BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= Contig2226

Length=772
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009620566.1|  PREDICTED: probable methyltransferase PMT13        232   7e-68   Nicotiana tomentosiformis
ref|XP_009782445.1|  PREDICTED: probable methyltransferase PMT13        231   9e-68   Nicotiana sylvestris
ref|XP_010457020.1|  PREDICTED: probable methyltransferase PMT13        222   8e-67   Camelina sativa [gold-of-pleasure]
ref|XP_006339458.1|  PREDICTED: probable methyltransferase PMT13-...    227   6e-66   Solanum tuberosum [potatoes]
ref|XP_004229834.1|  PREDICTED: probable methyltransferase PMT13        226   6e-66   Solanum lycopersicum
ref|XP_006286483.1|  hypothetical protein CARUB_v10000518mg             224   2e-65   
ref|XP_006396269.1|  hypothetical protein EUTSA_v10028525mg             225   2e-65   Eutrema salsugineum [saltwater cress]
ref|XP_010427357.1|  PREDICTED: probable methyltransferase PMT13        225   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_006286484.1|  hypothetical protein CARUB_v10000518mg             224   5e-65   Capsella rubella
ref|XP_006445145.1|  hypothetical protein CICLE_v10019404mg             224   5e-65   Citrus clementina [clementine]
ref|XP_010419629.1|  PREDICTED: probable methyltransferase PMT13        224   6e-65   Camelina sativa [gold-of-pleasure]
ref|XP_006491019.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...    224   7e-65   
ref|XP_011091711.1|  PREDICTED: probable methyltransferase PMT13        222   3e-64   Sesamum indicum [beniseed]
gb|EYU32065.1|  hypothetical protein MIMGU_mgv1a003241mg                222   3e-64   Erythranthe guttata [common monkey flower]
ref|XP_010529254.1|  PREDICTED: probable methyltransferase PMT13        219   4e-63   Tarenaya hassleriana [spider flower]
emb|CDY07198.1|  BnaCnng02130D                                          218   1e-62   
ref|XP_008383241.1|  PREDICTED: probable methyltransferase PMT13        218   1e-62   
ref|XP_007220546.1|  hypothetical protein PRUPE_ppa003145mg             217   3e-62   Prunus persica
ref|NP_567184.1|  type II membrane pectin methyltransferase             217   3e-62   Arabidopsis thaliana [mouse-ear cress]
gb|KJB22349.1|  hypothetical protein B456_004G042500                    216   5e-62   Gossypium raimondii
ref|XP_002272714.1|  PREDICTED: probable methyltransferase PMT13        215   1e-61   Vitis vinifera
gb|KJB41230.1|  hypothetical protein B456_007G095900                    212   2e-61   Gossypium raimondii
ref|XP_009349940.1|  PREDICTED: probable methyltransferase PMT13        214   2e-61   Pyrus x bretschneideri [bai li]
ref|XP_009343540.1|  PREDICTED: probable methyltransferase PMT13        214   3e-61   Pyrus x bretschneideri [bai li]
gb|KHG02077.1|  hypothetical protein F383_25150                         212   4e-61   Gossypium arboreum [tree cotton]
gb|KJB41231.1|  hypothetical protein B456_007G095900                    212   4e-61   Gossypium raimondii
ref|XP_012083471.1|  PREDICTED: probable methyltransferase PMT13        214   4e-61   Jatropha curcas
ref|XP_008438089.1|  PREDICTED: probable methyltransferase PMT13        213   4e-61   Cucumis melo [Oriental melon]
ref|XP_009111460.1|  PREDICTED: probable methyltransferase PMT13        213   5e-61   Brassica rapa
gb|KJB41229.1|  hypothetical protein B456_007G095900                    213   8e-61   Gossypium raimondii
ref|XP_008232740.1|  PREDICTED: probable methyltransferase PMT13        213   9e-61   Prunus mume [ume]
ref|XP_010278571.1|  PREDICTED: probable methyltransferase PMT13        213   9e-61   Nelumbo nucifera [Indian lotus]
ref|XP_008385702.1|  PREDICTED: probable methyltransferase PMT13        213   1e-60   
ref|XP_004133879.1|  PREDICTED: probable methyltransferase PMT13        212   2e-60   Cucumis sativus [cucumbers]
ref|XP_002872932.1|  hypothetical protein ARALYDRAFT_490495             211   4e-60   
ref|XP_009134532.1|  PREDICTED: probable methyltransferase PMT13        211   5e-60   Brassica rapa
emb|CDX74348.1|  BnaA03g26990D                                          211   5e-60   
emb|CDX91893.1|  BnaC03g31950D                                          211   6e-60   
ref|XP_011093168.1|  PREDICTED: probable methyltransferase PMT13        211   6e-60   Sesamum indicum [beniseed]
ref|XP_007051915.1|  S-adenosyl-L-methionine-dependent methyltran...    211   6e-60   
gb|AAD17338.1|  F15P23.2 gene product                                   209   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010255504.1|  PREDICTED: probable methyltransferase PMT13        209   3e-59   Nelumbo nucifera [Indian lotus]
ref|XP_011469063.1|  PREDICTED: probable methyltransferase PMT13 ...    207   3e-59   Fragaria vesca subsp. vesca
ref|XP_004306834.1|  PREDICTED: probable methyltransferase PMT13 ...    207   9e-59   Fragaria vesca subsp. vesca
ref|XP_002320756.1|  dehydration-responsive family protein              207   1e-58   Populus trichocarpa [western balsam poplar]
emb|CDY51142.1|  BnaA09g51770D                                          206   2e-58   Brassica napus [oilseed rape]
emb|CDP08877.1|  unnamed protein product                                206   3e-58   Coffea canephora [robusta coffee]
ref|XP_011035117.1|  PREDICTED: probable methyltransferase PMT13        204   1e-57   Populus euphratica
ref|XP_010671687.1|  PREDICTED: probable methyltransferase PMT13 ...    202   7e-57   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS64664.1|  hypothetical protein M569_10115                         197   1e-55   Genlisea aurea
ref|XP_007139954.1|  hypothetical protein PHAVU_008G072600g             194   9e-54   Phaseolus vulgaris [French bean]
ref|XP_010055223.1|  PREDICTED: probable methyltransferase PMT13        193   2e-53   Eucalyptus grandis [rose gum]
gb|ACN78958.1|  dehydration responsive protein                          191   3e-53   Glycine max [soybeans]
ref|XP_003528881.1|  PREDICTED: probable methyltransferase PMT13-...    192   5e-53   Glycine max [soybeans]
ref|XP_003552360.1|  PREDICTED: probable methyltransferase PMT13-...    191   8e-53   Glycine max [soybeans]
gb|KJB24669.1|  hypothetical protein B456_004G156600                    188   1e-51   Gossypium raimondii
ref|XP_003534594.1|  PREDICTED: probable methyltransferase PMT13-...    187   4e-51   Glycine max [soybeans]
gb|KEH18952.1|  methyltransferase                                       186   5e-51   Medicago truncatula
ref|XP_004492679.1|  PREDICTED: probable methyltransferase PMT13-...    186   7e-51   Cicer arietinum [garbanzo]
ref|XP_009382296.1|  PREDICTED: probable methyltransferase PMT13        184   2e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003521295.1|  PREDICTED: probable methyltransferase PMT13-...    184   3e-50   Glycine max [soybeans]
ref|XP_007134962.1|  hypothetical protein PHAVU_010G090400g             184   4e-50   Phaseolus vulgaris [French bean]
gb|KDO86019.1|  hypothetical protein CISIN_1g007645mg                   181   3e-49   Citrus sinensis [apfelsine]
ref|XP_006857872.1|  PREDICTED: probable methyltransferase PMT13        181   4e-49   Amborella trichopoda
ref|XP_010091551.1|  putative methyltransferase PMT13                   176   1e-47   
ref|XP_010919247.1|  PREDICTED: probable methyltransferase PMT13 ...    176   1e-47   Elaeis guineensis
ref|XP_010919248.1|  PREDICTED: probable methyltransferase PMT13 ...    176   1e-47   
ref|XP_009401770.1|  PREDICTED: probable methyltransferase PMT13        177   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010919246.1|  PREDICTED: probable methyltransferase PMT13 ...    176   4e-47   Elaeis guineensis
ref|XP_008799525.1|  PREDICTED: probable methyltransferase PMT13        174   2e-46   
ref|XP_003623833.1|  hypothetical protein MTR_7g076150                  173   4e-46   Medicago truncatula
gb|ABK25383.1|  unknown                                                 170   4e-45   Picea sitchensis
ref|XP_010053663.1|  PREDICTED: probable methyltransferase PMT13        170   4e-45   Eucalyptus grandis [rose gum]
gb|AIU48613.1|  quasimodo 3                                             169   4e-45   Erythranthe guttata [common monkey flower]
gb|AIU48615.1|  quasimodo 3                                             167   3e-44   Solanum tuberosum [potatoes]
gb|AIU48625.1|  quasimodo 3                                             167   3e-44   Solanum lycopersicum
gb|AIU48627.1|  quasimodo 3                                             164   2e-43   Schrenkiella parvula
gb|AIU48617.1|  quasimodo 3                                             163   5e-43   Prunus persica
gb|AIU48600.1|  quasimodo 3                                             163   5e-43   Eucalyptus grandis [rose gum]
gb|AIU48632.1|  quasimodo 3                                             163   6e-43   Platanus x hispanica [London plane tree]
gb|AIU48610.1|  quasimodo 3                                             162   9e-43   Medicago truncatula
gb|AIU48595.1|  quasimodo 3                                             162   1e-42   Citrus clementina [clementine]
gb|AIU48598.1|  quasimodo 3                                             162   1e-42   Capsella rubella
gb|AIU48602.1|  quasimodo 3                                             162   2e-42   Buxus sinica
gb|AIU48612.1|  quasimodo 3                                             162   2e-42   Manihot esculenta [manioc]
gb|AIU48597.1|  quasimodo 3                                             162   2e-42   Carica papaya [mamon]
gb|AIU48586.1|  quasimodo 3                                             162   2e-42   Arabidopsis thaliana [mouse-ear cress]
gb|AIU48585.1|  quasimodo 3                                             161   3e-42   Arabidopsis lyrata [lyrate rockcress]
gb|AIU48589.1|  quasimodo 3                                             160   4e-42   Musa acuminata [banana]
gb|AIU48628.1|  quasimodo 3                                             160   9e-42   Vitis vinifera
gb|AIU48619.1|  quasimodo 3                                             160   1e-41   Phaseolus vulgaris [French bean]
gb|AIU48592.1|  quasimodo 3                                             159   1e-41   Theobroma cacao [chocolate]
gb|AIU48634.1|  quasimodo 3                                             158   3e-41   Houttuynia cordata [chameleon-plant]
gb|AIU48584.1|  quasimodo 3                                             157   8e-41   Aquilegia coerulea [Rocky Mountain columbine]
gb|AIU48594.1|  quasimodo 3                                             157   1e-40   Sarcandra glabra
gb|AIU48593.1|  quasimodo 3                                             156   2e-40   Acorus calamus [flagroot]
gb|AIU48609.1|  quasimodo 3                                             156   3e-40   Aristolochia tagala
gb|AIU48638.1|  quasimodo 3                                             155   4e-40   Cabomba caroliniana
gb|AIU48629.1|  quasimodo 3                                             155   5e-40   Lactuca sativa [cultivated lettuce]
gb|AIU48607.1|  quasimodo 3                                             155   7e-40   Pandanus utilis
gb|AIU48611.1|  quasimodo 3                                             154   9e-40   Canna indica [canna]
gb|AIU48622.1|  quasimodo 3                                             154   1e-39   Dioscorea oppositifolia
gb|AIU48630.1|  quasimodo 3                                             152   5e-39   Ceratophyllum platyacanthum subsp. oryzetorum
gb|AIU48636.1|  quasimodo 3                                             152   5e-39   Alisma plantago-aquatica
gb|AIU48588.1|  quasimodo 3                                             152   6e-39   Magnolia denudata [haku-mokuren]
gb|AIU48587.1|  quasimodo 3                                             148   8e-39   Lilium brownii [Hong Kong lily]
gb|AIU48616.1|  quasimodo 3                                             150   2e-38   Populus trichocarpa [western balsam poplar]
gb|AIU48590.1|  quasimodo 3                                             150   2e-38   Pinellia ternata
gb|AIU48608.1|  quasimodo 3                                             150   2e-38   Asparagus officinalis
gb|AIU48605.1|  quasimodo 3                                             149   6e-38   Ceratophyllum demersum [hornwort]
gb|AIU48606.1|  quasimodo 3                                             149   6e-38   Chimonanthus praecox [wintersweet]
gb|AIU48596.1|  quasimodo 3                                             149   6e-38   Gossypium raimondii
gb|AIU48631.1|  quasimodo 3                                             148   1e-37   Cinnamomum camphora
gb|AIU48623.1|  quasimodo 3                                             148   2e-37   Yucca filamentosa [Adam's-needle]
gb|AIU48601.1|  quasimodo 3                                             147   4e-37   Illicium henryi
gb|AIU48621.1|  quasimodo 3                                             146   7e-37   Ricinus communis
ref|XP_002511800.1|  conserved hypothetical protein                     146   8e-37   
gb|AIU48637.1|  quasimodo 3                                             145   1e-36   Trachycarpus fortunei
emb|CAH67036.1|  OSIGBa0139P06.9                                        145   3e-36   Oryza sativa [red rice]
emb|CAE02253.2|  OSJNBb0032E06.12                                       145   3e-36   Oryza sativa Japonica Group [Japonica rice]
gb|AIU48618.1|  quasimodo 3                                             144   7e-36   Panicum virgatum
gb|AIU48624.1|  quasimodo 3                                             143   1e-35   Setaria italica
gb|AIU48603.1|  quasimodo 3                                             142   3e-35   Iris japonica
gb|AIU48591.1|  quasimodo 3                                             141   4e-35   Brachypodium distachyon [annual false brome]
ref|XP_003580350.1|  PREDICTED: probable methyltransferase PMT13        142   4e-35   Brachypodium distachyon [annual false brome]
ref|XP_002961169.1|  hypothetical protein SELMODRAFT_74065              142   4e-35   Selaginella moellendorffii
ref|XP_002966837.1|  hypothetical protein SELMODRAFT_168608             142   4e-35   Selaginella moellendorffii
dbj|BAJ96404.1|  predicted protein                                      139   4e-35   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AIU48626.1|  quasimodo 3                                             140   1e-34   Sorghum bicolor [broomcorn]
dbj|BAJ96685.1|  predicted protein                                      140   1e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ98075.1|  predicted protein                                      140   1e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008669009.1|  PREDICTED: probable methyltransferase PMT13        140   1e-34   Zea mays [maize]
gb|AIU48635.1|  quasimodo 3                                             140   1e-34   Zea mays [maize]
ref|XP_004976531.1|  PREDICTED: probable methyltransferase PMT13-...    140   2e-34   Setaria italica
gb|AIU48633.1|  quasimodo 3                                             137   1e-33   Ginkgo biloba [ginkgo]
ref|XP_002448358.1|  hypothetical protein SORBIDRAFT_06g025780          129   2e-30   
gb|EEE61526.1|  hypothetical protein OsJ_15828                          127   3e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001772854.1|  predicted protein                                  117   2e-26   
ref|XP_001769468.1|  predicted protein                                  117   3e-26   
gb|EMS47379.1|  putative methyltransferase PMT13                        110   1e-24   Triticum urartu
gb|AIU48604.1|  quasimodo 3                                           98.6    6e-20   Chloranthus japonicus
gb|KHN27285.1|  Putative methyltransferase PMT13                      94.0    2e-18   Glycine soja [wild soybean]
ref|XP_010940855.1|  PREDICTED: probable methyltransferase PMT21      93.2    1e-17   
gb|EMT00863.1|  hypothetical protein F775_08090                       92.4    1e-17   
ref|XP_002992272.1|  hypothetical protein SELMODRAFT_186660           89.4    1e-16   
ref|XP_009136994.1|  PREDICTED: probable methyltransferase PMT21      87.8    4e-16   Brassica rapa
ref|XP_012075070.1|  PREDICTED: probable methyltransferase PMT21      87.8    4e-16   Jatropha curcas
gb|KDP35427.1|  hypothetical protein JCGZ_10810                       87.8    4e-16   Jatropha curcas
ref|XP_006662118.1|  PREDICTED: probable methyltransferase PMT20-...  87.8    4e-16   Oryza brachyantha
emb|CDY01583.1|  BnaC07g35730D                                        87.8    4e-16   
emb|CDX98606.1|  BnaA03g43910D                                        87.8    5e-16   
gb|KJB25151.1|  hypothetical protein B456_004G178700                  87.0    7e-16   Gossypium raimondii
dbj|BAJ94360.1|  predicted protein                                    87.0    8e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK00591.1|  predicted protein                                    87.0    8e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002310457.2|  hypothetical protein POPTR_0007s02440g           87.0    8e-16   
gb|EPS61707.1|  hypothetical protein M569_13087                       84.0    9e-16   Genlisea aurea
ref|XP_011016489.1|  PREDICTED: probable methyltransferase PMT17      84.0    2e-15   Populus euphratica
ref|XP_002317647.1|  dehydration-responsive family protein            85.9    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_009365745.1|  PREDICTED: probable methyltransferase PMT21      85.5    2e-15   Pyrus x bretschneideri [bai li]
ref|XP_008373450.1|  PREDICTED: probable methyltransferase PMT21      85.5    2e-15   
ref|XP_008364478.1|  PREDICTED: probable methyltransferase PMT21      85.5    2e-15   
ref|XP_009774700.1|  PREDICTED: probable methyltransferase PMT21      85.5    2e-15   Nicotiana sylvestris
gb|KFK28580.1|  methyltransferase pmt20                               85.5    3e-15   Arabis alpina [alpine rockcress]
gb|ACL53638.1|  unknown                                               85.5    3e-15   Zea mays [maize]
gb|EAY93110.1|  hypothetical protein OsI_14912                        85.5    3e-15   Oryza sativa Indica Group [Indian rice]
ref|NP_001152283.1|  ankyrin protein kinase-like                      85.1    3e-15   Zea mays [maize]
ref|XP_006364469.1|  PREDICTED: probable methyltransferase PMT21-...  85.1    3e-15   Solanum tuberosum [potatoes]
ref|XP_004245921.1|  PREDICTED: probable methyltransferase PMT21      85.1    3e-15   Solanum lycopersicum
ref|XP_008680760.1|  PREDICTED: ankyrin protein kinase-like isofo...  85.1    3e-15   Zea mays [maize]
ref|XP_009133584.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...  85.1    3e-15   
ref|XP_007210267.1|  hypothetical protein PRUPE_ppa003130mg           84.7    3e-15   
ref|XP_004244424.1|  PREDICTED: probable methyltransferase PMT20      85.1    3e-15   Solanum lycopersicum
ref|XP_004144403.1|  PREDICTED: probable methyltransferase PMT21      85.1    3e-15   Cucumis sativus [cucumbers]
ref|XP_007210268.1|  hypothetical protein PRUPE_ppa003130mg           85.1    4e-15   Prunus persica
ref|XP_008460424.1|  PREDICTED: probable methyltransferase PMT21      84.7    4e-15   Cucumis melo [Oriental melon]
ref|XP_006361241.1|  PREDICTED: probable methyltransferase PMT20-...  84.7    4e-15   Solanum tuberosum [potatoes]
gb|EAZ29807.1|  hypothetical protein OsJ_13866                        84.7    4e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011026358.1|  PREDICTED: probable methyltransferase PMT19      84.7    4e-15   Populus euphratica
gb|EYU37520.1|  hypothetical protein MIMGU_mgv1a003222mg              84.7    4e-15   Erythranthe guttata [common monkey flower]
ref|XP_010676941.1|  PREDICTED: probable methyltransferase PMT17      84.7    4e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU37521.1|  hypothetical protein MIMGU_mgv1a003222mg              84.7    5e-15   Erythranthe guttata [common monkey flower]
gb|KHG30506.1|  putative methyltransferase PMT21 -like protein        84.3    5e-15   Gossypium arboreum [tree cotton]
gb|KHG22120.1|  hypothetical protein F383_28461                       84.7    6e-15   Gossypium arboreum [tree cotton]
gb|KJB51529.1|  hypothetical protein B456_008G220500                  84.0    7e-15   Gossypium raimondii
ref|XP_010056181.1|  PREDICTED: probable methyltransferase PMT20      84.0    7e-15   Eucalyptus grandis [rose gum]
ref|XP_011004387.1|  PREDICTED: probable methyltransferase PMT18      84.0    8e-15   Populus euphratica
ref|XP_006858634.1|  PREDICTED: probable methyltransferase PMT19      84.0    8e-15   Amborella trichopoda
ref|XP_010677437.1|  PREDICTED: probable methyltransferase PMT21      84.0    8e-15   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS73062.1|  hypothetical protein M569_01690                       83.6    9e-15   Genlisea aurea
ref|XP_009619970.1|  PREDICTED: probable methyltransferase PMT20      83.6    9e-15   Nicotiana tomentosiformis
ref|XP_009794519.1|  PREDICTED: probable methyltransferase PMT20      83.6    1e-14   Nicotiana sylvestris
ref|XP_002530544.1|  S-adenosylmethionine-dependent methyltransfe...  83.6    1e-14   Ricinus communis
ref|NP_567575.1|  putative methyltransferase PMT21                    83.6    1e-14   Arabidopsis thaliana [mouse-ear cress]
gb|KJB59346.1|  hypothetical protein B456_009G250600                  84.0    1e-14   Gossypium raimondii
emb|CDY09274.1|  BnaC03g63040D                                        83.6    1e-14   Brassica napus [oilseed rape]
ref|XP_009132524.1|  PREDICTED: probable methyltransferase PMT21      83.6    1e-14   Brassica rapa
gb|KHF97731.1|  putative methyltransferase PMT21 -like protein        83.6    1e-14   Gossypium arboreum [tree cotton]
ref|XP_009373681.1|  PREDICTED: probable methyltransferase PMT18      83.6    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_009414612.1|  PREDICTED: probable methyltransferase PMT24      83.6    1e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006368294.1|  hypothetical protein POPTR_0001s01380g           83.2    1e-14   
ref|XP_009350354.1|  PREDICTED: probable methyltransferase PMT18      83.6    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_010535872.1|  PREDICTED: probable methyltransferase PMT21      83.2    1e-14   Tarenaya hassleriana [spider flower]
emb|CDY61681.1|  BnaC01g40980D                                        83.2    1e-14   Brassica napus [oilseed rape]
ref|NP_192782.1|  putative methyltransferase PMT17                    83.2    1e-14   Arabidopsis thaliana [mouse-ear cress]
emb|CDY12278.1|  BnaA09g24780D                                        83.2    1e-14   Brassica napus [oilseed rape]
ref|XP_006368293.1|  dehydration-responsive family protein            83.2    2e-14   Populus trichocarpa [western balsam poplar]
gb|ABK94960.1|  unknown                                               83.2    2e-14   Populus trichocarpa [western balsam poplar]
ref|XP_011018410.1|  PREDICTED: probable methyltransferase PMT20      83.2    2e-14   Populus euphratica
ref|XP_009114945.1|  PREDICTED: probable methyltransferase PMT20      83.2    2e-14   Brassica rapa
ref|XP_011028039.1|  PREDICTED: probable methyltransferase PMT20      82.8    2e-14   Populus euphratica
ref|XP_007040817.1|  S-adenosyl-L-methionine-dependent methyltran...  82.8    2e-14   
ref|XP_002867953.1|  early-responsive to dehydration 3                82.8    2e-14   Arabidopsis lyrata subsp. lyrata
emb|CDX78919.1|  BnaA01g09860D                                        83.2    2e-14   
ref|XP_002304375.2|  dehydration-responsive family protein            82.8    2e-14   
ref|XP_010478606.1|  PREDICTED: probable methyltransferase PMT20      82.8    2e-14   Camelina sativa [gold-of-pleasure]
gb|AES77233.2|  S-adenosylmethionine-dependent methyltransferase,...  82.4    2e-14   Medicago truncatula
emb|CDX76494.1|  BnaA08g09060D                                        82.4    2e-14   
ref|XP_009611450.1|  PREDICTED: probable methyltransferase PMT21      82.4    2e-14   Nicotiana tomentosiformis
emb|CDX99828.1|  BnaC05g22500D                                        82.8    2e-14   
ref|XP_006662791.1|  PREDICTED: probable methyltransferase PMT26-...  82.8    2e-14   Oryza brachyantha
ref|XP_003621015.1|  hypothetical protein MTR_7g006060                82.4    2e-14   
ref|XP_009384739.1|  PREDICTED: probable methyltransferase PMT21      82.4    3e-14   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK37159.1|  hypothetical protein AALP_AA4G221000                  82.4    3e-14   Arabis alpina [alpine rockcress]
ref|XP_004983508.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...  82.4    3e-14   
ref|XP_010054055.1|  PREDICTED: probable methyltransferase PMT21      82.4    3e-14   Eucalyptus grandis [rose gum]
ref|XP_006439163.1|  hypothetical protein CICLE_v10019302mg           82.4    3e-14   
ref|XP_002519866.1|  S-adenosylmethionine-dependent methyltransfe...  82.0    3e-14   
ref|XP_006286418.1|  hypothetical protein CARUB_v10003037mg           82.0    3e-14   Capsella rubella
ref|XP_006414006.1|  hypothetical protein EUTSA_v10024718mg           82.0    3e-14   
ref|XP_007156365.1|  hypothetical protein PHAVU_003G280100g           82.0    3e-14   Phaseolus vulgaris [French bean]
ref|XP_010278811.1|  PREDICTED: probable methyltransferase PMT21      82.0    3e-14   
ref|XP_006282955.1|  hypothetical protein CARUB_v10007621mg           82.0    3e-14   Capsella rubella
ref|XP_009360657.1|  PREDICTED: probable methyltransferase PMT24      82.4    3e-14   Pyrus x bretschneideri [bai li]
ref|XP_006584650.1|  PREDICTED: probable methyltransferase PMT26-...  82.4    3e-14   Glycine max [soybeans]
ref|XP_010508464.1|  PREDICTED: probable methyltransferase PMT19      82.0    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_006307041.1|  hypothetical protein CARUB_v10008629mg           81.6    4e-14   
ref|XP_008799999.1|  PREDICTED: probable methyltransferase PMT21 ...  81.6    4e-14   
ref|XP_002874627.1|  dehydration-responsive family protein            81.6    4e-14   Arabidopsis lyrata subsp. lyrata
ref|XP_006307042.1|  hypothetical protein CARUB_v10008629mg           81.6    4e-14   Capsella rubella
ref|NP_001065036.1|  Os10g0510400                                     81.6    4e-14   
ref|XP_008799998.1|  PREDICTED: probable methyltransferase PMT20 ...  81.6    4e-14   Phoenix dactylifera
ref|XP_010455441.1|  PREDICTED: probable methyltransferase PMT17      81.6    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010421961.1|  PREDICTED: probable methyltransferase PMT17      81.6    4e-14   Camelina sativa [gold-of-pleasure]
ref|XP_004982637.1|  PREDICTED: probable methyltransferase PMT18-...  81.6    4e-14   Setaria italica
gb|KHN11837.1|  Putative methyltransferase PMT20                      81.6    4e-14   Glycine soja [wild soybean]
ref|XP_010277710.1|  PREDICTED: probable methyltransferase PMT24      82.0    4e-14   Nelumbo nucifera [Indian lotus]
ref|XP_003534313.1|  PREDICTED: probable methyltransferase PMT20-...  81.6    4e-14   Glycine max [soybeans]
ref|XP_004982638.1|  PREDICTED: probable methyltransferase PMT18-...  81.6    5e-14   Setaria italica
emb|CDY48339.1|  BnaA09g26820D                                        82.0    5e-14   Brassica napus [oilseed rape]
gb|KEH31563.1|  methyltransferase PMT14-like protein, putative        82.4    5e-14   Medicago truncatula
ref|XP_006573482.1|  PREDICTED: probable methyltransferase PMT20 ...  81.3    5e-14   
ref|XP_002466953.1|  hypothetical protein SORBIDRAFT_01g017340        81.6    5e-14   Sorghum bicolor [broomcorn]
ref|XP_006573483.1|  PREDICTED: probable methyltransferase PMT20 ...  81.3    5e-14   
ref|XP_010461008.1|  PREDICTED: probable methyltransferase PMT20      81.6    5e-14   Camelina sativa [gold-of-pleasure]
emb|CDY43782.1|  BnaA06g23180D                                        81.6    5e-14   Brassica napus [oilseed rape]
ref|XP_009397802.1|  PREDICTED: probable methyltransferase PMT21      81.3    5e-14   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010499729.1|  PREDICTED: probable methyltransferase PMT20      81.3    5e-14   Camelina sativa [gold-of-pleasure]
ref|XP_003523221.1|  PREDICTED: probable methyltransferase PMT26-...  81.6    6e-14   Glycine max [soybeans]
ref|XP_006827213.1|  PREDICTED: probable methyltransferase PMT2       81.3    6e-14   
ref|XP_010255768.1|  PREDICTED: probable methyltransferase PMT21      81.3    6e-14   Nelumbo nucifera [Indian lotus]
ref|XP_006580338.1|  PREDICTED: probable methyltransferase PMT26-...  81.6    6e-14   Glycine max [soybeans]
ref|XP_002516311.1|  ATP binding protein, putative                    81.6    6e-14   Ricinus communis
ref|XP_006599113.1|  PREDICTED: probable methyltransferase PMT20-...  81.3    6e-14   Glycine max [soybeans]
ref|XP_007156094.1|  hypothetical protein PHAVU_003G258000g           81.6    6e-14   Phaseolus vulgaris [French bean]
gb|KFK31838.1|  hypothetical protein AALP_AA6G165000                  81.3    6e-14   Arabis alpina [alpine rockcress]
gb|KEH18956.1|  methyltransferase                                     81.3    6e-14   Medicago truncatula
gb|KHN34092.1|  Putative methyltransferase PMT26                      81.6    7e-14   Glycine soja [wild soybean]
ref|XP_003547828.1|  PREDICTED: probable methyltransferase PMT20-...  81.3    7e-14   Glycine max [soybeans]
ref|XP_010413759.1|  PREDICTED: probable methyltransferase PMT25      81.3    7e-14   Camelina sativa [gold-of-pleasure]
ref|XP_003517079.1|  PREDICTED: probable methyltransferase PMT20 ...  80.9    7e-14   Glycine max [soybeans]
ref|XP_006574692.1|  PREDICTED: probable methyltransferase PMT27-...  81.3    7e-14   
ref|XP_010515490.1|  PREDICTED: probable methyltransferase PMT27      81.3    7e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010503787.1|  PREDICTED: probable methyltransferase PMT27      81.3    7e-14   Camelina sativa [gold-of-pleasure]
ref|XP_010426649.1|  PREDICTED: probable methyltransferase PMT27      81.3    7e-14   Camelina sativa [gold-of-pleasure]
gb|KHN00508.1|  Putative methyltransferase PMT27                      81.3    7e-14   Glycine soja [wild soybean]
ref|XP_003519883.1|  PREDICTED: probable methyltransferase PMT27-...  81.3    7e-14   Glycine max [soybeans]
ref|XP_006296465.1|  hypothetical protein CARUB_v10025649mg           80.9    7e-14   
ref|XP_010918079.1|  PREDICTED: probable methyltransferase PMT21      80.9    8e-14   Elaeis guineensis
ref|XP_006394213.1|  hypothetical protein EUTSA_v10003654mg           81.3    8e-14   Eutrema salsugineum [saltwater cress]
ref|XP_006436689.1|  hypothetical protein CICLE_v10032468mg           78.2    8e-14   
gb|EMT24893.1|  hypothetical protein F775_19481                       81.3    8e-14   
ref|XP_009150474.1|  PREDICTED: probable methyltransferase PMT26      81.3    8e-14   
ref|XP_011465047.1|  PREDICTED: probable methyltransferase PMT20      80.9    8e-14   
ref|XP_006487510.1|  PREDICTED: probable methyltransferase PMT20-...  78.6    8e-14   
emb|CDX84478.1|  BnaC03g50220D                                        81.3    8e-14   
emb|CDP14936.1|  unnamed protein product                              80.9    9e-14   
ref|XP_008802976.1|  PREDICTED: probable methyltransferase PMT21 ...  80.9    9e-14   
ref|XP_010428798.1|  PREDICTED: probable methyltransferase PMT10      80.9    9e-14   
ref|XP_006492200.1|  PREDICTED: probable methyltransferase PMT20-...  78.2    9e-14   
ref|XP_008802977.1|  PREDICTED: probable methyltransferase PMT21 ...  80.9    9e-14   
ref|XP_008802980.1|  PREDICTED: probable methyltransferase PMT21 ...  80.5    9e-14   
ref|XP_008378063.1|  PREDICTED: probable methyltransferase PMT18      80.9    9e-14   
gb|EMS61672.1|  putative methyltransferase PMT26                      80.9    1e-13   
ref|XP_010091548.1|  putative methyltransferase PMT15                 80.5    1e-13   
ref|XP_008802979.1|  PREDICTED: probable methyltransferase PMT21 ...  80.5    1e-13   
gb|AAM15161.1|  hypothetical protein                                  80.5    1e-13   
ref|XP_006476235.1|  PREDICTED: probable methyltransferase PMT18-...  80.5    1e-13   
ref|NP_181849.1|  S-adenosyl-L-methionine-dependent methyltransfe...  80.5    1e-13   
gb|KDO76804.1|  hypothetical protein CISIN_1g006834mg                 80.5    1e-13   
gb|EPS59470.1|  hypothetical protein M569_15334                       80.5    1e-13   
dbj|BAC24840.1|  dehydration-responsive protein-like                  80.5    1e-13   
ref|XP_006397065.1|  hypothetical protein EUTSA_v10028495mg           80.5    1e-13   
ref|XP_009109665.1|  PREDICTED: probable methyltransferase PMT24      80.5    1e-13   
ref|XP_008239284.1|  PREDICTED: probable methyltransferase PMT18      80.5    1e-13   
ref|XP_006443118.1|  hypothetical protein CICLE_v10019345mg           80.5    1e-13   
gb|KEH20321.1|  methyltransferase PMT16, putative                     80.5    1e-13   
ref|XP_006290554.1|  hypothetical protein CARUB_v10016641mg           80.9    1e-13   
ref|XP_010524131.1|  PREDICTED: probable methyltransferase PMT19      80.1    1e-13   
ref|XP_006281931.1|  hypothetical protein CARUB_v10028139mg           80.5    1e-13   
ref|XP_002467415.1|  hypothetical protein SORBIDRAFT_01g027660        80.1    1e-13   
ref|XP_010419238.1|  PREDICTED: probable methyltransferase PMT10      80.1    1e-13   
ref|XP_002881329.1|  hypothetical protein ARALYDRAFT_482372           80.5    1e-13   
gb|KJB24074.1|  hypothetical protein B456_004G127200                  80.1    1e-13   
ref|XP_004510859.1|  PREDICTED: probable methyltransferase PMT15-...  80.1    1e-13   
ref|XP_009128712.1|  PREDICTED: probable methyltransferase PMT17      80.1    1e-13   
ref|XP_011092623.1|  PREDICTED: probable methyltransferase PMT20      80.1    2e-13   
ref|XP_002265127.1|  PREDICTED: probable methyltransferase PMT20      80.1    2e-13   
gb|KCW90077.1|  hypothetical protein EUGRSUZ_A02270                   79.7    2e-13   
ref|XP_003573760.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...  80.1    2e-13   
ref|XP_010439756.1|  PREDICTED: probable methyltransferase PMT21      79.7    2e-13   
emb|CBI37452.3|  unnamed protein product                              79.7    2e-13   
ref|XP_010449394.1|  PREDICTED: probable methyltransferase PMT21      79.7    2e-13   
gb|KJB09868.1|  hypothetical protein B456_001G171500                  79.7    2e-13   
ref|XP_010434448.1|  PREDICTED: probable methyltransferase PMT21      79.7    2e-13   
ref|NP_174468.1|  putative methyltransferase PMT20                    79.7    2e-13   
ref|XP_008348991.1|  PREDICTED: probable methyltransferase PMT18      79.7    2e-13   
ref|XP_002890952.1|  hypothetical protein ARALYDRAFT_473372           79.7    2e-13   
ref|XP_010541176.1|  PREDICTED: probable methyltransferase PMT20      80.1    2e-13   
ref|XP_009108413.1|  PREDICTED: probable methyltransferase PMT21      79.7    2e-13   
gb|AAN60317.1|  unknown                                               79.7    2e-13   
ref|XP_002266357.1|  PREDICTED: probable methyltransferase PMT26      80.1    2e-13   
ref|XP_010506178.1|  PREDICTED: probable methyltransferase PMT19      79.7    2e-13   
ref|XP_004228376.1|  PREDICTED: probable methyltransferase PMT2       79.7    2e-13   
ref|XP_010906699.1|  PREDICTED: probable methyltransferase PMT21      79.7    2e-13   
ref|XP_006645134.1|  PREDICTED: probable methyltransferase PMT26-...  79.7    2e-13   
gb|KHG21522.1|  hypothetical protein F383_01075                       79.7    2e-13   
ref|XP_010055373.1|  PREDICTED: probable methyltransferase PMT19      79.7    2e-13   
ref|XP_010056322.1|  PREDICTED: probable methyltransferase PMT7 i...  79.3    2e-13   
gb|KJB09867.1|  hypothetical protein B456_001G171500                  79.7    2e-13   
ref|XP_010056330.1|  PREDICTED: probable methyltransferase PMT7 i...  79.3    2e-13   
ref|XP_001760536.1|  predicted protein                                79.3    2e-13   
ref|XP_007039271.1|  S-adenosyl-L-methionine-dependent methyltran...  79.3    2e-13   
gb|EAY76734.1|  hypothetical protein OsI_04689                        79.7    2e-13   
ref|NP_001045015.1|  Os01g0883900                                     79.7    2e-13   
ref|NP_190676.1|  putative methyltransferase PMT27                    79.7    2e-13   
ref|XP_002320758.2|  hypothetical protein POPTR_0014s07180g           79.3    2e-13   
ref|XP_006432559.1|  hypothetical protein CICLE_v10000643mg           79.3    2e-13   
gb|EMT17461.1|  hypothetical protein F775_31288                       79.7    2e-13   
dbj|BAD82580.1|  ankyrin-like protein                                 79.7    2e-13   
ref|XP_006295874.1|  hypothetical protein CARUB_v10025004mg           79.7    2e-13   
ref|XP_009149307.1|  PREDICTED: probable methyltransferase PMT27      79.7    3e-13   
emb|CDX94256.1|  BnaC02g29160D                                        79.3    3e-13   
ref|XP_010527657.1|  PREDICTED: probable methyltransferase PMT24      79.7    3e-13   
ref|XP_010527898.1|  PREDICTED: probable methyltransferase PMT2       79.3    3e-13   
gb|EMS53293.1|  putative methyltransferase PMT26                      79.7    3e-13   
emb|CDY33299.1|  BnaA01g19660D                                        79.3    3e-13   
ref|XP_009107959.1|  PREDICTED: probable methyltransferase PMT18      79.3    3e-13   
ref|XP_010469377.1|  PREDICTED: probable methyltransferase PMT25      79.3    3e-13   
ref|XP_002880030.1|  dehydration-responsive family protein            79.3    3e-13   
ref|XP_004503920.1|  PREDICTED: probable methyltransferase PMT26-...  79.3    3e-13   
ref|XP_010546331.1|  PREDICTED: probable methyltransferase PMT26      79.3    3e-13   
emb|CDY66721.1|  BnaC03g76010D                                        79.0    3e-13   
ref|XP_006415288.1|  hypothetical protein EUTSA_v10007126mg           79.0    3e-13   
ref|XP_011035186.1|  PREDICTED: probable methyltransferase PMT15 ...  79.0    3e-13   
ref|XP_009401236.1|  PREDICTED: probable methyltransferase PMT21      79.0    3e-13   
emb|CDY44966.1|  BnaA08g06660D                                        79.0    3e-13   
gb|KCW51108.1|  hypothetical protein EUGRSUZ_J00712                   78.6    3e-13   
ref|XP_002269747.2|  PREDICTED: probable methyltransferase PMT15      79.0    3e-13   
gb|ACN28572.1|  unknown                                               79.3    3e-13   
gb|KEH21299.1|  methyltransferase PMT16, putative                     79.0    3e-13   
gb|KHN16949.1|  Putative methyltransferase PMT26                      79.3    3e-13   
ref|XP_006397485.1|  hypothetical protein EUTSA_v10001370mg           79.0    3e-13   
ref|NP_001151565.1|  ankyrin-like protein                             79.0    3e-13   
gb|EEC67295.1|  hypothetical protein OsI_34283                        79.0    3e-13   
ref|XP_004970814.1|  PREDICTED: probable methyltransferase PMT26-...  79.3    3e-13   
ref|XP_008360714.1|  PREDICTED: probable methyltransferase PMT26      79.3    4e-13   
ref|XP_011022921.1|  PREDICTED: probable methyltransferase PMT26      79.0    4e-13   
emb|CDM85080.1|  unnamed protein product                              79.0    4e-13   
gb|KHN09623.1|  Putative methyltransferase PMT26                      79.0    4e-13   
ref|XP_008371671.1|  PREDICTED: probable methyltransferase PMT26      78.6    4e-13   
ref|XP_009124372.1|  PREDICTED: probable methyltransferase PMT18      79.0    4e-13   
ref|XP_003526869.1|  PREDICTED: probable methyltransferase PMT26-...  79.0    4e-13   
ref|XP_004964271.1|  PREDICTED: probable methyltransferase PMT17-...  79.0    4e-13   
ref|XP_010270331.1|  PREDICTED: probable methyltransferase PMT26 ...  79.0    4e-13   
ref|XP_008784684.1|  PREDICTED: probable methyltransferase PMT2       78.6    4e-13   
gb|KJB71369.1|  hypothetical protein B456_011G118900                  79.3    4e-13   
ref|XP_004503565.1|  PREDICTED: probable methyltransferase PMT18-...  78.6    4e-13   
ref|XP_006487856.1|  PREDICTED: probable methyltransferase PMT20-...  75.1    4e-13   
ref|XP_006366703.1|  PREDICTED: probable methyltransferase PMT2-l...  78.6    4e-13   
ref|XP_010270332.1|  PREDICTED: probable methyltransferase PMT26 ...  79.0    4e-13   
ref|XP_008796868.1|  PREDICTED: probable methyltransferase PMT17      78.6    4e-13   
emb|CDX84046.1|  BnaC08g07230D                                        78.6    4e-13   
ref|XP_008345949.1|  PREDICTED: probable methyltransferase PMT26      78.6    4e-13   
ref|XP_006403957.1|  hypothetical protein EUTSA_v10010109mg           79.0    4e-13   
gb|EEE51778.1|  hypothetical protein OsJ_33227                        79.0    4e-13   
ref|NP_565153.1|  putative methyltransferase PMT10                    78.6    4e-13   
emb|CDY26534.1|  BnaC01g23650D                                        79.0    4e-13   
gb|KHG15143.1|  hypothetical protein F383_09666                       79.0    4e-13   
emb|CDY39830.1|  BnaC02g42880D                                        79.0    4e-13   
ref|XP_002449126.1|  hypothetical protein SORBIDRAFT_05g005510        79.0    4e-13   
ref|XP_011035172.1|  PREDICTED: probable methyltransferase PMT15 ...  78.6    4e-13   
ref|NP_001065922.2|  Os11g0186300                                     79.0    5e-13   
emb|CDY72237.1|  BnaC08g48790D                                        77.8    5e-13   
ref|XP_010092030.1|  putative methyltransferase PMT21                 78.6    5e-13   
ref|XP_009102852.1|  PREDICTED: probable methyltransferase PMT24      78.6    5e-13   
gb|KHG06183.1|  hypothetical protein F383_31802                       79.0    5e-13   
ref|XP_002889132.1|  hypothetical protein ARALYDRAFT_339887           79.0    5e-13   
emb|CDY47694.1|  BnaCnng15360D                                        78.6    5e-13   
emb|CDY47695.1|  BnaCnng15370D                                        78.6    5e-13   
ref|XP_009115787.1|  PREDICTED: probable methyltransferase PMT27      78.6    5e-13   
emb|CDY67792.1|  BnaAnng25160D                                        78.2    5e-13   
emb|CDY44314.1|  BnaA07g07980D                                        78.6    5e-13   
ref|XP_009355841.1|  PREDICTED: probable methyltransferase PMT26      78.6    5e-13   
ref|XP_009145227.1|  PREDICTED: LOW QUALITY PROTEIN: probable met...  78.2    5e-13   
gb|KJB75964.1|  hypothetical protein B456_012G065600                  78.2    5e-13   
ref|XP_007158159.1|  hypothetical protein PHAVU_002G129100g           78.2    5e-13   
gb|KJB75961.1|  hypothetical protein B456_012G065600                  78.2    5e-13   
ref|XP_002458871.1|  hypothetical protein SORBIDRAFT_03g041910        78.6    5e-13   
gb|AAC34356.1|  Hypothetical protein                                  79.0    5e-13   
ref|XP_011075047.1|  PREDICTED: probable methyltransferase PMT20      78.2    5e-13   
ref|XP_009383568.1|  PREDICTED: probable methyltransferase PMT26      78.6    6e-13   
gb|KJB40187.1|  hypothetical protein B456_007G049800                  78.6    6e-13   
ref|XP_007210288.1|  hypothetical protein PRUPE_ppa002760mg           78.2    6e-13   
ref|XP_010518942.1|  PREDICTED: probable methyltransferase PMT20      78.2    6e-13   
ref|XP_010239480.1|  PREDICTED: probable methyltransferase PMT25      78.6    6e-13   
ref|XP_011038052.1|  PREDICTED: probable methyltransferase PMT17      78.2    6e-13   
emb|CDY22567.1|  BnaC05g24050D                                        78.2    6e-13   
ref|XP_008227415.1|  PREDICTED: probable methyltransferase PMT26      78.6    6e-13   
ref|XP_010538339.1|  PREDICTED: probable methyltransferase PMT20      78.2    6e-13   
gb|AAX94055.2|  dehydration-induced protein                           78.2    6e-13   
ref|XP_011023413.1|  PREDICTED: probable methyltransferase PMT15      78.2    6e-13   
ref|XP_008351840.1|  PREDICTED: probable methyltransferase PMT2       75.1    6e-13   
ref|XP_010934554.1|  PREDICTED: probable methyltransferase PMT15      78.2    6e-13   
ref|XP_008437487.1|  PREDICTED: probable methyltransferase PMT18      78.2    7e-13   
emb|CDY31339.1|  BnaA02g34020D                                        78.2    7e-13   
ref|XP_010090820.1|  putative methyltransferase PMT26                 78.2    7e-13   
emb|CDX94669.1|  BnaC07g09890D                                        78.2    7e-13   
emb|CDX90190.1|  BnaA08g17940D                                        78.2    7e-13   
ref|XP_009349944.1|  PREDICTED: probable methyltransferase PMT15      78.2    7e-13   
ref|XP_009130433.1|  PREDICTED: probable methyltransferase PMT26      78.2    7e-13   
ref|XP_006661944.1|  PREDICTED: probable methyltransferase PMT18-...  78.2    7e-13   
ref|XP_012070600.1|  PREDICTED: probable methyltransferase PMT26      78.2    7e-13   
ref|XP_010461135.1|  PREDICTED: probable methyltransferase PMT18      78.2    7e-13   
ref|XP_009798747.1|  PREDICTED: probable methyltransferase PMT27      78.2    7e-13   
ref|XP_002285889.2|  PREDICTED: probable methyltransferase PMT24      78.2    7e-13   
ref|XP_004304673.1|  PREDICTED: probable methyltransferase PMT9       77.8    7e-13   
ref|XP_004509540.1|  PREDICTED: probable methyltransferase PMT21-...  77.8    7e-13   
gb|AAF97349.1|AC021045_6  Unknown Protein                             77.8    7e-13   
ref|XP_006306983.1|  hypothetical protein CARUB_v10008557mg           77.8    7e-13   
gb|AAP72961.1|  putative ankyrin-like protein                         78.2    7e-13   
ref|XP_008811930.1|  PREDICTED: probable methyltransferase PMT24      78.2    7e-13   
ref|XP_010501748.1|  PREDICTED: probable methyltransferase PMT18      77.4    7e-13   
ref|XP_007214544.1|  hypothetical protein PRUPE_ppa001471mg           78.2    8e-13   
ref|XP_008462649.1|  PREDICTED: probable methyltransferase PMT26      78.2    8e-13   
ref|XP_003564784.1|  PREDICTED: probable methyltransferase PMT26      78.2    8e-13   
ref|XP_004490044.1|  PREDICTED: probable methyltransferase PMT2-l...  77.8    8e-13   
ref|XP_007158605.1|  hypothetical protein PHAVU_002G166600g           78.2    8e-13   
ref|XP_009115237.1|  PREDICTED: probable methyltransferase PMT24 ...  77.8    8e-13   
ref|XP_002891032.1|  dehydration-responsive family protein            77.8    8e-13   
ref|XP_006415121.1|  hypothetical protein EUTSA_v10007044mg           77.8    8e-13   
ref|XP_008791705.1|  PREDICTED: probable methyltransferase PMT17      77.8    8e-13   
ref|XP_008394173.1|  PREDICTED: probable methyltransferase PMT26 ...  78.2    8e-13   
ref|XP_009115236.1|  PREDICTED: probable methyltransferase PMT24 ...  77.8    8e-13   
ref|NP_564419.1|  putative methyltransferase PMT18                    77.8    8e-13   
ref|XP_010660482.1|  PREDICTED: probable methyltransferase PMT18 ...  77.8    8e-13   
ref|XP_010478718.1|  PREDICTED: probable methyltransferase PMT18      77.8    8e-13   
ref|XP_008356816.1|  PREDICTED: probable methyltransferase PMT18      77.8    9e-13   
ref|XP_009113612.1|  PREDICTED: probable methyltransferase PMT17      77.8    9e-13   
ref|XP_012078344.1|  PREDICTED: probable methyltransferase PMT24      77.8    9e-13   
emb|CBI34642.3|  unnamed protein product                              77.4    9e-13   
ref|XP_006586284.1|  PREDICTED: probable methyltransferase PMT19-...  77.4    9e-13   
ref|XP_008394175.1|  PREDICTED: probable methyltransferase PMT26 ...  77.8    9e-13   
ref|XP_010474375.1|  PREDICTED: probable methyltransferase PMT10      77.8    9e-13   
ref|XP_002270920.1|  PREDICTED: probable methyltransferase PMT18 ...  77.8    9e-13   
ref|XP_010517874.1|  PREDICTED: probable methyltransferase PMT19      77.4    9e-13   
ref|XP_004143348.1|  PREDICTED: probable methyltransferase PMT26      77.8    9e-13   
ref|XP_006415572.1|  hypothetical protein EUTSA_v10006884mg           77.8    1e-12   
ref|XP_010906388.1|  PREDICTED: probable methyltransferase PMT24      77.8    1e-12   
ref|XP_010521110.1|  PREDICTED: probable methyltransferase PMT26      77.8    1e-12   
ref|XP_010919407.1|  PREDICTED: probable methyltransferase PMT17      77.4    1e-12   
ref|XP_004309496.1|  PREDICTED: probable methyltransferase PMT18      77.4    1e-12   
ref|XP_007137790.1|  hypothetical protein PHAVU_009G155600g           77.8    1e-12   
ref|XP_012066233.1|  PREDICTED: probable methyltransferase PMT19 ...  77.4    1e-12   
ref|XP_010478312.1|  PREDICTED: probable methyltransferase PMT24 ...  77.8    1e-12   
ref|XP_010460728.1|  PREDICTED: probable methyltransferase PMT24      77.8    1e-12   
emb|CDY18904.1|  BnaC04g04460D                                        77.4    1e-12   
ref|XP_011091674.1|  PREDICTED: probable methyltransferase PMT15      77.4    1e-12   
ref|XP_008375441.1|  PREDICTED: probable methyltransferase PMT18      77.4    1e-12   
ref|XP_002893569.1|  hypothetical protein ARALYDRAFT_473159           77.8    1e-12   
ref|XP_007019267.1|  S-adenosyl-L-methionine-dependent methyltran...  77.8    1e-12   
ref|XP_009360254.1|  PREDICTED: probable methyltransferase PMT18      77.4    1e-12   
gb|ACU17089.1|  unknown                                               74.3    1e-12   
gb|EPS57356.1|  hypothetical protein M569_17462                       74.3    1e-12   
ref|XP_012066231.1|  PREDICTED: probable methyltransferase PMT19 ...  77.4    1e-12   
ref|XP_002864883.1|  hypothetical protein ARALYDRAFT_496597           77.8    1e-12   
gb|ERN08735.1|  hypothetical protein AMTR_s00017p00240980             77.8    1e-12   
ref|XP_006420647.1|  hypothetical protein CICLE_v10006580mg           74.3    1e-12   
ref|XP_007159858.1|  hypothetical protein PHAVU_002G273700g           77.8    1e-12   
emb|CDX99539.1|  BnaC09g24530D                                        77.4    1e-12   
ref|XP_004502956.1|  PREDICTED: probable methyltransferase PMT26-...  77.4    1e-12   



