVWEKVDFIWYY  140

Query  540  EDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNN  671
            EDV +KRPV W FY G+ + VMTFEVG VL D   QAP YCFN 
Sbjct  141  EDVYTKRPVRWDFYDGISSQVMTFEVGAVLPDTVTQAPAYCFNQ  184



>gb|KEH20961.1| transferring glycosyl group transferase [Medicago truncatula]
Length=215

 Score =   221 bits (563),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 123/162 (76%), Gaps = 3/162 (2%)
 Frame = +3

Query  201  VPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTSF  380
            VP PWP QFHS+LF+N    G L+  D WYDWPNGR FNI QNQLG L YDL WNN TSF
Sbjct  30   VPAPWPKQFHSVLFLN--RSGNLRKTDFWYDWPNGRIFNIFQNQLGILKYDLAWNNRTSF  87

Query  381  IYTLDS-SRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSK  557
             YT+D  +  C+VL   VG+L P+WL GANYLGQ++ + FLCNVWEK +FIWYYEDVV++
Sbjct  88   FYTVDPFNSTCEVLHFDVGVLPPNWLHGANYLGQQHSENFLCNVWEKDDFIWYYEDVVTR  147

Query  558  RPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVE  683
            +PV W F+ GM+ HVMTFEVG VL D +WQAP+YCF+ +  E
Sbjct  148  KPVKWIFHDGMITHVMTFEVGAVLDDAHWQAPVYCFSKAEAE  189



>ref|XP_009350628.1| PREDICTED: uncharacterized protein At4g14100-like [Pyrus x bretschneideri]
Length=188

 Score =   219 bits (557),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 101/164 (62%), Positives = 123/164 (75%), Gaps = 1/164 (1%)
 Frame = +3

Query  180  NAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLE  359
               +  P P+PWPLQFH++LF+N+T+   LQ+ DLWYDWP GRN NI Q QLG ++YD+E
Sbjct  22   TCSNSNPTPSPWPLQFHALLFMNLTTTH-LQLSDLWYDWPRGRNVNIFQKQLGEVLYDIE  80

Query  360  WNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYY  539
            WNNGTSF Y++  +  C+V+   VGI RPD+LDGA YLG +  DGFLCNVWEKV+FIWYY
Sbjct  81   WNNGTSFYYSVGDNGSCEVMGFEVGIPRPDFLDGAEYLGTEVTDGFLCNVWEKVDFIWYY  140

Query  540  EDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNN  671
            EDV +KRPV W FY G+ + VMTFEVG VL D   QAP YCFN 
Sbjct  141  EDVYTKRPVRWDFYDGISSQVMTFEVGAVLPDTVAQAPAYCFNQ  184



>gb|KCW64356.1| hypothetical protein EUGRSUZ_G01982 [Eucalyptus grandis]
Length=222

 Score =   220 bits (560),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 129/180 (72%), Gaps = 7/180 (4%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLG-NLVYDLEWNNG  371
             P  TPWP QFH+ LF+N  SKGTLQ++DLWYD PNGRN N I++QL  ++++D+EW+NG
Sbjct  34   APAATPWPPQFHAALFMN-NSKGTLQLVDLWYDLPNGRNLNAIRDQLSPSVLHDVEWDNG  92

Query  372  TSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVV  551
            TS+ YTL     CQ +  PVGILRPDWLDGA+YLG+  +DGFLC+ W KV+FI YYEDV 
Sbjct  93   TSYYYTLGDGGSCQTMHFPVGILRPDWLDGASYLGRSRVDGFLCDGWAKVDFIRYYEDVA  152

Query  552  SKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSDAKPLRLG  731
            +KRPV+WAF+    AHVMTFEVG VL D  WQAP YCF     E    P ++ A  +  G
Sbjct  153  TKRPVFWAFFN---AHVMTFEVGAVLEDAGWQAPAYCFGKK--EGADGPKLAAASGVSRG  207



>ref|XP_006366285.1| PREDICTED: uncharacterized protein At4g14100-like [Solanum tuberosum]
Length=213

 Score =   219 bits (557),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 121/159 (76%), Gaps = 2/159 (1%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P+P+PWP QFH+   +N T  G L+ +DLWYDWPN R  +I Q QLG  +Y +EW NGT
Sbjct  29   DPIPSPWPHQFHATTIMNYT--GGLRKVDLWYDWPNKRYLHINQYQLGKKLYGVEWQNGT  86

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            SF +TLDS+ EC +   PVGILRP+WL+GANY+GQ+Y DGFLCNVW+K++FI YYEDV +
Sbjct  87   SFYFTLDSTEECTIRHFPVGILRPNWLEGANYMGQRYKDGFLCNVWDKIDFIHYYEDVAT  146

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNN  671
            + PVYW F  G++ H+MTFEVGKVL D  WQAP YCF  
Sbjct  147  QIPVYWHFNDGLIEHIMTFEVGKVLEDSKWQAPAYCFKE  185



>ref|XP_009350629.1| PREDICTED: uncharacterized protein At4g14100-like [Pyrus x bretschneideri]
Length=188

 Score =   217 bits (552),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 121/158 (77%), Gaps = 1/158 (1%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            P P+PWPLQFH++LF+N+ +   LQ+ DLWYDWP GRN NI Q QLG ++YD+EWNNGTS
Sbjct  28   PTPSPWPLQFHALLFMNLNTT-HLQLSDLWYDWPRGRNVNIFQKQLGEVLYDIEWNNGTS  86

Query  378  FIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSK  557
            F Y++  +  C+V+   VGI RPD+LDGA YLG +  DGFLCNVWEKV+FIWYYEDV +K
Sbjct  87   FYYSVGDNGSCEVMGFEVGIPRPDFLDGAEYLGTEVTDGFLCNVWEKVDFIWYYEDVYTK  146

Query  558  RPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNN  671
            RPV W FY G+ + VMTFEVG VL D   QAP YCFN 
Sbjct  147  RPVRWDFYDGISSQVMTFEVGAVLPDTVAQAPAYCFNQ  184



>gb|KGN46408.1| hypothetical protein Csa_6G091320 [Cucumis sativus]
Length=204

 Score =   216 bits (550),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 123/160 (77%), Gaps = 12/160 (8%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +PVPTPWP QFHSI   N +  G L++ DLWYDWPNGRNFNI+Q+QLG L+Y +EWNNGT
Sbjct  26   DPVPTPWPPQFHSIYVTNFS--GVLEITDLWYDWPNGRNFNIVQHQLGTLLYGIEWNNGT  83

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
             F+YTLDSS+ C  +   VG+L P WLDGA+YLGQ+++DGFLCNVWEKV+FIWYYEDV +
Sbjct  84   EFLYTLDSSKTCDTIQFEVGLLPPKWLDGAHYLGQRHVDGFLCNVWEKVDFIWYYEDVET  143

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            K PVYW FY          +VG VL D  WQAP+YCF+++
Sbjct  144  KIPVYWLFY----------DVGAVLEDEKWQAPVYCFDST  173



>ref|XP_010066471.1| PREDICTED: uncharacterized protein At4g14100-like [Eucalyptus 
grandis]
 gb|KCW64355.1| hypothetical protein EUGRSUZ_G01981 [Eucalyptus grandis]
Length=232

 Score =   217 bits (552),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 120/159 (75%), Gaps = 4/159 (3%)
 Frame = +3

Query  213  WPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLG-NLVYDLEWNNGTSFIYT  389
            WP QFHS++ +N +  G LQ+IDLWYDWPNGRNFNII++QL   L+YDLEWNNGTSF YT
Sbjct  46   WPHQFHSLMVMNFS--GALQLIDLWYDWPNGRNFNIIRDQLSPTLLYDLEWNNGTSFFYT  103

Query  390  LDS-SRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPV  566
            L   S  C+   + VGILRP WL+GA YLG++ +DGFLC+ WEK +FI YYEDV +KRPV
Sbjct  104  LGGDSPSCRTAQLEVGILRPGWLEGAAYLGRRRVDGFLCDGWEKADFIRYYEDVETKRPV  163

Query  567  YWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVE  683
            +W FYTG  AHVMTFEVG  L D  WQAP YCF+    E
Sbjct  164  HWRFYTGREAHVMTFEVGAALEDAKWQAPAYCFDQKEAE  202



>ref|XP_007014116.1| Transferring glycosyl groups [Theobroma cacao]
 gb|EOY31735.1| Transferring glycosyl groups [Theobroma cacao]
Length=187

 Score =   214 bits (544),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 118/157 (75%), Gaps = 1/157 (1%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            P PTPWP QFH++L + + S G  Q+ DLWYDWP GRN N+ Q QLG  +YD+EWNNGTS
Sbjct  27   PDPTPWPEQFHALLCMTLYSGGH-QITDLWYDWPKGRNVNLQQKQLGVFMYDIEWNNGTS  85

Query  378  FIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSK  557
            F YTL ++  C+ +D  VGI RPD+LDGANYLG +  DGFLCNVWEKV+FIWYYEDV +K
Sbjct  86   FYYTLGTNGTCETVDFGVGIPRPDFLDGANYLGTEVKDGFLCNVWEKVDFIWYYEDVATK  145

Query  558  RPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFN  668
            RPV W FY G++ HVMTFEVG  L D   QAP YCF 
Sbjct  146  RPVRWDFYDGIITHVMTFEVGATLPDSTVQAPEYCFT  182



>ref|XP_008223676.1| PREDICTED: uncharacterized protein At4g14100-like [Prunus mume]
Length=189

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 100/160 (63%), Positives = 121/160 (76%), Gaps = 2/160 (1%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            P P PWP QFH++LF+N+ S   LQ+ DLWYDWP GRN NI Q QLG ++YD+EWNNGTS
Sbjct  28   PTPNPWPDQFHALLFMNL-STTKLQLSDLWYDWPKGRNVNIFQKQLGEVLYDVEWNNGTS  86

Query  378  FIYTLDSSRECQVLDVPVGILRPDWL-DGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            F YT+  +  C+V++  VGI RPD+L DGA+YLG +  DGFLCNVWEKV+FIWYYEDV +
Sbjct  87   FYYTIGENGACEVMEFEVGIPRPDFLLDGAHYLGTEVTDGFLCNVWEKVDFIWYYEDVYT  146

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            +RPV W FY G+ + VMTFEVG VL D   QAP YCFN  
Sbjct  147  RRPVRWDFYDGISSQVMTFEVGAVLPDSVTQAPAYCFNQE  186



>ref|XP_008797122.1| PREDICTED: uncharacterized protein At4g14100-like [Phoenix dactylifera]
Length=220

 Score =   211 bits (538),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 94/162 (58%), Positives = 121/162 (75%), Gaps = 1/162 (1%)
 Frame = +3

Query  186  GDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWN  365
            G+  P P  WP +FH++L++N+ S G LQM DLWYDWP GRN N++Q QLG L++D+EW+
Sbjct  29   GEDPPTPAAWPERFHALLYMNL-SDGRLQMSDLWYDWPAGRNVNLMQKQLGVLLHDVEWD  87

Query  366  NGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYED  545
            NGTSF YTL  +R C+    PVGI R D++ G+ YLG +Y DGFLC++WEKV+FIWYYED
Sbjct  88   NGTSFYYTLGPTRYCRTTLFPVGIPRRDFMLGSTYLGLRYTDGFLCHLWEKVDFIWYYED  147

Query  546  VVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNN  671
              ++RPV W FY G+  HVMTFEVG  L +P WQAP YCF +
Sbjct  148  ASTRRPVRWDFYDGISTHVMTFEVGVTLEEPQWQAPSYCFTD  189



>ref|XP_006453439.1| hypothetical protein CICLE_v10009608mg [Citrus clementina]
 ref|XP_006474141.1| PREDICTED: uncharacterized protein At4g14100-like [Citrus sinensis]
 gb|ESR66679.1| hypothetical protein CICLE_v10009608mg [Citrus clementina]
 gb|KDO36384.1| hypothetical protein CISIN_1g029792mg [Citrus sinensis]
Length=188

 Score =   208 bits (530),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            PVPTPWP +FH++ + N++S G LQ+   WYDWP GRN  IIQ QL +L+Y++EWNNGTS
Sbjct  26   PVPTPWPERFHALTYKNLSSDG-LQIAHQWYDWPRGRNVYIIQKQLSDLLYNVEWNNGTS  84

Query  378  FIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSK  557
            F YTL  +  C V+   +GI RPD+LDGA YLG ++ DGFLCN+WEK++FIWYYEDV +K
Sbjct  85   FYYTLGENGSCDVVHYGIGIPRPDFLDGATYLGTRFTDGFLCNLWEKLDFIWYYEDVQTK  144

Query  558  RPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNST  677
            +PV W F  G+  HVMTFEVG VL DP  QAP YCFN  T
Sbjct  145  KPVRWDFSDGISVHVMTFEVGAVLHDPLIQAPSYCFNQDT  184



>ref|XP_002532408.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
 gb|EEF29972.1| transferase, transferring glycosyl groups, putative [Ricinus 
communis]
Length=195

 Score =   208 bits (529),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 98/148 (66%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = +3

Query  222  QFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTSFIYTLDSS  401
            QFH++L++N+ SKG LQM DLWYDWPNGRN NI Q QL  ++YD+EWNNGTSF YTL+  
Sbjct  41   QFHALLYMNL-SKGNLQMSDLWYDWPNGRNVNIFQKQLSIILYDIEWNNGTSFYYTLEEP  99