>ref|XP_009620566.1| PREDICTED: probable methyltransferase PMT13 [Nicotiana tomentosiformis]
Length=599

 Score =   232 bits (591),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 145/165 (88%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            MGHL+L SS RN R+W+LLDLV AAFFAAV +FFLL+ TPLGDSLAASGRQ+LL   SGD
Sbjct  1    MGHLNLPSSKRNVRQWRLLDLVSAAFFAAVLIFFLLLCTPLGDSLAASGRQSLLRSASGD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
             +QRS LV+ VESGR+   I  CPADYVDHMPCEDPR+NSQLSREMNYYRERHCPLP +T
Sbjct  61   PRQRSRLVSQVESGRQTTGIDACPADYVDHMPCEDPRLNSQLSREMNYYRERHCPLPKDT  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPPP+GY+V V WP+SLHKI+H+NMPYNKIADRKGHQGWMK
Sbjct  121  PLCLIPPPQGYRVSVHWPDSLHKIWHENMPYNKIADRKGHQGWMK  165



>ref|XP_009782445.1| PREDICTED: probable methyltransferase PMT13 [Nicotiana sylvestris]
Length=599

 Score =   231 bits (590),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 128/165 (78%), Positives = 144/165 (87%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            MGHL+L SS RN R+W+LLDLV AAFFAAV +FFLL+ TPLGDSLAASGRQ+LL   SGD
Sbjct  1    MGHLNLPSSKRNVRQWRLLDLVSAAFFAAVLIFFLLLCTPLGDSLAASGRQSLLRSASGD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
             +QRS LV  VESGR+   I  CPADYVDHMPCEDPR+NSQLSREMNYYRERHCPLP +T
Sbjct  61   PRQRSRLVAQVESGRQTTGIDACPADYVDHMPCEDPRLNSQLSREMNYYRERHCPLPKDT  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPPP+GY+V V WP+SLHKI+H+NMPYNKIADRKGHQGWMK
Sbjct  121  PLCLIPPPQGYRVSVHWPDSLHKIWHENMPYNKIADRKGHQGWMK  165



>ref|XP_010457020.1| PREDICTED: probable methyltransferase PMT13, partial [Camelina 
sativa]
Length=328

 Score =   222 bits (565),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 140/165 (85%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            MGHLSL +S RN R+W+LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   + D
Sbjct  1    MGHLSLPASKRNPRQWRLLDIVTAAFFGIVLLFFVLLFTPLGDSMAASGRQTLLLSTASD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
             +QR  LV LVE+G+ + PI++CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PRQRQRLVALVEAGQHLQPIEYCPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPPP GYK+PV WPESLHKI+H NMPYNKIADRKGHQGWMK
Sbjct  121  PLCLIPPPSGYKIPVPWPESLHKIWHANMPYNKIADRKGHQGWMK  165



>ref|XP_006339458.1| PREDICTED: probable methyltransferase PMT13-like [Solanum tuberosum]
Length=599

 Score =   227 bits (578),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 142/165 (86%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            MGHL+L SS RN R+W+LLDLV AAFFAAV +FFLL+ TPLGDSLAASGRQ LL   SGD
Sbjct  1    MGHLNLPSSKRNVRQWRLLDLVSAAFFAAVLIFFLLLCTPLGDSLAASGRQTLLRSASGD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
             +QRS L+  VESGR    I  C ADYVD+MPCEDPRINSQLSREMN+YRERHCPLP +T
Sbjct  61   PRQRSRLIAQVESGRHNTAIDACSADYVDYMPCEDPRINSQLSREMNFYRERHCPLPKDT  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPP +GY+VPV+WPESLHKI+H+NMPYNKIADRKGHQGWMK
Sbjct  121  PLCLIPPTQGYRVPVQWPESLHKIWHENMPYNKIADRKGHQGWMK  165



>ref|XP_004229834.1| PREDICTED: probable methyltransferase PMT13 [Solanum lycopersicum]
Length=599

 Score =   226 bits (577),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 126/165 (76%), Positives = 142/165 (86%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            MGHL+L SS RN R+W+LLDLV AAFFAAV +FFLL+ TPLGDSLAASGRQ LL   SGD
Sbjct  1    MGHLNLPSSKRNVRQWRLLDLVSAAFFAAVLIFFLLLCTPLGDSLAASGRQTLLRSASGD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
             +QRS L+  VESGR    I  C ADYVD+MPCEDPRINSQLSREMN+YRERHCPLP +T
Sbjct  61   PRQRSRLIAQVESGRHNTAIDACSADYVDYMPCEDPRINSQLSREMNFYRERHCPLPKDT  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPP +GY+VPV+WPESLHKI+H+NMPYNKIADRKGHQGWMK
Sbjct  121  PLCLIPPTQGYRVPVQWPESLHKIWHENMPYNKIADRKGHQGWMK  165



>ref|XP_006286483.1| hypothetical protein CARUB_v10000518mg [Capsella rubella]
 gb|EOA19381.1| hypothetical protein CARUB_v10000518mg [Capsella rubella]
Length=536

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 141/165 (85%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            MGHLSL +S RN R+W+LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   + D
Sbjct  1    MGHLSLPASKRNPRQWRLLDIVTAAFFGIVLLFFILLFTPLGDSMAASGRQTLLLSTASD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
             +QR  LVTLVE+G+ + PI++CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PRQRQRLVTLVEAGQHLQPIEYCPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPPP GYK+PV WPESLHKI+H NMPYNKIADRKGHQGWMK
Sbjct  121  PLCLIPPPSGYKIPVPWPESLHKIWHANMPYNKIADRKGHQGWMK  165



>ref|XP_006396269.1| hypothetical protein EUTSA_v10028525mg [Eutrema salsugineum]
 gb|ESQ37722.1| hypothetical protein EUTSA_v10028525mg [Eutrema salsugineum]
Length=599

 Score =   225 bits (574),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 142/165 (86%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            MGHL+L +S RN R+W+LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   + D
Sbjct  1    MGHLNLPASKRNPRQWRLLDIVTAAFFGIVLLFFILLFTPLGDSMAASGRQTLLLSTASD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
             +QR  LVTLVE+G+ + PI++CPA+ VDHMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PRQRQRLVTLVEAGQHLQPIEYCPAEAVDHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPPP GYK+PV WPESLHKI+H NMPYNKIADRKGHQGWMK
Sbjct  121  PLCLIPPPSGYKIPVPWPESLHKIWHANMPYNKIADRKGHQGWMK  165



>ref|XP_010427357.1| PREDICTED: probable methyltransferase PMT13 [Camelina sativa]
Length=599

 Score =   225 bits (573),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 142/165 (86%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            MGHLSL +S RN R+W+LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   + D
Sbjct  1    MGHLSLPASKRNPRQWRLLDIVTAAFFGIVLLFFVLLFTPLGDSMAASGRQTLLLSTASD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
             +QR  LVTLVE+G+ + PI++CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PRQRQRLVTLVEAGQHLQPIEYCPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPPPEGYK+PV WP+SLHKI+H NMPYNKIADRKGHQGWMK
Sbjct  121  PLCLIPPPEGYKIPVPWPQSLHKIWHANMPYNKIADRKGHQGWMK  165



>ref|XP_006286484.1| hypothetical protein CARUB_v10000518mg [Capsella rubella]
 gb|EOA19382.1| hypothetical protein CARUB_v10000518mg [Capsella rubella]
Length=599

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 141/165 (85%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            MGHLSL +S RN R+W+LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   + D
Sbjct  1    MGHLSLPASKRNPRQWRLLDIVTAAFFGIVLLFFILLFTPLGDSMAASGRQTLLLSTASD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
             +QR  LVTLVE+G+ + PI++CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PRQRQRLVTLVEAGQHLQPIEYCPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPPP GYK+PV WPESLHKI+H NMPYNKIADRKGHQGWMK
Sbjct  121  PLCLIPPPSGYKIPVPWPESLHKIWHANMPYNKIADRKGHQGWMK  165



>ref|XP_006445145.1| hypothetical protein CICLE_v10019404mg [Citrus clementina]
 gb|ESR58385.1| hypothetical protein CICLE_v10019404mg [Citrus clementina]
 gb|KDO86018.1| hypothetical protein CISIN_1g007645mg [Citrus sinensis]
Length=595

 Score =   224 bits (571),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 139/164 (85%), Gaps = 2/164 (1%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  460
            MGHL+L +S RNAR+W+LLD+V A FF  V +FFLLVFTPLGDSLAASGRQALL  + D 
Sbjct  1    MGHLNLPASKRNARQWKLLDIVSATFFGLVLLFFLLVFTPLGDSLAASGRQALLMSTSDP  60

Query  461  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  640
            +QR  LV L+E+G  + PI+ CPAD VDHMPCEDPR NSQLSREMN+YRERHCPLP +TP
Sbjct  61   RQRQRLVALIEAGHHVKPIESCPADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPDQTP  120

Query  641  ICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +CLIPPP GYK+PV WPESL KI+H NMPYNKIADRKGHQGWMK
Sbjct  121  LCLIPPPRGYKIPVPWPESLSKIWHANMPYNKIADRKGHQGWMK  164



>ref|XP_010419629.1| PREDICTED: probable methyltransferase PMT13 [Camelina sativa]
Length=599

 Score =   224 bits (571),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 140/165 (85%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            MGHLSL +S RN R+W+LLD+V A FF  V +FF+L+FTPLGDS+AASGRQ LL   + D
Sbjct  1    MGHLSLPASKRNPRQWRLLDIVTAVFFGIVLLFFVLLFTPLGDSMAASGRQTLLLSTASD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
             +QR  LVTLVE+G+ + PI++CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PRQRQRLVTLVEAGQHLQPIEYCPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPPP GYK+PV WPESLHKI+H NMPYNKIADRKGHQGWMK
Sbjct  121  PLCLIPPPSGYKIPVPWPESLHKIWHANMPYNKIADRKGHQGWMK  165



>ref|XP_006491019.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT13-like 
[Citrus sinensis]
Length=598

 Score =   224 bits (570),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 139/164 (85%), Gaps = 2/164 (1%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  460
            MGHL+L +S RNAR+W+LLD+V A FF  V +FFLLVFTPLGDSLAASGRQALL  + D 
Sbjct  1    MGHLNLPASKRNARQWKLLDIVSATFFGLVLLFFLLVFTPLGDSLAASGRQALLMSTSDP  60

Query  461  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  640
            +QR  LV L+E+G  + PI+ CPAD VDHMPCEDPR NSQLSREMN+YRERHCPLP +TP
Sbjct  61   RQRQRLVALIEAGHHVKPIESCPADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPDQTP  120

Query  641  ICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +CLIPPP GYK+PV WPESL KI+H NMPYNKIADRKGHQGWMK
Sbjct  121  LCLIPPPRGYKIPVPWPESLSKIWHANMPYNKIADRKGHQGWMK  164



>ref|XP_011091711.1| PREDICTED: probable methyltransferase PMT13 [Sesamum indicum]
Length=597

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 139/163 (85%), Gaps = 1/163 (1%)
 Frame = +2

Query  287  MGHLSLFSS-HRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALLSGDSQ  463
            MG L+L SS HR+ R+W+LLD+V AAFF AV +FFLLVFTPLGDSLAASGR+ LL  D +
Sbjct  1    MGLLNLPSSKHRHTRQWRLLDIVTAAFFGAVLLFFLLVFTPLGDSLAASGRRTLLRTDPR  60

Query  464  QRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPI  643
             R  LV LVE GR+ A I  CP D VDHMPCEDPRINSQLSREMNYYRERHCP P ETP+
Sbjct  61   LRERLVALVEFGRQTAAIDACPVDMVDHMPCEDPRINSQLSREMNYYRERHCPRPEETPL  120

Query  644  CLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            CLIPPPEGY+VPV+WP+SLHKI+HDNMPYNKIADRKGHQGWMK
Sbjct  121  CLIPPPEGYRVPVQWPDSLHKIWHDNMPYNKIADRKGHQGWMK  163



>gb|EYU32065.1| hypothetical protein MIMGU_mgv1a003241mg [Erythranthe guttata]
Length=597

 Score =   222 bits (566),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 126/163 (77%), Positives = 140/163 (86%), Gaps = 1/163 (1%)
 Frame = +2

Query  287  MGHLSLFSS-HRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALLSGDSQ  463
            MG L+L SS +R+AR+W+LLD+V AAFFAAV +FFLLVFTPLGDSLAASGRQ LL  D +
Sbjct  1    MGLLNLSSSKNRHARQWRLLDIVTAAFFAAVLLFFLLVFTPLGDSLAASGRQTLLRSDPR  60

Query  464  QRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPI  643
             R  LV LVE GR+   I  CPAD V HMPCEDPRINSQLSREMN+YRERHCPLP ETP+
Sbjct  61   HRGRLVALVELGRQAVAIDACPADMVAHMPCEDPRINSQLSREMNFYRERHCPLPTETPL  120

Query  644  CLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            CLIPPPEGY+V V+WPESLHKI+HDNMPYNKIADRKGHQGWMK
Sbjct  121  CLIPPPEGYRVSVQWPESLHKIWHDNMPYNKIADRKGHQGWMK  163



>ref|XP_010529254.1| PREDICTED: probable methyltransferase PMT13 [Tarenaya hassleriana]
Length=599

 Score =   219 bits (558),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 142/165 (86%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            MGHL+L +S R +R+W+LLD+V AAFFA VF+FFLL+FTPLGDS+AASGRQALL   + D
Sbjct  1    MGHLNLPASKRGSRQWRLLDIVSAAFFAIVFLFFLLIFTPLGDSMAASGRQALLLSTASD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
              QR  LV LVE+G+   PI++C ++ VDHMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PAQRQRLVALVEAGQHQQPIEYCSSEAVDHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPPP GYK+PVRWP+SLHKI+H NMPYNKIADRKGHQGWMK
Sbjct  121  PLCLIPPPPGYKIPVRWPDSLHKIWHANMPYNKIADRKGHQGWMK  165



>emb|CDY07198.1| BnaCnng02130D [Brassica napus]
Length=599

 Score =   218 bits (555),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 120/165 (73%), Positives = 138/165 (84%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            M HL+L  S RN R+W+LLD++ AAFFA V +FF+L+FTPLGDS+AASGRQ LL   + D
Sbjct  1    MKHLNLPFSKRNPRQWRLLDIITAAFFAVVLLFFILLFTPLGDSMAASGRQTLLVSTTSD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
             +QR  LVTLVESG  + PI++CPAD V HMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PRQRQRLVTLVESGHHLQPIEYCPADAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPPP GYK+ V WPESLHKI+H NMPYNKIADRKGHQGWMK
Sbjct  121  PLCLIPPPNGYKISVPWPESLHKIWHANMPYNKIADRKGHQGWMK  165



>ref|XP_008383241.1| PREDICTED: probable methyltransferase PMT13 [Malus domestica]
Length=599

 Score =   218 bits (554),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 139/165 (84%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            MGHL+L +S R+ R+W+LLDL+ A FF  V VFFLLVFTPLGDSLAASGRQALL   + D
Sbjct  1    MGHLNLPASKRSPRQWRLLDLISAXFFGIVIVFFLLVFTPLGDSLAASGRQALLLSTNAD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
             +QR  LV LVE G+   PI+ CPA+ VDHMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PKQRHRLVALVELGQHHQPIEACPANAVDHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPPP GYK+PVRWP+SL KI+HDNMP+NKIADRKGHQGWMK
Sbjct  121  PLCLIPPPNGYKIPVRWPDSLTKIWHDNMPHNKIADRKGHQGWMK  165



>ref|XP_007220546.1| hypothetical protein PRUPE_ppa003145mg [Prunus persica]
 gb|EMJ21745.1| hypothetical protein PRUPE_ppa003145mg [Prunus persica]
Length=599

 Score =   217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 123/165 (75%), Positives = 139/165 (84%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            MGHL+L +S R+ R+W+LLDLV AAFF  V VFFLLVFTPLGDSLAASGRQALL   + D
Sbjct  1    MGHLNLPASKRSPRQWRLLDLVSAAFFGIVIVFFLLVFTPLGDSLAASGRQALLLSTNAD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
             +QR  LV LVE G+   PI+ CP D VDHMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PRQRHRLVALVELGQHQQPIEACPVDAVDHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPPP GYK+PV+WP+SLHKI+H NMP+NKIADRKGHQGWMK
Sbjct  121  PLCLIPPPNGYKIPVQWPDSLHKIWHSNMPHNKIADRKGHQGWMK  165



>ref|NP_567184.1| type II membrane pectin methyltransferase [Arabidopsis thaliana]
 sp|Q93W95.1|PMTD_ARATH RecName: Full=Probable methyltransferase PMT13 [Arabidopsis thaliana]
 gb|AAL24317.1| Unknown protein [Arabidopsis thaliana]
 gb|AAL24395.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN15470.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP37736.1| At4g00740 [Arabidopsis thaliana]
 gb|AEE81928.1| type II membrane pectin methyltransferase [Arabidopsis thaliana]
Length=600

 Score =   217 bits (552),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 141/166 (85%), Gaps = 4/166 (2%)
 Frame = +2

Query  287  MGHLSLFSSHR-NARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SG  454
            MGH++L +S R N R+W+LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   + 
Sbjct  1    MGHVNLPASKRGNPRQWRLLDIVTAAFFGIVLLFFILLFTPLGDSMAASGRQTLLLSTAS  60

Query  455  DSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHE  634
            D +QR  LVTLVE+G+ + PI++CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP E
Sbjct  61   DPRQRQRLVTLVEAGQHLQPIEYCPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEE  120

Query  635  TPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            TP+CLIPPP GYK+PV WPESLHKI+H NMPYNKIADRKGHQGWMK
Sbjct  121  TPLCLIPPPSGYKIPVPWPESLHKIWHANMPYNKIADRKGHQGWMK  166



>gb|KJB22349.1| hypothetical protein B456_004G042500 [Gossypium raimondii]
Length=598

 Score =   216 bits (550),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 123/164 (75%), Positives = 138/164 (84%), Gaps = 2/164 (1%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  460
            MGHL+L  S RN R+W+LLD+V A FFA V +FFLLVFTPLGDSLAASGRQALL  + D 
Sbjct  1    MGHLNLPPSKRNPRQWKLLDIVSAFFFALVLLFFLLVFTPLGDSLAASGRQALLLSTSDP  60

Query  461  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  640
            +QR  LV L+E G    PI+ CPAD VDHMPCEDPR NSQLSREMN+YRERHCPLP ETP
Sbjct  61   KQRHRLVELLELGHHHQPIEACPADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPDETP  120

Query  641  ICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +CLIPPP GYK+PV+WPESLHKI+H NMP+NKIADRKGHQGWMK
Sbjct  121  LCLIPPPLGYKIPVQWPESLHKIWHSNMPHNKIADRKGHQGWMK  164



>ref|XP_002272714.1| PREDICTED: probable methyltransferase PMT13 [Vitis vinifera]
 ref|XP_010661563.1| PREDICTED: probable methyltransferase PMT13 [Vitis vinifera]
 ref|XP_010661564.1| PREDICTED: probable methyltransferase PMT13 [Vitis vinifera]
 emb|CBI38767.3| unnamed protein product [Vitis vinifera]
Length=597

 Score =   215 bits (547),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 122/164 (74%), Positives = 142/164 (87%), Gaps = 3/164 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  460
            MGHL+L SS RNAR+++LLDLV A+FF  V +FFLLVFTPLGDSLAASGRQALL  + D 
Sbjct  1    MGHLNLPSSKRNARQYRLLDLVTASFFGIVIIFFLLVFTPLGDSLAASGRQALLLSTADP  60

Query  461  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  640
            +QR  LV LVE+G++ A I+ CPA+ VDHMPCEDPR NSQLSREMN+YRER CPLP ETP
Sbjct  61   RQRQRLVALVEAGQQQA-IEACPAEEVDHMPCEDPRRNSQLSREMNFYRERQCPLPAETP  119

Query  641  ICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +CLIPPP+GY +PVRWP+SLHKI+H NMP+NKIADRKGHQGWMK
Sbjct  120  LCLIPPPDGYHIPVRWPDSLHKIWHSNMPHNKIADRKGHQGWMK  163



>gb|KJB41230.1| hypothetical protein B456_007G095900 [Gossypium raimondii]
Length=493

 Score =   212 bits (540),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 137/164 (84%), Gaps = 2/164 (1%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  460
            MGHL+L +S RN R+W+LLD++ A FF  V +FFLLVFTPLGDS+AASGRQALL  + D 
Sbjct  1    MGHLNLPASKRNPRQWKLLDIITAIFFGLVLLFFLLVFTPLGDSMAASGRQALLLSTSDP  60

Query  461  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  640
            +QR  LV+LVE G    PI+ CPA+ VDHMPCEDPR NSQLSREMN YRERHCPLP E P
Sbjct  61   RQRHRLVSLVELGHHHKPIEACPANSVDHMPCEDPRRNSQLSREMNLYRERHCPLPDEMP  120

Query  641  ICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +CLIPPP GYK+PV+WPESLHKI+H NMP+NKIADRKGHQGWMK
Sbjct  121  LCLIPPPPGYKIPVQWPESLHKIWHSNMPHNKIADRKGHQGWMK  164



>ref|XP_009349940.1| PREDICTED: probable methyltransferase PMT13 [Pyrus x bretschneideri]
Length=599

 Score =   214 bits (546),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 121/165 (73%), Positives = 139/165 (84%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            MGHL+L +S R+ R+W+LLDL+ AAFF  V VFF+LVFTPLGDSLAASGRQALL   + D
Sbjct  1    MGHLNLPASKRSPRQWRLLDLISAAFFGIVIVFFVLVFTPLGDSLAASGRQALLLSTNAD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
             +QR  LV LVE G+   PI+ C A+ VDHMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PKQRHRLVALVELGQHHQPIEACLANAVDHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPPP GYK+PVRWP+SL KI+HDNMP+NKIADRKGHQGWMK
Sbjct  121  PLCLIPPPNGYKIPVRWPDSLTKIWHDNMPHNKIADRKGHQGWMK  165



>ref|XP_009343540.1| PREDICTED: probable methyltransferase PMT13 [Pyrus x bretschneideri]
Length=599

 Score =   214 bits (545),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 139/165 (84%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            MGHL+L +S R++R+ +LLDL+ AAFF  V  FFLLVFTPLGDSLAASGRQALL   + D
Sbjct  1    MGHLNLPASKRSSRQCRLLDLISAAFFGIVIFFFLLVFTPLGDSLAASGRQALLLSTNAD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
             +QR  LVTLVE G+   PI+ CPAD VDHMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PKQRHRLVTLVELGQHHQPIEACPADAVDHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPPP GYK+PV WP+SL KI+HDNMP+NKIADRKGHQGWMK
Sbjct  121  PLCLIPPPNGYKIPVPWPDSLTKIWHDNMPHNKIADRKGHQGWMK  165



>gb|KHG02077.1| hypothetical protein F383_25150 [Gossypium arboreum]
Length=525

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 137/164 (84%), Gaps = 2/164 (1%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  460
            MGHL+L +S RN R+W+LLD++ A FF  V +FFLLVFTPLGDS+AASGRQALL  + D 
Sbjct  1    MGHLNLPASKRNPRQWKLLDIITAIFFGLVLLFFLLVFTPLGDSMAASGRQALLLSTSDP  60

Query  461  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  640
            +QR  LV+LVE G    PI+ CPA+ VDHMPCEDPR NSQLSREMN YRERHCPLP E P
Sbjct  61   RQRHRLVSLVELGHHHKPIEACPANSVDHMPCEDPRRNSQLSREMNLYRERHCPLPDEMP  120

Query  641  ICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +CLIPPP GYK+PV+WPESLHKI+H NMP+NKIADRKGHQGWMK
Sbjct  121  LCLIPPPPGYKIPVQWPESLHKIWHSNMPHNKIADRKGHQGWMK  164



>gb|KJB41231.1| hypothetical protein B456_007G095900 [Gossypium raimondii]
Length=525

 Score =   212 bits (540),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 137/164 (84%), Gaps = 2/164 (1%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  460
            MGHL+L +S RN R+W+LLD++ A FF  V +FFLLVFTPLGDS+AASGRQALL  + D 
Sbjct  1    MGHLNLPASKRNPRQWKLLDIITAIFFGLVLLFFLLVFTPLGDSMAASGRQALLLSTSDP  60

Query  461  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  640
            +QR  LV+LVE G    PI+ CPA+ VDHMPCEDPR NSQLSREMN YRERHCPLP E P
Sbjct  61   RQRHRLVSLVELGHHHKPIEACPANSVDHMPCEDPRRNSQLSREMNLYRERHCPLPDEMP  120

Query  641  ICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +CLIPPP GYK+PV+WPESLHKI+H NMP+NKIADRKGHQGWMK
Sbjct  121  LCLIPPPPGYKIPVQWPESLHKIWHSNMPHNKIADRKGHQGWMK  164



>ref|XP_012083471.1| PREDICTED: probable methyltransferase PMT13 [Jatropha curcas]
 gb|KDP28683.1| hypothetical protein JCGZ_14454 [Jatropha curcas]
Length=598

 Score =   214 bits (544),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 120/164 (73%), Positives = 139/164 (85%), Gaps = 2/164 (1%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  460
            MGHL+L +S RN R+W+LLDLV A FF  VF+FFLLVFTPLGDSLAASGRQALL  + D 
Sbjct  1    MGHLNLPASKRNPRQWKLLDLVSAVFFGLVFLFFLLVFTPLGDSLAASGRQALLLSTSDP  60

Query  461  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  640
            +QR  LV L+E+GR   PI+ C AD VDHMPCEDPR NSQLSREMN+YRERHCPLP +TP
Sbjct  61   RQRHRLVELIETGRHPQPIEACTADAVDHMPCEDPRRNSQLSREMNFYRERHCPLPDDTP  120

Query  641  ICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +CLIPPP GY++ V+WP+SLHKI+H NMP+NKIADRKGHQGWMK
Sbjct  121  LCLIPPPNGYRISVQWPQSLHKIWHANMPHNKIADRKGHQGWMK  164



>ref|XP_008438089.1| PREDICTED: probable methyltransferase PMT13 [Cucumis melo]
Length=593

 Score =   213 bits (543),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 141/164 (86%), Gaps = 3/164 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  460
            MGH++L +S RN R+W+LLD+V A FF  V +FFLLVFT LGDSLAASGRQ LL  + D 
Sbjct  1    MGHVNLPASKRNGRQWRLLDIVSAVFFGLVLLFFLLVFTRLGDSLAASGRQTLLLSNADP  60

Query  461  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  640
            +QR  ++ LVE+G++ A I+ CPAD VDHMPCEDPR NSQLSREMNYYRERHCPLP+ETP
Sbjct  61   RQRQRIMELVEAGQKQA-IEACPADAVDHMPCEDPRRNSQLSREMNYYRERHCPLPYETP  119

Query  641  ICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +CLIPPP+GYK+PV+WPESLHKI+H NMP+NKIADRKGHQGWMK
Sbjct  120  LCLIPPPDGYKIPVQWPESLHKIWHSNMPHNKIADRKGHQGWMK  163



>ref|XP_009111460.1| PREDICTED: probable methyltransferase PMT13 [Brassica rapa]
Length=591

 Score =   213 bits (543),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 117/165 (71%), Positives = 137/165 (83%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            M HL+L  S RN R+W+L+D++ AAFFA V +FF+L+FTPL DS+AASGRQ LL   + D
Sbjct  1    MKHLNLPFSKRNPRQWRLVDIITAAFFAVVLLFFILLFTPLRDSMAASGRQTLLISTASD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
             +QR  LVTLVESG  + PI++CPAD V HMPCEDP+ NSQLSREMN+YRERHCPLP ET
Sbjct  61   PRQRQRLVTLVESGHHLQPIEYCPADAVAHMPCEDPKRNSQLSREMNFYRERHCPLPEET  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPPP GYK+ V WPESLHKI+H NMPYNKIADRKGHQGWMK
Sbjct  121  PLCLIPPPNGYKISVPWPESLHKIWHANMPYNKIADRKGHQGWMK  165



>gb|KJB41229.1| hypothetical protein B456_007G095900 [Gossypium raimondii]
 gb|KJB41232.1| hypothetical protein B456_007G095900 [Gossypium raimondii]
Length=597

 Score =   213 bits (542),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 137/164 (84%), Gaps = 2/164 (1%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  460
            MGHL+L +S RN R+W+LLD++ A FF  V +FFLLVFTPLGDS+AASGRQALL  + D 
Sbjct  1    MGHLNLPASKRNPRQWKLLDIITAIFFGLVLLFFLLVFTPLGDSMAASGRQALLLSTSDP  60

Query  461  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  640
            +QR  LV+LVE G    PI+ CPA+ VDHMPCEDPR NSQLSREMN YRERHCPLP E P
Sbjct  61   RQRHRLVSLVELGHHHKPIEACPANSVDHMPCEDPRRNSQLSREMNLYRERHCPLPDEMP  120

Query  641  ICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +CLIPPP GYK+PV+WPESLHKI+H NMP+NKIADRKGHQGWMK
Sbjct  121  LCLIPPPPGYKIPVQWPESLHKIWHSNMPHNKIADRKGHQGWMK  164



>ref|XP_008232740.1| PREDICTED: probable methyltransferase PMT13 [Prunus mume]
Length=599

 Score =   213 bits (542),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 137/165 (83%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            MGHL+L +S R+ R W+LLDLV AAFF  V VFFLLVFT LGDSLAASGRQALL   + D
Sbjct  1    MGHLNLPASKRSPRHWRLLDLVSAAFFGIVIVFFLLVFTRLGDSLAASGRQALLLSTNAD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
             +QR  LV LVE G+   PI+ CP D VDHMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PKQRHRLVALVELGQHQQPIEACPVDAVDHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPPP GYK+PV+WP+SLHKI+H NMP+NKIADRKGHQGWMK
Sbjct  121  PLCLIPPPNGYKIPVQWPDSLHKIWHSNMPHNKIADRKGHQGWMK  165



>ref|XP_010278571.1| PREDICTED: probable methyltransferase PMT13 [Nelumbo nucifera]
Length=595

 Score =   213 bits (541),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 118/162 (73%), Positives = 140/162 (86%), Gaps = 1/162 (1%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALLSGDSQQ  466
            MGHL+L SS RN+R+W+LLDLV AA F AVFVFFLLVFTPLGDSLAASGRQ L   D +Q
Sbjct  1    MGHLNLPSSKRNSRQWRLLDLVSAALFGAVFVFFLLVFTPLGDSLAASGRQTLSMADPRQ  60

Query  467  RSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPIC  646
            R  ++ L+E+G++   I+ CPAD VD+MPCEDPR NSQLSREMN+YRERHCPLP ETP+C
Sbjct  61   RQRMIALIEAGQQ-QTIEACPADAVDYMPCEDPRRNSQLSREMNFYRERHCPLPEETPLC  119

Query  647  LIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            LIPPP+GY++ V+WP+SLHKI+H NMP+NKIADRKGHQGWMK
Sbjct  120  LIPPPDGYRISVQWPDSLHKIWHSNMPHNKIADRKGHQGWMK  161



>ref|XP_008385702.1| PREDICTED: probable methyltransferase PMT13 [Malus domestica]
Length=599

 Score =   213 bits (541),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 122/165 (74%), Positives = 140/165 (85%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            MGHL+L +S R++R+ +LLDL+ AAFF  V VFFLLVFTPLGDSLAASGRQALL   + D
Sbjct  1    MGHLNLPASKRSSRQCRLLDLISAAFFGIVIVFFLLVFTPLGDSLAASGRQALLLSTNAD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
             +QR  LVTLVE G+   PI+ CPA+ VDHMPCEDPR NSQLSREMN+YRERHCPLP ET
Sbjct  61   PKQRHRLVTLVELGQHHQPIEACPAEAVDHMPCEDPRRNSQLSREMNFYRERHCPLPEET  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPPP GYK+PV WP+SL KI+HDNMP+NKIADRKGHQGWMK
Sbjct  121  PLCLIPPPNGYKIPVPWPDSLTKIWHDNMPHNKIADRKGHQGWMK  165



>ref|XP_004133879.1| PREDICTED: probable methyltransferase PMT13 [Cucumis sativus]
 gb|KGN56547.1| hypothetical protein Csa_3G123200 [Cucumis sativus]
Length=593

 Score =   212 bits (539),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 119/164 (73%), Positives = 141/164 (86%), Gaps = 3/164 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  460
            MGH++L +S RN R+W+LLD+V AAFF  V +FFLLVFT LGDSLAASGRQ LL  + D 
Sbjct  1    MGHVNLPASKRNGRQWRLLDIVSAAFFGLVLLFFLLVFTRLGDSLAASGRQTLLLSNADP  60

Query  461  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  640
             QR  ++ LVE+G++ A I+ CPA+ VDHMPCEDPR NSQLSREMNYYRERHCPLP+ETP
Sbjct  61   GQRQRIMELVEAGQKQA-IEACPAEAVDHMPCEDPRRNSQLSREMNYYRERHCPLPYETP  119

Query  641  ICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +CLIPPP+GYK+PV+WPESLHKI+H NMP+NKIADRKGHQGWMK
Sbjct  120  LCLIPPPDGYKIPVQWPESLHKIWHSNMPHNKIADRKGHQGWMK  163



>ref|XP_002872932.1| hypothetical protein ARALYDRAFT_490495 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49191.1| hypothetical protein ARALYDRAFT_490495 [Arabidopsis lyrata subsp. 
lyrata]
Length=602

 Score =   211 bits (537),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 119/168 (71%), Positives = 140/168 (83%), Gaps = 6/168 (4%)
 Frame = +2

Query  287  MGHLSLFSSHR--NARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---S  451
            MGHL+L +S R  N R+W LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   +
Sbjct  1    MGHLNLPASKRSSNPRQWCLLDIVTAAFFGIVLLFFILLFTPLGDSMAASGRQTLLLSTA  60

Query  452  GDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPH  631
             D +QR  LVTLVE+G+ + PI++CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP 
Sbjct  61   SDPRQRQRLVTLVEAGQHLQPIEYCPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPE  120

Query  632  ETPICLIPPPEGYKVPVRWPESLHKI-FHDNMPYNKIADRKGHQGWMK  772
            ETP+CLIPPP GYK+PV WPESLHK+ +H NMPYNKIADRKGHQGWMK
Sbjct  121  ETPLCLIPPPSGYKIPVPWPESLHKVLWHANMPYNKIADRKGHQGWMK  168



>ref|XP_009134532.1| PREDICTED: probable methyltransferase PMT13 [Brassica rapa]
Length=597

 Score =   211 bits (537),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 131/158 (83%), Gaps = 3/158 (2%)
 Frame = +2

Query  308  SSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGDSQQRSLL  478
            S   N R+W LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   + D +QR  L
Sbjct  6    SKRNNQRQWSLLDIVTAAFFGIVLLFFILLFTPLGDSMAASGRQTLLLSTASDPRQRQRL  65

Query  479  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  658
            VTLVESG+ + PI++CPAD V HMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPP
Sbjct  66   VTLVESGQHLQPIEYCPADAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEETPLCLIPP  125

Query  659  PEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P GYK+ V WPESLHKI+H NMPYNKIADRKGHQGWMK
Sbjct  126  PSGYKISVPWPESLHKIWHANMPYNKIADRKGHQGWMK  163



>emb|CDX74348.1| BnaA03g26990D [Brassica napus]
Length=597

 Score =   211 bits (536),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 131/158 (83%), Gaps = 3/158 (2%)
 Frame = +2

Query  308  SSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGDSQQRSLL  478
            S   N R+W LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   + D +QR  L
Sbjct  6    SKRNNQRQWSLLDIVTAAFFGIVLLFFILLFTPLGDSMAASGRQTLLLSTASDPRQRQRL  65

Query  479  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  658
            VTLVESG+ + PI++CPAD V HMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPP
Sbjct  66   VTLVESGQHLQPIEYCPADAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEETPLCLIPP  125

Query  659  PEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P GYK+ V WPESLHKI+H NMPYNKIADRKGHQGWMK
Sbjct  126  PSGYKISVPWPESLHKIWHANMPYNKIADRKGHQGWMK  163



>emb|CDX91893.1| BnaC03g31950D [Brassica napus]
Length=597

 Score =   211 bits (536),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 131/158 (83%), Gaps = 3/158 (2%)
 Frame = +2

Query  308  SSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGDSQQRSLL  478
            S   N R+W LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   + D +QR  L
Sbjct  6    SKRNNQRQWSLLDIVTAAFFGIVLLFFILLFTPLGDSMAASGRQTLLLSTASDPRQRQRL  65

Query  479  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  658
            VTLVESG+ + PI++CPAD V HMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPP
Sbjct  66   VTLVESGQHLQPIEYCPADAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEETPLCLIPP  125

Query  659  PEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P GYK+ V WPESLHKI+H NMPYNKIADRKGHQGWMK
Sbjct  126  PSGYKISVPWPESLHKIWHANMPYNKIADRKGHQGWMK  163



>ref|XP_011093168.1| PREDICTED: probable methyltransferase PMT13 [Sesamum indicum]
 ref|XP_011093169.1| PREDICTED: probable methyltransferase PMT13 [Sesamum indicum]
Length=601

 Score =   211 bits (536),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 136/167 (81%), Gaps = 4/167 (2%)
 Frame = +2

Query  284  EMGHLSLFSS-HRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALLSG--  454
            +MG  +L SS  RNARKW+LLD++ AAFF AV V FLLVFTPLGD+ AASGR+  L    
Sbjct  3    QMGLFNLASSKQRNARKWRLLDIITAAFFLAVLVLFLLVFTPLGDAFAASGRKTALQSPV  62