Query  402  RECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYWAFY  581
              C+V++  VGI RPD+LDGANYLG    DGFLCNVWEKV+FIWYYEDV +KRPV W FY
Sbjct  100  YSCEVMEFGVGIPRPDFLDGANYLGTTVTDGFLCNVWEKVDFIWYYEDVSTKRPVRWDFY  159

Query  582  TGMVAHVMTFEVGKVLSDPNWQAPLYCF  665
             G+ +HV+TFEVG VL D   QAP  CF
Sbjct  160  DGISSHVITFEVGAVLDDSLTQAPANCF  187



>gb|EMT33452.1| hypothetical protein F775_30441 [Aegilops tauschii]
Length=221

 Score =   207 bits (528),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/168 (58%), Positives = 124/168 (74%), Gaps = 7/168 (4%)
 Frame = +3

Query  174  NPNA--GDPEPVPTPWPLQFHSILFINIT-SKGTLQMIDLWYDWPNGRNFNIIQNQL-GN  341
            NP A  G   PVPTPWP QFH+++F N+T S G LQ+IDL+YDWP GRN N+I NQL G+
Sbjct  24   NPAAAGGSAPPVPTPWPEQFHAVMFTNLTESGGRLQLIDLYYDWPRGRNLNLIHNQLSGD  83

Query  342  LVYDLEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKV  521
              YD+EW NGTS+I+    S  C+ +  PVG+L PDWL GA YLG++  DGF C++W KV
Sbjct  84   PTYDVEWTNGTSYIF---DSASCRTIRFPVGVLPPDWLHGAVYLGRESTDGFDCHLWTKV  140

Query  522  EFIWYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCF  665
            +F+WYYEDV++ RPV W F+ GM  HVM+FEVG VL D +WQAP +CF
Sbjct  141  DFVWYYEDVLTHRPVRWNFFNGMQQHVMSFEVGGVLEDSHWQAPSHCF  188



>ref|XP_010929713.1| PREDICTED: uncharacterized protein At4g14100-like [Elaeis guineensis]
Length=209

 Score =   206 bits (525),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 120/162 (74%), Gaps = 1/162 (1%)
 Frame = +3

Query  186  GDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWN  365
            G+  P P PWP +FH+ L++N+ S G LQ+ DLWYDWP GRN N++Q QLG L++D+EW+
Sbjct  28   GEDTPTPAPWPERFHAQLYMNL-SDGRLQISDLWYDWPAGRNVNLMQKQLGVLLHDVEWD  86

Query  366  NGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYED  545
            NGTSF YTL  +  C+ +  PVGI R D++ G+ YLG +Y DGFLC++WEKV+FIWYYED
Sbjct  87   NGTSFYYTLGPTGHCRTMLFPVGIPRRDFMVGSTYLGPRYTDGFLCHLWEKVDFIWYYED  146

Query  546  VVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNN  671
              ++RPV W FY G+  HVMTFEVG VL +  WQAP  CF +
Sbjct  147  AATRRPVRWDFYDGISTHVMTFEVGGVLEESQWQAPSNCFTD  188



>ref|XP_011462640.1| PREDICTED: uncharacterized protein At4g14100-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=179

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 114/159 (72%), Gaps = 13/159 (8%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            P PTPWP QFH++L++N+TS G LQ+ D+WYDWP GRN NI Q QLG L+YD+EWNNGTS
Sbjct  28   PTPTPWPEQFHALLYMNLTSSGHLQLSDVWYDWPRGRNVNIFQKQLGELLYDVEWNNGTS  87

Query  378  FIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSK  557
            + +TL     CQV++  VGI RPD+LDGANYLG +  DGFLCNVWEKV+FIWYYEDV +K
Sbjct  88   YYFTLGEGGHCQVMEFEVGIPRPDFLDGANYLGTEVTDGFLCNVWEKVDFIWYYEDVQTK  147

Query  558  RPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            RPV W FY              VL D   QAP YCFN +
Sbjct  148  RPVRWDFY-------------DVLPDSVTQAPAYCFNQN  173



>ref|XP_002965445.1| hypothetical protein SELMODRAFT_83843 [Selaginella moellendorffii]
 gb|EFJ32865.1| hypothetical protein SELMODRAFT_83843 [Selaginella moellendorffii]
Length=217

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 125/185 (68%), Gaps = 5/185 (3%)
 Frame = +3

Query  180  NAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLE  359
             AG   P PTPWP QFH++L  N  + G L  +DLWYD+PNGRNFNII +QLG+ +YDLE
Sbjct  21   GAGFGSPTPTPWPEQFHALLLQN--ASGKLSTVDLWYDFPNGRNFNIIHSQLGSTLYDLE  78

Query  360  WNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDG-ANYLGQKYMDGFLCNVWEKVE-FIW  533
            W NGTSF Y LD+   C+ + VPVGIL PDWL G + Y+G + + GF CNVW K + FI+
Sbjct  79   WTNGTSFFYDLDAG-SCRTVHVPVGILPPDWLVGNSTYIGVREVGGFTCNVWSKADDFIF  137

Query  534  YYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSDA  713
            YYEDV +KRPVYW FYTG   +VMTFE GKVL D  WQAP YCF+    +S         
Sbjct  138  YYEDVETKRPVYWIFYTGREEYVMTFEPGKVLEDEGWQAPWYCFDREENKSFQENGGDTK  197

Query  714  KPLRL  728
            +P  L
Sbjct  198  EPSEL  202



>ref|XP_002984546.1| hypothetical protein SELMODRAFT_120238 [Selaginella moellendorffii]
 gb|EFJ14596.1| hypothetical protein SELMODRAFT_120238 [Selaginella moellendorffii]
Length=213

 Score =   202 bits (514),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/172 (58%), Positives = 122/172 (71%), Gaps = 5/172 (3%)
 Frame = +3

Query  180  NAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLE  359
            +AG   P PTPWP QFH++L  N  + G L  +DLWYD+PNGRNFNII +QLG+ +YDLE
Sbjct  21   DAGFGSPTPTPWPEQFHALLLQN--ASGKLSTVDLWYDFPNGRNFNIIHSQLGSTLYDLE  78

Query  360  WNNGTSFIYTLDSSRECQVLDVPVGILRPDWL-DGANYLGQKYMDGFLCNVWEKVE-FIW  533
            W NGTSF Y LD+   C+ + VPVGIL PDWL   + Y+G + + GF CNVW K + FI+
Sbjct  79   WTNGTSFFYDLDAG-SCRTVHVPVGILPPDWLVSNSTYIGVREVGGFTCNVWSKADDFIF  137

Query  534  YYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESL  689
            YYEDV +KRPVYW FYTG   +VMTFE GKVL D  WQAP YCF+    +S 
Sbjct  138  YYEDVETKRPVYWIFYTGREEYVMTFEPGKVLEDEGWQAPWYCFDREENKSF  189



>ref|XP_006658351.1| PREDICTED: uncharacterized protein At4g14100-like [Oryza brachyantha]
Length=256

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/196 (51%), Positives = 126/196 (64%), Gaps = 6/196 (3%)
 Frame = +3

Query  180  NAGDPEPVPTPWPLQFHSILFINIT-SKGTLQMIDLWYDWPNGRNFNIIQNQL-GNLVYD  353
             A  P P+PTPWP QFH+++  N+T S G LQ+IDL+YDWP GRN N+I+ QL G+  YD
Sbjct  50   GAAAPTPIPTPWPDQFHAVVLTNLTESGGRLQLIDLYYDWPGGRNLNLIRGQLSGDPTYD  109

Query  354  LEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWL-DGANYLGQKYMDGFLCNVWEKVEFI  530
            +EW NGTSF +    S  C+    PVG+L PDWL DGA YLG+  + GF C+VW KV+F+
Sbjct  110  VEWTNGTSFFF---DSASCRTKLFPVGLLPPDWLVDGAVYLGRHAVGGFDCHVWTKVDFV  166

Query  531  WYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSD  710
            WYYEDVV+ RPV W F+ GM  HVM+FEVG VL D  WQAP  CF++     +     + 
Sbjct  167  WYYEDVVTHRPVRWNFFNGMQQHVMSFEVGGVLKDSKWQAPARCFSDQETVGIAGAATAT  226

Query  711  AKPLRLGRAFDVSVSL  758
             +       FDV  S 
Sbjct  227  GRLQGEDAKFDVMSSF  242



>ref|XP_002965443.1| hypothetical protein SELMODRAFT_68863, partial [Selaginella moellendorffii]
 gb|EFJ32863.1| hypothetical protein SELMODRAFT_68863, partial [Selaginella moellendorffii]
Length=161

 Score =   199 bits (505),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/164 (60%), Positives = 119/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            P PTPWP QFH++LF N  S G L  IDLWYD+PNGRNFNII +QLG+ +YDLEW NGTS
Sbjct  1    PTPTPWPEQFHALLFQN--SSGKLSTIDLWYDFPNGRNFNIIHSQLGSTLYDLEWTNGTS  58

Query  378  FIYTLDSSRECQVLDVPVGILRPDWL-DGANYLGQKYMDGFLCNVWEKVE-FIWYYEDVV  551
            F Y LD+   C+ +  PVGIL PDWL   + Y+G + + GF CNVW K + FI YYEDV 
Sbjct  59   FYYDLDAGS-CKTMHFPVGILSPDWLVSNSTYIGVEKVGGFTCNVWSKADGFIVYYEDVE  117

Query  552  SKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVE  683
            +KRPV+W F+TGM  +VMTFE GKVL D  WQAP YCF++   E
Sbjct  118  TKRPVHWLFFTGMSQYVMTFEPGKVLEDEAWQAPWYCFDSEDNE  161



>ref|XP_002324489.1| hypothetical protein POPTR_0018s10470g [Populus trichocarpa]
 gb|EEF03054.1| hypothetical protein POPTR_0018s10470g [Populus trichocarpa]
Length=197

 Score =   200 bits (508),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/160 (59%), Positives = 117/160 (73%), Gaps = 2/160 (1%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            P+P PWP QFH++L++N++S   LQ+ +LWYDWP GRN NIIQ QL  L+YD EWNNGT+
Sbjct  35   PIPAPWPEQFHALLYMNLSSTH-LQITNLWYDWPRGRNVNIIQKQLSVLLYDTEWNNGTT  93

Query  378  FIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSK  557
            F YTL     C+++   VGI RPD+LDGA YLG    DG+LCNVWEK++ IWYYEDV +K
Sbjct  94   FYYTLSEPHSCRIMVNDVGIPRPDFLDGAEYLGTAVTDGYLCNVWEKIDTIWYYEDVYTK  153

Query  558  RPVYWAFYTGMVAHVMTFEVGKVLSDPN-WQAPLYCFNNS  674
            RPV W F  G+  HV+TF+VG VL D +  QAP YCFN  
Sbjct  154  RPVRWDFNDGISTHVITFDVGAVLLDDSVTQAPAYCFNQE  193



>ref|XP_002984548.1| hypothetical protein SELMODRAFT_16681, partial [Selaginella moellendorffii]
 gb|EFJ14598.1| hypothetical protein SELMODRAFT_16681, partial [Selaginella moellendorffii]
Length=160

 Score =   198 bits (503),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 117/160 (73%), Gaps = 5/160 (3%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            P PTPWP QFH++LF N  S G L  IDLWYD+PNGRNFNII +QLG+ +YDLEW NGTS
Sbjct  1    PTPTPWPEQFHALLFQN--SSGKLSTIDLWYDFPNGRNFNIIHHQLGSTLYDLEWTNGTS  58

Query  378  FIYTLDSSRECQVLDVPVGILRPDWL-DGANYLGQKYMDGFLCNVWEKVE-FIWYYEDVV  551
            F Y LD+   C+ +  PVGIL PDWL   + Y+G + + GF CNVW K + FI YYEDV 
Sbjct  59   FYYDLDAGS-CKTMHFPVGILSPDWLVSNSTYIGVEKVGGFTCNVWSKADGFIVYYEDVE  117

Query  552  SKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNN  671
            +KRPV+W F+TGM  +VMTFE GKVL D  WQAP YCF+ 
Sbjct  118  TKRPVHWLFFTGMSQYVMTFEPGKVLEDEAWQAPWYCFDR  157



>ref|XP_003557445.1| PREDICTED: uncharacterized protein At4g14100-like [Brachypodium 
distachyon]
Length=222

 Score =   198 bits (503),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 119/169 (70%), Gaps = 5/169 (3%)
 Frame = +3

Query  222  QFHSILFINIT-SKGTLQMIDLWYDWPNGRNFNIIQNQL-GNLVYDLEWNNGTSFIYTLD  395
            QFH+++F N+T S G LQ+IDL+YDWP GRN N+I++QL G+  YD+EW NGTS+I+   
Sbjct  43   QFHAVMFTNLTESGGRLQLIDLYYDWPRGRNLNLIRSQLSGDPKYDVEWTNGTSYIF---  99

Query  396  SSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYWA  575
             S  C+ +   VGIL PDWL GA YLG++  DGF C+VW KV+FIWYYEDVV+ RPV W 
Sbjct  100  DSASCRTIKFAVGILPPDWLRGAVYLGRETTDGFDCHVWTKVDFIWYYEDVVTHRPVRWN  159

Query  576  FYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSDAKPL  722
            FYTGM  HVM+F VG VL D  WQAP +CFN+    + G+  V     L
Sbjct  160  FYTGMQQHVMSFNVGGVLEDSQWQAPAHCFNDHAAMATGADAVDTMSSL  208