Query  455  -DSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPH  631
             D + R+ L+ L+E GR+   I  CPAD VDHMPCEDPRINSQLSREMNYYRERHCP   
Sbjct  63   LDPRNRAKLLALLELGRQGVTIDACPADMVDHMPCEDPRINSQLSREMNYYRERHCPKAE  122

Query  632  ETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            ETP+CLIPPP+GY+VPV+WPESLHKI+HDNMPYNKIADRKGHQGWMK
Sbjct  123  ETPLCLIPPPQGYRVPVQWPESLHKIWHDNMPYNKIADRKGHQGWMK  169



>ref|XP_007051915.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOX96072.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=598

 Score =   211 bits (536),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 118/164 (72%), Positives = 132/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  460
            MGHL+L +S RN R+W+LLD++   FF  V +FFLLVFTPLGDSLAASGRQALL  + D 
Sbjct  1    MGHLNLPASKRNPRQWKLLDIISTIFFGLVLLFFLLVFTPLGDSLAASGRQALLLSTSDP  60

Query  461  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  640
             QR  LV LVE G     I+ CPAD VDHMPCEDPR NSQLSREMN+YRER CPLP E P
Sbjct  61   GQRHRLVALVELGHHHQAIEACPADSVDHMPCEDPRRNSQLSREMNFYRERQCPLPDEMP  120

Query  641  ICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +CLIPPP GYK+PVRWPESLH I+H NMP+NKIADRKGHQGWMK
Sbjct  121  LCLIPPPPGYKIPVRWPESLHMIWHSNMPHNKIADRKGHQGWMK  164



>gb|AAD17338.1| F15P23.2 gene product [Arabidopsis thaliana]
 emb|CAB80883.1| predicted protein of unknown function [Arabidopsis thaliana]
Length=590

 Score =   209 bits (532),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 118/176 (67%), Positives = 141/176 (80%), Gaps = 14/176 (8%)
 Frame = +2

Query  287  MGHLSLFSSHR-NARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SG  454
            MGH++L +S R N R+W+LLD+V AAFF  V +FF+L+FTPLGDS+AASGRQ LL   + 
Sbjct  1    MGHVNLPASKRGNPRQWRLLDIVTAAFFGIVLLFFILLFTPLGDSMAASGRQTLLLSTAS  60

Query  455  DSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHE  634
            D +QR  LVTLVE+G+ + PI++CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP E
Sbjct  61   DPRQRQRLVTLVEAGQHLQPIEYCPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEE  120

Query  635  TPICLIPPPEGYKVPVRWPESLHKIF----------HDNMPYNKIADRKGHQGWMK  772
            TP+CLIPPP GYK+PV WPESLHK++          H NMPYNKIADRKGHQGWMK
Sbjct  121  TPLCLIPPPSGYKIPVPWPESLHKVYWILAPITMIWHANMPYNKIADRKGHQGWMK  176



>ref|XP_010255504.1| PREDICTED: probable methyltransferase PMT13 [Nelumbo nucifera]
Length=593

 Score =   209 bits (531),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 142/163 (87%), Gaps = 3/163 (2%)
 Frame = +2

Query  290  GHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDSQ  463
            G L+L  S RNAR+W+LLDLV AAFF A+FVFFLLVFTPLGDSLAASGRQ L+  +GD +
Sbjct  3    GQLNLPFSKRNARQWRLLDLVSAAFFGAIFVFFLLVFTPLGDSLAASGRQTLVLSTGDPR  62

Query  464  QRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPI  643
            QR  +V L+E+G++ + I+ CPA+ VDHMPCEDPR NSQLSREMN+YRER+CPLP ETP+
Sbjct  63   QRQRMVALIEAGKQQS-IEACPAEAVDHMPCEDPRRNSQLSREMNFYRERNCPLPEETPL  121

Query  644  CLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            CLIPPPEGY++ V+WPESLHKI+H NMP+NKIADRKGHQGWMK
Sbjct  122  CLIPPPEGYRISVQWPESLHKIWHSNMPHNKIADRKGHQGWMK  164



>ref|XP_011469063.1| PREDICTED: probable methyltransferase PMT13 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=527

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 137/165 (83%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            MGHL+L +S R  R+W+LLDLV AAFF  V +FFLLVFTPLGDS+AASGRQ+LL   + D
Sbjct  1    MGHLNLPASKRIPRQWRLLDLVSAAFFGIVILFFLLVFTPLGDSMAASGRQSLLLSTNAD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
             +QR  LV LVE G+   PI+ CPAD VDHMPCEDPR NSQLSREMN+YRERHCP P ET
Sbjct  61   PKQRHRLVALVEQGQHQQPIEACPADAVDHMPCEDPRRNSQLSREMNFYRERHCPPPEET  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPPP+GY++PV WPESL KI+H NMP+NKIA+RKGHQGWMK
Sbjct  121  PLCLIPPPDGYRIPVPWPESLEKIWHSNMPHNKIAERKGHQGWMK  165



>ref|XP_004306834.1| PREDICTED: probable methyltransferase PMT13 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=599

 Score =   207 bits (528),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 118/165 (72%), Positives = 137/165 (83%), Gaps = 3/165 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            MGHL+L +S R  R+W+LLDLV AAFF  V +FFLLVFTPLGDS+AASGRQ+LL   + D
Sbjct  1    MGHLNLPASKRIPRQWRLLDLVSAAFFGIVILFFLLVFTPLGDSMAASGRQSLLLSTNAD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
             +QR  LV LVE G+   PI+ CPAD VDHMPCEDPR NSQLSREMN+YRERHCP P ET
Sbjct  61   PKQRHRLVALVEQGQHQQPIEACPADAVDHMPCEDPRRNSQLSREMNFYRERHCPPPEET  120

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+CLIPPP+GY++PV WPESL KI+H NMP+NKIA+RKGHQGWMK
Sbjct  121  PLCLIPPPDGYRIPVPWPESLEKIWHSNMPHNKIAERKGHQGWMK  165



>ref|XP_002320756.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE99071.1| dehydration-responsive family protein [Populus trichocarpa]
Length=594

 Score =   207 bits (527),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 117/164 (71%), Positives = 137/164 (84%), Gaps = 2/164 (1%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  460
            MGHL+L +S RN R+W+LLDLV A FF  VF+FFLLVFTPLGDSLAASGRQ LL  + D 
Sbjct  1    MGHLNLPASKRNPRQWKLLDLVTATFFGLVFLFFLLVFTPLGDSLAASGRQTLLRSTSDP  60

Query  461  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  640
            +QR  LV L+E+G+   PI+ CPAD VDHMPCEDPR NSQLSREMN+YRERHCP   +T 
Sbjct  61   RQRHRLVALIEAGQNAQPIEACPADEVDHMPCEDPRRNSQLSREMNFYRERHCPPVEDTH  120

Query  641  ICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +CLIPPP+GYK+ VRWP+SLHKI+H NMP++KIADRKGHQGWMK
Sbjct  121  LCLIPPPDGYKISVRWPQSLHKIWHANMPHDKIADRKGHQGWMK  164



>emb|CDY51142.1| BnaA09g51770D [Brassica napus]
Length=617

 Score =   206 bits (525),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 130/155 (84%), Gaps = 3/155 (2%)
 Frame = +2

Query  317  RNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGDSQQRSLLVTL  487
            RN R+W+L D++ AAFFA V +FF+L+FTPL DS+AASGRQ LL   + D +QR  LVTL
Sbjct  37   RNPRQWRLFDIITAAFFAVVLLFFILLFTPLRDSMAASGRQTLLVTTTSDPRQRQRLVTL  96

Query  488  VESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEG  667
            VESG  + PI++CPAD V HMPCEDP+ NSQLSREMN+YRERHCPLP ETP+CLIPPP G
Sbjct  97   VESGHHLQPIEYCPADAVAHMPCEDPKRNSQLSREMNFYRERHCPLPEETPLCLIPPPNG  156

Query  668  YKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            YK+ V WPESLHKI+H NMPYNKIADRKGHQGWMK
Sbjct  157  YKISVPWPESLHKIWHANMPYNKIADRKGHQGWMK  191



>emb|CDP08877.1| unnamed protein product [Coffea canephora]
Length=601

 Score =   206 bits (524),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 139/170 (82%), Gaps = 10/170 (6%)
 Frame = +2

Query  287  MGHLSLFSSHR--NARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL----  448
            MGHL+L SS +  NAR+W+LLDLV A  F AVF+FF+LVFTPLGDSLAASGRQ LL    
Sbjct  1    MGHLNLPSSKQRNNARQWRLLDLVTAILFGAVFIFFVLVFTPLGDSLAASGRQTLLRSSM  60

Query  449  -SGDSQQRSLLVTLVES-GREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCP  622
             + D  QR+ LV LVES G  +  I  CPA+ VDHMPCEDPRINSQLSREMN+YRERHCP
Sbjct  61   GAADPLQRARLVALVESTGNPV--IDSCPAEMVDHMPCEDPRINSQLSREMNFYRERHCP  118

Query  623  LPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             P +TP+CLIPPP+GY+V V+WPESL KI+HDNMPYNKIADRKGHQGWMK
Sbjct  119  APEQTPLCLIPPPQGYRVSVQWPESLRKIWHDNMPYNKIADRKGHQGWMK  168



>ref|XP_011035117.1| PREDICTED: probable methyltransferase PMT13 [Populus euphratica]
Length=594

 Score =   204 bits (520),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 116/164 (71%), Positives = 136/164 (83%), Gaps = 2/164 (1%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  460
            MGHL+L +S RN R+W+LLDLV A FF  VF+FFLLVFTPLGDSLAASGRQ LL  + D 
Sbjct  1    MGHLNLPASKRNPRQWKLLDLVTATFFGLVFLFFLLVFTPLGDSLAASGRQTLLRSTSDP  60

Query  461  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  640
            +QR  LV L+E+G    PI+ CPAD VDHMPCEDPR NSQLSREMN+YRERHCP   +T 
Sbjct  61   RQRHRLVALIEAGHNAQPIEACPADEVDHMPCEDPRRNSQLSREMNFYRERHCPPVEDTH  120

Query  641  ICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +CLIPPP+GYK+ V+WP+SLHKI+H NMP++KIADRKGHQGWMK
Sbjct  121  LCLIPPPDGYKISVQWPQSLHKIWHANMPHDKIADRKGHQGWMK  164



>ref|XP_010671687.1| PREDICTED: probable methyltransferase PMT13 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=597

 Score =   202 bits (515),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 135/166 (81%), Gaps = 4/166 (2%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            MGH++L SS +  ++W+LLDLV A FF  V +FFLL+FTPLGDSLAASGRQ LL   + D
Sbjct  1    MGHINLSSSKKAGKQWKLLDLVIACFFGIVVLFFLLIFTPLGDSLAASGRQTLLRTSASD  60

Query  458  SQQR-SLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHE  634
             +QR  L+V L E+      I  CPA++VD+MPCEDP+ NSQLSREMN+YRERHCPLP +
Sbjct  61   PRQRMKLIVALEETSNGGQMIDACPAEFVDYMPCEDPKRNSQLSREMNFYRERHCPLPED  120

Query  635  TPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +P+CLIPPP+GYKVPV WP+SLHKI+H NMPYNKIADRKGHQGWMK
Sbjct  121  SPLCLIPPPQGYKVPVHWPQSLHKIWHSNMPYNKIADRKGHQGWMK  166



>gb|EPS64664.1| hypothetical protein M569_10115, partial [Genlisea aurea]
Length=522

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 111/164 (68%), Positives = 131/164 (80%), Gaps = 2/164 (1%)
 Frame = +2

Query  287  MGHLSL--FSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALLSGDS  460
            MG L+L   S HR++R+  LLDL+ AA F  V +FF+LVFTPLGDS AASG+ ALL  D 
Sbjct  1    MGLLNLQPSSKHRHSRQVHLLDLITAAIFGIVVLFFVLVFTPLGDSWAASGKLALLRSDP  60

Query  461  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  640
            +QR   V+ +  GR  A +  CPAD VDHMPCEDPRINSQLSR+MN+YRERHCP P +T 
Sbjct  61   KQRWSTVSELLVGRHAALVDSCPADMVDHMPCEDPRINSQLSRDMNFYRERHCPAPEDTQ  120

Query  641  ICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +CLIPPPEGY++PV+WPESL KI+HDNMPYNKIADRKGHQGWMK
Sbjct  121  LCLIPPPEGYQIPVQWPESLDKIWHDNMPYNKIADRKGHQGWMK  164



>ref|XP_007139954.1| hypothetical protein PHAVU_008G072600g [Phaseolus vulgaris]
 gb|ESW11948.1| hypothetical protein PHAVU_008G072600g [Phaseolus vulgaris]
Length=592

 Score =   194 bits (492),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 114/167 (68%), Positives = 131/167 (78%), Gaps = 8/167 (5%)
 Frame = +2

Query  287  MGHLSLFSSHR--NARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SG  454
            MGH +  S  +  +ARKWQLLDLV   FF  V +FF++VFTPLGDSLAASGRQ LL    
Sbjct  1    MGHSNSSSPSKRGHARKWQLLDLVSGVFFFLVLLFFVMVFTPLGDSLAASGRQTLLLSGA  60

Query  455  DSQQRSLLVTLVES-GREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPH  631
            DS+ R  LV  VE+ GR +   + CPAD  D+MPCEDPR+NSQLSREMNYYRERHCP P 
Sbjct  61   DSRHRHQLVEAVETAGRGV---EACPADMADYMPCEDPRLNSQLSREMNYYRERHCPRPE  117

Query  632  ETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            ++P+CLIPPP GY+VPV WPESLHKI+H NMPYNKIADRKGHQGWMK
Sbjct  118  DSPLCLIPPPSGYRVPVPWPESLHKIWHSNMPYNKIADRKGHQGWMK  164



>ref|XP_010055223.1| PREDICTED: probable methyltransferase PMT13 [Eucalyptus grandis]
 gb|KCW71691.1| hypothetical protein EUGRSUZ_E00210 [Eucalyptus grandis]
Length=596

 Score =   193 bits (490),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 111/163 (68%), Positives = 129/163 (79%), Gaps = 2/163 (1%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALLSGDSQQ  466
            MGHLSL +S R+ R+W+LLDLV A     V +FFLLVFT LGDSLAASGRQ+LL   S+ 
Sbjct  1    MGHLSLPASKRSPRQWKLLDLVIAVLLGLVLLFFLLVFTRLGDSLAASGRQSLLLA-SRD  59

Query  467  RSLLVTLVESGREI-APIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPI  643
             + LV  VESG+   + I+ CP DY DHMPCEDPR NSQLSREMN+YRERHCP P  TP+
Sbjct  60   HARLVAAVESGKLYPSHIESCPDDYADHMPCEDPRRNSQLSREMNFYRERHCPPPEGTPL  119

Query  644  CLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            CL+PPPEGYK+PV+WP  L KI+H NMP+NKIADRKGHQGWMK
Sbjct  120  CLVPPPEGYKIPVQWPACLDKIWHSNMPHNKIADRKGHQGWMK  162



>gb|ACN78958.1| dehydration responsive protein [Glycine max]
Length=496

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 102/126 (81%), Gaps = 4/126 (3%)
 Frame = +2

Query  401  TPLGDSLAASGRQALL--SGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRIN  574
            TPLGDSLAASGRQ LL    D QQR  LV  +E+G     ++ CPA   DHMPCEDPR+N
Sbjct  45   TPLGDSLAASGRQTLLRSGADPQQRHRLVAAIEAGGR--GVEACPAADADHMPCEDPRLN  102

Query  575  SQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKG  754
            SQLSREMNYYRERHCP P ++P+CLIPPP GY+VPV WPESLHKI+H NMPYNKIADRKG
Sbjct  103  SQLSREMNYYRERHCPRPEDSPLCLIPPPHGYRVPVPWPESLHKIWHSNMPYNKIADRKG  162

Query  755  HQGWMK  772
            HQGWMK
Sbjct  163  HQGWMK  168



>ref|XP_003528881.1| PREDICTED: probable methyltransferase PMT13-like [Glycine max]
Length=594

 Score =   192 bits (487),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 112/166 (67%), Positives = 133/166 (80%), Gaps = 5/166 (3%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL---SGD  457
            M HL+L +S R  R+W++LDL+ AAFF  VF+FF+LVFTP GDSLAASGRQ LL   S D
Sbjct  1    MPHLNLPASKR-VRQWRVLDLISAAFFGLVFLFFMLVFTPAGDSLAASGRQTLLLSASAD  59

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYV-DHMPCEDPRINSQLSREMNYYRERHCPLPHE  634
             +QR  +   +E+G++   I  CPAD   DHMPCEDPR+NSQLSREMNYYRERHCP    
Sbjct  60   PRQRLHVAAAIEAGQQSRVIDACPADTAADHMPCEDPRLNSQLSREMNYYRERHCPPLET  119

Query  635  TPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +P+CL+PPP+GYKVPV+WPESLHKI+H NMPYNKIADRKGHQGWMK
Sbjct  120  SPLCLVPPPKGYKVPVQWPESLHKIWHSNMPYNKIADRKGHQGWMK  165



>ref|XP_003552360.1| PREDICTED: probable methyltransferase PMT13-like [Glycine max]
Length=596

 Score =   191 bits (486),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 102/126 (81%), Gaps = 4/126 (3%)
 Frame = +2

Query  401  TPLGDSLAASGRQALL--SGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRIN  574
            TPLGDSLAASGRQ LL    D QQR  LV  +E+G     ++ CPA   DHMPCEDPR+N
Sbjct  45   TPLGDSLAASGRQTLLRSGADPQQRHRLVAAIEAGGR--GVEACPAADADHMPCEDPRLN  102

Query  575  SQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKG  754
            SQLSREMNYYRERHCP P ++P+CLIPPP GY+VPV WPESLHKI+H NMPYNKIADRKG
Sbjct  103  SQLSREMNYYRERHCPRPEDSPLCLIPPPHGYRVPVPWPESLHKIWHSNMPYNKIADRKG  162

Query  755  HQGWMK  772
            HQGWMK
Sbjct  163  HQGWMK  168



>gb|KJB24669.1| hypothetical protein B456_004G156600 [Gossypium raimondii]
Length=586

 Score =   188 bits (477),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/155 (67%), Positives = 122/155 (79%), Gaps = 2/155 (1%)
 Frame = +2

Query  314  HRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDSQQRSLLVTL  487
            +RNAR+W+ LD+  A FF+ V +FFLLVFTP GD LA SGRQALL  + D +QR   V+L
Sbjct  5    NRNARQWKFLDIFTAMFFSLVLLFFLLVFTPFGDPLAYSGRQALLLSTSDPKQRHRFVSL  64

Query  488  VESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEG  667
            VE G    PI  CP D VDHMPCEDP+ NSQLSR MN+YRERHCPLP E P+CLIPPP  
Sbjct  65   VELGEHRQPIDPCPPDSVDHMPCEDPKRNSQLSRYMNFYRERHCPLPDEMPLCLIPPPLD  124

Query  668  YKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            YK+P++WPESLHK++H NMP+NKIA RKGHQGWMK
Sbjct  125  YKIPIQWPESLHKVWHSNMPHNKIATRKGHQGWMK  159



>ref|XP_003534594.1| PREDICTED: probable methyltransferase PMT13-like isoform X1 [Glycine 
max]
 ref|XP_006587869.1| PREDICTED: probable methyltransferase PMT13-like isoform X2 [Glycine 
max]
Length=597

 Score =   187 bits (474),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 101/126 (80%), Gaps = 4/126 (3%)
 Frame = +2

Query  401  TPLGDSLAASGRQALL--SGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRIN  574
            TPLGDSLAASGRQ LL    D +Q   LV  +E+G     ++ CPA   DHMPCEDPR+N
Sbjct  46   TPLGDSLAASGRQTLLRSGADPRQHHRLVAAIEAGGR--GLEACPAADADHMPCEDPRLN  103

Query  575  SQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKG  754
            SQLSREMNYYRERHCP P ++P+CLIPPP GY+VPV WPESLHKI+H NMPYNKIADRKG
Sbjct  104  SQLSREMNYYRERHCPRPEDSPLCLIPPPHGYRVPVPWPESLHKIWHSNMPYNKIADRKG  163

Query  755  HQGWMK  772
            HQGWMK
Sbjct  164  HQGWMK  169



>gb|KEH18952.1| methyltransferase [Medicago truncatula]
Length=602

 Score =   186 bits (473),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 112/175 (64%), Positives = 129/175 (74%), Gaps = 15/175 (9%)
 Frame = +2

Query  287  MGHLSLFSSHR-----------NARKWQlldlvfaaffaavfvffllvfTPLGDSLAASG  433
            MGH++L  S R           N R W+L+DL+ AAFF  VF+FF+ VFT LGDSLAASG
Sbjct  1    MGHVNLPPSKRTPTITNIINNYNPRHWRLIDLISAAFFGLVFLFFVFVFTSLGDSLAASG  60

Query  434  RQALL--SGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYR  607
            RQ LL    D QQR  LV  +E G+ +  I  CPAD VDHMPCE+PR+NSQLSREMNYYR
Sbjct  61   RQTLLMSGSDPQQRLRLVAAIEVGQRV--IDACPADAVDHMPCENPRLNSQLSREMNYYR  118

Query  608  ERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            ERHCP    T +CL+PPP GYKV V+WPESLHKI+H NMP+NKIADRKGHQGWMK
Sbjct  119  ERHCPPVENTVLCLVPPPSGYKVSVQWPESLHKIWHSNMPHNKIADRKGHQGWMK  173



>ref|XP_004492679.1| PREDICTED: probable methyltransferase PMT13-like [Cicer arietinum]
Length=595

 Score =   186 bits (472),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 104/166 (63%), Positives = 129/166 (78%), Gaps = 4/166 (2%)
 Frame = +2

Query  287  MGHLSLFSSHR-NARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGD  457
            MGH +     R N R+W+L+DL+  AFF+ +F+FF+  +T + DSLA SGR+A++  + D
Sbjct  1    MGHSNFPPWKRTNTRQWRLIDLISIAFFSLLFLFFIFFYTTISDSLAVSGRRAVVPSTVD  60

Query  458  SQQRSLLVTLVESGREIA-PIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHE  634
             QQR+ LV  +E+G      I+ C AD VDHMPCEDPR NSQLSREMNYYRERHCP P E
Sbjct  61   PQQRNRLVVEIETGLSNGRTIEACSADEVDHMPCEDPRRNSQLSREMNYYRERHCPPPEE  120

Query  635  TPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            TP+CLIPPP GY++PVRWPES+HKI+H NMP+NKIADRKGHQGWMK
Sbjct  121  TPLCLIPPPSGYRIPVRWPESMHKIWHSNMPHNKIADRKGHQGWMK  166



>ref|XP_009382296.1| PREDICTED: probable methyltransferase PMT13 [Musa acuminata subsp. 
malaccensis]
Length=600

 Score =   184 bits (468),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 105/127 (83%), Gaps = 3/127 (2%)
 Frame = +2

Query  401  TPLGDSLAASGRQALL--SGDSQQRSLLVTLVES-GREIAPIQFCPADYVDHMPCEDPRI  571
            T LGDSLAASGR+AL   +  S+QR  +V L++S       I  CPA+ VD+MPCEDPR 
Sbjct  41   TSLGDSLAASGRRALARSAAGSRQRERIVALLDSPTASPFAIDSCPAEEVDNMPCEDPRR  100

Query  572  NSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRK  751
            NSQLSREMN+YRERHCPLP ETP+CL+PPP+GY++PV WPESLHKI+HDNMPYNKIA+RK
Sbjct  101  NSQLSREMNFYRERHCPLPGETPLCLVPPPKGYRIPVPWPESLHKIWHDNMPYNKIAERK  160

Query  752  GHQGWMK  772
            GHQGWMK
Sbjct  161  GHQGWMK  167



>ref|XP_003521295.1| PREDICTED: probable methyltransferase PMT13-like [Glycine max]
Length=597

 Score =   184 bits (468),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 113/169 (67%), Positives = 131/169 (78%), Gaps = 8/169 (5%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL----SG  454
            MGH++L +S R  R+W++LDLV AAFF  VF+FFLLVFTP GDSLAASGRQ LL    S 
Sbjct  1    MGHVNLPASKR-VRQWRVLDLVSAAFFGLVFLFFLLVFTPAGDSLAASGRQTLLLSASSA  59

Query  455  DSQQRSLLVTLVESGREIAP--IQFCPADYV-DHMPCEDPRINSQLSREMNYYRERHCPL  625
            D + R  +   +E   +  P  I+ CPAD   DHMPCEDPR+NSQLSREMNYYRERHCP 
Sbjct  60   DPRLRLRVSAAIEEAGQRQPRVIEACPADTAADHMPCEDPRLNSQLSREMNYYRERHCPP  119

Query  626  PHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
               TP+CL+PP +GYKVPV+WPESLHKI+H NMPYNKIADRKGHQGWMK
Sbjct  120  LETTPLCLVPPLKGYKVPVKWPESLHKIWHSNMPYNKIADRKGHQGWMK  168



>ref|XP_007134962.1| hypothetical protein PHAVU_010G090400g [Phaseolus vulgaris]
 gb|ESW06956.1| hypothetical protein PHAVU_010G090400g [Phaseolus vulgaris]
Length=596

 Score =   184 bits (467),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 129/166 (78%), Gaps = 5/166 (3%)
 Frame = +2

Query  287  MGHLSLFSSHR--NARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SG  454
            MGH++L +S R    R+W++LD+V AAFF  VF+FF+LVFT +GDSLAASGRQ LL  + 
Sbjct  1    MGHVNLPASKRLGGPRQWRVLDVVTAAFFGLVFLFFVLVFTSMGDSLAASGRQTLLLSTT  60

Query  455  DSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHE  634
            D  QR  +   VE+G+    I  CPAD  DHMPCEDPR+NSQLSR MNYYRERHCP    
Sbjct  61   DPLQRLRVSAAVEAGQPRV-IDACPADTADHMPCEDPRLNSQLSRVMNYYRERHCPPLEN  119

Query  635  TPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            TP+CL+PPP GY+V V+WPESLHKI+H NMPYNKIADRKGHQGWMK
Sbjct  120  TPLCLVPPPRGYRVSVQWPESLHKIWHSNMPYNKIADRKGHQGWMK  165



>gb|KDO86019.1| hypothetical protein CISIN_1g007645mg [Citrus sinensis]
Length=527

 Score =   181 bits (458),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 106/168 (63%), Positives = 126/168 (75%), Gaps = 9/168 (5%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL--SGDS  460
            MGHL+L +S RNAR+W+LLD+V A FF  V +FFLLVFTPLGDSLAASGRQALL  + D 
Sbjct  1    MGHLNLPASKRNARQWKLLDIVSATFFGLVLLFFLLVFTPLGDSLAASGRQALLMSTSDP  60

Query  461  QQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  640
            +QR  LV L+E+G  + PI+ CPAD VDHMPCEDPR NSQLSREMN+YRERHCPLP +TP
Sbjct  61   RQRQRLVALIEAGHHVKPIESCPADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPDQTP  120

Query  641  ICLIPPPEGYKVPVRWPESLHKI-------FHDNMPYNKIADRKGHQG  763
            +CLIPPP GYK+PV WPESL K+         +N+     A R  H+ 
Sbjct  121  LCLIPPPRGYKIPVPWPESLSKVASFGGSMLSENILTLSFAPRDSHKA  168



>ref|XP_006857872.1| PREDICTED: probable methyltransferase PMT13 [Amborella trichopoda]
 gb|ERN19339.1| hypothetical protein AMTR_s00069p00098800 [Amborella trichopoda]
Length=599

 Score =   181 bits (460),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 106/167 (63%), Positives = 130/167 (78%), Gaps = 7/167 (4%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALLSG---D  457
            MGH++L       R W++LDL+ AAFFAAV  FFLLVFTPLGDSLAASGRQAL      D
Sbjct  1    MGHITLTPKKLQPRGWRVLDLISAAFFAAVLAFFLLVFTPLGDSLAASGRQALAQASVLD  60

Query  458  SQQRSLLVTLVESGREIAPIQFCPADYVD--HMPCEDPRINSQLSREMNYYRERHCPLPH  631
             +QR+ +  L E GR++  + FC  + VD  +MPCEDPR NSQLSRE N+YRERHCP P 
Sbjct  61   LKQRAEVAGLAEMGRKV--LDFCSLEAVDADYMPCEDPRRNSQLSRERNFYRERHCPKPE  118

Query  632  ETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            ++P+CLIPPPEGY++P +WPES+HKI+H NMP+NKIA+RKGHQGWMK
Sbjct  119  DSPLCLIPPPEGYRIPAQWPESMHKIWHSNMPHNKIAERKGHQGWMK  165



>ref|XP_010091551.1| putative methyltransferase PMT13 [Morus notabilis]
 gb|EXB44736.1| putative methyltransferase PMT13 [Morus notabilis]
Length=545

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/108 (75%), Positives = 90/108 (83%), Gaps = 0/108 (0%)
 Frame = +2

Query  449  SGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLP  628
            + D +QR  LVT+VE GR   PI  C AD VDHMPCEDPR NSQLSREMN+YRERHCPLP
Sbjct  4    TADPKQRHRLVTVVELGRHHHPIDACQADAVDHMPCEDPRRNSQLSREMNFYRERHCPLP  63

Query  629  HETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             ETP+CLIPPP GYK+ V WPESLHKI+H NMP+NKIA+RKGHQGWMK
Sbjct  64   EETPLCLIPPPNGYKISVPWPESLHKIWHSNMPHNKIAERKGHQGWMK  111



>ref|XP_010919247.1| PREDICTED: probable methyltransferase PMT13 isoform X2 [Elaeis 
guineensis]
Length=503

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 131/172 (76%), Gaps = 10/172 (6%)
 Frame = +2

Query  287  MGHLSLFSSHRNA--RKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQAL----L  448
            MGH++L  S R    R+W LLDLV A+FFAAV VFF+LVFT LGDSLAASGR+AL     
Sbjct  1    MGHVNLPPSRRGGPGRQWTLLDLVSASFFAAVLVFFVLVFTSLGDSLAASGRRALARSSS  60

Query  449  SGDSQQRSLLVTLVES----GREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERH  616
            S D +QR  L+ L++     G   A I  CPA+ VD+MPCEDPR NSQLSR MN YRERH
Sbjct  61   SSDPRQRDRLIALLDGPPAPGGHRAVIDACPAEEVDYMPCEDPRRNSQLSRHMNLYRERH  120