>ref|XP_002459483.1| hypothetical protein SORBIDRAFT_02g005370 [Sorghum bicolor]
 gb|EER96004.1| hypothetical protein SORBIDRAFT_02g005370 [Sorghum bicolor]
Length=241

 Score =   194 bits (492),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 121/163 (74%), Gaps = 6/163 (4%)
 Frame = +3

Query  207  TPWPLQFHSILFINIT-SKGTLQMIDLWYDWPNGRNFNIIQNQL-GNLVYDLEWNNGTSF  380
            TPWP QFH+++F N+T S G LQ+IDL+YDWP GRN N+I++QL G+ +YD+EW NGTS+
Sbjct  44   TPWPEQFHAVVFTNLTESGGRLQLIDLYYDWPRGRNLNLIRDQLSGDPLYDVEWTNGTSY  103

Query  381  IYTLDSSRECQVLDVPVGILRPDWLD-GANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSK  557
             +    S  C+ +  PVG+L PDWL  GA YLG++++DGF C++W KV+F+WYYE+V + 
Sbjct  104  YF---DSGSCRTIRFPVGLLPPDWLAAGAVYLGREHVDGFDCHLWTKVDFVWYYEEVATG  160

Query  558  RPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
            RPV W F+ GM  HVM+FEVG VL D  WQAP YCFN    ++
Sbjct  161  RPVRWNFFNGMQQHVMSFEVGGVLEDSKWQAPAYCFNGGNADT  203



>ref|XP_002460796.1| hypothetical protein SORBIDRAFT_02g035030 [Sorghum bicolor]
 gb|EER97317.1| hypothetical protein SORBIDRAFT_02g035030 [Sorghum bicolor]
Length=238

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 93/182 (51%), Positives = 128/182 (70%), Gaps = 8/182 (4%)
 Frame = +3

Query  222  QFHSILFINIT-SKGTLQMIDLWYDWPNGRNFNIIQNQL-GNLVYDLEWNNGTSFIYTLD  395
            QFH+++F N+T S G LQ+IDL+YDWP GRN N+I++QL G+ +YD+EW NGTS+ +   
Sbjct  43   QFHAVVFTNLTESGGRLQLIDLYYDWPRGRNLNLIRDQLSGDPLYDVEWTNGTSYFF---  99

Query  396  SSRECQVLDVPVGILRPDWLD-GANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYW  572
             S  C+ + VPVG+L PDWL  GA YLG++++DGF C++W KV+FIWYYE+V + RPV W
Sbjct  100  DSGSCRTVRVPVGLLPPDWLAAGAVYLGREHVDGFDCHLWTKVDFIWYYEEVATGRPVRW  159

Query  573  AFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSDAKPLRLGRAFDVSV  752
             F+ GM  HVM+FEVG VL D  WQAP YCFN    ++  + + +D      GR+  V V
Sbjct  160  NFFNGMQQHVMSFEVGGVLEDSKWQAPAYCFNGGNADT--ANVAADGVDSDAGRSSRVDV  217

Query  753  SL  758
             +
Sbjct  218  DV  219



>ref|XP_010909570.1| PREDICTED: uncharacterized protein At4g14100-like [Elaeis guineensis]
Length=226

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 83/161 (52%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P P PWP +FH++L++N+T+ G L + D+WYD P GRN +++Q QL +L+Y++EW NGT
Sbjct  28   DPAPMPWPERFHALLYMNLTATGELMVTDIWYDLPRGRNVHLMQRQLDDLLYNVEWENGT  87

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            SF YTL S+R C      +G+ RPDWL  + YLG++Y DGFLC+VW K++F+WYYEDV +
Sbjct  88   SFYYTLGSTRYCHPKQWGIGLPRPDWLADSTYLGRRYTDGFLCHVWTKLDFVWYYEDVDT  147

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPN-WQAPLYCFNNS  674
            +RPV W F+ G+  +VMTFE G  L+D   WQAP +CF++ 
Sbjct  148  RRPVRWDFFDGVTNYVMTFEPGASLNDSQLWQAPSHCFSSG  188



>ref|NP_001059085.1| Os07g0189800 [Oryza sativa Japonica Group]
 dbj|BAC83925.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD31859.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20999.1| Os07g0189800 [Oryza sativa Japonica Group]
 gb|EAZ03053.1| hypothetical protein OsI_25195 [Oryza sativa Indica Group]
 gb|EAZ38973.1| hypothetical protein OsJ_23393 [Oryza sativa Japonica Group]
 dbj|BAG92677.1| unnamed protein product [Oryza sativa Japonica Group]
Length=226

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 113/160 (71%), Gaps = 8/160 (5%)
 Frame = +3

Query  222  QFHSILFINITSK---GTLQMIDLWYDWPNGRNFNIIQNQL-GNLVYDLEWNNGTSFIYT  389
            +FH++LF N+T     G LQM DL+YDWP GRN N++  QL G+ VYD+EW NGTS+ + 
Sbjct  37   RFHAVLFTNLTQTSGGGKLQMTDLYYDWPGGRNLNLVAGQLSGDPVYDVEWTNGTSYYF-  95

Query  390  LDSSRECQVLDVPVGILRPDWLD-GANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPV  566
               S  C+ L  PVGIL PDWL  GA YLG++ +DGF C+VW KV+FIWYYEDVV+ RPV
Sbjct  96   --DSASCRTLLFPVGILPPDWLAAGAAYLGREAVDGFDCHVWTKVDFIWYYEDVVTHRPV  153

Query  567  YWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
             W FYTGM  HVM+FEVG  L D  WQAP YCFN+    +
Sbjct  154  RWNFYTGMQQHVMSFEVGGALEDSKWQAPAYCFNDQEAAT  193



>ref|XP_007223699.1| hypothetical protein PRUPE_ppa012977mg [Prunus persica]
 gb|EMJ24898.1| hypothetical protein PRUPE_ppa012977mg [Prunus persica]
Length=147

 Score =   187 bits (474),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +3

Query  255  SKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTSFIYTLDSSRECQVLDVPVG  434
            S   LQ+ DLWYDWP GRN NI Q QLG ++YD+EWNNGTSF YTL  +  C+V++  VG
Sbjct  4    STTKLQLSDLWYDWPKGRNVNIFQKQLGEVLYDVEWNNGTSFYYTLGQNGACEVMEFEVG  63

Query  435  ILRPDWL-DGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYWAFYTGMVAHVMTF  611
            I RPD+L DGA+YLG    DGFLCNVWEK +FIWYYEDV ++RPV W FY G+ + VMTF
Sbjct  64   IPRPDFLLDGAHYLGTVVTDGFLCNVWEKADFIWYYEDVYTRRPVRWDFYDGISSQVMTF  123

Query  612  EVGKVLSDPNWQAPLYCFNNS  674
            EVG VL D   QAP YCFN  
Sbjct  124  EVGAVLPDSVTQAPAYCFNQE  144



>gb|EAZ03052.1| hypothetical protein OsI_25194 [Oryza sativa Indica Group]
Length=246

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 98/214 (46%), Positives = 136/214 (64%), Gaps = 8/214 (4%)
 Frame = +3

Query  207  TPWPLQFHSILFINIT-SKGTLQMIDLWYDWPNGRNFNIIQNQL-GNLVYDLEWNNGTSF  380
            TPWP QFH+++F N+T S G LQ+IDL+YDWP GRN N+I+ QL G+  YD+EW NGTS+
Sbjct  26   TPWPEQFHAVVFTNLTGSGGRLQLIDLYYDWPRGRNLNLIRGQLSGDPTYDVEWTNGTSY  85

Query  381  IYTLDSSRECQVLDVPVGILRPDWLD-GANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSK  557
             +   S   C+    PVG+L PDWL  GA YLG++ + GF C++W KV+F+WYYEDVV+ 
Sbjct  86   FFNATS---CRTKLFPVGLLPPDWLAAGAVYLGRETVAGFDCHLWTKVDFVWYYEDVVTH  142

Query  558  RPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNN--STVESLGSPIVSDAKPLRLG  731
            RPV W F+ GM  HVM+FEVG VL D  WQAP  CF++  + +   G+  V+D +     
Sbjct  143  RPVRWNFFNGMQQHVMSFEVGGVLEDSKWQAPARCFSDQHTVIADPGAATVTDDRVEGED  202

Query  732  RAFDVSVSL*PFTYLSCSYLTLIANFKNKNLLQA  833
               DV  +      + C+ +T    F + +  +A
Sbjct  203  GKLDVMNAFFSNMKMLCANMTENVKFGSSSDCKA  236



>ref|XP_001767281.1| predicted protein [Physcomitrella patens]
 gb|EDQ67962.1| predicted protein [Physcomitrella patens]
Length=230

 Score =   189 bits (479),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/171 (52%), Positives = 119/171 (70%), Gaps = 4/171 (2%)
 Frame = +3

Query  192  PEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNG  371
             +P+P PWPLQFH+ L+ N T  G L MIDLWYD+PNGRN N+IQ QLG++++D+E+ NG
Sbjct  33   ADPIPKPWPLQFHAQLYQNRT--GKLSMIDLWYDYPNGRNLNLIQKQLGSVIHDVEYTNG  90

Query  372  TSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVV  551
            TSF Y L++   C+V+   VGILRPD+L+ A Y+G   +DG+ CNVW+K +FI Y+ED+ 
Sbjct  91   TSFYYDLEAG-TCKVVLFQVGILRPDFLNDATYVGVDEIDGYKCNVWDKADFIRYWEDIE  149

Query  552  SKRPVYWAF-YTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPI  701
            ++RP+ W F  TGM  HVM FE G VL D  WQAP  CF      +  S +
Sbjct  150  TRRPISWLFTTTGMWMHVMKFEEGNVLDDQKWQAPPSCFERRVASTTSSAL  200



>ref|NP_001059084.1| Os07g0189700 [Oryza sativa Japonica Group]
 dbj|BAC83924.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAD31858.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF20998.1| Os07g0189700 [Oryza sativa Japonica Group]
Length=225

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 122/175 (70%), Gaps = 8/175 (5%)
 Frame = +3

Query  207  TPWPLQFHSILFINIT-SKGTLQMIDLWYDWPNGRNFNIIQNQL-GNLVYDLEWNNGTSF  380
            TPWP QFH+++F N+T S G LQ+IDL+YDWP GRN N+I+ QL G+  YD+EW NGTS+
Sbjct  25   TPWPEQFHAVVFTNLTGSGGRLQLIDLYYDWPRGRNLNLIRGQLSGDPTYDVEWTNGTSY  84

Query  381  IYTLDSSRECQVLDVPVGILRPDWLD-GANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSK  557
             +   S   C+    PVG+L PDWL  GA YLG++ + GF C++W KV+ +WYYEDVV+ 
Sbjct  85   FFNATS---CRTKLFPVGLLPPDWLAAGAVYLGRETVAGFDCHLWTKVDIVWYYEDVVTH  141

Query  558  RPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNN--STVESLGSPIVSDAK  716
            RPV W F+ GM  HVM+FEVG VL D  WQAP  CF++  + +   G+  V+D +
Sbjct  142  RPVRWNFFNGMQQHVMSFEVGGVLEDSKWQAPARCFSDQHTVIADPGAATVTDDR  196



>ref|XP_011018225.1| PREDICTED: uncharacterized protein At4g14100-like [Populus euphratica]
Length=200

 Score =   182 bits (463),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 114/163 (70%), Gaps = 5/163 (3%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            P+P PWP QFH++L++N++S   LQ+ +LWYDWP GRN NIIQ QL  L+YD EWNNGT+
Sbjct  35   PIPAPWPEQFHALLYMNLSST-RLQITNLWYDWPRGRNVNIIQKQLSVLLYDTEWNNGTT  93

Query  378  FIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSK  557
            F YTL     C+++   VGI RPD+LDGA YLG    DG+L N WEK++ +WYYEDV  K
Sbjct  94   FYYTLSEPHSCRIMVNDVGIPRPDFLDGAEYLGTAVTDGYLRNAWEKIDTMWYYEDVYMK  153

Query  558  RP--VY-WAFYTGMVAHVMTFEVGKVLSDPN-WQAPLYCFNNS  674
            RP  VY    + G+  HV+TF+VG VL D +  QAP YCFN  
Sbjct  154  RPFAVYNLIIFAGISTHVITFDVGAVLLDDSVTQAPAYCFNQE  196



>gb|ABK96668.1| unknown [Populus trichocarpa x Populus deltoides]
Length=148

 Score =   180 bits (456),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/139 (62%), Positives = 101/139 (73%), Gaps = 1/139 (1%)
 Frame = +3

Query  255  SKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTSFIYTLDSSRECQVLDVPVG  434
            S   LQ+ +LWYDWP GRN NIIQ QL  L+YD EWNNGT+F YTL     C+++   VG
Sbjct  4    SSTRLQITNLWYDWPRGRNVNIIQKQLSVLLYDTEWNNGTTFYYTLSEPHSCRIMVNDVG  63

Query  435  ILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYWAFYTGMVAHVMTFE  614
            I RPD+LDGA YLG    DG+LCNVWEK++ IWYYEDV +KRPV W F  G+  HV+TFE
Sbjct  64   IPRPDFLDGAEYLGTAVTDGYLCNVWEKIDTIWYYEDVYTKRPVRWDFNDGISTHVITFE  123

Query  615  VGKVLSDPN-WQAPLYCFN  668
            VG VLSD +  QAP YCFN
Sbjct  124  VGAVLSDDSVTQAPAYCFN  142



>ref|XP_004981035.1| PREDICTED: uncharacterized protein At4g14100-like [Setaria italica]
Length=206

 Score =   176 bits (447),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/158 (56%), Positives = 108/158 (68%), Gaps = 6/158 (4%)
 Frame = +3

Query  207  TPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLV--YDLEWNNGTSF  380
            TPWP QFH+ L ++  S G + + DLWYDWP GRN ++I+ QL +    +D E NNGTSF
Sbjct  30   TPWPPQFHATLVMD--SHGNMSIADLWYDWPGGRNLHVIRYQLADDAPYFDNELNNGTSF  87

Query  381  IYTLDSSRECQVLDVPVGILRPDWL-DGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSK  557
             YT  + R C+   V VGILRPDWL  GA YLG++   GF C+VW K +FI YYEDV +K
Sbjct  88   FYT-PARRSCRSAAVGVGILRPDWLLPGAVYLGRRDAGGFDCHVWAKADFITYYEDVKTK  146

Query  558  RPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNN  671
            RPV W FYTG +A+VM FEVG VL D  WQ P YCFN 
Sbjct  147  RPVKWVFYTGRIAYVMNFEVGAVLEDAAWQVPEYCFNK  184



>ref|NP_001143658.1| hypothetical protein precursor [Zea mays]
 gb|ACG33820.1| hypothetical protein [Zea mays]
 gb|ACN28533.1| unknown [Zea mays]
 tpg|DAA59889.1| TPA: hypothetical protein ZEAMMB73_155028 [Zea mays]
Length=238

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/153 (55%), Positives = 113/153 (74%), Gaps = 6/153 (4%)
 Frame = +3

Query  222  QFHSILFINIT-SKGTLQMIDLWYDWPNGRNFNIIQNQLG-NLVYDLEWNNGTSFIYTLD  395
            QFH+++F N+T S G LQ+IDL+YDWP GRN N+I++QL  + +YD+EW NGTS+ +   
Sbjct  45   QFHAVVFTNLTESGGRLQLIDLYYDWPRGRNLNLIRDQLSSDPLYDVEWTNGTSYFF---  101

Query  396  SSRECQVLDVPVGILRPDWLD-GANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYW  572
             S  C+ +  PVGIL PDWL  GA YLG++++DGF C++W KV+F+WYYE+V + RPV W
Sbjct  102  DSGSCRTMRFPVGILPPDWLAAGAVYLGREHVDGFDCHLWTKVDFVWYYEEVATGRPVRW  161

Query  573  AFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNN  671
             F+ GM  HVM+FEVG VL D  WQAP  CF+ 
Sbjct  162  NFFNGMQQHVMSFEVGGVLEDSKWQAPPRCFSG  194



>ref|XP_010525636.1| PREDICTED: uncharacterized protein At4g14100-like isoform X2 
[Tarenaya hassleriana]
Length=166

 Score =   174 bits (442),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 97/130 (75%), Gaps = 2/130 (2%)
 Frame = +3

Query  180  NAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLE  359
            N     P P  WPLQFH++LFIN  + G+LQ  DLWYDW NGRNFNIIQ QLG L YDLE
Sbjct  36   NCIHQTPKPQQWPLQFHAVLFIN--NSGSLQKTDLWYDWVNGRNFNIIQKQLGELTYDLE  93

Query  360  WNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYY  539
            WNNGTSF YTL  S +C+ +   VGILRP+WL+ A Y+G +++DGFLCN W KV+FIWYY
Sbjct  94   WNNGTSFYYTLGESGKCREITFEVGILRPNWLEDAEYVGVRHVDGFLCNAWTKVDFIWYY  153

Query  540  EDVVSKRPVY  569
            EDV SK P +
Sbjct  154  EDVESKLPAW  163



>ref|XP_004955718.1| PREDICTED: uncharacterized protein At4g14100-like [Setaria italica]
Length=242

 Score =   176 bits (447),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/167 (53%), Positives = 110/167 (66%), Gaps = 8/167 (5%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINIT-SKGTLQMIDLWYDWPNGRNFNIIQNQL-GNLVYDLEWNNG  371
            PVPTPWP QFH+++F N+T S G LQ+ID++YDWP GRN N+I NQL G+  Y++EW NG
Sbjct  49   PVPTPWPEQFHAVIFTNLTESGGRLQLIDIYYDWPKGRNLNLIHNQLSGDPTYNVEWANG  108

Query  372  TSFIYTLDSSRECQVLDVPVGILRPDWLD--GANYLGQKYMDGFLCNVWEKVEFIWYYED  545
            TS+++   S   C      VG+L PDW+   GA YLG+  +DGF C+VW    F  YYED
Sbjct  109  TSYLFDAAS---CWTFHFAVGLLPPDWMKARGAAYLGRGRLDGFDCHVWSNFLFARYYED  165

Query  546  VVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
              + RPV W F  GM  HVM+FEVG VL D  WQAP YCFN     +
Sbjct  166  AATGRPVGWNF-NGMQQHVMSFEVGGVLEDSKWQAPAYCFNGDNANT  211



>ref|XP_004959035.1| PREDICTED: uncharacterized protein At4g14100-like [Setaria italica]
Length=229

 Score =   176 bits (445),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 88/168 (52%), Positives = 113/168 (67%), Gaps = 9/168 (5%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINIT-SKGTLQMIDLWYDWPNGRNFNIIQNQL-GNLVYDLEWNNG  371
            PVPTPWP QFH+++F N+T S G LQ+ID++YDWP GRN N+I NQL G+  Y++EW NG
Sbjct  49   PVPTPWPEQFHAVIFTNLTESGGRLQLIDIYYDWPKGRNLNLIHNQLSGDPTYNVEWANG  108

Query  372  TSFIYTLDSSRECQVLDVPVGILRPDWLD--GANYLGQKYMDGFLCNVWEKVEFIWYYED  545
            TS+++   S   C      VG+L PDW+   GA YLG+  +DGF C+VW    F  YYED
Sbjct  109  TSYLFDAAS---CWTFHFAVGLLPPDWMKARGAAYLGRGRLDGFDCHVWSNFLFARYYED  165

Query  546  VVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPN-WQAPLYCFNNSTVES  686
              + RPV W F  GM+ HV++FE G VLSD   WQAP YCFN S  ++
Sbjct  166  AATGRPVGWNF-NGMLRHVLSFEAGAVLSDSGKWQAPAYCFNGSNADA  212



>ref|XP_002463512.1| hypothetical protein SORBIDRAFT_01g001110 [Sorghum bicolor]
 gb|EER90510.1| hypothetical protein SORBIDRAFT_01g001110 [Sorghum bicolor]
Length=223

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 105/156 (67%), Gaps = 6/156 (4%)
 Frame = +3

Query  213  WPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLV--YDLEWNNGTSFIY  386
            WP QFH+ L +     G + + DLWYDWP GRN +II+ QL      YD EWNNGTSF Y
Sbjct  39   WPPQFHATLVMEY--HGNMSVADLWYDWPGGRNLHIIRYQLAADAPYYDNEWNNGTSFFY  96

Query  387  TLDSSRECQVLDVPVGILRPDWLD-GANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRP  563
            T  + R C+   V VGILRPDWL  G+ YLG++   GF C+VW K +FI YYEDV +KRP
Sbjct  97   T-PARRTCRSAAVGVGILRPDWLRPGSVYLGRRDAGGFDCHVWAKADFITYYEDVKTKRP  155

Query  564  VYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNN  671
            V W FYTG +A+VM+FEVG VL D  WQAP YCF  
Sbjct  156  VKWVFYTGRIAYVMSFEVGAVLEDAAWQAPEYCFTK  191



>ref|NP_001144542.1| uncharacterized protein LOC100277542 precursor [Zea mays]
 gb|ACG41294.1| hypothetical protein [Zea mays]
 tpg|DAA52508.1| TPA: hypothetical protein ZEAMMB73_923100 [Zea mays]
Length=214

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 107/157 (68%), Gaps = 6/157 (4%)
 Frame = +3

Query  213  WPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLV--YDLEWNNGTSFIY  386
            WP QFH+ L ++    G + + DLWYDWP GRN ++I+ QL      YD EWNNGTSF Y
Sbjct  36   WPPQFHATLVMDY--HGNMSVADLWYDWPGGRNLHVIRYQLAADAPYYDNEWNNGTSFFY  93

Query  387  TLDSSRECQVLDVPVGILRPDWLD-GANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRP  563
            T  + R C+   V VGILRPDWL  GA YLG++   GF C+VW K +FI YYEDV +KRP
Sbjct  94   T-PALRTCRSAAVGVGILRPDWLRPGAVYLGRRDAGGFDCHVWAKADFITYYEDVNTKRP  152

Query  564  VYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            V W FYTG  A+VM+FEVG VL D  WQAP YCF N+
Sbjct  153  VKWVFYTGRTAYVMSFEVGAVLEDAAWQAPEYCFTNN  189



>ref|NP_001142641.1| uncharacterized protein LOC100274921 precursor [Zea mays]
 gb|ACG25708.1| hypothetical protein [Zea mays]
Length=216

 Score =   174 bits (441),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/163 (55%), Positives = 107/163 (66%), Gaps = 6/163 (4%)
 Frame = +3

Query  213  WPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLV--YDLEWNNGTSFIY  386
            WP QFH+ L ++      + + DLWYDWP GRN ++I+ QL      YD EWNNGTSF Y
Sbjct  36   WPPQFHATLVMDYHDN--MSVADLWYDWPGGRNLHVIRYQLAADAPYYDNEWNNGTSFFY  93

Query  387  TLDSSRECQVLDVPVGILRPDWLD-GANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRP  563
            T  + R C+   V VGILRPDWL  GA YLG++   GF C+VW K +FI YYEDV +KRP
Sbjct  94   T-PALRTCRSAAVGVGILRPDWLRPGAVYLGRRDAGGFDCHVWAKADFITYYEDVNTKRP  152

Query  564  VYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLG  692
            V W FYTG  A+VM+FEVG VL D  WQAP YCF N     LG
Sbjct  153  VKWVFYTGRTAYVMSFEVGAVLEDAAWQAPEYCFTNDNDGGLG  195



>gb|KHN09700.1| Hypothetical protein glysoja_011974, partial [Glycine soja]
Length=151

 Score =   170 bits (431),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 102/137 (74%), Gaps = 8/137 (6%)
 Frame = +3

Query  309  NFNIIQNQLGNLV-YDLEWNNGTSFIYTLD-SSRECQVLDVPVGILRPDWLDGANYLGQK  482
            NFNI+Q QL +LV YDL+WNNGTSFIYTL  S   CQVL   VGILRP+WL GA YLGQ+
Sbjct  2    NFNILQYQLDHLVTYDLQWNNGTSFIYTLHPSDPTCQVLHFQVGILRPNWLHGATYLGQQ  61

Query  483  YMDGFLCNVWEKVEFIWYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYC  662
            ++D FLCN WEKV+     EDV ++RPV W FY+G  AHVMTFEVG VL DPNWQAP+YC
Sbjct  62   HVDNFLCNAWEKVD-----EDVFTRRPVKWIFYSGYTAHVMTFEVGAVLEDPNWQAPVYC  116

Query  663  FNNSTVESLGSPIVSDA  713
            FN +  E   SPI+  A
Sbjct  117  FNENEKEK-NSPILRPA  132



>dbj|BAJ98762.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=219

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 102/152 (67%), Gaps = 7/152 (5%)
 Frame = +3

Query  222  QFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLV--YDLEWNNGTSFIYTLD  395
            QFH+ L ++   KG L + DLWYDWP GRN ++I+ QL      YD EWNNGTSF YT  
Sbjct  42   QFHAKLLMDY--KGNLSLADLWYDWPGGRNLHVIRYQLAADAPYYDAEWNNGTSFFYT-P  98

Query  396  SSRECQVLDVPVGILRPDWLD-GANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYW  572
            + R C+   V VGILRPDWL  GA YLG+   DGF C+VW K +FI YYED  ++RPV W
Sbjct  99   ARRACRSAAVGVGILRPDWLAPGAAYLGRAQADGFDCHVWAKADFITYYEDAQTRRPVKW  158

Query  573  AFYTGMVAHVMTFEVGKVLSD-PNWQAPLYCF  665
             FYTG  AHVM+FE G VL D   WQAP YCF
Sbjct  159  VFYTGRTAHVMSFEPGAVLEDAAQWQAPDYCF  190



>dbj|BAJ85338.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=219

 Score =   172 bits (436),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 102/152 (67%), Gaps = 7/152 (5%)
 Frame = +3

Query  222  QFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLV--YDLEWNNGTSFIYTLD  395
            QFH+ L ++   KG L + DLWYDWP GRN ++I+ QL      YD EWNNGTSF YT  
Sbjct  42   QFHAKLLMDY--KGNLSLADLWYDWPGGRNLHVIRYQLAADAPYYDAEWNNGTSFFYT-P  98

Query  396  SSRECQVLDVPVGILRPDWLD-GANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYW  572
            + R C+   V VGILRPDWL  GA YLG+   DGF C+VW K +FI YYED  ++RPV W
Sbjct  99   ARRACRSAAVGVGILRPDWLAPGAAYLGRAQADGFDCHVWAKADFITYYEDAQTRRPVKW  158