Query  617  CPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            CP P E+ +CLIPPP+GY+ PV WPESLHKI+HDNMPY+KIA+RKGHQGWMK
Sbjct  121  CPPPGESLLCLIPPPQGYRYPVPWPESLHKIWHDNMPYDKIAERKGHQGWMK  172



>ref|XP_010919248.1| PREDICTED: probable methyltransferase PMT13 isoform X3 [Elaeis 
guineensis]
Length=501

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 131/172 (76%), Gaps = 10/172 (6%)
 Frame = +2

Query  287  MGHLSLFSSHRNA--RKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQAL----L  448
            MGH++L  S R    R+W LLDLV A+FFAAV VFF+LVFT LGDSLAASGR+AL     
Sbjct  1    MGHVNLPPSRRGGPGRQWTLLDLVSASFFAAVLVFFVLVFTSLGDSLAASGRRALARSSS  60

Query  449  SGDSQQRSLLVTLVES----GREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERH  616
            S D +QR  L+ L++     G   A I  CPA+ VD+MPCEDPR NSQLSR MN YRERH
Sbjct  61   SSDPRQRDRLIALLDGPPAPGGHRAVIDACPAEEVDYMPCEDPRRNSQLSRHMNLYRERH  120

Query  617  CPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            CP P E+ +CLIPPP+GY+ PV WPESLHKI+HDNMPY+KIA+RKGHQGWMK
Sbjct  121  CPPPGESLLCLIPPPQGYRYPVPWPESLHKIWHDNMPYDKIAERKGHQGWMK  172



>ref|XP_009401770.1| PREDICTED: probable methyltransferase PMT13 [Musa acuminata subsp. 
malaccensis]
Length=603

 Score =   177 bits (449),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 105/132 (80%), Gaps = 9/132 (7%)
 Frame = +2

Query  401  TPLGDSLAASGRQALL---SGDSQQRSLLVTLVE-----SGREIAPIQFCPADYVDHMPC  556
            T LGDSLAASGR+AL    + D +QR  ++ L++     +GR +  I  C A+ VD+MPC
Sbjct  41   TSLGDSLAASGRRALARSSTDDPRQRQRILALLDPPSSAAGRTVV-IDACSAEEVDNMPC  99

Query  557  EDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNK  736
            EDPR NSQLSREMN+YRERHCP P E P+CL+PPP+GY++PV WPESLHKI+HDNMPY+K
Sbjct  100  EDPRRNSQLSREMNFYRERHCPPPEEMPLCLVPPPKGYRIPVSWPESLHKIWHDNMPYDK  159

Query  737  IADRKGHQGWMK  772
            IA+RKGHQGWMK
Sbjct  160  IAERKGHQGWMK  171



>ref|XP_010919246.1| PREDICTED: probable methyltransferase PMT13 isoform X1 [Elaeis 
guineensis]
Length=605

 Score =   176 bits (446),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 131/172 (76%), Gaps = 10/172 (6%)
 Frame = +2

Query  287  MGHLSLFSSHRNA--RKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQAL----L  448
            MGH++L  S R    R+W LLDLV A+FFAAV VFF+LVFT LGDSLAASGR+AL     
Sbjct  1    MGHVNLPPSRRGGPGRQWTLLDLVSASFFAAVLVFFVLVFTSLGDSLAASGRRALARSSS  60

Query  449  SGDSQQRSLLVTLVES----GREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERH  616
            S D +QR  L+ L++     G   A I  CPA+ VD+MPCEDPR NSQLSR MN YRERH
Sbjct  61   SSDPRQRDRLIALLDGPPAPGGHRAVIDACPAEEVDYMPCEDPRRNSQLSRHMNLYRERH  120

Query  617  CPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            CP P E+ +CLIPPP+GY+ PV WPESLHKI+HDNMPY+KIA+RKGHQGWMK
Sbjct  121  CPPPGESLLCLIPPPQGYRYPVPWPESLHKIWHDNMPYDKIAERKGHQGWMK  172



>ref|XP_008799525.1| PREDICTED: probable methyltransferase PMT13 [Phoenix dactylifera]
Length=605

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 110/172 (64%), Positives = 129/172 (75%), Gaps = 10/172 (6%)
 Frame = +2

Query  287  MGHLSLFSSHRNA--RKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQAL----L  448
            MGH++L  S R    R+W  LDLV A+FFAAV VFF+LVFT LGDSLAASGR+AL     
Sbjct  1    MGHVNLPPSRRGGPGRQWTFLDLVSASFFAAVLVFFILVFTSLGDSLAASGRRALARSSS  60

Query  449  SGDSQQRSLLVTLVES----GREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERH  616
            S D +QR  L+ L++     G   A I  CPA+ VD+MPCEDPR NSQLSR MN YRERH
Sbjct  61   SSDPRQRDRLLALLDGPPVPGGHRAVIDACPAEEVDYMPCEDPRRNSQLSRHMNLYRERH  120

Query  617  CPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            CP P E+ +CL PPP+GY+ PV WPESLHKI+HDNMPY+KIA+RKGHQGWMK
Sbjct  121  CPPPGESLLCLTPPPQGYRYPVSWPESLHKIWHDNMPYDKIAERKGHQGWMK  172



>ref|XP_003623833.1| hypothetical protein MTR_7g076150 [Medicago truncatula]
 gb|ABN08824.1| Protein of unknown function DUF248, methyltransferase putative 
[Medicago truncatula]
 gb|AES80051.1| methyltransferase PMT16, putative [Medicago truncatula]
Length=589

 Score =   173 bits (438),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 88/107 (82%), Gaps = 1/107 (1%)
 Frame = +2

Query  455  DSQQRSLLVTLVESGR-EIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPH  631
            D QQR+ LV  +E G      I+ CPA  VDHMPCEDPR NSQLSREMNYYRERHCPLP 
Sbjct  54   DPQQRNRLVVAIEEGMLNGKSIEACPASEVDHMPCEDPRRNSQLSREMNYYRERHCPLPE  113

Query  632  ETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            ET +CLIPPP GY+VPVRWPES+HKI+H NMP+NKIADRKGHQGWMK
Sbjct  114  ETAVCLIPPPNGYRVPVRWPESMHKIWHSNMPHNKIADRKGHQGWMK  160



>gb|ABK25383.1| unknown [Picea sitchensis]
Length=601

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 123/169 (73%), Gaps = 10/169 (6%)
 Frame = +2

Query  287  MGHLSLFSSHRNARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQALL------  448
            MGH+S+  S R  R+W+LLDLV    F AVF+F L VFTPLGDSLAASGRQ+L+      
Sbjct  1    MGHISV-PSKRLVRQWKLLDLVSGLLFLAVFIFLLCVFTPLGDSLAASGRQSLVLSGGRD  59

Query  449  -SGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPL  625
             +GD Q R   + +VESG   A ++ CP + VD+ PCEDPR +S  SRE N YRERHCP 
Sbjct  60   RNGDPQHRERFLRVVESGE--AAVEACPLESVDYSPCEDPRRSSHFSRERNVYRERHCPP  117

Query  626  PHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P +  +CLIPPP  YK+P+ WPESLHKI+H NMP+NKIADRKGHQGWMK
Sbjct  118  PDQNLLCLIPPPLDYKIPLPWPESLHKIWHSNMPHNKIADRKGHQGWMK  166



>ref|XP_010053663.1| PREDICTED: probable methyltransferase PMT13 [Eucalyptus grandis]
 gb|KCW78015.1| hypothetical protein EUGRSUZ_D02247 [Eucalyptus grandis]
Length=579

 Score =   170 bits (430),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/109 (73%), Positives = 90/109 (83%), Gaps = 4/109 (4%)
 Frame = +2

Query  449  SGDSQQRSLLVTLVESG-REIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPL  625
            S  ++  S L   VESG R + P   CPA YVDHMPCEDPR +SQLSREMNYYRERHCP 
Sbjct  40   SAAARDHSRLAAAVESGARRVEP---CPAGYVDHMPCEDPRRSSQLSREMNYYRERHCPP  96

Query  626  PHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P ETP+CL+PPP+GY+VPVRWPESL+KI+H NMPYNKIADRKGHQGWMK
Sbjct  97   PEETPLCLVPPPDGYRVPVRWPESLNKIWHSNMPYNKIADRKGHQGWMK  145



>gb|AIU48613.1| quasimodo 3, partial [Erythranthe guttata]
Length=505

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/83 (89%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPAD V HMPCEDPRINSQLSREMN+YRERHCPLP ETP+CLIPPPEGY+V V+WPESLH
Sbjct  1    CPADMVAHMPCEDPRINSQLSREMNFYRERHCPLPTETPLCLIPPPEGYRVSVQWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+HDNMPYNKIADRKGHQGWMK
Sbjct  61   KIWHDNMPYNKIADRKGHQGWMK  83



>gb|AIU48615.1| quasimodo 3, partial [Solanum tuberosum]
Length=505

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C ADYVD+MPCEDPRINSQLSREMN+YRERHCPLP +TP+CLIPP +GY+VPV+WPESLH
Sbjct  1    CSADYVDYMPCEDPRINSQLSREMNFYRERHCPLPKDTPLCLIPPTQGYRVPVQWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H+NMPYNKIADRKGHQGWMK
Sbjct  61   KIWHENMPYNKIADRKGHQGWMK  83



>gb|AIU48625.1| quasimodo 3, partial [Solanum lycopersicum]
Length=505

 Score =   167 bits (422),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 80/83 (96%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C ADYVD+MPCEDPRINSQLSREMN+YRERHCPLP +TP+CLIPP +GY+VPV+WPESLH
Sbjct  1    CSADYVDYMPCEDPRINSQLSREMNFYRERHCPLPKDTPLCLIPPTQGYRVPVQWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H+NMPYNKIADRKGHQGWMK
Sbjct  61   KIWHENMPYNKIADRKGHQGWMK  83



>gb|AIU48627.1| quasimodo 3, partial [Schrenkiella parvula]
Length=505

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPA+ VDHMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPPP GYK+PV WPESLH
Sbjct  1    CPAEAVDHMPCEDPRRNSQLSREMNFYRERHCPLPEETPLCLIPPPSGYKIPVPWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMPYNKIADRKGHQGWMK
Sbjct  61   KIWHANMPYNKIADRKGHQGWMK  83



>gb|AIU48617.1| quasimodo 3, partial [Prunus persica]
Length=505

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CP D VDHMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPPP GYK+PV+WP+SLH
Sbjct  1    CPVDAVDHMPCEDPRRNSQLSREMNFYRERHCPLPEETPLCLIPPPNGYKIPVQWPDSLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMP+NKIADRKGHQGWMK
Sbjct  61   KIWHSNMPHNKIADRKGHQGWMK  83



>gb|AIU48600.1| quasimodo 3, partial [Eucalyptus grandis]
Length=505

 Score =   163 bits (413),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPA YVDHMPCEDPR +SQLSREMNYYRERHCP P ETP+CL+PPP+GY+VPVRWPESL+
Sbjct  1    CPAGYVDHMPCEDPRRSSQLSREMNYYRERHCPPPEETPLCLVPPPDGYRVPVRWPESLN  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMPYNKIADRKGHQGWMK
Sbjct  61   KIWHSNMPYNKIADRKGHQGWMK  83



>gb|AIU48632.1| quasimodo 3, partial [Platanus x acerifolia]
Length=505

 Score =   163 bits (412),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPA+ VDHMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPPP+GY++PV+WPESLH
Sbjct  1    CPAEAVDHMPCEDPRKNSQLSREMNFYRERHCPLPEETPLCLIPPPDGYRIPVQWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMP+NKIADRKGHQGWMK
Sbjct  61   KIWHSNMPHNKIADRKGHQGWMK  83



>gb|AIU48610.1| quasimodo 3, partial [Medicago truncatula]
Length=505

 Score =   162 bits (411),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPA  VDHMPCEDPR NSQLSREMNYYRERHCPLP ET +CLIPPP GY+VPVRWPES+H
Sbjct  1    CPASEVDHMPCEDPRRNSQLSREMNYYRERHCPLPEETAVCLIPPPNGYRVPVRWPESMH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMP+NKIADRKGHQGWMK
Sbjct  61   KIWHSNMPHNKIADRKGHQGWMK  83



>gb|AIU48595.1| quasimodo 3, partial [Citrus clementina]
 gb|AIU48599.1| quasimodo 3, partial [Citrus sinensis]
Length=505

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPAD VDHMPCEDPR NSQLSREMN+YRERHCPLP +TP+CLIPPP GYK+PV WPESL 
Sbjct  1    CPADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPDQTPLCLIPPPRGYKIPVPWPESLS  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMPYNKIADRKGHQGWMK
Sbjct  61   KIWHANMPYNKIADRKGHQGWMK  83



>gb|AIU48598.1| quasimodo 3, partial [Capsella rubella]
Length=505

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPPP GYK+PV WPESLH
Sbjct  1    CPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEETPLCLIPPPSGYKIPVPWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMPYNKIADRKGHQGWMK
Sbjct  61   KIWHANMPYNKIADRKGHQGWMK  83



>gb|AIU48602.1| quasimodo 3, partial [Buxus sinica]
Length=505

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPA+ VDHMPCEDPR NSQLSREMNYYRERHCPLP ETP+CLIPPP+GY++PV+WPESLH
Sbjct  1    CPAEAVDHMPCEDPRRNSQLSREMNYYRERHCPLPEETPLCLIPPPDGYRIPVQWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMP+NKIA RKGHQGWMK
Sbjct  61   KIWHSNMPHNKIAARKGHQGWMK  83



>gb|AIU48612.1| quasimodo 3, partial [Manihot esculenta]
Length=505

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C AD VDHMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPPP GYKVPV+WP+SLH
Sbjct  1    CSADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPDETPLCLIPPPNGYKVPVQWPQSLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMP+NKIADRKGHQGWMK
Sbjct  61   KIWHANMPHNKIADRKGHQGWMK  83



>gb|AIU48597.1| quasimodo 3, partial [Carica papaya]
Length=505

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPAD VDHMPCEDPR NSQLSREMN+YRERHCPLP  TP+CLIP P GYKVPV WPESLH
Sbjct  1    CPADSVDHMPCEDPRRNSQLSREMNFYRERHCPLPEHTPLCLIPSPAGYKVPVPWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMPYNKIADRKGHQGWMK
Sbjct  61   KIWHANMPYNKIADRKGHQGWMK  83



>gb|AIU48586.1| quasimodo 3, partial [Arabidopsis thaliana]
Length=505

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPPP GYK+PV WPESLH
Sbjct  1    CPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEETPLCLIPPPSGYKIPVPWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMPYNKIADRKGHQGWMK
Sbjct  61   KIWHANMPYNKIADRKGHQGWMK  83



>gb|AIU48585.1| quasimodo 3, partial [Arabidopsis lyrata]
Length=505

 Score =   161 bits (408),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPA+ V HMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPPP GYK+PV WPESLH
Sbjct  1    CPAEAVAHMPCEDPRRNSQLSREMNFYRERHCPLPEETPLCLIPPPSGYKIPVPWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            K++H NMPYNKIADRKGHQGWMK
Sbjct  61   KVWHANMPYNKIADRKGHQGWMK  83



>gb|AIU48589.1| quasimodo 3, partial [Musa acuminata]
Length=505

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 79/83 (95%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPA+ VD+MPCEDPR NSQLSREMN+YRERHCPLP ETP+CL+PPP+GY++PV WPESLH
Sbjct  1    CPAEEVDNMPCEDPRRNSQLSREMNFYRERHCPLPGETPLCLVPPPKGYRIPVPWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+HDNMPYNKIA+RKGHQGWMK
Sbjct  61   KIWHDNMPYNKIAERKGHQGWMK  83



>gb|AIU48628.1| quasimodo 3, partial [Vitis vinifera]
Length=505

 Score =   160 bits (404),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPA+ VDHMPCEDPR NSQLSREMN+YRER CPLP ETP+CLIPPP+GY +PVRWP+SLH
Sbjct  1    CPAEEVDHMPCEDPRRNSQLSREMNFYRERQCPLPAETPLCLIPPPDGYHIPVRWPDSLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMP+NKIADRKGHQGWMK
Sbjct  61   KIWHSNMPHNKIADRKGHQGWMK  83



>gb|AIU48619.1| quasimodo 3, partial [Phaseolus vulgaris]
Length=504

 Score =   160 bits (404),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/83 (83%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPAD  D+MPCEDPR+NSQLSREMNYYRERHCP P ++P+CLIPPP GY+VPV WPESLH
Sbjct  1    CPADMADYMPCEDPRLNSQLSREMNYYRERHCPRPEDSPLCLIPPPSGYRVPVPWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMPYNKIADRKGHQGWMK
Sbjct  61   KIWHSNMPYNKIADRKGHQGWMK  83



>gb|AIU48592.1| quasimodo 3, partial [Theobroma cacao]
Length=505

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/83 (84%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPAD VDHMPCEDPR NSQLSREMN+YRER CPLP E P+CLIPPP GYK+PVRWPESLH
Sbjct  1    CPADSVDHMPCEDPRRNSQLSREMNFYRERQCPLPDEMPLCLIPPPPGYKIPVRWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
             I+H NMP+NKIADRKGHQGWMK
Sbjct  61   MIWHSNMPHNKIADRKGHQGWMK  83



>gb|AIU48634.1| quasimodo 3, partial [Houttuynia cordata]
Length=504

 Score =   158 bits (400),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPAD VDHMPCEDPR +SQLSREMN+YRERHCP P E P+CLIPPP+GY++PVRWPESLH
Sbjct  1    CPADAVDHMPCEDPRRSSQLSREMNFYRERHCPAPEEAPLCLIPPPQGYQIPVRWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMP+NKIA+RKGHQGWMK
Sbjct  61   KIWHSNMPHNKIAERKGHQGWMK  83



>gb|AIU48584.1| quasimodo 3, partial [Aquilegia coerulea]
Length=505

 Score =   157 bits (397),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C  D VDHMPCEDPR NSQLSREMN+YRERHCPLP ETP+CLIPPP+GY++ V WPESLH
Sbjct  1    CSIDEVDHMPCEDPRKNSQLSREMNFYRERHCPLPQETPLCLIPPPKGYRISVNWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMP+NKIADRKGHQGWMK
Sbjct  61   KIWHSNMPHNKIADRKGHQGWMK  83



>gb|AIU48594.1| quasimodo 3, partial [Sarcandra glabra]
Length=504

 Score =   157 bits (397),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 78/83 (94%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CP+D VDHMPCEDPR NSQLSREMN+YRERHCP+P +TP+CLIPPP+GY++PV WPESL+
Sbjct  1    CPSDAVDHMPCEDPRRNSQLSREMNFYRERHCPVPEDTPLCLIPPPDGYQIPVTWPESLN  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMP+NKIA+RKGHQGWMK
Sbjct  61   KIWHSNMPHNKIAERKGHQGWMK  83



>gb|AIU48593.1| quasimodo 3, partial [Acorus calamus]
Length=505

 Score =   156 bits (395),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPA+ VDHMPCEDPR NSQLSR+MN+YRERHCP P ETP+CLIPPP+GY++PV WPESLH
Sbjct  1    CPAEEVDHMPCEDPRRNSQLSRDMNFYRERHCPPPEETPLCLIPPPDGYRIPVTWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMP+NKIA+RKGHQGWMK
Sbjct  61   KIWHSNMPHNKIAERKGHQGWMK  83



>gb|AIU48609.1| quasimodo 3, partial [Aristolochia tagala]
Length=505

 Score =   156 bits (394),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPA+ VDHMPCEDPR NSQLSR+MN+YRERHCPLP ETP+CLI PPEGY++PV+WPESLH
Sbjct  1    CPAEAVDHMPCEDPRRNSQLSRDMNFYRERHCPLPEETPLCLISPPEGYRIPVQWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+  NMP+NKIA+RKGHQGWMK
Sbjct  61   KIWFKNMPHNKIAERKGHQGWMK  83



>gb|AIU48638.1| quasimodo 3, partial [Cabomba caroliniana]
Length=503

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPAD VDHMPCEDPR NSQLSRE N+YRERHCP P E+P+CLIPP  GYK+PV WPES++
Sbjct  1    CPADVVDHMPCEDPRRNSQLSRERNFYRERHCPAPEESPLCLIPPTSGYKIPVSWPESMY  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMPYNKIA+RKGHQGWMK
Sbjct  61   KIWHSNMPYNKIAERKGHQGWMK  83



>gb|AIU48629.1| quasimodo 3, partial [Lactuca sativa]
Length=505

 Score =   155 bits (392),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPAD VD+MPCEDP  NSQLSREMN+YRERHCP P ET +CLIP P+GY VP++WPESLH
Sbjct  1    CPADTVDYMPCEDPTRNSQLSREMNFYRERHCPSPDETSLCLIPAPQGYHVPIQWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H+NMPYNKIADRKGHQGWMK
Sbjct  61   KIWHENMPYNKIADRKGHQGWMK  83



>gb|AIU48607.1| quasimodo 3, partial [Pandanus utilis]
Length=505

 Score =   155 bits (391),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPA+ VD MPCEDPR NSQLSR+MNYYRERHCP P E P+CL+PPP+GY++P+ WP+SLH
Sbjct  1    CPAEEVDQMPCEDPRRNSQLSRDMNYYRERHCPAPGEAPLCLVPPPQGYRIPISWPDSLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+HDNMPY+KIA+RKGHQGWMK
Sbjct  61   KIWHDNMPYDKIAERKGHQGWMK  83



>gb|AIU48611.1| quasimodo 3, partial [Canna indica]
Length=505

 Score =   154 bits (390),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 77/83 (93%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPA+ VD+MPCEDPR +SQLSREMN+YRERHCP+P + P+CL+PPP+GY+ PV WP+SLH
Sbjct  1    CPAEEVDNMPCEDPRRSSQLSREMNFYRERHCPMPEDMPLCLVPPPKGYRSPVLWPDSLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+HDNMPYNKIADRKGHQGWMK
Sbjct  61   KIWHDNMPYNKIADRKGHQGWMK  83



>gb|AIU48622.1| quasimodo 3, partial [Dioscorea oppositifolia]
Length=505

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/83 (82%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPAD VD MPCEDPR +SQLSR MN YRERHCP   E P+CLIPPP+GY+VPV+WPESLH
Sbjct  1    CPADDVDQMPCEDPRRSSQLSRFMNSYRERHCPAAGEAPLCLIPPPDGYRVPVQWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+HDNMPYNKIADRKGHQGWMK
Sbjct  61   KIWHDNMPYNKIADRKGHQGWMK  83



>gb|AIU48630.1| quasimodo 3, partial [Ceratophyllum platyacanthum subsp. oryzetorum]
Length=505

 Score =   152 bits (385),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 76/83 (92%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CP + VD+MPCEDP+ NS+LSR MN+YRERHCPLP ETP+CLIPPP+GY++PV WPESLH
Sbjct  1    CPIETVDYMPCEDPKRNSRLSRVMNFYRERHCPLPEETPLCLIPPPKGYRIPVTWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMP+NKIA+RKGHQGWMK
Sbjct  61   KIWHSNMPHNKIAERKGHQGWMK  83



>gb|AIU48636.1| quasimodo 3, partial [Alisma plantago-aquatica]
Length=505

 Score =   152 bits (384),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPA+  DHMPCEDPR NSQLSR MN+YRERHCP P E P+CLIPPP+GY++PV WPESLH
Sbjct  1    CPAEETDHMPCEDPRRNSQLSRHMNFYRERHCPSPEEVPLCLIPPPQGYRIPVPWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMP+NKIA+RKGHQGWMK
Sbjct  61   KIWHSNMPHNKIAERKGHQGWMK  83



>gb|AIU48588.1| quasimodo 3, partial [Magnolia denudata]
Length=505

 Score =   152 bits (384),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 67/83 (81%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C  D VDHMPCEDPR NSQLSREMN+YRERHCP    TPICL+PPP+GY+VPV WPESLH
Sbjct  1    CSPDAVDHMPCEDPRRNSQLSREMNFYRERHCPALEATPICLVPPPDGYRVPVPWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMP+NKIADRKGHQGWMK
Sbjct  61   KIWHSNMPHNKIADRKGHQGWMK  83



>gb|AIU48587.1| quasimodo 3, partial [Lilium brownii]
Length=312

 Score =   148 bits (374),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C A+ VD +PCEDPR  SQLSREMN+YRERHCP P + P+CLIPPPEGY VPV WPESLH
Sbjct  1    CAAEEVDQLPCEDPRRFSQLSREMNFYRERHCPEPEDVPLCLIPPPEGYHVPVPWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H+NMPYNKIADRKGHQGWMK
Sbjct  61   KIWHNNMPYNKIADRKGHQGWMK  83



>gb|AIU48616.1| quasimodo 3, partial [Populus trichocarpa]
Length=505

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPAD VDHMPCEDPR NSQLSREMN+YRERHCP   +T +CLIPPP+GYK+ VRWP+SLH
Sbjct  1    CPADEVDHMPCEDPRRNSQLSREMNFYRERHCPPVEDTHLCLIPPPDGYKISVRWPQSLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMP++KIADRKGHQGWMK
Sbjct  61   KIWHANMPHDKIADRKGHQGWMK  83



>gb|AIU48590.1| quasimodo 3, partial [Pinellia ternata]
Length=504

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C A+ VDHMPCEDPR NSQLSR MN+YRERHCP P ET +CLIPPP+GY++PV WPESLH
Sbjct  1    CSAEEVDHMPCEDPRRNSQLSRHMNFYRERHCPPPEETALCLIPPPDGYRIPVSWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMP+NKIA+RKGHQGWMK
Sbjct  61   KIWHSNMPHNKIAERKGHQGWMK  83



>gb|AIU48608.1| quasimodo 3, partial [Asparagus officinalis]
Length=505

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C +D VD MPCEDPR NSQLSREMN+YRERHCP P + P+CL+P P GY++PV+WPESLH
Sbjct  1    CSSDKVDDMPCEDPRRNSQLSREMNFYRERHCPAPEDGPLCLVPAPAGYRIPVQWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+HDNMP+NKIA+RKGHQGWMK
Sbjct  61   KIWHDNMPHNKIAERKGHQGWMK  83



>gb|AIU48605.1| quasimodo 3, partial [Ceratophyllum demersum]
Length=505

 Score =   149 bits (377),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CP + VD+MPCEDP+ NS+LSR MN+YRERHCPL  ETP+CLIPPP+GY++PV WPESLH
Sbjct  1    CPIETVDYMPCEDPKRNSRLSRVMNFYRERHCPLLEETPLCLIPPPKGYRIPVTWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMP+NKIA+RKGHQGWMK
Sbjct  61   KIWHSNMPHNKIAERKGHQGWMK  83



>gb|AIU48606.1| quasimodo 3, partial [Chimonanthus praecox]
Length=505

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 75/83 (90%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CP+D +DHMPCEDPR NSQLSREMN+YRERHCP P E+ ICLIPPP GY++PV WPESLH
Sbjct  1    CPSDAIDHMPCEDPRRNSQLSREMNFYRERHCPDPTESQICLIPPPSGYRIPVPWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI++ NMP++KIA+RKGHQGWMK
Sbjct  61   KIWYSNMPHSKIAERKGHQGWMK  83



>gb|AIU48596.1| quasimodo 3, partial [Gossypium raimondii]
Length=503

 Score =   149 bits (376),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 73/83 (88%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CP D VDHMPCEDP+ NSQLSR MN+YRERHCPLP E P+CLIPPP  YK+P++WPESLH
Sbjct  1    CPPDSVDHMPCEDPKRNSQLSRYMNFYRERHCPLPDEMPLCLIPPPLDYKIPIQWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            K++H NMP+NKIA RKGHQGWMK
Sbjct  61   KVWHSNMPHNKIATRKGHQGWMK  83



>gb|AIU48631.1| quasimodo 3, partial [Cinnamomum camphora]
Length=505

 Score =   148 bits (374),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/83 (78%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPA+ VDHMPCEDPR NSQLSREMN+YRERHCP   E+ +CLIPPP GY++PV WPESLH
Sbjct  1    CPAEAVDHMPCEDPRRNSQLSREMNFYRERHCPSLEESMVCLIPPPVGYQIPVPWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMP+NKIA+RKGHQGWMK
Sbjct  61   KIWHSNMPHNKIAERKGHQGWMK  83



>gb|AIU48623.1| quasimodo 3, partial [Yucca filamentosa]
Length=505

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 72/83 (87%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C AD VD MPCEDP+ NSQLSREMN+YRERHCP P E P+CL+PPPEGY+VP+ WPESL 
Sbjct  1    CSADEVDQMPCEDPKRNSQLSREMNFYRERHCPSPGEGPLCLVPPPEGYRVPIPWPESLF  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H N PY+KIADRKGHQGWMK
Sbjct  61   KIWHGNTPYDKIADRKGHQGWMK  83



>gb|AIU48601.1| quasimodo 3, partial [Illicium henryi]
Length=505

 Score =   147 bits (371),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C ++ VDHMPCEDPR NSQLSREMN+YRERHCP P ETP+CLIPPP+GY+ P+ WP+S+ 
Sbjct  1    CSSEAVDHMPCEDPRRNSQLSREMNFYRERHCPKPEETPLCLIPPPDGYRTPIPWPDSML  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMP+NKIA+RKGHQGWMK
Sbjct  61   KIWHSNMPHNKIAERKGHQGWMK  83



>gb|AIU48621.1| quasimodo 3, partial [Ricinus communis]
Length=496

 Score =   146 bits (368),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  548  MPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMP  727
            MPCEDPR NSQLSR+MN+YRERHCP+P ETP+CLIPPP GYK+PV+WP+SLHKI+H NMP
Sbjct  1    MPCEDPRRNSQLSRDMNFYRERHCPIPDETPLCLIPPPNGYKIPVQWPQSLHKIWHANMP  60

Query  728  YNKIADRKGHQGWMK  772
            +NKIADRKGHQGWMK
Sbjct  61   HNKIADRKGHQGWMK  75



>ref|XP_002511800.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF50469.1| conserved hypothetical protein [Ricinus communis]
Length=507

 Score =   146 bits (369),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +2

Query  548  MPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMP  727
            MPCEDPR NSQLSR+MN+YRERHCP+P ETP+CLIPPP GYK+PV+WP+SLHKI+H NMP
Sbjct  1    MPCEDPRRNSQLSRDMNFYRERHCPIPDETPLCLIPPPNGYKIPVQWPQSLHKIWHANMP  60