Query  573  AFYTGMVAHVMTFEVGKVLSD-PNWQAPLYCF  665
             FYTG  AHVM+FE G VL D   WQAP YCF
Sbjct  159  VFYTGRTAHVMSFEPGAVLEDAAQWQAPDYCF  190



>ref|XP_006581827.1| PREDICTED: uncharacterized protein At4g14100-like, partial [Glycine 
max]
Length=152

 Score =   169 bits (428),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 103/137 (75%), Gaps = 8/137 (6%)
 Frame = +3

Query  309  NFNIIQNQLGNLV-YDLEWNNGTSFIYTLD-SSRECQVLDVPVGILRPDWLDGANYLGQK  482
            NFNI+Q QL +LV YDL+WNNGTSFIYTL  S   CQVL   VGILRP+WL GA YLGQ+
Sbjct  3    NFNILQYQLDHLVTYDLQWNNGTSFIYTLHPSDPTCQVLHFQVGILRPNWLLGATYLGQQ  62

Query  483  YMDGFLCNVWEKVEFIWYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYC  662
            ++D FLCNVWEKV+     EDV+++RPV W FY+G  AHVMT EVG VL DPNWQAP+YC
Sbjct  63   HVDNFLCNVWEKVD-----EDVLTRRPVKWIFYSGYTAHVMTLEVGAVLEDPNWQAPVYC  117

Query  663  FNNSTVESLGSPIVSDA  713
            FN +  E   SPI+  A
Sbjct  118  FNENEKEK-NSPILRPA  133



>gb|KDO62434.1| hypothetical protein CISIN_1g044660mg [Citrus sinensis]
Length=159

 Score =   166 bits (419),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 98/127 (77%), Gaps = 1/127 (1%)
 Frame = +3

Query  198  PVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTS  377
            PVPTPWP +FH++ + N++S G LQ+ D WYDWP GRN  IIQ QL +L+Y++EWNNGTS
Sbjct  26   PVPTPWPERFHALTYKNLSSDG-LQIADQWYDWPRGRNVYIIQKQLSDLLYNVEWNNGTS  84

Query  378  FIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSK  557
            F YTL  +  C V+   +GI RPD+LD A YLG ++ DGFLCN+WEK++FIWYYEDV +K
Sbjct  85   FYYTLGENGTCDVVHYGIGIPRPDFLDEATYLGTRFTDGFLCNLWEKLDFIWYYEDVQTK  144

Query  558  RPVYWAF  578
            +P+ W F
Sbjct  145  KPIRWDF  151



>ref|XP_003559144.2| PREDICTED: uncharacterized protein At4g14100-like [Brachypodium 
distachyon]
Length=224

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 94/174 (54%), Positives = 112/174 (64%), Gaps = 13/174 (7%)
 Frame = +3

Query  174  NPNAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLG----N  341
             P  G P+P PTPWP QFH+ L +  T +G L + DLWYDWP GRN ++I+ QL     +
Sbjct  22   QPTGGSPDPTPTPWPPQFHAKLLM--THRGNLSLADLWYDWPGGRNLHVIRYQLAADSES  79

Query  342  LVYDLEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDG----ANYLGQ--KYMDGFLC  503
              YD EWNNGTSF YT  + R C+   V VGILRPDWL      A YLG+      GF C
Sbjct  80   PYYDAEWNNGTSFFYT-PARRACRSAQVGVGILRPDWLSSPAGDAAYLGRFPDVDGGFDC  138

Query  504  NVWEKVEFIWYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCF  665
            +VW K +FI YYE+V ++RPV W FYTG  AHVM+FE G VL D  WQAP YCF
Sbjct  139  HVWSKADFITYYEEVGTRRPVKWVFYTGRTAHVMSFEAGAVLEDAEWQAPEYCF  192



>ref|NP_001051909.1| Os03g0850800 [Oryza sativa Japonica Group]
 gb|AAO20053.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99922.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13823.1| Os03g0850800 [Oryza sativa Japonica Group]
 gb|EAY92603.1| hypothetical protein OsI_14345 [Oryza sativa Indica Group]
 gb|EAZ29320.1| hypothetical protein OsJ_13384 [Oryza sativa Japonica Group]
Length=214

 Score =   166 bits (419),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/154 (54%), Positives = 100/154 (65%), Gaps = 6/154 (4%)
 Frame = +3

Query  222  QFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLG--NLVYDLEWNNGTSFIYTLD  395
            QFH+ L +     G L + DLWYDWP GRN ++I+ QL      YD EWNNGTSF YT  
Sbjct  35   QFHAKLLMEF--HGNLSLADLWYDWPGGRNLHVIRYQLAADEPFYDNEWNNGTSFFYT-P  91

Query  396  SSRECQVLDVPVGILRPDWL-DGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYW  572
            + R C+   V VGIL P+WL  G+ YLG+   DGF C+VW K +FI YYED ++KRPV W
Sbjct  92   ARRACRSAAVGVGILPPNWLVPGSVYLGRHPADGFDCHVWAKADFITYYEDTLTKRPVKW  151

Query  573  AFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
             FYTG  +HVM+FE G VL D  WQAP YCF   
Sbjct  152  VFYTGRTSHVMSFEEGAVLEDAEWQAPEYCFGKG  185



>ref|XP_006650901.1| PREDICTED: uncharacterized protein At4g14100-like [Oryza brachyantha]
Length=193

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/166 (50%), Positives = 105/166 (63%), Gaps = 6/166 (4%)
 Frame = +3

Query  222  QFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLV--YDLEWNNGTSFIYTLD  395
            QFH+ L ++    G L + DLWYDWP GRN ++I+ QL      YD EWNNGTSF YT  
Sbjct  14   QFHAKLLMDF--HGNLSLADLWYDWPGGRNLHVIRYQLAADAPFYDNEWNNGTSFFYT-P  70

Query  396  SSRECQVLDVPVGILRPDWL-DGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYW  572
            + R C+   V VGIL P+WL  G+ YLG++   G  C+V+ K +FI YYEDV +KRPV W
Sbjct  71   ARRTCRSAAVGVGILPPNWLVQGSVYLGRQSTGGVDCHVFAKADFITYYEDVRTKRPVKW  130

Query  573  AFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSD  710
             FYTG  +HVM FE G VL D  WQAP YCF      S  + ++S+
Sbjct  131  VFYTGKTSHVMAFEEGAVLEDAEWQAPEYCFGKGDETSSNNALISE  176



>dbj|BAJ91045.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04186.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=225

 Score =   160 bits (405),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 86/190 (45%), Positives = 119/190 (63%), Gaps = 14/190 (7%)
 Frame = +3

Query  204  PTPWPLQFHSILFINITSKGT------LQMIDLWYDWPNGRNFNIIQNQL-GNLVYDLEW  362
            P PWP QFH++LF N+T+         L++ DL+YDWP  RN N+I++QL G+ +YD+EW
Sbjct  29   PAPWPEQFHAVLFTNLTNVSVASTGPPLRLHDLYYDWPRRRNLNLIRHQLSGDPLYDVEW  88

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            NNGT+F +    +  C+ L V VG+L P WL GA YLG++   G  C+VW K  FI YYE
Sbjct  89   NNGTTFYF---DTATCRTLQVAVGVLPPGWLSGAAYLGRETTGGIDCHVWGKAGFIVYYE  145

Query  543  DVVSKRPVYWAFY--TGMVAHVMTFEVGKVLSDPN-WQAPLYCF-NNSTVESLGSPIVSD  710
            D +++RPV W F   TG+   VM+FEVG VL D + WQAP +CF +++  E      VS+
Sbjct  146  DALTRRPVRWNFLDVTGIQQFVMSFEVGVVLEDDDQWQAPAHCFLDDAANEDDDHIAVSN  205

Query  711  AKPLRLGRAF  740
               +   R F
Sbjct  206  GITMDAARLF  215



>ref|XP_010102991.1| hypothetical protein L484_022870 [Morus notabilis]
 gb|EXB94558.1| hypothetical protein L484_022870 [Morus notabilis]
Length=323

 Score =   162 bits (410),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 106/179 (59%), Gaps = 18/179 (10%)
 Frame = +3

Query  171  SNPNAGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLG-NLV  347
            S+P      P+PT WP QFH++LF+N T  G L + DLWYDWP GRN NI QNQL   L+
Sbjct  30   SSPPPAAENPIPTRWPEQFHALLFMNFTPTGELHLADLWYDWPRGRNVNIHQNQLAKKLL  89

Query  348  YDLEWNNGTSFIYTL-----DSSRECQVLDVPVGILRPDWL-DGANYLGQKYMDGFLCNV  509
            + +EWNNGTSF YTL          C V    VGI RPD+L +GA YLG +  DGFLC+V
Sbjct  90   FAVEWNNGTSFYYTLGNGGDGDGGTCDVTQFEVGIPRPDFLAEGAEYLGTQVTDGFLCHV  149

Query  510  WEKVEFIWYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVES  686
            WEK +FIWYYEDV+++RPV +            F  G  L   N +    CF  + V +
Sbjct  150  WEKADFIWYYEDVLTRRPVRF-----------DFSDGGDLGGANGRGEKKCFRENVVRA  197



>ref|XP_009596906.1| PREDICTED: uncharacterized protein At4g14100-like isoform X2 
[Nicotiana tomentosiformis]
Length=178

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 94/166 (57%), Gaps = 37/166 (22%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGT  374
            +P+P PWP QFH+I  +N T    L+ +DLWYDWPN R  +I Q QLG  +Y +EW NG 
Sbjct  29   DPIPEPWPHQFHAITIMNYTQ--GLRKVDLWYDWPNKRYMHINQYQLGKTLYGVEWQNG-  85

Query  375  SFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
                                              QKY DGFLCNVW+KV F+ YYED V+
Sbjct  86   ----------------------------------QKYKDGFLCNVWDKVGFLRYYEDAVT  111

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLG  692
            K PVYW FY G+V H+MTFEVGKVL D  WQAP YCF     ES+ 
Sbjct  112  KIPVYWHFYDGLVEHIMTFEVGKVLEDSKWQAPAYCFKEVEKESIS  157



>emb|CDM81562.1| unnamed protein product [Triticum aestivum]
Length=226

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 83/171 (49%), Positives = 112/171 (65%), Gaps = 15/171 (9%)
 Frame = +3

Query  204  PTPWPLQFHSILFINITSKGT------LQMIDLWYDWPNGRNFNIIQNQL-GNLVYDLEW  362
            P PWP QFH++LF N+T+         L++ DL+YDWP  RN N+I++QL G+ +YD+EW
Sbjct  30   PAPWPEQFHAVLFTNLTNVSIASTGPPLRLHDLYYDWPRRRNLNLIRHQLSGDPLYDVEW  89

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWL--DGANYLGQKYMDGFLCNVWEKVEFIWY  536
            NNGT+F +    S  C+   VPVG+L P WL   GA YLG++   G  C+VW K +FI Y
Sbjct  90   NNGTTFYF---DSATCRTQQVPVGVLPPGWLADGGAVYLGRETTGGIDCHVWGKADFIVY  146

Query  537  YEDVVSKRPVYWAFY--TGMVAHVMTFEVGKVLSDPN-WQAPLYCFNNSTV  680
            YED ++ RPV+W F   TG+   VM+FEVG VL D + WQAP +CF + T 
Sbjct  147  YEDALTGRPVHWNFLDVTGLQQFVMSFEVGVVLEDDDQWQAPAHCFLDETA  197



>emb|CDM81558.1| unnamed protein product [Triticum aestivum]
Length=229

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/197 (47%), Positives = 119/197 (60%), Gaps = 21/197 (11%)
 Frame = +3

Query  204  PTPWPLQFHSILFINIT------SKGTLQMIDLWYDWPNGRNFNIIQNQLG-NLVYDLEW  362
            P PWP QFH++LF N+T      +   L++ DL+YDWP  RN N+I+ QL  + +YD+EW
Sbjct  29   PAPWPEQFHAVLFTNLTNVSFASTSPPLRLHDLYYDWPRRRNLNLIRYQLSRDPLYDVEW  88

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWL--DGANYLGQKYMDGFLCNVWEKVEFIWY  536
            NNGTSF +    S  C+ L  PVG+LRP W+   GA YLG++   G  C+VW K +FI Y
Sbjct  89   NNGTSFYF---DSATCRTLQFPVGMLRPGWIAEGGAVYLGRETTGGIDCHVWGKADFIVY  145

Query  537  YEDVVSKRPVYWAF--YTGMVAHVMTFEVGKVLS-DPNWQAPLYCF----NNSTVESLGS  695
            YED +++RPV W F   TG+   VM+FEVG VL  D  WQAP +CF     N T E    
Sbjct  146  YEDALTRRPVRWNFIDVTGIEQFVMSFEVGVVLEDDSQWQAPAHCFLDDAANKTNEHDDH  205

Query  696  PIVSDA--KPLRLGRAF  740
              VS+     LRL R F
Sbjct  206  VAVSNGVMDALRLFRKF  222



>tpg|DAA59888.1| TPA: hypothetical protein ZEAMMB73_634735 [Zea mays]
Length=213

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 109/167 (65%), Gaps = 11/167 (7%)
 Frame = +3

Query  192  PEPVPTPWPLQFHSILFINITSKGT-LQMIDLWYDWPNGRNFNIIQNQLG---NLVYDLE  359
            P   P PWP QFH+++  N++++G  LQ+IDL+YDWP GR+ NI+++QL       +++E
Sbjct  40   PATTP-PWPDQFHAVVVTNLSARGGGLQLIDLYYDWPRGRDLNIVRDQLSGERRWSWNVE  98

Query  360  WNNGTSFIYTLDSSRECQVLDVPVGILRPDW-LDGANYLGQKYMDGFLCNVWEKVEFIWY  536
            W+NGT+F++    S  C+     VG+L PDW   GA YLG+  +DGF C+VW    F  Y
Sbjct  99   WSNGTAFLF---DSASCRTFQFAVGLLPPDWKARGAAYLGRDRVDGFDCHVWSNFVFARY  155

Query  537  YEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPN-WQAPLYCFNNS  674
            YEDV + RPV W F  G+  HV++FE G VL D + WQAP YCF N+
Sbjct  156  YEDVATGRPVSWNF-NGLQRHVLSFEAGAVLQDSSKWQAPAYCFTNT  201



>ref|NP_001143659.1| uncharacterized protein LOC100276382 precursor [Zea mays]
 gb|ACG33824.1| hypothetical protein [Zea mays]
Length=213

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 109/167 (65%), Gaps = 11/167 (7%)
 Frame = +3

Query  192  PEPVPTPWPLQFHSILFINITSKGT-LQMIDLWYDWPNGRNFNIIQNQLG---NLVYDLE  359
            P   P PWP QFH+++  N++++G  LQ+IDL+YDWP GR+ NI+++QL       +++E
Sbjct  40   PATTP-PWPDQFHAVVVTNLSARGGGLQLIDLYYDWPRGRDLNIVRDQLSGERRWSWNVE  98

Query  360  WNNGTSFIYTLDSSRECQVLDVPVGILRPDW-LDGANYLGQKYMDGFLCNVWEKVEFIWY  536
            W+NGT+F++    S  C+     VG+L PDW   GA YLG+  +DGF C+VW    F  Y
Sbjct  99   WSNGTAFLF---DSASCRTFQFAVGLLPPDWKARGAAYLGRDRVDGFDCHVWSNFVFARY  155

Query  537  YEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPN-WQAPLYCFNNS  674
            YEDV + RPV W F  G+  HV++FE G VL D + WQAP YCF N+
Sbjct  156  YEDVATGRPVIWNF-NGLQRHVLSFEAGAVLQDSSKWQAPAYCFTNT  201



>ref|XP_008651206.1| PREDICTED: uncharacterized protein LOC100276382 isoform X1 [Zea 
mays]
Length=234

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/161 (47%), Positives = 107/161 (66%), Gaps = 10/161 (6%)
 Frame = +3

Query  210  PWPLQFHSILFINITSKGT-LQMIDLWYDWPNGRNFNIIQNQLG---NLVYDLEWNNGTS  377
            PWP QFH+++  N++++G  LQ+IDL+YDWP GR+ NI+++QL       +++EW+NGT+
Sbjct  66   PWPDQFHAVVVTNLSARGGGLQLIDLYYDWPRGRDLNIVRDQLSGERRWSWNVEWSNGTA  125

Query  378  FIYTLDSSRECQVLDVPVGILRPDW-LDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
            F++    S  C+     VG+L PDW   GA YLG+  +DGF C+VW    F  YYEDV +
Sbjct  126  FLF---DSASCRTFQFAVGLLPPDWKARGAAYLGRDRVDGFDCHVWSNFVFARYYEDVAT  182

Query  555  KRPVYWAFYTGMVAHVMTFEVGKVLSDPN-WQAPLYCFNNS  674
             RPV W F  G+  HV++FE G VL D + WQAP YCF N+
Sbjct  183  GRPVSWNF-NGLQRHVLSFEAGAVLQDSSKWQAPAYCFTNT  222



>ref|XP_002459482.1| hypothetical protein SORBIDRAFT_02g005360 [Sorghum bicolor]
 gb|EER96003.1| hypothetical protein SORBIDRAFT_02g005360 [Sorghum bicolor]
Length=222

 Score =   152 bits (384),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/185 (44%), Positives = 108/185 (58%), Gaps = 20/185 (11%)
 Frame = +3

Query  192  PEPVPT----PWPLQFHSILFINITSKG-TLQMIDLWYDWPNGRNFNIIQNQLGNL--VY  350
            P PVP     PWP Q+H+++  N T++G  LQ ID++YDWP GR  N+I++QLG+   + 
Sbjct  39   PPPVPATTSPPWPEQYHAVVITNQTTRGGRLQQIDIYYDWPRGRALNVIRDQLGSGEPLR  98

Query  351  DLEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWLD-----GANYLGQKYMDGFLCNVWE  515
            D+EW NGTSF++    S  C     PVG+L PDW       GA YLG+  +DGF C+VW 
Sbjct  99   DVEWTNGTSFLF---DSASCTTFQYPVGLLPPDWKKARGGGGAAYLGRDRVDGFDCHVWS  155

Query  516  KVEFIWYYEDVVSKRPVYWAFY---TGMVAHVMTFEVGKVLSDPN--WQAPLYCFNNSTV  680
               F  YYED  + RPV W      T M  HV++FEVG V  D +  WQAP YCFN    
Sbjct  156  NSVFARYYEDAATGRPVSWIVVNNGTVMQRHVLSFEVGGVPQDDDTKWQAPPYCFNGGRA  215

Query  681  ESLGS  695
            +   +
Sbjct  216  DGAAA  220



>ref|XP_003560226.1| PREDICTED: uncharacterized protein At4g14100-like [Brachypodium 
distachyon]
Length=258

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 79/163 (48%), Positives = 107/163 (66%), Gaps = 15/163 (9%)
 Frame = +3

Query  213  WPLQFHSILFINITSKGT------LQMIDLWYDWPNGRNFNIIQNQL-GNLVYDLEWNNG  371
            WP QFH++LF N+T+  T      L++ DL+YDWP  RN N++++QL  + +YD+EW+NG
Sbjct  63   WPDQFHAVLFTNLTNVSTASTGPPLRLTDLYYDWPRRRNLNLVRHQLSADPLYDVEWDNG  122

Query  372  TSFIYTLDSSRECQVLDVPVGILRPDWLD--GANYLGQKYMDGFLCNVWEKVEFIWYYED  545
            T+F +    +  C+    PVG+LRP WL   GA YLG++   G  C+VW K  FI YYED
Sbjct  123  TTFYF---DTATCRTEHFPVGVLRPGWLSDGGAVYLGRQSTGGIECHVWGKAGFIVYYED  179

Query  546  VVSKRPVYWAF--YTGMVAHVMTFEVGKVLS-DPNWQAPLYCF  665
            VV++RPV W F   TG+   VM+FEVG VL  D  WQAP +CF
Sbjct  180  VVTRRPVRWNFIDVTGIEQFVMSFEVGVVLEDDAQWQAPAHCF  222



>gb|EMT32711.1| hypothetical protein F775_26165 [Aegilops tauschii]
Length=226

 Score =   152 bits (383),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 108/173 (62%), Gaps = 15/173 (9%)
 Frame = +3

Query  204  PTPWPLQFHSILFINITSKGT------LQMIDLWYDWPNGRNFNIIQNQL-GNLVYDLEW  362
            P PWP QFH++LF N+T+         L+  DL+YDWP  RN N+I++QL G+ +YD+EW
Sbjct  30   PAPWPEQFHAVLFTNLTNVSIASTGPPLRPHDLYYDWPRRRNLNLIRHQLSGDPLYDVEW  89

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWL--DGANYLGQKYMDGFLCNVWEKVEFIWY  536
            NNGT+F +    S  C+   VPVG+L P WL   GA YLG++   G  C VW K +FI Y
Sbjct  90   NNGTTFYF---DSATCRTQQVPVGVLPPGWLADGGAVYLGRETTGGIDCRVWGKADFILY  146

Query  537  YEDVVSKRPVYWAFY--TGMVAHVMTFEVGKVLSDPN-WQAPLYCFNNSTVES  686
            YED ++ RPV W F   TG+   VM+FEVG VL D + WQAP +CF +     
Sbjct  147  YEDALTGRPVRWNFLDVTGLQQFVMSFEVGVVLEDDDQWQAPAHCFLDEAAHG  199



>ref|XP_008653006.1| PREDICTED: uncharacterized protein At4g14100-like [Zea mays]
 tpg|DAA62522.1| TPA: hypothetical protein ZEAMMB73_428240 [Zea mays]
Length=235

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/198 (43%), Positives = 118/198 (60%), Gaps = 22/198 (11%)
 Frame = +3

Query  189  DPEPVPTPWPLQFHSILFINIT-----SKGT-LQMIDLWYDWPNGRNFNIIQNQL-GNLV  347
            D  P PTPWP +FH++LF N+T     S G  L++ DL+YDWP  RN N++++QL  + +
Sbjct  32   DGHPSPTPWPERFHAVLFTNLTNYTEASTGPPLRVTDLYYDWPRRRNLNLVRHQLSADPL  91

Query  348  YDLEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDG--ANYLGQKYMDGFLCNVWEKV  521
            YD+EWNNGT F +    S+ C+V   PVG+L P WL G  A Y+G++   G  C+VW K 
Sbjct  92   YDVEWNNGTGFYF---DSKACRVEQFPVGVLPPWWLSGGGAEYVGRRVAGGIDCHVWGKA  148

Query  522  EFIWYYEDVVSKRPVYWAF--YTGMVAHVMTFEVGKVLS-DPNWQAPLYCF-------NN  671
             FI+YYE+  + RPV W F   TG+   VM+FE G  L  D  WQAP YCF        +
Sbjct  149  GFIFYYEEARTGRPVRWDFVDVTGIQQFVMSFEPGAALEDDAQWQAPAYCFPDDDDAARS  208

Query  672  STVESLGSPIVSDAKPLR  725
            S  E  G  + + ++ LR
Sbjct  209  SGEEEAGVGLEAASRLLR  226



>gb|EMS47301.1| hypothetical protein TRIUR3_02605 [Triticum urartu]
Length=200

 Score =   150 bits (380),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/122 (57%), Positives = 93/122 (76%), Gaps = 5/122 (4%)
 Frame = +3

Query  222  QFHSILFINIT-SKGTLQMIDLWYDWPNGRNFNIIQNQL-GNLVYDLEWNNGTSFIYTLD  395
            QFH+++F N+T S G LQ+IDL+YDWP GRN N+I+NQL G+  YD+EW NGTS+I+   
Sbjct  51   QFHAVMFTNLTESGGRLQLIDLYYDWPRGRNLNLIRNQLSGDPTYDVEWTNGTSYIF---  107

Query  396  SSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYWA  575
             S  C+ +  PVG+L PDWL GA YLG++  DGF C++W KV+F+WYYEDV++ RPV W 
Sbjct  108  DSASCRTIRFPVGVLPPDWLHGAVYLGRETTDGFDCHLWTKVDFVWYYEDVLTHRPVRWN  167

Query  576  FY  581
            F+
Sbjct  168  FF  169



>ref|NP_001144667.1| uncharacterized protein LOC100277692 precursor [Zea mays]
 gb|ACG42191.1| hypothetical protein [Zea mays]
Length=238

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 83/187 (44%), Positives = 112/187 (60%), Gaps = 17/187 (9%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINIT-----SKGT-LQMIDLWYDWPNGRNFNIIQNQL-GNLVYD  353
             P PTPWP +FH++LF N+T     S G  L++ DL+YDWP  RN N++++QL  + +YD
Sbjct  37   HPSPTPWPERFHAVLFTNLTNYTEASTGPPLRVTDLYYDWPRRRNLNLVRHQLSADPLYD  96

Query  354  LEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDG--ANYLGQKYMDGFLCNVWEKVEF  527
            +EWNNGT F +    S+ C+V   PVG+L P WL G  A Y+G++   G  C+VW K  F
Sbjct  97   VEWNNGTGFYF---DSKACRVEQFPVGVLPPWWLSGGGAEYVGRRVAGGIDCHVWGKAGF  153

Query  528  IWYYEDVVSKRPVYWAF--YTGMVAHVMTFEVGKVLS-DPNWQAPLYCF--NNSTVESLG  692
            I+YYE+  + RPV W F   TG+   VM+FE G  L  D  WQAP YCF  ++    S G
Sbjct  154  IFYYEEARTGRPVRWDFVDVTGIQQFVMSFEPGAALEDDAQWQAPAYCFPDDDDAARSSG  213

Query  693  SPIVSDA  713
                 D 
Sbjct  214  EEEAGDG  220



>ref|XP_010451539.1| PREDICTED: uncharacterized protein At4g14100-like [Camelina sativa]
Length=156

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 91/164 (55%), Gaps = 52/164 (32%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEW  362
            A   EPVPTPWP QFH+++F+N                                      
Sbjct  23   ATADEPVPTPWPHQFHALMFMN--------------------------------------  44

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
                   Y+ D S +       VGILRP+WLDGA YLGQK + GFLCNVWEKV+FIWYYE
Sbjct  45   -------YSGDLSHK-------VGILRPNWLDGAKYLGQKNVSGFLCNVWEKVDFIWYYE  90

Query  543  DVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNS  674
            DV +KRPV W FYTG  AH+MTFEVG VL D  WQAP+YCFN  
Sbjct  91   DVETKRPVQWIFYTGREAHLMTFEVGAVLEDEKWQAPVYCFNKE  134