Query  728  YNKIADRKGHQGWMK  772
            +NKIADRKGHQGWMK
Sbjct  61   HNKIADRKGHQGWMK  75



>gb|AIU48637.1| quasimodo 3, partial [Trachycarpus fortunei]
Length=505

 Score =   145 bits (367),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPA+ VD+MPCEDPR NSQL+R MN YRERHCP P E+ +CL+PPP+GY+ PV WPESLH
Sbjct  1    CPAEEVDYMPCEDPRRNSQLTRHMNLYRERHCPPPGESLLCLVPPPQGYRYPVPWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+HDNMPY+KIA+RKGHQGWMK
Sbjct  61   KIWHDNMPYDKIAERKGHQGWMK  83



>emb|CAH67036.1| OSIGBa0139P06.9 [Oryza sativa Indica Group]
 gb|EEC77823.1| hypothetical protein OsI_17029 [Oryza sativa Indica Group]
Length=584

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E P+CL+PPP GY+VPV WPESLH
Sbjct  71   CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEAPVCLVPPPRGYRVPVPWPESLH  130

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+HDNMPY KIA+RKGHQGWMK
Sbjct  131  KIWHDNMPYGKIAERKGHQGWMK  153



>emb|CAE02253.2| OSJNBb0032E06.12 [Oryza sativa Japonica Group]
Length=586

 Score =   145 bits (365),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E P+CL+PPP GY+VPV WPESLH
Sbjct  73   CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEAPVCLVPPPRGYRVPVPWPESLH  132

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+HDNMPY KIA+RKGHQGWMK
Sbjct  133  KIWHDNMPYGKIAERKGHQGWMK  155



>gb|AIU48618.1| quasimodo 3, partial [Panicum virgatum]
Length=505

 Score =   144 bits (362),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E P CL+PPP GY++PV WPESLH
Sbjct  1    CAASEVDFLPCEDPRRSSRLSREMNYYRERHCPARGEAPACLVPPPSGYRIPVPWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+HDNMPY KIA+RKGHQGWMK
Sbjct  61   KIWHDNMPYGKIAERKGHQGWMK  83



>gb|AIU48624.1| quasimodo 3, partial [Setaria italica]
Length=505

 Score =   143 bits (360),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/83 (76%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E P CL+PPP GY+VPV WPESLH
Sbjct  1    CAAAEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEAPACLVPPPSGYRVPVPWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+HDNMPY KIA+RKGHQGWMK
Sbjct  61   KIWHDNMPYGKIAERKGHQGWMK  83



>gb|AIU48603.1| quasimodo 3, partial [Iris japonica]
Length=505

 Score =   142 bits (357),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 74/83 (89%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C A+ VD+MPCEDPR +SQLSR+MN+YRER CPLP E P+CL+PP +GY++PV WPESLH
Sbjct  1    CSAEEVDNMPCEDPRRSSQLSRKMNFYRERQCPLPGEAPLCLVPPTDGYRLPVPWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H NMPY+K+A+RKGHQGWMK
Sbjct  61   KIWHANMPYDKLAERKGHQGWMK  83



>gb|AIU48591.1| quasimodo 3, partial [Brachypodium distachyon]
Length=505

 Score =   141 bits (356),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E   CL+PPP GY+VPV WPESLH
Sbjct  1    CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEALACLVPPPRGYRVPVSWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+HDNMPY KIA+RKGHQGWMK
Sbjct  61   KIWHDNMPYGKIAERKGHQGWMK  83



>ref|XP_003580350.1| PREDICTED: probable methyltransferase PMT13 [Brachypodium distachyon]
Length=583

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E   CL+PPP GY+VPV WPESLH
Sbjct  68   CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEALACLVPPPRGYRVPVSWPESLH  127

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+HDNMPY KIA+RKGHQGWMK
Sbjct  128  KIWHDNMPYGKIAERKGHQGWMK  150



>ref|XP_002961169.1| hypothetical protein SELMODRAFT_74065 [Selaginella moellendorffii]
 gb|EFJ38708.1| hypothetical protein SELMODRAFT_74065 [Selaginella moellendorffii]
Length=591

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 92/129 (71%), Gaps = 8/129 (6%)
 Frame = +2

Query  401  TPLGDSLAASGRQALLSGDSQQ-----RSLLVTLVESGREIAPIQFCPADYVDHMPCEDP  565
            TPLGDS+AASG ++L S  + +     R  LV L+E G+ +   + C     D+MPC+DP
Sbjct  40   TPLGDSMAASGLKSLDSPLAMEIRPSGRQRLVKLIEKGQRV---ELCAPGLADYMPCQDP  96

Query  566  RINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIAD  745
            + +SQ+SRE N YRERHCP  +E  +C IP P GYKVPV WP+SL+K+++ NMPY KIA+
Sbjct  97   KRSSQISRERNRYRERHCPPENERLLCRIPSPRGYKVPVPWPDSLNKVWYSNMPYGKIAE  156

Query  746  RKGHQGWMK  772
            RKGHQGWMK
Sbjct  157  RKGHQGWMK  165



>ref|XP_002966837.1| hypothetical protein SELMODRAFT_168608 [Selaginella moellendorffii]
 gb|EFJ31436.1| hypothetical protein SELMODRAFT_168608 [Selaginella moellendorffii]
Length=591

 Score =   142 bits (357),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/129 (54%), Positives = 92/129 (71%), Gaps = 8/129 (6%)
 Frame = +2

Query  401  TPLGDSLAASGRQALLSGDSQQ-----RSLLVTLVESGREIAPIQFCPADYVDHMPCEDP  565
            TPLGDS+AASG ++L S  + +     R  LV L+E G+ +   + C     D+MPC+DP
Sbjct  40   TPLGDSMAASGLKSLDSPLAMEIRPSGRQRLVKLIEKGQRV---ELCAPGLADYMPCQDP  96

Query  566  RINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIAD  745
            + +SQ+SRE N YRERHCP  +E  +C IP P GYKVPV WP+SL+K+++ NMPY KIA+
Sbjct  97   KRSSQISRERNRYRERHCPPENERLLCRIPSPRGYKVPVPWPDSLNKVWYSNMPYGKIAE  156

Query  746  RKGHQGWMK  772
            RKGHQGWMK
Sbjct  157  RKGHQGWMK  165



>dbj|BAJ96404.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=350

 Score =   139 bits (351),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E   CL+PPP GY+VPV WPESLH
Sbjct  65   CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEASACLVPPPPGYRVPVPWPESLH  124

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+HDNMPY KIA+RKGHQGWMK
Sbjct  125  KIWHDNMPYGKIAERKGHQGWMK  147



>gb|AIU48626.1| quasimodo 3, partial [Sorghum bicolor]
Length=505

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E   CL+PPP GY+VPV WPESLH
Sbjct  1    CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEALACLVPPPRGYRVPVPWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+HDNMPY KIA+RKGHQGWMK
Sbjct  61   KIWHDNMPYGKIAERKGHQGWMK  83



>dbj|BAJ96685.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=580

 Score =   140 bits (354),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E   CL+PPP GY+VPV WPESLH
Sbjct  65   CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEASACLVPPPPGYRVPVPWPESLH  124

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+HDNMPY KIA+RKGHQGWMK
Sbjct  125  KIWHDNMPYGKIAERKGHQGWMK  147



>dbj|BAJ98075.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=572

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E   CL+PPP GY+VPV WPESLH
Sbjct  65   CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEASACLVPPPPGYRVPVPWPESLH  124

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+HDNMPY KIA+RKGHQGWMK
Sbjct  125  KIWHDNMPYGKIAERKGHQGWMK  147



>ref|XP_008669009.1| PREDICTED: probable methyltransferase PMT13 [Zea mays]
 gb|AFW59274.1| hypothetical protein ZEAMMB73_145295 [Zea mays]
Length=583

 Score =   140 bits (353),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 75/97 (77%), Gaps = 3/97 (3%)
 Frame = +2

Query  482  TLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  661
            ++  +G  + P   C A  VD +PCEDPR +S+LSREMNYYRERHCP   E   CL+PPP
Sbjct  57   SVARAGGTVPP---CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPTRGEALACLVPPP  113

Query  662  EGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             GY++PV WPESLHKI+HDNMPY KIA+RKGHQGWMK
Sbjct  114  RGYRIPVPWPESLHKIWHDNMPYGKIAERKGHQGWMK  150



>gb|AIU48635.1| quasimodo 3, partial [Zea mays]
Length=505

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E   CL+PPP GY++PV WPESLH
Sbjct  1    CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPTRGEALACLVPPPRGYRIPVPWPESLH  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+HDNMPY KIA+RKGHQGWMK
Sbjct  61   KIWHDNMPYGKIAERKGHQGWMK  83



>ref|XP_004976531.1| PREDICTED: probable methyltransferase PMT13-like [Setaria italica]
Length=577

 Score =   140 bits (352),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +2

Query  539  VDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHD  718
            VD +PCEDPR +S+LSREMNYYRERHCP   E P CL+PPP GY+VPV WPESLHKI+HD
Sbjct  67   VDLLPCEDPRRSSRLSREMNYYRERHCPARGEAPACLVPPPSGYRVPVPWPESLHKIWHD  126

Query  719  NMPYNKIADRKGHQGWMK  772
            NMPY KIA+RKGHQGWMK
Sbjct  127  NMPYGKIAERKGHQGWMK  144



>gb|AIU48633.1| quasimodo 3, partial [Ginkgo biloba]
Length=505

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CP + VDH+PCEDPR +SQ SRE NYYRERHCP P E  +CLIPPP  YK+PV WP+SL+
Sbjct  1    CPLESVDHIPCEDPRRSSQFSRERNYYRERHCPPPSENLLCLIPPPVNYKIPVPWPDSLY  60

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+H N+P+NKIADRKGHQGWMK
Sbjct  61   KIWHSNIPHNKIADRKGHQGWMK  83



>ref|XP_002448358.1| hypothetical protein SORBIDRAFT_06g025780 [Sorghum bicolor]
 gb|EES12686.1| hypothetical protein SORBIDRAFT_06g025780 [Sorghum bicolor]
Length=606

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 73/113 (65%), Gaps = 23/113 (20%)
 Frame = +2

Query  494  SGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYK  673
            SG  + P   C A  VD +PCEDPR +S+LSREMNYYRERHCP   E   CL+PPP GY+
Sbjct  64   SGGAVPP---CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEALACLVPPPRGYR  120

Query  674  VPVRWPESLHK--------------------IFHDNMPYNKIADRKGHQGWMK  772
            VPV WPESLHK                    I+HDNMPY KIA+RKGHQGWMK
Sbjct  121  VPVPWPESLHKLPVVNAHGFLILYLSEMDFLIWHDNMPYGKIAERKGHQGWMK  173



>gb|EEE61526.1| hypothetical protein OsJ_15828 [Oryza sativa Japonica Group]
Length=463

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C A  VD +PCEDPR +S+LSREMNYYRERHCP   E P+CL+PPP GY+VPV WPESLH
Sbjct  73   CAASEVDLLPCEDPRRSSRLSREMNYYRERHCPARGEAPVCLVPPPRGYRVPVPWPESLH  132

Query  704  KIFHDNMPYNKIADRK  751
            KI+HDNMPY KIA+RK
Sbjct  133  KIWHDNMPYGKIAERK  148



>ref|XP_001772854.1| predicted protein [Physcomitrella patens]
 gb|EDQ62256.1| predicted protein [Physcomitrella patens]
Length=608

 Score =   117 bits (294),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 77/126 (61%), Gaps = 7/126 (6%)
 Frame = +2

Query  401  TPLGDSLAASGRQ---ALLSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRI  571
            T LGDSLAA G+Q   A L  D          VE+G     ++ CP    D MPC DP+ 
Sbjct  40   TSLGDSLAAGGQQYLDAALRADPTSSGFWQQ-VETG---LLVESCPVRLADIMPCHDPKR  95

Query  572  NSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRK  751
                ++E N+YRERHCP   E   CLIPPP  Y++PVRWPESLH+I+ +N P+NKIA+ K
Sbjct  96   ARAFTKERNHYRERHCPPAEERLRCLIPPPPDYQIPVRWPESLHRIWFNNTPHNKIAELK  155

Query  752  GHQGWM  769
              QGWM
Sbjct  156  SDQGWM  161



>ref|XP_001769468.1| predicted protein [Physcomitrella patens]
 gb|EDQ65837.1| predicted protein [Physcomitrella patens]
Length=598

 Score =   117 bits (293),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 94/152 (62%), Gaps = 7/152 (5%)
 Frame = +2

Query  323  ARKWQlldlvfaaffaavfvffllvfTPLGDSLAASGRQAL---LSGDSQQRSLLVTLVE  493
             RKWQLLD++     AA+ + FLL+FT LGDSLA +G++ L   L  DS         VE
Sbjct  14   GRKWQLLDIIIFTMMAALMILFLLIFTSLGDSLATAGQRELDAALRADSTSNGFW-DQVE  72

Query  494  SGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYK  673
             G     ++ CP    D MPC DP+     S+E N+YRERHCP   E   CLIPPP  Y+
Sbjct  73   HG---LLVESCPVRLADIMPCHDPKRARSFSKERNHYRERHCPPFEEKLRCLIPPPPDYQ  129

Query  674  VPVRWPESLHKIFHDNMPYNKIADRKGHQGWM  769
            +PVRWPESL KI+ +N P+NKIA+ K  QGWM
Sbjct  130  IPVRWPESLRKIWFNNTPHNKIAELKSDQGWM  161



>gb|EMS47379.1| putative methyltransferase PMT13 [Triticum urartu]
Length=440

 Score =   110 bits (276),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  593  MNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            MNYYRERHCP   E P CL+PPP GY+VPV WPE LHKI+HDNMPY KIA+RKGHQGWMK
Sbjct  1    MNYYRERHCPARGEAPACLVPPPPGYRVPVPWPEGLHKIWHDNMPYGKIAERKGHQGWMK  60



>gb|AIU48604.1| quasimodo 3, partial [Chloranthus japonicus]
Length=495

 Score = 98.6 bits (244),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 48/83 (58%), Positives = 56/83 (67%), Gaps = 10/83 (12%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CP+D V HMPCED R N           ER CP P E P+CLIPPP+GY++PV WPESL+
Sbjct  1    CPSDAVHHMPCEDLRRNG----------ERKCPAPEEMPLCLIPPPDGYRIPVPWPESLY  50

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            KI+  NMP+ KIAD K HQ  MK
Sbjct  51   KIWRTNMPHIKIADGKVHQSLMK  73



>gb|KHN27285.1| Putative methyltransferase PMT13, partial [Glycine soja]
Length=475

 Score = 94.0 bits (232),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  635  TPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            TP+CL+PP +GYKVPV+WPESLHKI+H NMPYNKIADRKGHQGWMK
Sbjct  1    TPLCLVPPLKGYKVPVKWPESLHKIWHSNMPYNKIADRKGHQGWMK  46



>ref|XP_010940855.1| PREDICTED: probable methyltransferase PMT21 [Elaeis guineensis]
Length=1027

 Score = 93.2 bits (230),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/95 (45%), Positives = 62/95 (65%), Gaps = 8/95 (8%)
 Frame = +2

Query  503  EIAPIQF--CPADYVDHMPCEDPRINSQLSREMNY---YRERHCPLPHETPICLIPPPEG  667
            E+ P+ F  C +DY D+ PC DP+   +  R  NY   +RERHCP  +E   CL+PPP+G
Sbjct  502  EVKPVAFPECDSDYQDYTPCTDPK---RWRRYGNYRLTHRERHCPPIYERKECLVPPPDG  558

Query  668  YKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            YK P+RWP S H+ ++ N+PY+ I + K HQ W++
Sbjct  559  YKQPIRWPNSKHECWYRNVPYDWINNNKSHQNWLR  593



>gb|EMT00863.1| hypothetical protein F775_08090 [Aegilops tauschii]
Length=608

 Score = 92.4 bits (228),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 69/113 (61%), Gaps = 8/113 (7%)
 Frame = +2

Query  449  SGDSQQRSLLVTLVESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNY---YRER  613
            +   +  ++ + +  +G     ++F  CPADY D+ PC DP+   +  R  NY   + ER
Sbjct  63   TAKQEGSAIALAIARNGNGDDEVEFSECPADYQDYTPCTDPK---RWRRYGNYRLSFMER  119

Query  614  HCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            HCP P E  +CL+PPP GYK P+RWP+S H+ ++ N+PY+ I  +K +Q W++
Sbjct  120  HCPPPPERAVCLVPPPRGYKPPIRWPKSKHQCWYRNVPYDWINSQKSNQHWLR  172



>ref|XP_002992272.1| hypothetical protein SELMODRAFT_186660 [Selaginella moellendorffii]
 gb|EFJ06653.1| hypothetical protein SELMODRAFT_186660 [Selaginella moellendorffii]
Length=539

 Score = 89.4 bits (220),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 59/89 (66%), Gaps = 4/89 (4%)
 Frame = +2

Query  515  IQFCPADYVDHMPCEDPRINSQLSREMNYYR----ERHCPLPHETPICLIPPPEGYKVPV  682
            +  CP+++ +++PC DP   + +S ++N  R    ER CP PH+ P CL+PPP+ YK+P+
Sbjct  26   VSLCPSNFTEYIPCHDPNYIASISSKLNLSRREHLERQCPPPHQRPFCLVPPPKSYKLPI  85

Query  683  RWPESLHKIFHDNMPYNKIADRKGHQGWM  769
            RWP+S   ++  N+ + ++A+ KG Q W+
Sbjct  86   RWPQSRDYVWRSNVNHTRLAEVKGGQNWV  114



>ref|XP_009136994.1| PREDICTED: probable methyltransferase PMT21 [Brassica rapa]
 ref|XP_009136995.1| PREDICTED: probable methyltransferase PMT21 [Brassica rapa]
Length=601

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 66/116 (57%), Gaps = 2/116 (2%)
 Frame = +2

Query  431  GRQALLSGDSQQRSLLVTLVESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYY  604
            G+  L   D  +    + +V++  ++  + F  C +DY D+ PC DPR   +       +
Sbjct  41   GKNKLQVNDVAKAGSSLDVVDNSPQVKSVSFPECSSDYQDYTPCTDPRKWKKYGTHRLTF  100

Query  605  RERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             ERHCP   +   CL+PPP GYK P+RWP+S ++ ++ N+PY+ I  +K +Q W+K
Sbjct  101  MERHCPPVFDRKQCLVPPPNGYKSPIRWPKSKNECWYRNVPYDWINKQKSNQHWLK  156



>ref|XP_012075070.1| PREDICTED: probable methyltransferase PMT21 [Jatropha curcas]
 ref|XP_012075071.1| PREDICTED: probable methyltransferase PMT21 [Jatropha curcas]
 ref|XP_012075073.1| PREDICTED: probable methyltransferase PMT21 [Jatropha curcas]
Length=600

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 59/96 (61%), Gaps = 7/96 (7%)
 Frame = +2

Query  506  IAPIQF-------CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPE  664
            +AP+Q        C +DY D+ PC DPR   +   +     ERHCP P E  +CL+PPP+
Sbjct  63   VAPLQIKSAVFPECSSDYQDYTPCTDPRRWKKYGYQRLTLMERHCPPPFERKVCLVPPPD  122

Query  665  GYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            GYK P+RWP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  123  GYKPPIRWPKSRDECWYRNVPYDWINKQKSNQNWLR  158



>gb|KDP35427.1| hypothetical protein JCGZ_10810 [Jatropha curcas]
Length=580

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 59/96 (61%), Gaps = 7/96 (7%)
 Frame = +2

Query  506  IAPIQF-------CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPE  664
            +AP+Q        C +DY D+ PC DPR   +   +     ERHCP P E  +CL+PPP+
Sbjct  43   VAPLQIKSAVFPECSSDYQDYTPCTDPRRWKKYGYQRLTLMERHCPPPFERKVCLVPPPD  102

Query  665  GYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            GYK P+RWP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  103  GYKPPIRWPKSRDECWYRNVPYDWINKQKSNQNWLR  138



>ref|XP_006662118.1| PREDICTED: probable methyltransferase PMT20-like [Oryza brachyantha]
Length=609

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 54/83 (65%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPADY D+ PC DP+   +       + ERHCP P E   CL+PPP+GYK P+RWP+S  
Sbjct  87   CPADYQDYTPCTDPKRWRKYGNYRLSFMERHCPPPVERKECLVPPPQGYKAPIRWPKSKD  146

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            + ++ N+PY+ I  +K +Q W++
Sbjct  147  QCWYRNVPYDWINSQKSNQHWLR  169



>emb|CDY01583.1| BnaC07g35730D [Brassica napus]
Length=657

 Score = 87.8 bits (216),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 66/116 (57%), Gaps = 2/116 (2%)
 Frame = +2

Query  431  GRQALLSGDSQQRSLLVTLVESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYY  604
            G+  L   D  +    + +V++  ++  + F  C +DY D+ PC DPR   +       +
Sbjct  97   GKNKLQVNDVAKAGSSLDVVDNSPQVKSVSFPECSSDYQDYTPCTDPRKWKKYGTHRLTF  156

Query  605  RERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             ERHCP   +   CL+PPP GYK P+RWP+S ++ ++ N+PY+ I  +K +Q W+K
Sbjct  157  MERHCPPVFDRKQCLVPPPNGYKSPIRWPKSKNECWYRNVPYDWINKQKSNQHWLK  212



>emb|CDX98606.1| BnaA03g43910D [Brassica napus]
Length=664

 Score = 87.8 bits (216),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/116 (34%), Positives = 66/116 (57%), Gaps = 2/116 (2%)
 Frame = +2

Query  431  GRQALLSGDSQQRSLLVTLVESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYY  604
            G+  L   D  +    + +V++  ++  + F  C +DY D+ PC DPR   +       +
Sbjct  104  GKNKLQVNDVAKAGSSLDVVDNSPQVKSVSFPECSSDYQDYTPCTDPRKWKKYGTHRLTF  163

Query  605  RERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             ERHCP   +   CL+PPP GYK P+RWP+S ++ ++ N+PY+ I  +K +Q W+K
Sbjct  164  MERHCPPVFDRKQCLVPPPNGYKSPIRWPKSKNECWYRNVPYDWINKQKSNQHWLK  219



>gb|KJB25151.1| hypothetical protein B456_004G178700 [Gossypium raimondii]
 gb|KJB25152.1| hypothetical protein B456_004G178700 [Gossypium raimondii]
 gb|KJB25153.1| hypothetical protein B456_004G178700 [Gossypium raimondii]
 gb|KJB25154.1| hypothetical protein B456_004G178700 [Gossypium raimondii]
Length=604

 Score = 87.0 bits (214),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/97 (41%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +2

Query  488  VESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  661
             E+  +I P+ F  C  DY D+ PC DPR   +       + ERHCP  +E   CL+PPP
Sbjct  65   AENALQIKPVTFSECSIDYQDYTPCTDPRRWKKYGYRRLTFLERHCPPLYERKECLVPPP  124

Query  662  EGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             GYK P+RWP+S  + ++ N+PY+ I  +K +Q W+K
Sbjct  125  VGYKPPIRWPKSRKECWYRNVPYDWINKQKSNQNWLK  161



>dbj|BAJ94360.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=578

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 44/118 (37%), Positives = 68/118 (58%), Gaps = 11/118 (9%)
 Frame = +2

Query  443  LLSGDSQQRSLLVTLVE-----SGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNY--  601
            ++S   Q+ S +   +      +G E      CPA+Y D+ PC DP+   +  R  NY  
Sbjct  61   IVSTTKQEGSAIALAIAGHGNGNGDEEVEFSECPAEYQDYTPCTDPK---RWRRYGNYRL  117

Query  602  -YRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             + ERHCP P E  +CL+PPP GYK P+RWP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  118  SFMERHCPPPPERAVCLVPPPRGYKPPIRWPKSKDQCWYRNVPYDWINSQKSNQHWLR  175



>dbj|BAK00591.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=611

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 60/96 (63%), Gaps = 6/96 (6%)
 Frame = +2

Query  494  SGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNY---YRERHCPLPHETPICLIPPPE  664
            +G E      CPA+Y D+ PC DP+   +  R  NY   + ERHCP P E  +CL+PPP 
Sbjct  83   NGDEEVEFSECPAEYQDYTPCTDPK---RWRRYGNYRLSFMERHCPPPPERAVCLVPPPR  139

Query  665  GYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            GYK P+RWP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  140  GYKPPIRWPKSKDQCWYRNVPYDWINSQKSNQHWLR  175



>ref|XP_002310457.2| hypothetical protein POPTR_0007s02440g [Populus trichocarpa]
 gb|EEE90907.2| hypothetical protein POPTR_0007s02440g [Populus trichocarpa]
Length=600

 Score = 87.0 bits (214),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 55/91 (60%), Gaps = 0/91 (0%)
 Frame = +2

Query  500  REIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVP  679
            R +    FCP ++ ++ PC DP   +  + E  + RERHCP P+E P+CL+P P GYK P
Sbjct  76   RNLQFFNFCPPNFTNYCPCHDPSRETDFTAERFFSRERHCPEPYEKPMCLVPRPAGYKRP  135

Query  680  VRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
              WP+S    +  N+P+ ++++ K  Q W++
Sbjct  136  FSWPKSRDYAWFKNLPFKELSEVKKTQNWVR  166



>gb|EPS61707.1| hypothetical protein M569_13087, partial [Genlisea aurea]
Length=262

 Score = 84.0 bits (206),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 60/100 (60%), Gaps = 2/100 (2%)
 Frame = +2

Query  479  VTLVESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLI  652
            V +  +  +I  + F  C  DY D+ PC DPR   + S     + ERHCP   E  +CL+
Sbjct  45   VAIAAAPLQIKAVNFPECSPDYQDYTPCTDPRRWRKYSYRRLSFMERHCPPLSERKVCLV  104

Query  653  PPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            PPP+GYK P++WP+S  + ++ N+PY+ I  +K +Q W+K
Sbjct  105  PPPDGYKPPIKWPKSKDECWYRNVPYDWINKQKSNQHWLK  144



>ref|XP_011016489.1| PREDICTED: probable methyltransferase PMT17, partial [Populus 
euphratica]
Length=345

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (54%), Gaps = 4/121 (3%)
 Frame = +2

Query  410  GDSLAASGRQALLSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSR  589
            G S   S   A+L  +S  + +     +S  EI P   C   Y ++ PC+DPR   +  R
Sbjct  62   GVSSNPSSESAVLDFNSHHQ-IQFNNTDSVNEIPP---CDMSYSEYTPCQDPRRGRKFDR  117

Query  590  EMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWM  769
             M  YRERHCP   E  +CLIP P  YK P +WP+S    ++DN+P+ +++  K  Q W+
Sbjct  118  NMLKYRERHCPTKDELLLCLIPAPPKYKTPFKWPQSRDYAWYDNIPHKELSIEKAVQNWI  177

Query  770  K  772
            +
Sbjct  178  Q  178



>ref|XP_002317647.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE98259.1| dehydration-responsive family protein [Populus trichocarpa]
Length=625

 Score = 85.9 bits (211),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 67/121 (55%), Gaps = 4/121 (3%)
 Frame = +2

Query  410  GDSLAASGRQALLSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSR  589
            G S   S   A+L  +S  + + +   +S  EI P   C   Y ++ PC+DP+   +  R
Sbjct  62   GVSSNPSSESAVLDFNSHHQ-IQINNTDSVNEIPP---CDMSYSEYTPCQDPQRGRKFDR  117

Query  590  EMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWM  769
             M  YRERHCP   E  +CLIP P  YK P +WP+S    ++DN+P+N+++  K  Q W+
Sbjct  118  NMLKYRERHCPTKDELLLCLIPAPPKYKTPFKWPQSRDYAWYDNIPHNELSIEKAVQNWI  177

Query  770  K  772
            +
Sbjct  178  Q  178



>ref|XP_009365745.1| PREDICTED: probable methyltransferase PMT21 [Pyrus x bretschneideri]
 ref|XP_009365746.1| PREDICTED: probable methyltransferase PMT21 [Pyrus x bretschneideri]
Length=593

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 59/97 (61%), Gaps = 2/97 (2%)
 Frame = +2

Query  488  VESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  661
            V+S  ++ P+ F  C +DY D+ PC DPR   +       + ERHCP   E   CL+PPP
Sbjct  55   VQSSLQLKPVTFAECSSDYQDYTPCTDPRRWRKYGVHRLTFMERHCPPVLERKECLVPPP  114

Query  662  EGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +GYK P+RWP S  + ++ N+PY+ I  +K +Q W++
Sbjct  115  DGYKPPIRWPNSRDECWYRNVPYDWINKQKSNQNWLR  151



>ref|XP_008373450.1| PREDICTED: probable methyltransferase PMT21 [Malus domestica]
Length=593

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 59/97 (61%), Gaps = 2/97 (2%)
 Frame = +2

Query  488  VESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  661
            V+S  ++ P+ F  C +DY D+ PC DPR   +       + ERHCP   E   CL+PPP
Sbjct  55   VQSSLQLKPVTFAECSSDYQDYTPCTDPRRWRKYGVHRLTFMERHCPPVLERKECLVPPP  114

Query  662  EGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +GYK P+RWP S  + ++ N+PY+ I  +K +Q W++
Sbjct  115  DGYKPPIRWPNSRDECWYRNVPYDWINKQKSNQNWLR  151



>ref|XP_008364478.1| PREDICTED: probable methyltransferase PMT21 [Malus domestica]
Length=593

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 59/97 (61%), Gaps = 2/97 (2%)
 Frame = +2

Query  488  VESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  661
            V+S  ++ P+ F  C +DY D+ PC DPR   +       + ERHCP   E   CL+PPP
Sbjct  55   VQSSLQLKPVTFAECSSDYQDYTPCTDPRRWRKYGVHRLTFMERHCPPVLERKECLVPPP  114

Query  662  EGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +GYK P+RWP S  + ++ N+PY+ I  +K +Q W++
Sbjct  115  DGYKPPIRWPNSRDECWYRNVPYDWINKQKSNQNWLR  151



>ref|XP_009774700.1| PREDICTED: probable methyltransferase PMT21 [Nicotiana sylvestris]
 ref|XP_009774701.1| PREDICTED: probable methyltransferase PMT21 [Nicotiana sylvestris]
 ref|XP_009774702.1| PREDICTED: probable methyltransferase PMT21 [Nicotiana sylvestris]
Length=600