>ref|XP_004955717.1| PREDICTED: uncharacterized protein At4g14100-like [Setaria italica]
Length=210

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 78/163 (48%), Positives = 102/163 (63%), Gaps = 12/163 (7%)
 Frame = +3

Query  222  QFHSILFINITSK-GTLQMIDLWYDWPNGRNFNIIQNQLGNL----VYDLEWNNGTSFIY  386
            QFH+++  N+TSK G LQ+ID +YDWP GR+ N+I++QL       + ++EW NGTSF++
Sbjct  35   QFHAVVITNLTSKSGRLQVIDSYYDWPRGRSVNVIRDQLSAAGEPPLRNVEWANGTSFLF  94

Query  387  TLDSSRECQVLDVPVGILRPDW--LDGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKR  560
               S   C      VG+L PDW    GA YLG+  +DGF C+VW    F  YYEDV + R
Sbjct  95   DAAS---CWTFHFAVGLLPPDWKKARGAAYLGRGRLDGFDCHVWSNFLFARYYEDVATGR  151

Query  561  PVYWAFYTGMVAHVMTFEVGKVLSDP-NWQAPLYCFNNSTVES  686
            PV W F  GM  HV++FE G VL D   WQAP YCFN S  ++
Sbjct  152  PVGWNF-NGMERHVLSFEAGAVLPDSGKWQAPAYCFNGSNADA  193



>ref|XP_004957672.1| PREDICTED: uncharacterized protein At4g14100-like [Setaria italica]
Length=243

 Score =   148 bits (373),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 106/172 (62%), Gaps = 14/172 (8%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGT------LQMIDLWYDWPNGRNFNIIQNQL-GN  341
            +G P P PTPWP +FH++LF N+T+  +      L++ DL+YDWP  RN N++++QL  +
Sbjct  29   SGLPLPSPTPWPERFHAVLFTNLTNYSSASTGPPLRITDLYYDWPRRRNLNLVRHQLSAD  88

Query  342  LVYDLEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWLDG--ANYLGQKYMDGFLCNVWE  515
             +YD+EWNNGT+F +    S  C+V+  PVG+L P WL G  A Y G+    G  C+VW 
Sbjct  89   PLYDVEWNNGTAFYF---DSSTCRVVRFPVGVLPPWWLSGGGAEYAGRAVSGGIDCHVWG  145

Query  516  KVEFIWYYEDVVSKRPVYWAFY--TGMVAHVMTFEVGKVLSDPNWQAPLYCF  665
            K   I YYE+  + RPV W F    G+  +V+ FE G  L D  WQAP +CF
Sbjct  146  KAGLIVYYEEAATGRPVRWDFLDDDGIKQYVIRFEPGVALEDAQWQAPAHCF  197



>ref|XP_002459480.1| hypothetical protein SORBIDRAFT_02g005350 [Sorghum bicolor]
 gb|EER96001.1| hypothetical protein SORBIDRAFT_02g005350 [Sorghum bicolor]
Length=227

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 102/158 (65%), Gaps = 11/158 (7%)
 Frame = +3

Query  222  QFHSILFINITSKGT---LQMIDLWYDWPNGRNFNIIQNQL-GNLVYDLEWNNGTSFIYT  389
            QFH+++  N+++ G    LQ+IDL+YDWP GR+ NI+++QL G   +++EW NGT+F++ 
Sbjct  61   QFHAVVITNLSAHGGGGGLQLIDLYYDWPRGRDLNIVRDQLSGEPQWNVEWTNGTAFLFD  120

Query  390  LDSSRECQVLDVPVGILRPDWLD--GANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRP  563
              S   C      VG+L PDW    GA YLG+  +DGF C+VW    F  YYEDV + RP
Sbjct  121  AAS---CATFQFAVGLLPPDWKSRAGAAYLGRDRVDGFDCHVWSNFVFARYYEDVATGRP  177

Query  564  VYWAFYTGMVAHVMTFEVGKVLSDPN-WQAPLYCFNNS  674
            V W F  GM  HV++FE G VL D + WQAP YCF +S
Sbjct  178  VSWTF-NGMQRHVLSFEAGAVLQDSSKWQAPAYCFIDS  214



>ref|XP_006658553.1| PREDICTED: uncharacterized protein LOC102715958 [Oryza brachyantha]
Length=387

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 72/170 (42%), Positives = 110/170 (65%), Gaps = 16/170 (9%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGT------LQMIDLWYDWPNGRNFNIIQNQL-GNLVYD  353
             P P  WP +FH+ LF N+T+         L++++L+YDWP  RN N++++QL  + +YD
Sbjct  181  HPTPARWPDRFHATLFANLTNASMASTGPPLRIMELYYDWPRRRNLNVVRHQLSADPLYD  240

Query  354  LEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWL---DGANYLGQKYMDGFLCNVWEKVE  524
            +EW+NGT+F +    SR C+    PVG+LRPDWL   +G  YLG++   G  C+VW+K+ 
Sbjct  241  VEWDNGTTFYF---DSRSCRAEQFPVGVLRPDWLADGEGVVYLGRQVTGGIECDVWDKLG  297

Query  525  FIWYYEDVVSKRPVYWAFY--TGMVAHVMTFEVG-KVLSDPNWQAPLYCF  665
            F+ Y+++V + RPV W F   TG+   VM+FE+G ++  D  WQAP +CF
Sbjct  298  FVVYFQEVATGRPVRWNFLDVTGIQQFVMSFEIGVEMPEDSEWQAPAHCF  347



>gb|EAZ03833.1| hypothetical protein OsI_25962 [Oryza sativa Indica Group]
Length=254

 Score =   145 bits (367),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/177 (45%), Positives = 107/177 (60%), Gaps = 18/177 (10%)
 Frame = +3

Query  180  NAGDPEPVPTPWPLQFHSILFINITSKGT------LQMIDLWYDWPNGRNFNIIQNQLG-  338
            NA  PEP P  WP  FH+ LF N+T+         L++ DL+YDWP  RN N+I+ QL  
Sbjct  31   NAPPPEPKPARWPDVFHARLFTNLTNHSAASTGPPLRVADLYYDWPRRRNLNLIRYQLAA  90

Query  339  --NLVYDLEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWL---DGANYLGQKYMDGFLC  503
              + +YD+EW+NGT+F +    SR C+    PVG+LRP WL    G  YLG+    G  C
Sbjct  91   ADDPLYDVEWDNGTTFYF---DSRSCRTERFPVGVLRPGWLADGGGVVYLGRWRTGGIEC  147

Query  504  NVWEKVEFIWYYEDVVSKRPVYWAFY--TGMVAHVMTFEVGKVLS-DPNWQAPLYCF  665
            +VW+K+ F+ YY++V + RPV W F   TG+   VM+FEVG  L  D  WQAP +CF
Sbjct  148  DVWDKLGFVVYYQEVATGRPVRWNFLDKTGIQQFVMSFEVGVTLEDDSQWQAPAHCF  204



>gb|ACN27168.1| unknown [Zea mays]
Length=182

 Score =   141 bits (356),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 96/128 (75%), Gaps = 6/128 (5%)
 Frame = +3

Query  222  QFHSILFINIT-SKGTLQMIDLWYDWPNGRNFNIIQNQLG-NLVYDLEWNNGTSFIYTLD  395
            QFH+++F N+T S G LQ+IDL+YDWP GRN N+I++QL  + +YD+EW NGTS+ +   
Sbjct  45   QFHAVVFTNLTESGGRLQLIDLYYDWPRGRNLNLIRDQLSSDPLYDVEWTNGTSYFF---  101

Query  396  SSRECQVLDVPVGILRPDWLD-GANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYW  572
             S  C+ +  PVGIL PDWL  GA YLG++++DGF C++W KV+F+WYYE+V + RPV W
Sbjct  102  DSGSCRTMRFPVGILPPDWLAAGAVYLGREHVDGFDCHLWTKVDFVWYYEEVATGRPVRW  161

Query  573  AFYTGMVA  596
             F+ G ++
Sbjct  162  NFFNGSIS  169



>ref|NP_001059620.1| Os07g0475000 [Oryza sativa Japonica Group]
 dbj|BAF21534.1| Os07g0475000, partial [Oryza sativa Japonica Group]
Length=246

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 105/173 (61%), Gaps = 18/173 (10%)
 Frame = +3

Query  192  PEPVPTPWPLQFHSILFINITSKGT------LQMIDLWYDWPNGRNFNIIQNQLG---NL  344
            PEP P  WP  FH+ LF N+T+         L++ DL+YDW   RN N+I+ QL    + 
Sbjct  27   PEPKPARWPDVFHARLFTNLTNHSAASTGPPLRVADLYYDWSRRRNLNLIRYQLAAADDP  86

Query  345  VYDLEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWL---DGANYLGQKYMDGFLCNVWE  515
            +YD+EW+NGT+F +    SR C+    PVG+LRP WL    G  YLG+    G  C+VW+
Sbjct  87   LYDVEWDNGTTFYF---DSRSCRTERFPVGVLRPGWLADGGGVVYLGRWRTGGIECDVWD  143

Query  516  KVEFIWYYEDVVSKRPVYWAFY--TGMVAHVMTFEVGKVLSDPN-WQAPLYCF  665
            K+ F+ YY++V + RPV W F   TG+   VM+FEVG  L D + WQAP +CF
Sbjct  144  KLGFVVYYQEVATGRPVRWNFLDKTGIQQFVMSFEVGVTLEDDSQWQAPAHCF  196



>gb|EAZ39776.1| hypothetical protein OsJ_24212 [Oryza sativa Japonica Group]
Length=252

 Score =   141 bits (355),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 77/173 (45%), Positives = 104/173 (60%), Gaps = 18/173 (10%)
 Frame = +3

Query  192  PEPVPTPWPLQFHSILFINITSKGT------LQMIDLWYDWPNGRNFNIIQNQLG---NL  344
            PEP P  WP  FH+ LF N+T+         L++ DL+YDW   RN N+I+ QL    + 
Sbjct  33   PEPKPARWPDVFHARLFTNLTNHSAASTGPPLRVADLYYDWSRRRNLNLIRYQLAAADDP  92

Query  345  VYDLEWNNGTSFIYTLDSSRECQVLDVPVGILRPDWL---DGANYLGQKYMDGFLCNVWE  515
            +YD+EW+NGT+F +    SR C+    PVG+LRP WL    G  YLG+    G  C+VW+
Sbjct  93   LYDVEWDNGTTFYF---DSRSCRTERFPVGVLRPGWLADGGGVVYLGRWRTGGIECDVWD  149

Query  516  KVEFIWYYEDVVSKRPVYWAFY--TGMVAHVMTFEVGKVLS-DPNWQAPLYCF  665
            K+ F+ YY++V + RPV W F   TG+   VM+FEVG  L  D  WQAP +CF
Sbjct  150  KLGFVVYYQEVATGRPVRWNFLDKTGIQQFVMSFEVGVTLEDDSQWQAPAHCF  202



>emb|CAB10188.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78451.1| hypothetical protein [Arabidopsis thaliana]
Length=1047

 Score =   145 bits (367),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 78/181 (43%), Positives = 100/181 (55%), Gaps = 32/181 (18%)
 Frame = +3

Query  183  AGDPEPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEW  362
            A   EPVPTPWP QFH+++F+N +  G L MIDLWYDW NGRNFNIIQ QLG + YDLEW
Sbjct  23   AAADEPVPTPWPHQFHALMFMNYS--GDLSMIDLWYDWTNGRNFNIIQEQLGGITYDLEW  80

Query  363  NNGTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYE  542
            NNGTSF YTLD S+ C          R   L+ ++ +  ++    L    + +  +  + 
Sbjct  81   NNGTSFFYTLDESKSC----------RSGQLEDSHCVRFEFF--ILSRKLKYLRRVGEFS  128

Query  543  DVVSKRPVYWAFYT------------------GMVAHVMTFEVGKVLSDPNWQAPLYCFN  668
             ++    VY    T                  G  AH+MT+EVG VL D  WQAP+YCFN
Sbjct  129  VLLKSGRVYILIVTNTLCALHLMGRLKLPNHSGREAHIMTYEVGAVLEDEKWQAPVYCFN  188

Query  669  N  671
             
Sbjct  189  K  189



>ref|XP_002462848.1| hypothetical protein SORBIDRAFT_02g033060 [Sorghum bicolor]
 gb|EER99369.1| hypothetical protein SORBIDRAFT_02g033060 [Sorghum bicolor]
Length=252

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 74/161 (46%), Positives = 104/161 (65%), Gaps = 15/161 (9%)
 Frame = +3

Query  222  QFHSILFINIT-----SKGT-LQMIDLWYDWPNGRNFNIIQNQLG-NLVYDLEWNNGTSF  380
            +FH++LF N+T     S G  L++ DL+YDWP  RN N++++QL  + +YD+EWNNGT+F
Sbjct  50   RFHAVLFTNLTNYSDASTGPPLRITDLYYDWPRRRNLNLVRHQLSPDPLYDVEWNNGTTF  109

Query  381  IYTLDSSRECQVLDVPVGILRPDWLDG--ANYLGQKYMDGFLCNVWEKVEFIWYYEDVVS  554
             +    SR C+V   PVG+L P WL G  A YLG++   G  C++W K  FI+YYE+  +
Sbjct  110  YF---DSRACRVERFPVGVLPPWWLSGGGAQYLGRRVAGGIDCHLWGKAGFIFYYEEART  166