 Score = 85.5 bits (210),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C ADY D+ PC DPR   +       + ERHCP   E   CL+PPP+GYKVP+RWP+S +
Sbjct  77   CSADYQDYTPCTDPRRWKKYGLHRLTFMERHCPPTFERKECLVPPPDGYKVPIRWPKSKN  136

Query  704  KIFHDNMPYNKIADRKGHQGWM  769
            + ++ N+PY+ I  +K +Q W+
Sbjct  137  ECWYRNVPYDWINKQKSNQHWL  158



>gb|KFK28580.1| methyltransferase pmt20 [Arabis alpina]
Length=599

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/116 (34%), Positives = 66/116 (57%), Gaps = 2/116 (2%)
 Frame = +2

Query  431  GRQALLSGDSQQRSLLVTLVESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYY  604
            G+  +   D  +    V +V++ +  + + F  C +DY D+ PC DPR   +       +
Sbjct  41   GKNNMEVNDVAKVGSSVDVVDTTQAKSAVTFSECGSDYQDYTPCTDPRKWKKYGTHRLTF  100

Query  605  RERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             ERHCP   +   CL+PPP GYK P+RWP+S ++ ++ N+PY+ I  +K +Q W++
Sbjct  101  MERHCPPVFDRKQCLVPPPNGYKPPIRWPKSKNECWYRNVPYDWINTQKSNQNWLR  156



>gb|ACL53638.1| unknown [Zea mays]
Length=610

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 69/123 (56%), Gaps = 15/123 (12%)
 Frame = +2

Query  416  SLAASGRQALLSGDSQQRSLLVTLVESGREIAPIQF--CPADYVDHMPCEDPRINSQLSR  589
            +L A+      S D Q R  L +        A + F  CPADY D+ PC DP+   +  R
Sbjct  61   ALGAATTTRRPSDDGQARPALAS-------TAAVAFPECPADYQDYTPCTDPK---RWRR  110

Query  590  EMNY---YRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQ  760
              NY   + ERHCP P +   CL+PPP+GYK P+RWP+S  + ++ N+PY+ I  +K +Q
Sbjct  111  YGNYRLSFMERHCPPPPDRQQCLVPPPKGYKPPIRWPKSKDQCWYRNVPYDWINSQKSNQ  170

Query  761  GWM  769
             W+
Sbjct  171  HWL  173



>gb|EAY93110.1| hypothetical protein OsI_14912 [Oryza sativa Indica Group]
Length=610

 Score = 85.5 bits (210),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            CPADY D+ PC DP+   +       + ERHCP   E   CL+PPP+GYK P+RWP+S  
Sbjct  83   CPADYQDYTPCTDPKRWRKYGNYRLSFMERHCPPAVERKECLVPPPQGYKAPIRWPKSKD  142

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            + ++ N+PY+ I  +K +Q W++
Sbjct  143  QCWYRNVPYDWINSQKSNQHWLR  165



>ref|NP_001152283.1| ankyrin protein kinase-like [Zea mays]
 gb|ACG46792.1| ankyrin protein kinase-like [Zea mays]
Length=610

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 69/123 (56%), Gaps = 15/123 (12%)
 Frame = +2

Query  416  SLAASGRQALLSGDSQQRSLLVTLVESGREIAPIQF--CPADYVDHMPCEDPRINSQLSR  589
            +L A+      S D Q R  L +        A + F  CPADY D+ PC DP+   +  R
Sbjct  61   ALGAATTTRRPSDDGQARPALAS-------TAAVAFPECPADYQDYTPCTDPK---RWRR  110

Query  590  EMNY---YRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQ  760
              NY   + ERHCP P +   CL+PPP+GYK P+RWP+S  + ++ N+PY+ I  +K +Q
Sbjct  111  YGNYRLSFMERHCPPPPDRQQCLVPPPKGYKPPIRWPKSKDQCWYRNVPYDWINSQKSNQ  170

Query  761  GWM  769
             W+
Sbjct  171  HWL  173



>ref|XP_006364469.1| PREDICTED: probable methyltransferase PMT21-like [Solanum tuberosum]
Length=597

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C ADY D+ PC DPR   +       + ERHCP   E   CL+PPP+GYKVP+RWP+S +
Sbjct  75   CSADYQDYTPCTDPRRWKKYGLHRLTFMERHCPPNFERKECLVPPPDGYKVPIRWPKSKN  134

Query  704  KIFHDNMPYNKIADRKGHQGWM  769
            + ++ N+PY+ I  +K +Q W+
Sbjct  135  ECWYRNVPYDWINKQKSNQHWL  156



>ref|XP_004245921.1| PREDICTED: probable methyltransferase PMT21 [Solanum lycopersicum]
 ref|XP_004245922.1| PREDICTED: probable methyltransferase PMT21 [Solanum lycopersicum]
 ref|XP_010325612.1| PREDICTED: probable methyltransferase PMT21 [Solanum lycopersicum]
Length=597

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 53/82 (65%), Gaps = 0/82 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C ADY D+ PC DPR   +       + ERHCP   E   CL+PPP+GYKVP+RWP+S +
Sbjct  75   CSADYQDYTPCTDPRRWKKYGLHRLTFMERHCPPNFERKECLVPPPDGYKVPIRWPKSKN  134

Query  704  KIFHDNMPYNKIADRKGHQGWM  769
            + ++ N+PY+ I  +K +Q W+
Sbjct  135  ECWYRNVPYDWINKQKSNQHWL  156



>ref|XP_008680760.1| PREDICTED: ankyrin protein kinase-like isoform X1 [Zea mays]
 gb|ACN28641.1| unknown [Zea mays]
 tpg|DAA46557.1| TPA: ankyrin protein kinase-like protein isoform 1 [Zea mays]
 tpg|DAA46558.1| TPA: ankyrin protein kinase-like protein isoform 2 [Zea mays]
 tpg|DAA46559.1| TPA: ankyrin protein kinase-like protein isoform 3 [Zea mays]
Length=610

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 69/123 (56%), Gaps = 15/123 (12%)
 Frame = +2

Query  416  SLAASGRQALLSGDSQQRSLLVTLVESGREIAPIQF--CPADYVDHMPCEDPRINSQLSR  589
            +L A+      S D Q R  L +        A + F  CPADY D+ PC DP+   +  R
Sbjct  61   ALGAATTTRRPSDDGQARPALAS-------TAAVAFPECPADYQDYTPCTDPK---RWRR  110

Query  590  EMNY---YRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQ  760
              NY   + ERHCP P +   CL+PPP+GYK P+RWP+S  + ++ N+PY+ I  +K +Q
Sbjct  111  YGNYRLSFMERHCPPPPDRQQCLVPPPKGYKPPIRWPKSKDQCWYRNVPYDWINSQKSNQ  170

Query  761  GWM  769
             W+
Sbjct  171  HWL  173



>ref|XP_009133584.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT19 
[Brassica rapa]
Length=602

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 54/86 (63%), Gaps = 2/86 (2%)
 Frame = +2

Query  521  FCPADYVDHMPCEDPRINSQLSREMNYYRERHCP-LPHETPI-CLIPPPEGYKVPVRWPE  694
             CP ++ +++PC DP    Q S E +Y RERHCP L HE  + CL+P P GYK P  WPE
Sbjct  91   LCPKNFTNYLPCHDPSTARQYSIERHYRRERHCPDLSHEKKLRCLVPKPSGYKTPFHWPE  150

Query  695  SLHKIFHDNMPYNKIADRKGHQGWMK  772
            S +  +  N+P+ K+A+ K  Q W++
Sbjct  151  SRNYAWFKNVPFKKLAEFKKTQNWVR  176



>ref|XP_007210267.1| hypothetical protein PRUPE_ppa003130mg [Prunus persica]
 gb|EMJ11466.1| hypothetical protein PRUPE_ppa003130mg [Prunus persica]
Length=527

 Score = 84.7 bits (208),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 61/104 (59%), Gaps = 9/104 (9%)
 Frame = +2

Query  488  VESGRE--IAPIQF-------CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  640
            V S +E  +AP+Q        C +DY D+ PC DPR   +       + ERHCP   E  
Sbjct  55   VRSSKESLVAPLQIKTVSFAECSSDYQDYTPCTDPRRWKKYGVHRLTFMERHCPPVFERK  114

Query  641  ICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             CL+PPP+GYK+P+RWP S  + ++ N+PY+ I  +K +Q W++
Sbjct  115  ECLVPPPDGYKLPIRWPNSRDECWYRNVPYDWINKQKSNQNWLR  158



>ref|XP_004244424.1| PREDICTED: probable methyltransferase PMT20 [Solanum lycopersicum]
 ref|XP_004244425.1| PREDICTED: probable methyltransferase PMT20 [Solanum lycopersicum]
 ref|XP_010324489.1| PREDICTED: probable methyltransferase PMT20 [Solanum lycopersicum]
 ref|XP_010324490.1| PREDICTED: probable methyltransferase PMT20 [Solanum lycopersicum]
Length=597

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 59/100 (59%), Gaps = 7/100 (7%)
 Frame = +2

Query  494  SGREIAPIQF-------CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLI  652
            +G    P+Q        C A+Y D+ PC DP+   +  R    + ERHCP   E   CL+
Sbjct  58   TGTATVPVQIKAVSFPECSAEYQDYTPCTDPKRWHKYGRHRLAFLERHCPPSFERQECLV  117

Query  653  PPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            PPP+GYK P+RWP+S ++ ++ N+PY+ I  +K +Q W+K
Sbjct  118  PPPDGYKSPIRWPKSKNECWYRNVPYDWINKQKSNQHWLK  157



>ref|XP_004144403.1| PREDICTED: probable methyltransferase PMT21 [Cucumis sativus]
 ref|XP_011651685.1| PREDICTED: probable methyltransferase PMT21 [Cucumis sativus]
 gb|KGN58396.1| hypothetical protein Csa_3G636940 [Cucumis sativus]
Length=602

 Score = 85.1 bits (209),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = +2

Query  503  EIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKV  676
            ++ P+ F  C +DY D+ PC DPR   +       + ERHCP   E   CLIPPP+GYK 
Sbjct  70   QLKPVTFQECSSDYQDYTPCTDPRKWKKYGLHRLTFMERHCPPVFERKECLIPPPDGYKP  129

Query  677  PVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+RWP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  130  PIRWPKSKDECWYRNVPYDWINKQKSNQNWLR  161



>ref|XP_007210268.1| hypothetical protein PRUPE_ppa003130mg [Prunus persica]
 gb|EMJ11467.1| hypothetical protein PRUPE_ppa003130mg [Prunus persica]
Length=600

 Score = 85.1 bits (209),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/104 (39%), Positives = 61/104 (59%), Gaps = 9/104 (9%)
 Frame = +2

Query  488  VESGRE--IAPIQF-------CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETP  640
            V S +E  +AP+Q        C +DY D+ PC DPR   +       + ERHCP   E  
Sbjct  55   VRSSKESLVAPLQIKTVSFAECSSDYQDYTPCTDPRRWKKYGVHRLTFMERHCPPVFERK  114

Query  641  ICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             CL+PPP+GYK+P+RWP S  + ++ N+PY+ I  +K +Q W++
Sbjct  115  ECLVPPPDGYKLPIRWPNSRDECWYRNVPYDWINKQKSNQNWLR  158



>ref|XP_008460424.1| PREDICTED: probable methyltransferase PMT21 [Cucumis melo]
 ref|XP_008460425.1| PREDICTED: probable methyltransferase PMT21 [Cucumis melo]
 ref|XP_008460426.1| PREDICTED: probable methyltransferase PMT21 [Cucumis melo]
 ref|XP_008460427.1| PREDICTED: probable methyltransferase PMT21 [Cucumis melo]
Length=602

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = +2

Query  503  EIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKV  676
            ++ P+ F  C +DY D+ PC DPR   +       + ERHCP   E   CLIPPP+GYK 
Sbjct  70   QLKPVTFQECSSDYQDYTPCTDPRKWKKYGLHRLTFMERHCPPVFERKECLIPPPDGYKP  129

Query  677  PVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+RWP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  130  PIRWPKSKDECWYRNVPYDWINKQKSNQNWLR  161



>ref|XP_006361241.1| PREDICTED: probable methyltransferase PMT20-like isoform X1 [Solanum 
tuberosum]
Length=597

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
 Frame = +2

Query  503  EIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKV  676
            +I  + F  C A+Y D+ PC DP+   +  R    + ERHCP   E   CL+PPP+GYK 
Sbjct  66   QIKAVSFPECSAEYQDYTPCTDPKRWHKYGRHRLAFLERHCPPSFERQECLVPPPDGYKS  125

Query  677  PVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+RWP+S ++ ++ N+PY+ I  +K +Q W+K
Sbjct  126  PIRWPKSKNECWYRNVPYDWINKQKSNQHWLK  157



>gb|EAZ29807.1| hypothetical protein OsJ_13866 [Oryza sativa Japonica Group]
Length=565

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 56/84 (67%), Gaps = 6/84 (7%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRI-NSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESL  700
            CPADY D+ PC DP+  N +LS     + ERHCP   E   CL+PPP+GYK P+RWP+S 
Sbjct  83   CPADYQDYTPCTDPKYGNYRLS-----FMERHCPPAVERKECLVPPPQGYKAPIRWPKSK  137

Query  701  HKIFHDNMPYNKIADRKGHQGWMK  772
             + ++ N+PY+ I  +K +Q W++
Sbjct  138  DQCWYRNVPYDWINSQKSNQHWLR  161



>ref|XP_011026358.1| PREDICTED: probable methyltransferase PMT19 [Populus euphratica]
Length=600

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 54/91 (59%), Gaps = 0/91 (0%)
 Frame = +2

Query  500  REIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVP  679
            R +    FCP ++ ++ PC DP   +  + E  + RERHCP P+E P CL+P P GYK P
Sbjct  76   RNLQFFNFCPPNFTNYCPCHDPSRETDFTAERFFSRERHCPEPYEKPPCLVPRPAGYKRP  135

Query  680  VRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
              WP+S    +  N+P+ ++++ K  Q W++
Sbjct  136  FSWPKSRDYAWFKNLPFKELSEVKKTQNWVR  166



>gb|EYU37520.1| hypothetical protein MIMGU_mgv1a003222mg [Erythranthe guttata]
 gb|EYU37522.1| hypothetical protein MIMGU_mgv1a003222mg [Erythranthe guttata]
 gb|EYU37523.1| hypothetical protein MIMGU_mgv1a003222mg [Erythranthe guttata]
 gb|EYU37524.1| hypothetical protein MIMGU_mgv1a003222mg [Erythranthe guttata]
Length=598

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
 Frame = +2

Query  503  EIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKV  676
            +I  + F  C AD  D+ PC DP+   + S     + ERHCP   E   CL+PPP+GYKV
Sbjct  66   QIKAVNFPECSADLQDYTPCTDPKRWKKYSLHRLSFMERHCPPVFEKKECLVPPPDGYKV  125

Query  677  PVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P++WP+S ++ ++ N+PY+ I  +K +Q W+K
Sbjct  126  PIKWPQSKNECWYRNVPYDWINKQKSNQHWLK  157



>ref|XP_010676941.1| PREDICTED: probable methyltransferase PMT17 [Beta vulgaris subsp. 
vulgaris]
Length=658

 Score = 84.7 bits (208),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 56/92 (61%), Gaps = 2/92 (2%)
 Frame = +2

Query  503  EIAPIQFCPAD--YVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKV  676
            EIA  +F P D  Y ++ PC+DPR   +  R M  YRERHCP   E   CLIPPP  YK 
Sbjct  120  EIAVKEFPPCDMSYSEYTPCQDPRRGRKFDRNMLKYRERHCPSKEEMMQCLIPPPPKYKT  179

Query  677  PVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P +WP+S    ++DN+P+ +++  K  Q W++
Sbjct  180  PFKWPQSRDYAWYDNIPHKELSIEKAIQNWIQ  211



>gb|EYU37521.1| hypothetical protein MIMGU_mgv1a003222mg [Erythranthe guttata]
Length=590

 Score = 84.7 bits (208),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 58/92 (63%), Gaps = 2/92 (2%)
 Frame = +2

Query  503  EIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKV  676
            +I  + F  C AD  D+ PC DP+   + S     + ERHCP   E   CL+PPP+GYKV
Sbjct  66   QIKAVNFPECSADLQDYTPCTDPKRWKKYSLHRLSFMERHCPPVFEKKECLVPPPDGYKV  125

Query  677  PVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P++WP+S ++ ++ N+PY+ I  +K +Q W+K
Sbjct  126  PIKWPQSKNECWYRNVPYDWINKQKSNQHWLK  157



>gb|KHG30506.1| putative methyltransferase PMT21 -like protein [Gossypium arboreum]
Length=604

 Score = 84.3 bits (207),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/97 (40%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = +2

Query  488  VESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  661
             E+  +I  + F  C  DY D+ PC DPR   +       + ERHCP  +E   CL+PPP
Sbjct  65   AENALQIKSVTFSECSIDYQDYTPCTDPRRWKKYGYRRLTFLERHCPPLYERKECLVPPP  124

Query  662  EGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             GYK P+RWP+S  + ++ N+PY+ I  +K +Q W+K
Sbjct  125  VGYKPPIRWPKSRKECWYRNVPYDWINKQKSNQNWLK  161



>gb|KHG22120.1| hypothetical protein F383_28461 [Gossypium arboreum]
Length=834

 Score = 84.7 bits (208),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 56/79 (71%), Gaps = 4/79 (5%)
 Frame = +2

Query  542  DHMPCEDP-RINSQLSREMNY-YRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFH  715
            D++PC D  ++  +L   M+Y +RERHCP   E P CL+P PEGYK  V+WP+S  KI++
Sbjct  314  DYIPCLDNWQVIRKLPSTMHYEHRERHCP--DEAPTCLVPLPEGYKCSVKWPKSRDKIWY  371

Query  716  DNMPYNKIADRKGHQGWMK  772
             N+P+ K+A+ KGHQ W+K
Sbjct  372  YNVPHTKLAEVKGHQNWVK  390



>gb|KJB51529.1| hypothetical protein B456_008G220500 [Gossypium raimondii]
 gb|KJB51530.1| hypothetical protein B456_008G220500 [Gossypium raimondii]
 gb|KJB51531.1| hypothetical protein B456_008G220500 [Gossypium raimondii]
Length=603

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +2

Query  515  IQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPE  694
             Q C AD+ D+ PC DPR   +       + ERHCP   E   CL+PPP+GYK P+RWP+
Sbjct  76   FQECSADFQDYTPCTDPRRWRKYGSHRLTFLERHCPPMLERKQCLVPPPDGYKPPIRWPK  135

Query  695  SLHKIFHDNMPYNKIADRKGHQGWMK  772
            S  + ++ N+PYN I  +K +Q W++
Sbjct  136  SRDECWYRNVPYNWINKQKSNQNWLR  161



>ref|XP_010056181.1| PREDICTED: probable methyltransferase PMT20 [Eucalyptus grandis]
 gb|KCW72790.1| hypothetical protein EUGRSUZ_E01240 [Eucalyptus grandis]
Length=608

 Score = 84.0 bits (206),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 57/96 (59%), Gaps = 7/96 (7%)
 Frame = +2

Query  506  IAPIQF-------CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPE  664
            +AP+Q        C +DY D+ PC DP+   +       + ERHCP   E   CL+PPPE
Sbjct  67   VAPLQMKFVTFPECSSDYQDYTPCTDPKRWRKYGMHRLTFMERHCPAVFERKECLVPPPE  126

Query  665  GYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            GYK P+RWP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  127  GYKPPIRWPKSRDECWYRNVPYDWINKQKSNQNWLR  162



>ref|XP_011004387.1| PREDICTED: probable methyltransferase PMT18 [Populus euphratica]
 ref|XP_011004388.1| PREDICTED: probable methyltransferase PMT18 [Populus euphratica]
Length=625

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (54%), Gaps = 4/121 (3%)
 Frame = +2

Query  410  GDSLAASGRQALLSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSR  589
            G S   S   A+L  +S  + +     +S  EI P   C   Y ++ PC+DPR   +  R
Sbjct  62   GLSSNPSSESAVLDFNSHHQ-IQFNNTDSVNEIPP---CDMSYSEYTPCQDPRRGRKFDR  117

Query  590  EMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWM  769
             M  YRERHCP   E  +CLIP P  YK P +WP+S    ++DN+P+ +++  K  Q W+
Sbjct  118  NMLKYRERHCPTKDELLLCLIPAPPKYKTPFKWPQSRDYAWYDNIPHKELSIEKAVQNWI  177

Query  770  K  772
            +
Sbjct  178  Q  178



>ref|XP_006858634.1| PREDICTED: probable methyltransferase PMT19 [Amborella trichopoda]
 gb|ERN20101.1| hypothetical protein AMTR_s00066p00040550 [Amborella trichopoda]
Length=633

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +2

Query  515  IQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPE  694
             QFC + Y D+ PC D R   +   +M ++RERHCP   E   CLIP P  Y+ P RWP+
Sbjct  99   FQFCDSKYRDYCPCHDTRREKKFDTDMLFFRERHCPERSEKLRCLIPVPSKYRTPFRWPK  158

Query  695  SLHKIFHDNMPYNKIADRKGHQGWMK  772
            S   ++  N+PY ++ + K  Q W++
Sbjct  159  SRDMVWFLNVPYKRLTETKADQNWVR  184



>ref|XP_010677437.1| PREDICTED: probable methyltransferase PMT21 [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010677438.1| PREDICTED: probable methyltransferase PMT21 [Beta vulgaris subsp. 
vulgaris]
Length=605

 Score = 84.0 bits (206),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 71/131 (54%), Gaps = 14/131 (11%)
 Frame = +2

Query  401  TPLGDSLAASGRQALLSGDSQQRSLLVTLVESGREIAPIQF-------CPADYVDHMPCE  559
             PL D++      ++ +   Q++       ++   +AP+Q        C  +Y D+ PC 
Sbjct  40   NPLKDNIDTKDITSVFTKTEQKQ-------QTTSAVAPLQIKSVSFSECGIEYQDYTPCT  92

Query  560  DPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKI  739
            DP    +   +   + ERHCP   E   CL+PPPEGYK+P+RWP+S ++ ++ N+P++ I
Sbjct  93   DPMRWKKYGYKRLAFLERHCPPIFERKQCLVPPPEGYKLPIRWPKSKNECWYRNVPFDWI  152

Query  740  ADRKGHQGWMK  772
              +K +Q W+K
Sbjct  153  NKQKSNQNWLK  163



>gb|EPS73062.1| hypothetical protein M569_01690 [Genlisea aurea]
Length=592

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = +2

Query  503  EIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKV  676
            +I P+ F  C  DY D+ PC DP    + S     + ERHCP   E   CL+PPP+GY++
Sbjct  60   QIKPVAFPECGPDYQDYTPCTDPTRWKKYSYRRLSFMERHCPPAFERKECLVPPPDGYRI  119

Query  677  PVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P++WP+S  + ++ N+PY+ I  +K +Q W+K
Sbjct  120  PIKWPKSKDECWYRNVPYDWINKQKSNQHWLK  151



>ref|XP_009619970.1| PREDICTED: probable methyltransferase PMT20 [Nicotiana tomentosiformis]
 ref|XP_009619971.1| PREDICTED: probable methyltransferase PMT20 [Nicotiana tomentosiformis]
Length=597

 Score = 83.6 bits (205),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = +2

Query  503  EIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKV  676
            +I  I F  C AD+ D+ PC DP+   +  +    + ERHCP   E   CL+PPP+GYK 
Sbjct  66   QIKAISFPECGADFQDYTPCTDPKRWHKYGKHRLSFLERHCPPSFERQECLVPPPDGYKS  125

Query  677  PVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+RWP+S  + ++ N+PY+ I  +K +Q W+K
Sbjct  126  PIRWPKSRDECWYRNVPYDWINKQKSNQHWLK  157



>ref|XP_009794519.1| PREDICTED: probable methyltransferase PMT20 [Nicotiana sylvestris]
 ref|XP_009794520.1| PREDICTED: probable methyltransferase PMT20 [Nicotiana sylvestris]
Length=597

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 57/92 (62%), Gaps = 2/92 (2%)
 Frame = +2

Query  503  EIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKV  676
            ++  I F  C AD+ D+ PC DP+   +  +    + ERHCP   E   CL+PPP+GYK 
Sbjct  66   QVKAISFPECSADFQDYTPCTDPKRWHKYGKHRLTFLERHCPPSFERQECLVPPPDGYKS  125

Query  677  PVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+RWP+S  + ++ N+PY+ I  +K +Q W+K
Sbjct  126  PIRWPKSRDECWYRNVPYDWINKQKSNQHWLK  157



>ref|XP_002530544.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF31835.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=603

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +2

Query  515  IQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPE  694
              FCP ++ D+ PC DP      + E  + RERHCP P+E   CLIP P GYK P  WP+
Sbjct  85   FSFCPPNFTDYCPCHDPSREMHFTTERFFNRERHCPEPNEKSKCLIPKPIGYKKPFSWPK  144

Query  695  SLHKIFHDNMPYNKIADRKGHQGWMK  772
            S    + +N+P+ K+ + K  Q W++
Sbjct  145  SRDYAWFNNVPFKKLTELKKSQNWVR  170



>ref|NP_567575.1| putative methyltransferase PMT21 [Arabidopsis thaliana]
 ref|NP_849408.1| putative methyltransferase PMT21 [Arabidopsis thaliana]
 sp|Q94II3.1|PMTL_ARATH RecName: Full=Probable methyltransferase PMT21; AltName: Full=Protein 
EARLY-RESPONSIVE TO DEHYDRATION 3 [Arabidopsis thaliana]
 dbj|BAB63914.1| ERD3 protein [Arabidopsis thaliana]
 dbj|BAH20212.1| AT4G19120 [Arabidopsis thaliana]
 dbj|BAH20330.1| AT4G19120 [Arabidopsis thaliana]
 gb|AEE84145.1| putative methyltransferase PMT21 [Arabidopsis thaliana]
 gb|AEE84146.1| putative methyltransferase PMT21 [Arabidopsis thaliana]
Length=600

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +2

Query  488  VESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  661
            V+   ++  + F  C +DY D+ PC DPR   +       + ERHCP   +   CL+PPP
Sbjct  59   VDDSLQVKSVSFSECSSDYQDYTPCTDPRKWKKYGTHRLTFMERHCPPVFDRKQCLVPPP  118

Query  662  EGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +GYK P+RWP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  119  DGYKPPIRWPKSKDECWYRNVPYDWINKQKSNQNWLR  155



>gb|KJB59346.1| hypothetical protein B456_009G250600 [Gossypium raimondii]
 gb|KJB59347.1| hypothetical protein B456_009G250600 [Gossypium raimondii]
Length=833

 Score = 84.0 bits (206),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 56/79 (71%), Gaps = 4/79 (5%)
 Frame = +2

Query  542  DHMPCEDP-RINSQLSREMNY-YRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFH  715
            D++PC D  ++  +L   M+Y +RERHCP   E P CL+P PEGYK  V+WP+S  KI++
Sbjct  314  DYIPCLDNWQVIRKLPSTMHYEHRERHCP--DEAPTCLVPLPEGYKRSVKWPKSRDKIWY  371

Query  716  DNMPYNKIADRKGHQGWMK  772
             N+P+ K+A+ KGHQ W+K
Sbjct  372  YNVPHTKLAEVKGHQNWVK  390



>emb|CDY09274.1| BnaC03g63040D [Brassica napus]
Length=591

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C +DY D+ PC DPR   +       + ERHCP   +   CL+PPP GYK P+RWP+S +
Sbjct  68   CSSDYQDYTPCTDPRKWKKYGTHRLTFMERHCPPVFDRKQCLVPPPNGYKSPIRWPKSKN  127

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            + ++ N+PY+ I ++K +Q W+K
Sbjct  128  ECWYRNVPYDWINNQKSNQHWLK  150



>ref|XP_009132524.1| PREDICTED: probable methyltransferase PMT21 [Brassica rapa]
Length=600

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +2

Query  488  VESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  661
            V++  ++  + F  C +DY D+ PC DPR   +       + ERHCP   +   CL+PPP
Sbjct  59   VDNSLQVKSVSFSECSSDYQDYTPCTDPRKWKKYGTHRLTFMERHCPPVFDRKQCLVPPP  118

Query  662  EGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             GYK P+RWP+S  + ++ N+PY+ I  +K +Q W+K
Sbjct  119  NGYKPPIRWPKSKEECWYRNVPYDWINKQKSNQHWLK  155



>gb|KHF97731.1| putative methyltransferase PMT21 -like protein [Gossypium arboreum]
Length=603

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C AD+ D+ PC DPR   +       + ERHCP   E   CL+PPP+GYK P+RWP+S  
Sbjct  79   CSADFQDYTPCTDPRRWRKYGSHRLTFLERHCPPMSERKQCLVPPPDGYKPPIRWPKSRD  138

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            + ++ N+PYN I  +K +Q W++
Sbjct  139  ECWYRNVPYNWINKQKSNQNWLR  161



>ref|XP_009373681.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
 ref|XP_009373682.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
 ref|XP_009373683.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
Length=630

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +2

Query  488  VESGREIAPIQFCPAD--YVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  661
            V+  +  A  +F P D  Y ++ PC+DPR   +  R+M  YRERHCP   E  +CLIP P
Sbjct  89   VDVNKTEAVQRFSPCDMSYSEYTPCQDPRRGRKFDRKMLKYRERHCPTKEEQLLCLIPAP  148

Query  662  EGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
              YK P +WP+S    ++DN+P+ +++  K  Q W++
Sbjct  149  PKYKTPFKWPQSRDFAWYDNIPHRELSIEKAVQNWIQ  185



>ref|XP_009414612.1| PREDICTED: probable methyltransferase PMT24 [Musa acuminata subsp. 
malaccensis]
Length=817

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 37/82 (45%), Positives = 57/82 (70%), Gaps = 10/82 (12%)
 Frame = +2

Query  542  DHMPCEDPRINSQLSREMNY-----YRERHCPLPHETPICLIPPPEGYKVPVRWPESLHK  706
            D++PC D   N    +++++     +RERHCP   E P CL+P P+GY++PVRWP S  K
Sbjct  299  DYIPCLD---NVAAIKKLHFTGHYEHRERHCP--EEPPTCLVPLPDGYRLPVRWPNSREK  353