Query  555  KRPVYWAF--YTGMVAHVMTFEVG-KVLSDPNWQAPLYCFN  668
             RPV W F   TG+  +VM+FE G ++  D  WQAP YCF 
Sbjct  167  GRPVRWDFVDVTGIQQYVMSFEPGVELEEDAQWQAPAYCFT  207



>gb|EMT07112.1| hypothetical protein F775_52341 [Aegilops tauschii]
Length=204

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 83/124 (67%), Gaps = 6/124 (5%)
 Frame = +3

Query  222  QFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLV--YDLEWNNGTSFIYTLD  395
            QFH+ L ++   KG L + DLWYDWP GRN ++I+ QL      YD EWNNGTSF YT  
Sbjct  49   QFHAKLLMDY--KGNLSLADLWYDWPGGRNLHVIRYQLAADAPYYDAEWNNGTSFFYT-P  105

Query  396  SSRECQVLDVPVGILRPDWLD-GANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYW  572
            + R C+   V VGILRPDWL  GA YLG+   DGF C+VW K +FI YYED  ++RPV W
Sbjct  106  ARRACRSAAVGVGILRPDWLAPGAAYLGRAPADGFDCHVWAKADFITYYEDAQTRRPVKW  165

Query  573  AFYT  584
             FYT
Sbjct  166  IFYT  169



>ref|XP_005646088.1| hypothetical protein COCSUDRAFT_17537 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE21544.1| hypothetical protein COCSUDRAFT_17537 [Coccomyxa subellipsoidea 
C-169]
Length=198

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 99/161 (61%), Gaps = 4/161 (2%)
 Frame = +3

Query  225  FHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTSFIYTLDSSR  404
            FH++   N    G+L ++DL+Y+W  GRN N+I +QLG  +YD+E+ N TS+ + L+   
Sbjct  39   FHAVAVQN--RSGSLALVDLYYEWQRGRNANLIHSQLGTTLYDIEYTNHTSYYFNLEEG-  95

Query  405  ECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVE-FIWYYEDVVSKRPVYWAFY  581
             C+ +  PVGIL PDWL  A YLG + +D    +VW K + FI YY DV +  PV W F+
Sbjct  96   TCRKITFPVGILTPDWLANATYLGTENVDAHDTHVWTKADGFIKYYADVHTGLPVRWIFF  155

Query  582  TGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIV  704
             G    +++F V + L D +WQAP YCF + + + L + ++
Sbjct  156  DGAQFEILSFVVNETLPDADWQAPSYCFTDKSQKLLHNTVL  196



>gb|EEE66717.1| hypothetical protein OsJ_23392 [Oryza sativa Japonica Group]
Length=211

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 76/212 (36%), Positives = 108/212 (51%), Gaps = 38/212 (18%)
 Frame = +3

Query  207  TPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQNQLGNLVYDLEWNNGTSFIY  386
            TPWP QFH++                                 G+  YD+EW NGTS+ +
Sbjct  25   TPWPEQFHALS--------------------------------GDPTYDVEWTNGTSYFF  52

Query  387  TLDSSRECQVLDVPVGILRPDWLD-GANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRP  563
               S   C+    PVG+L PDWL  GA YLG++ + GF C++W KV+ +WYYEDVV+ RP
Sbjct  53   NATS---CRTKLFPVGLLPPDWLAAGAVYLGRETVAGFDCHLWTKVDIVWYYEDVVTHRP  109

Query  564  VYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNN--STVESLGSPIVSDAKPLRLGRA  737
            V W F+ GM  HVM+FEVG VL D  WQAP  CF++  + +   G+  V+D +       
Sbjct  110  VRWNFFNGMQQHVMSFEVGGVLEDSKWQAPARCFSDQHTVIADPGAATVTDDRVEGEDGK  169

Query  738  FDVSVSL*PFTYLSCSYLTLIANFKNKNLLQA  833
             DV  +      + C+ +T    F + +  +A
Sbjct  170  LDVMNAFFSNMKMLCANMTENVKFGSSSDCKA  201



>gb|ACN28047.1| unknown [Zea mays]
Length=179

 Score =   120 bits (302),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/134 (46%), Positives = 87/134 (65%), Gaps = 9/134 (7%)
 Frame = +3

Query  192  PEPVPTPWPLQFHSILFINITSKGT-LQMIDLWYDWPNGRNFNIIQNQLG---NLVYDLE  359
            P   P PWP QFH+++  N++++G  LQ+IDL+YDWP GR+ NI+++QL       +++E
Sbjct  40   PATTP-PWPDQFHAVVVTNLSARGGGLQLIDLYYDWPRGRDLNIVRDQLSGERRWSWNVE  98

Query  360  WNNGTSFIYTLDSSRECQVLDVPVGILRPDW-LDGANYLGQKYMDGFLCNVWEKVEFIWY  536
            W+NGT+F++    S  C+     VG+L PDW   GA YLG+  +DGF C+VW    F  Y
Sbjct  99   WSNGTAFLF---DSASCRTFQFAVGLLPPDWKARGAAYLGRDRVDGFDCHVWSNFVFARY  155

Query  537  YEDVVSKRPVYWAF  578
            YEDV + RPV W F
Sbjct  156  YEDVATGRPVSWNF  169



>gb|EWM22600.1| transferase-like protein [Nannochloropsis gaditana]
Length=222

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 67/181 (37%), Positives = 95/181 (52%), Gaps = 9/181 (5%)
 Frame = +3

Query  195  EPVPTPWPLQFHSILFINITSKGTLQMIDLWYDWPNGRNFNIIQN-QLGNLVYDLEWNNG  371
            +  P  WP Q  ++L  N    G L    L YD PNGRN NII++ Q G  ++D E  NG
Sbjct  39   KKTPPVWPPQLTALLLQN--RGGNLSDTTLAYDLPNGRNLNIIKDRQTGLTLWDNERANG  96

Query  372  TSFIYTLDSSRE-CQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVE-----FIW  533
            +++ Y      E CQ L++ VGIL+PDWL GA Y G + + G LC+VW +       F+ 
Sbjct  97   STYYYHKAPEAESCQALNMHVGILKPDWLAGARYKGMEDVKGHLCDVWAQSSSLHHPFVT  156

Query  534  YYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTVESLGSPIVSDA  713
            Y+ D  ++RP  W F+ G +  V+ +  G  L D  WQ P YCF     + L    V  +
Sbjct  157  YFADAQTERPWRWIFFDGAIFDVLEWTPGGTLEDEAWQLPAYCFEKDRKDFLSDGQVQQS  216

Query  714  K  716
            +
Sbjct  217  E  217



>ref|XP_004978076.1| PREDICTED: uncharacterized protein LOC101777237 [Setaria italica]
Length=282

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/100 (53%), Positives = 69/100 (69%), Gaps = 1/100 (1%)
 Frame = +3

Query  384  YTLDSSRECQVLDVPVGILRPDWL-DGANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKR  560
            Y   +S  C+ +  PVGIL  DWL D A YLG++++DGF  ++W KV+FIWYYE++ + R
Sbjct  153  YVRFNSASCRTMQFPVGILPLDWLADSAVYLGREHVDGFDFHLWTKVDFIWYYEEIDTGR  212

Query  561  PVYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNNSTV  680
            PV W F+ GM  HVM+FEVG VL D  WQAP YCF+  T 
Sbjct  213  PVRWNFFNGMQQHVMSFEVGGVLEDSKWQAPAYCFDGDTA  252



>ref|XP_006658352.1| PREDICTED: uncharacterized protein LOC102711000 [Oryza brachyantha]
Length=212

 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/87 (59%), Positives = 63/87 (72%), Gaps = 3/87 (3%)
 Frame = +3

Query  459  GANYLGQKYMDGFLCNVWEKVEFIWYYEDVVSKRPVYWAFYTGMVAHVMTFEVGKVLSDP  638
            GA YLG+  +DGF C+VW KV FIWYYEDV++ RPV W FYTGM  HVM+FEVG VL D 
Sbjct  105  GAVYLGRDTVDGFNCHVWTKVGFIWYYEDVLTHRPVRWNFYTGMQQHVMSFEVGGVLEDS  164

Query  639  NWQAPLYCFNN---STVESLGSPIVSD  710
             WQAP  CFN+   +T  ++ + IVS+
Sbjct  165  KWQAPGRCFNDQEAATNSNIATKIVSE  191



>ref|XP_005766945.1| hypothetical protein EMIHUDRAFT_196892 [Emiliania huxleyi CCMP1516]
 gb|EOD14516.1| hypothetical protein EMIHUDRAFT_196892 [Emiliania huxleyi CCMP1516]
Length=196

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/182 (30%), Positives = 91/182 (50%), Gaps = 10/182 (5%)
 Frame = +3

Query  201  VPTPWPLQFHSI--LFINITSKGTLQMIDLWYDWPNGRNFNII--QNQLGNLVYDLEWNN  368
             P  WP +F  +     + ++  +L     +YD   G N   I       ++V+DLE ++
Sbjct  18   APPVWPRRFTLVQRRVPDASASVSLATTVTFYDADRGANLIQITPDANASDVVWDLELDS  77

Query  369  GTSFIYTLDSSRECQVLDVPVGILRPDWLDGANYLGQKYMDGFLCNVWEKVEFIWYYEDV  548
              S+ +T  S+ +C+ + +PVG+LRP WL  A +LG+K ++G  C  + K +FI YY D 
Sbjct  78   RLSYYFT-PSTGQCKEIAMPVGVLRPTWLSNATFLGRKRVNGRDCLAYTKADFIDYYADA  136

Query  549  VSKRPVYWAFYTGMVAHVMTF-EVGKVLSDPNWQA-PLYCFNNSTVESLGSPIVSDAKPL  722
             +  PV W F+T        F   G  + + +W A P YC   ++ E + +   +  K L
Sbjct  137  TTCEPVSWYFHTMRARFDSVFWAPGLAVPNASWLAPPRYCREEASPEPVAA---ASKKKL  193

Query  723  RL  728
            +L
Sbjct  194  KL  195



>emb|CBN73943.1| conserved unknown protein [Ectocarpus siliculosus]
Length=292

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 52/84 (62%), Gaps = 5/84 (6%)
 Frame = +3

Query  288  YDWPNGRNFNIIQNQLGNL---VYDLEWNNGTSFIY--TLDSSRECQVLDVPVGILRPDW  452
            YD+  GRN NIIQ Q G     ++D E  NGT++ Y      S+ C V+D  VGI+RPDW
Sbjct  72   YDYSAGRNLNIIQTQSGEEDGPLFDNERANGTTYYYHPAKAKSKYCNVIDFGVGIIRPDW  131

Query  453  LDGANYLGQKYMDGFLCNVWEKVE  524
            L+GA YLG++    + C+ WE+ E
Sbjct  132  LEGATYLGEEECGIYQCHKWEQGE  155



>ref|NP_001060768.1| Os08g0102800 [Oryza sativa Japonica Group]
 dbj|BAD33164.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF22682.1| Os08g0102800 [Oryza sativa Japonica Group]
 gb|EAZ41226.1| hypothetical protein OsJ_25731 [Oryza sativa Japonica Group]
 dbj|BAG99981.1| unnamed protein product [Oryza sativa Japonica Group]
Length=156

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 58/83 (70%), Gaps = 8/83 (10%)
 Frame = +3

Query  213  WPLQFHSILF-INITSK----GTLQMIDLWYDWPNGRNFNIIQNQLGN--LVYDLEWNNG  371
            WP +FH+++  IN+T+     G LQ+I+++YDWP+GR+ NI+++QL     +Y++EW NG
Sbjct  40   WPERFHAVVVSINLTNHDRGGGRLQLIEIYYDWPHGRDLNIVRDQLSGDPPLYNVEWVNG  99

Query  372  TSFIYTLDSSRECQVLDVPVGIL  440
            TS+++   +S  C+    PVGIL
Sbjct  100  TSYLFDTAAS-SCRTFQFPVGIL  121



>gb|EMT02491.1| hypothetical protein F775_52486 [Aegilops tauschii]
Length=1090

 Score = 65.1 bits (157),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 35/77 (45%), Positives = 46/77 (60%), Gaps = 6/77 (8%)
 Frame = +3

Query  453   LDGANYLGQKYMDGFLCNVWEKV---EFIWYYEDVVSKRPVYWAF--YTGMVAHVMTFEV  617
             L G +     + +G L   W +V   +FI YYED +++RPV W F   TG+   VM+FEV
Sbjct  976   LGGGSGAFSAHEEGRLWGYWREVGKADFIVYYEDALTRRPVRWNFIDVTGIEQFVMSFEV  1035

Query  618   GKVLSDPN-WQAPLYCF  665
             G VL D N WQAP +CF
Sbjct  1036  GVVLEDDNQWQAPAHCF  1052



>ref|XP_002303742.1| hypothetical protein POPTR_0003s15990g [Populus trichocarpa]
 gb|EEE78721.1| hypothetical protein POPTR_0003s15990g [Populus trichocarpa]
Length=55

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 20/36 (56%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +3

Query  564  VYWAFYTGMVAHVMTFEVGKVLSDPNWQAPLYCFNN  671
            VY   + G  AHVMTFEVG  L D  WQA +YCF++
Sbjct  8    VYLMMFAGREAHVMTFEVGAALEDAKWQAHVYCFDS  43



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1894952386554