Query  707  IFHDNMPYNKIADRKGHQGWMK  772
            I+++N+P+ K+A+ KGHQ W+K
Sbjct  354  IWYNNVPHTKLAEVKGHQNWVK  375



>ref|XP_006368294.1| hypothetical protein POPTR_0001s01380g [Populus trichocarpa]
 gb|ERP64863.1| hypothetical protein POPTR_0001s01380g [Populus trichocarpa]
Length=501

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 65/115 (57%), Gaps = 9/115 (8%)
 Frame = +2

Query  455  DSQQRSLLVTLVESGRE--IAPIQF-------CPADYVDHMPCEDPRINSQLSREMNYYR  607
            D  +   +  +V S +E  IAP+Q        C +DY D+ PC DP+   +       + 
Sbjct  44   DKIEAKDVAKVVSSPKESSIAPLQIKSTAFPECSSDYQDYTPCTDPKRWKKYGNHRLTFM  103

Query  608  ERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            ERHCP   E   CLIPPP+GYK P++WP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  104  ERHCPPVFERKECLIPPPDGYKPPIKWPKSRDQCWYRNVPYDWINKQKSNQNWLR  158



>ref|XP_009350354.1| PREDICTED: probable methyltransferase PMT18 [Pyrus x bretschneideri]
Length=628

 Score = 83.6 bits (205),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +2

Query  488  VESGREIAPIQFCPAD--YVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  661
            V+  +  A  +F P D  Y ++ PC+DPR   +  R+M  YRERHCP   E  +CLIP P
Sbjct  89   VDVNKTEAVQRFSPCDMSYSEYTPCQDPRRGRKFDRKMLKYRERHCPTKEEQLLCLIPAP  148

Query  662  EGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
              YK P +WP+S    ++DN+P+ +++  K  Q W++
Sbjct  149  PKYKTPFKWPQSRDFAWYDNIPHRELSIEKAVQNWIQ  185



>ref|XP_010535872.1| PREDICTED: probable methyltransferase PMT21 [Tarenaya hassleriana]
 ref|XP_010535879.1| PREDICTED: probable methyltransferase PMT21 [Tarenaya hassleriana]
 ref|XP_010535887.1| PREDICTED: probable methyltransferase PMT21 [Tarenaya hassleriana]
Length=598

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 64/118 (54%), Gaps = 10/118 (8%)
 Frame = +2

Query  419  LAASGRQALLSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMN  598
            +A +G  A   G++   SL V  V           C +DY D+ PC DPR   +      
Sbjct  49   VAKAGSSA---GETNAGSLQVKAVSFSE-------CSSDYQDYTPCTDPRKWKKYGTHRL  98

Query  599  YYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             + ERHCP   E   CL+PPP+GYK P+RWP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  99   TFMERHCPPVFERKECLVPPPDGYKPPIRWPKSKGECWYRNVPYDWINTQKSNQNWLR  156



>emb|CDY61681.1| BnaC01g40980D [Brassica napus]
Length=682

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 59/97 (61%), Gaps = 2/97 (2%)
 Frame = +2

Query  488  VESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  661
            V++  ++  + F  C +DY D+ PC DPR   +       + ERHCP   +   CL+PPP
Sbjct  59   VDNSPQVKSVSFSECSSDYQDYTPCTDPRKWKKYGTHRLTFMERHCPPVFDRKQCLVPPP  118

Query  662  EGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             GYK P+RWP+S ++ ++ N+PY+ I  +K +Q W+K
Sbjct  119  NGYKPPIRWPKSKNECWYRNVPYDWINKQKSNQHWLK  155



>ref|NP_192782.1| putative methyltransferase PMT17 [Arabidopsis thaliana]
 sp|Q9SZX8.1|PMTH_ARATH RecName: Full=Probable methyltransferase PMT17 [Arabidopsis thaliana]
 emb|CAB40037.1| putative protein [Arabidopsis thaliana]
 emb|CAB78167.1| putative protein [Arabidopsis thaliana]
 gb|AEE82883.1| putative methyltransferase PMT17 [Arabidopsis thaliana]
Length=633

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 57/98 (58%), Gaps = 0/98 (0%)
 Frame = +2

Query  479  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  658
            + L E+ + I   + C     ++ PCED +   +  R M  YRERHCP+  E   CLIPP
Sbjct  81   IELKETNQTIKYFEPCELSLSEYTPCEDRQRGRRFDRNMMKYRERHCPVKDELLYCLIPP  140

Query  659  PEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P  YK+P +WP+S    ++DN+P+ +++  K  Q W++
Sbjct  141  PPNYKIPFKWPQSRDYAWYDNIPHKELSVEKAVQNWIQ  178



>emb|CDY12278.1| BnaA09g24780D [Brassica napus]
Length=600

 Score = 83.2 bits (204),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = +2

Query  494  SGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEG  667
            S  +I  + F  C +D  D+ PC DP+   +       + ERHCP  HE   CLIPPP+G
Sbjct  64   SALQIKSVSFPECGSDLQDYTPCTDPKRWKRYGVHRLSFLERHCPPVHEKSECLIPPPDG  123

Query  668  YKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            YK P+RWP+S  + ++ N+PY+ I  +K +Q W+K
Sbjct  124  YKPPIRWPKSRDQCWYKNVPYDWINKQKSNQHWLK  158



>ref|XP_006368293.1| dehydration-responsive family protein [Populus trichocarpa]
 gb|ERP64862.1| dehydration-responsive family protein [Populus trichocarpa]
Length=599

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 65/115 (57%), Gaps = 9/115 (8%)
 Frame = +2

Query  455  DSQQRSLLVTLVESGRE--IAPIQF-------CPADYVDHMPCEDPRINSQLSREMNYYR  607
            D  +   +  +V S +E  IAP+Q        C +DY D+ PC DP+   +       + 
Sbjct  44   DKIEAKDVAKVVSSPKESSIAPLQIKSTAFPECSSDYQDYTPCTDPKRWKKYGNHRLTFM  103

Query  608  ERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            ERHCP   E   CLIPPP+GYK P++WP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  104  ERHCPPVFERKECLIPPPDGYKPPIKWPKSRDQCWYRNVPYDWINKQKSNQNWLR  158



>gb|ABK94960.1| unknown [Populus trichocarpa]
Length=599

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 65/115 (57%), Gaps = 9/115 (8%)
 Frame = +2

Query  455  DSQQRSLLVTLVESGRE--IAPIQF-------CPADYVDHMPCEDPRINSQLSREMNYYR  607
            D  +   +  +V S +E  IAP+Q        C +DY D+ PC DP+   +       + 
Sbjct  44   DKIEAKDVAKVVSSPKESSIAPLQIKSTAFPECSSDYQDYTPCTDPKRWKKYGNHRLTFM  103

Query  608  ERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            ERHCP   E   CLIPPP+GYK P++WP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  104  ERHCPPVFERKECLIPPPDGYKPPIKWPKSRDQCWYRNVPYDWINKQKSNQNWLR  158



>ref|XP_011018410.1| PREDICTED: probable methyltransferase PMT20 [Populus euphratica]
 ref|XP_011018411.1| PREDICTED: probable methyltransferase PMT20 [Populus euphratica]
 ref|XP_011018412.1| PREDICTED: probable methyltransferase PMT20 [Populus euphratica]
Length=600

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/115 (37%), Positives = 65/115 (57%), Gaps = 9/115 (8%)
 Frame = +2

Query  455  DSQQRSLLVTLVESGRE--IAPIQF-------CPADYVDHMPCEDPRINSQLSREMNYYR  607
            D  +   +  +V S +E  IAP+Q        C +DY D+ PC DP+   +       + 
Sbjct  44   DKIEAKDVAKVVSSPKESSIAPLQIKSTAFPECSSDYQDYTPCTDPKRWKKYGNHRLTFM  103

Query  608  ERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            ERHCP   E   CLIPPP+GYK P++WP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  104  ERHCPPVFERKECLIPPPDGYKPPIKWPKSRDQCWYRNVPYDWINKQKSNQNWLR  158



>ref|XP_009114945.1| PREDICTED: probable methyltransferase PMT20 [Brassica rapa]
 ref|XP_009114946.1| PREDICTED: probable methyltransferase PMT20 [Brassica rapa]
 ref|XP_009114948.1| PREDICTED: probable methyltransferase PMT20 [Brassica rapa]
 ref|XP_009114949.1| PREDICTED: probable methyltransferase PMT20 [Brassica rapa]
Length=600

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 57/95 (60%), Gaps = 2/95 (2%)
 Frame = +2

Query  494  SGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEG  667
            S  +I  + F  C +D  D+ PC DP+   +       + ERHCP  HE   CLIPPP+G
Sbjct  64   SALQIKSVSFPECGSDLQDYTPCTDPKRWKRYGVHRLSFLERHCPPVHEKSECLIPPPDG  123

Query  668  YKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            YK P+RWP+S  + ++ N+PY+ I  +K +Q W+K
Sbjct  124  YKPPIRWPKSRDQCWYKNVPYDWINKQKSNQHWLK  158



>ref|XP_011028039.1| PREDICTED: probable methyltransferase PMT20 [Populus euphratica]
 ref|XP_011028040.1| PREDICTED: probable methyltransferase PMT20 [Populus euphratica]
 ref|XP_011028041.1| PREDICTED: probable methyltransferase PMT20 [Populus euphratica]
Length=600

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 62/108 (57%), Gaps = 9/108 (8%)
 Frame = +2

Query  476  LVTLVESGRE--IAPIQF-------CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLP  628
            +  +V S +E  +AP+Q        C +DY D+ PC DPR   +       + ERHCP  
Sbjct  51   VAKVVSSPKESSVAPLQIKSTAFPECSSDYQDYTPCTDPRRWKKYGNHRLTFMERHCPPV  110

Query  629  HETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             E   CL+PPPEGYK P+ WP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  111  FERKECLVPPPEGYKPPITWPKSRDQCWYRNVPYDWINKQKSNQNWLR  158



>ref|XP_007040817.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007040818.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 ref|XP_007040819.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY25318.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY25319.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY25320.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=603

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/92 (41%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = +2

Query  503  EIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKV  676
            +I PI F  C  DY D+ PC DPR   +       + ERHCP   E   CL+PPP+GYK 
Sbjct  70   QIKPITFQECSIDYQDYTPCTDPRRWKKYGVHRLTFLERHCPPAFERKECLVPPPDGYKP  129

Query  677  PVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+ WP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  130  PITWPKSRDECWYRNVPYDWINKQKSNQNWLR  161



>ref|XP_002867953.1| early-responsive to dehydration 3 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44212.1| early-responsive to dehydration 3 [Arabidopsis lyrata subsp. 
lyrata]
Length=600

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = +2

Query  488  VESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  661
            V+   ++  + F  C +DY D+ PC DPR   +       + ERHCP   +   CL+PPP
Sbjct  59   VDDSLQVKSVSFSECSSDYQDYTPCTDPRKWKKYGTHRLTFMERHCPPVFDRKQCLVPPP  118

Query  662  EGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             GYK P+RWP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  119  NGYKPPIRWPKSKDECWYRNVPYDWINKQKSNQNWLR  155



>emb|CDX78919.1| BnaA01g09860D [Brassica napus]
Length=707

 Score = 83.2 bits (204),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 58/97 (60%), Gaps = 2/97 (2%)
 Frame = +2

Query  488  VESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  661
            V++  ++  + F  C +DY D+ PC DPR   +       + ERHCP   +   CL+PPP
Sbjct  59   VDNSLQVKSVSFSECSSDYQDYTPCTDPRKWKKYGTHRLTFMERHCPPVFDRKQCLVPPP  118

Query  662  EGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             GYK P+RWP+S  + ++ N+PY+ I  +K +Q W+K
Sbjct  119  NGYKPPIRWPKSKDECWYRNVPYDWINKQKSNQHWLK  155



>ref|XP_002304375.2| dehydration-responsive family protein [Populus trichocarpa]
 gb|EEE79354.2| dehydration-responsive family protein [Populus trichocarpa]
Length=591

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 62/108 (57%), Gaps = 9/108 (8%)
 Frame = +2

Query  476  LVTLVESGRE--IAPIQF-------CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLP  628
            +  +V S +E  +AP+Q        C +DY D+ PC DPR   +       + ERHCP  
Sbjct  51   VAKVVSSPKESSVAPLQIKSTAFPECSSDYQDYTPCTDPRRWKKYGNHRLTFMERHCPPV  110

Query  629  HETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             E   CL+PPPEGYK P+ WP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  111  FERKECLVPPPEGYKPPITWPKSRDQCWYRNVPYDWINKQKSNQNWLR  158



>ref|XP_010478606.1| PREDICTED: probable methyltransferase PMT20 [Camelina sativa]
 ref|XP_010478607.1| PREDICTED: probable methyltransferase PMT20 [Camelina sativa]
Length=604

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/111 (36%), Positives = 65/111 (59%), Gaps = 9/111 (8%)
 Frame = +2

Query  467  RSLLVTLVESGRE--IAPIQF-------CPADYVDHMPCEDPRINSQLSREMNYYRERHC  619
            R++    V S +E  ++PIQ        C +++ D+ PC DP+   +       + ERHC
Sbjct  52   RTITTKAVASPKEPTVSPIQIKSVSFPECGSEFQDYTPCTDPKRWKKYGTHRLSFLERHC  111

Query  620  PLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P  +E   CLIPPP+GYK P+RWP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  112  PAVYEKSECLIPPPDGYKPPIRWPKSREQCWYRNVPYDWINKQKSNQHWLQ  162



>gb|AES77233.2| S-adenosylmethionine-dependent methyltransferase, putative [Medicago 
truncatula]
Length=572

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = +2

Query  503  EIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPV  682
            +I+  QFC  +Y ++ PCEDP+   +  ++  + +ERHCP  +E   CLIP P GYK P 
Sbjct  39   KISHFQFCSTNYTNYCPCEDPKRQKKFPKKNYFRKERHCPQNNERLTCLIPKPIGYKNPF  98

Query  683  RWPESLHKIFHDNMPYNKIADRKGHQGWM  769
             WP+S    +  N+P+ K+ + K  Q W+
Sbjct  99   PWPKSKDNAWFSNVPFTKLVEYKKSQNWI  127



>emb|CDX76494.1| BnaA08g09060D [Brassica napus]
Length=586

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C +DY D+ PC DPR   +       + ERHCP   +   CL+PPP GYK P+RWP+S +
Sbjct  73   CSSDYQDYTPCTDPRKWKKYGTHRLTFMERHCPPVFDRKQCLVPPPNGYKSPIRWPKSKN  132

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            + ++ N+PY+ I  +K +Q W+K
Sbjct  133  ECWYRNVPYDWINKQKSNQHWLK  155



>ref|XP_009611450.1| PREDICTED: probable methyltransferase PMT21 [Nicotiana tomentosiformis]
 ref|XP_009611451.1| PREDICTED: probable methyltransferase PMT21 [Nicotiana tomentosiformis]
 ref|XP_009611452.1| PREDICTED: probable methyltransferase PMT21 [Nicotiana tomentosiformis]
Length=597

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 52/82 (63%), Gaps = 0/82 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C ADY D+ PC DPR   +       + ERHCP   E   CL+ PP+GYKVP+RWP+S +
Sbjct  74   CSADYQDYTPCTDPRRWKKYGLHRLTFMERHCPPNFERKECLVAPPDGYKVPIRWPKSKN  133

Query  704  KIFHDNMPYNKIADRKGHQGWM  769
            + ++ N+PY+ I  +K +Q W+
Sbjct  134  ECWYRNVPYDWINKQKSNQHWL  155



>emb|CDX99828.1| BnaC05g22500D [Brassica napus]
Length=750

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 76/127 (60%), Gaps = 7/127 (6%)
 Frame = +2

Query  404  PLGDSLAASGRQALLSGDSQQRSLLVTLVESGREIAPIQFCPADYV---DHMPCEDP-RI  571
            P GD    +   +  SG +    L+ +  E   +++ I++   +     D++PC D  + 
Sbjct  178  PAGDQAEITKESSTGSG-AWSTQLVESQNEKKAQVSSIKWKVCNVTAGPDYIPCLDNWQA  236

Query  572  NSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRK  751
              +L+R+   +RERHCP   E+P CL+P PEGYK  ++WP+S  KI+++N+P+ K+A+ K
Sbjct  237  IRKLARKHYEHRERHCP--EESPSCLVPLPEGYKRSIKWPKSREKIWYNNVPHMKLAEVK  294

Query  752  GHQGWMK  772
            GHQ W+K
Sbjct  295  GHQNWVK  301



>ref|XP_006662791.1| PREDICTED: probable methyltransferase PMT26-like [Oryza brachyantha]
Length=871

 Score = 82.8 bits (203),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 53/79 (67%), Gaps = 4/79 (5%)
 Frame = +2

Query  542  DHMPCEDPRIN-SQLSREMNY-YRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFH  715
            D++PC D      +L  + +Y +RERHCP   E P CL+P PEGY+ P+RWP S  KI++
Sbjct  355  DYIPCLDNEAAIKKLKTDAHYEHRERHCP--GEPPTCLVPAPEGYREPIRWPRSRDKIWY  412

Query  716  DNMPYNKIADRKGHQGWMK  772
             N+P+ K+A  KGHQ W+K
Sbjct  413  HNVPHTKLAAYKGHQNWVK  431



>ref|XP_003621015.1| hypothetical protein MTR_7g006060 [Medicago truncatula]
Length=591

 Score = 82.4 bits (202),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = +2

Query  503  EIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPV  682
            +I+  QFC  +Y ++ PCEDP+   +  ++  + +ERHCP  +E   CLIP P GYK P 
Sbjct  39   KISHFQFCSTNYTNYCPCEDPKRQKKFPKKNYFRKERHCPQNNERLTCLIPKPIGYKNPF  98

Query  683  RWPESLHKIFHDNMPYNKIADRKGHQGWM  769
             WP+S    +  N+P+ K+ + K  Q W+
Sbjct  99   PWPKSKDNAWFSNVPFTKLVEYKKSQNWI  127



>ref|XP_009384739.1| PREDICTED: probable methyltransferase PMT21 [Musa acuminata subsp. 
malaccensis]
Length=597

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 57/91 (63%), Gaps = 2/91 (2%)
 Frame = +2

Query  506  IAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVP  679
            I  ++F  C +DY D+ PC DP+   +       + ERHCP   E   CL+PPP GYKVP
Sbjct  67   IESVEFPECSSDYQDYTPCTDPKRWKKYGNYRLSFMERHCPPMVERKECLVPPPAGYKVP  126

Query  680  VRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            +RWP+S  + ++ N+PY+ I ++K +Q W++
Sbjct  127  IRWPKSRDQCWYRNVPYDWINNQKSNQHWLR  157



>gb|KFK37159.1| hypothetical protein AALP_AA4G221000 [Arabis alpina]
Length=592

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 53/85 (62%), Gaps = 1/85 (1%)
 Frame = +2

Query  521  FCPADYVDHMPCEDPRINSQLSREMNYYRERHCP-LPHETPICLIPPPEGYKVPVRWPES  697
             CP ++ +++PC DP  + Q S E +Y RERHCP   H+   CL+P P GYK P  WP+S
Sbjct  72   LCPKNFTNYIPCHDPSTSRQYSIERHYRRERHCPDSSHKKLRCLVPKPTGYKTPFTWPDS  131

Query  698  LHKIFHDNMPYNKIADRKGHQGWMK  772
             +  +  N+P+ K+A+ K  Q W++
Sbjct  132  RNYAWFKNVPFKKLAEFKKSQNWIR  156



>ref|XP_004983508.1| PREDICTED: LOW QUALITY PROTEIN: probable methyltransferase PMT21-like 
[Setaria italica]
Length=608

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 38/85 (45%), Positives = 56/85 (66%), Gaps = 6/85 (7%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNY---YRERHCPLPHETPICLIPPPEGYKVPVRWPE  694
            CPAD+ D+ PC DP+   +  R  NY   + ERHCP P +   CL+PPP+GYK P+RWP+
Sbjct  90   CPADFQDYTPCTDPK---RWRRYGNYRLSFMERHCPPPPDRQQCLVPPPKGYKPPIRWPK  146

Query  695  SLHKIFHDNMPYNKIADRKGHQGWM  769
            S  + ++ N+PY+ I  +K +Q W+
Sbjct  147  SKDQCWYRNVPYDWINSQKSNQHWL  171



>ref|XP_010054055.1| PREDICTED: probable methyltransferase PMT21 [Eucalyptus grandis]
 ref|XP_010054056.1| PREDICTED: probable methyltransferase PMT21 [Eucalyptus grandis]
 gb|KCW78439.1| hypothetical protein EUGRSUZ_D02595 [Eucalyptus grandis]
Length=604

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 55/92 (60%), Gaps = 2/92 (2%)
 Frame = +2

Query  503  EIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKV  676
            +I  + F  C +DY D+ PC DPR   +       + ERHCP   E   CL+PPP+GYK 
Sbjct  72   QIKSVSFPECSSDYQDYTPCTDPRRWKKYGTHRLTFMERHCPPIFERKECLVPPPDGYKP  131

Query  677  PVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+RWP+S    ++ N+PY+ I  +K +Q W++
Sbjct  132  PIRWPKSRDVCWYRNVPYDWINKQKSNQNWLR  163



>ref|XP_006439163.1| hypothetical protein CICLE_v10019302mg [Citrus clementina]
 gb|ESR52403.1| hypothetical protein CICLE_v10019302mg [Citrus clementina]
Length=629

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C   Y D+ PC+DP  + +  REM  YRERHCP   E   CLIP P  YK P +WP+S  
Sbjct  104  CDMSYSDYTPCQDPVRSRKFDREMAKYRERHCPKSEELLRCLIPAPPKYKTPFKWPQSRD  163

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
              ++DN+P+ +++  K  Q W++
Sbjct  164  YAWYDNIPHKELSIEKAGQNWIQ  186



>ref|XP_002519866.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF42470.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=501

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 58/96 (60%), Gaps = 7/96 (7%)
 Frame = +2

Query  506  IAPIQF-------CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPE  664
            +AP+Q        C ++Y D+ PC DPR   +   +   + ERHCP   E   CLIPPP+
Sbjct  63   VAPLQTKSTAFPECSSEYQDYTPCTDPRKWKKYGLQRLTFMERHCPPVFERKECLIPPPD  122

Query  665  GYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            GYK P++WP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  123  GYKSPIKWPKSRDQCWYRNVPYDWINKQKSNQNWLR  158



>ref|XP_006286418.1| hypothetical protein CARUB_v10003037mg [Capsella rubella]
 gb|EOA19316.1| hypothetical protein CARUB_v10003037mg [Capsella rubella]
Length=637

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 57/98 (58%), Gaps = 0/98 (0%)
 Frame = +2

Query  479  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  658
            + L E+ + I  ++ C     ++ PCED +   +  R M  YRERHCP   E   CLIPP
Sbjct  87   IDLKETNQTIKYLEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPP  146

Query  659  PEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P  YK+P +WP+S    ++DN+P+ +++  K  Q W++
Sbjct  147  PPNYKIPFKWPQSRDYAWYDNIPHKELSVEKAVQNWIQ  184



>ref|XP_006414006.1| hypothetical protein EUTSA_v10024718mg [Eutrema salsugineum]
 ref|XP_006414007.1| hypothetical protein EUTSA_v10024718mg [Eutrema salsugineum]
 ref|XP_006414008.1| hypothetical protein EUTSA_v10024718mg [Eutrema salsugineum]
 gb|ESQ55459.1| hypothetical protein EUTSA_v10024718mg [Eutrema salsugineum]
 gb|ESQ55460.1| hypothetical protein EUTSA_v10024718mg [Eutrema salsugineum]
 gb|ESQ55461.1| hypothetical protein EUTSA_v10024718mg [Eutrema salsugineum]
Length=600

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/92 (38%), Positives = 56/92 (61%), Gaps = 2/92 (2%)
 Frame = +2

Query  503  EIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKV  676
            ++  + F  C +DY D+ PC DPR   +       + ERHCP   +   CL+PPP GYK 
Sbjct  64   QVKSVSFSECSSDYQDYTPCTDPRKWKKYGTHRLTFMERHCPPVFDRKQCLVPPPNGYKP  123

Query  677  PVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+RWP+S ++ ++ N+PY+ I  +K +Q W++
Sbjct  124  PIRWPKSKNECWYRNVPYDWINKQKSNQNWLR  155



>ref|XP_007156365.1| hypothetical protein PHAVU_003G280100g [Phaseolus vulgaris]
 ref|XP_007156366.1| hypothetical protein PHAVU_003G280100g [Phaseolus vulgaris]
 gb|ESW28359.1| hypothetical protein PHAVU_003G280100g [Phaseolus vulgaris]
 gb|ESW28360.1| hypothetical protein PHAVU_003G280100g [Phaseolus vulgaris]
Length=598

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLH  703
            C ADY D+ PC DPR   +         ERHCP   E   CL+PPP+GYK P+RWP+S  
Sbjct  75   CSADYQDYTPCTDPRRWRKFGSYRLTLLERHCPPKFERKECLVPPPDGYKPPIRWPKSRD  134

Query  704  KIFHDNMPYNKIADRKGHQGWMK  772
            + ++ N+PY+ I  +K +Q W+K
Sbjct  135  ECWYRNVPYDWINKQKSNQHWLK  157



>ref|XP_010278811.1| PREDICTED: probable methyltransferase PMT21 [Nelumbo nucifera]
 ref|XP_010278812.1| PREDICTED: probable methyltransferase PMT21 [Nelumbo nucifera]
Length=607

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 56/92 (61%), Gaps = 2/92 (2%)
 Frame = +2

Query  503  EIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKV  676
            ++ P+ F  C  DY D+ PC DP+   +       + ERHCP   E   CL+PPP GY+V
Sbjct  74   KVQPVMFPECGIDYQDYTPCTDPKRWRKYDLHRLTFLERHCPPIFERKECLVPPPNGYRV  133

Query  677  PVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P+RWP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  134  PIRWPKSRGQCWYRNVPYDWINKQKSNQNWLR  165



>ref|XP_006282955.1| hypothetical protein CARUB_v10007621mg [Capsella rubella]
 gb|EOA15853.1| hypothetical protein CARUB_v10007621mg [Capsella rubella]
Length=600

 Score = 82.0 bits (201),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/97 (36%), Positives = 57/97 (59%), Gaps = 2/97 (2%)
 Frame = +2

Query  488  VESGREIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPP  661
            ++   ++  + F  C +DY D+ PC DPR   +       + ERHCP   +   CL+PPP
Sbjct  59   IDEAPQVKSVSFSECSSDYQDYTPCTDPRKWKKYGTHRLTFMERHCPPVFDRKQCLVPPP  118

Query  662  EGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             GYK P+RWP+S  + ++ N+PY+ I  +K +Q W++
Sbjct  119  NGYKPPIRWPKSKDQCWYRNVPYDWINKQKSNQNWLR  155



>ref|XP_009360657.1| PREDICTED: probable methyltransferase PMT24 [Pyrus x bretschneideri]
Length=805

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 51/79 (65%), Gaps = 4/79 (5%)
 Frame = +2

Query  542  DHMPCEDP--RINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFH  715
            D++PC D    I     R    +RERHCP   E P CL+P PEGYK P++WP S  KI++
Sbjct  285  DYIPCLDNWGSIKKLPGRGHYEHRERHCP--DEAPTCLVPLPEGYKRPIQWPTSRDKIWY  342

Query  716  DNMPYNKIADRKGHQGWMK  772
             N+P+ K+A+ KGHQ W+K
Sbjct  343  HNVPHTKLAEVKGHQNWVK  361



>ref|XP_006584650.1| PREDICTED: probable methyltransferase PMT26-like isoform X1 [Glycine 
max]
 ref|XP_006584651.1| PREDICTED: probable methyltransferase PMT26-like isoform X2 [Glycine 
max]
 ref|XP_006584652.1| PREDICTED: probable methyltransferase PMT26-like isoform X3 [Glycine 
max]
Length=842

 Score = 82.4 bits (202),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 53/79 (67%), Gaps = 4/79 (5%)
 Frame = +2

Query  542  DHMPCED--PRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFH  715
            D++PC D    I S  S +   +RER CP   E+P CL+P PEGYK P+ WP+S  KI++
Sbjct  321  DYIPCLDNLKAIKSLPSTKHYEHRERQCP--KESPTCLVPLPEGYKRPIEWPKSREKIWY  378

Query  716  DNMPYNKIADRKGHQGWMK  772
             N+P+ K+A+ KGHQ W+K
Sbjct  379  SNVPHTKLAEYKGHQNWVK  397



>ref|XP_010508464.1| PREDICTED: probable methyltransferase PMT19 [Camelina sativa]
 ref|XP_010508465.1| PREDICTED: probable methyltransferase PMT19 [Camelina sativa]
Length=603

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 51/84 (61%), Gaps = 1/84 (1%)
 Frame = +2

Query  524  CPADYVDHMPCEDPRINSQLSREMNYYRERHCP-LPHETPICLIPPPEGYKVPVRWPESL  700
            CP ++ +++PC DP    Q S E +Y RERHCP L  E   CL+  P GYK PV WPES 
Sbjct  85   CPKNFTNYLPCHDPSTARQYSIERHYRRERHCPDLAQEKFRCLVQKPSGYKTPVPWPESR  144

Query  701  HKIFHDNMPYNKIADRKGHQGWMK  772
               +  N+P+ K+A+ K  Q W++
Sbjct  145  SYAWFKNVPFKKLAEFKKSQNWVR  168



>ref|XP_006307041.1| hypothetical protein CARUB_v10008629mg [Capsella rubella]
 gb|EOA39939.1| hypothetical protein CARUB_v10008629mg [Capsella rubella]
Length=504

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 58/96 (60%), Gaps = 7/96 (7%)
 Frame = +2

Query  506  IAPIQF-------CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPE  664
            ++PIQ        C +++ D+ PC DP+   +       + ERHCP  +E   CLIPPP+
Sbjct  65   VSPIQVKSVSFPECGSEFQDYTPCTDPKRWKKYGTHRLSFLERHCPAVYEKSECLIPPPD  124

Query  665  GYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            GYK P+RWP+S  + ++ N+PY+ I  +K +Q W+K
Sbjct  125  GYKPPIRWPKSREQCWYRNVPYDWINKQKSNQHWLK  160



>ref|XP_008799999.1| PREDICTED: probable methyltransferase PMT21 isoform X2 [Phoenix 
dactylifera]
Length=550

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 9/105 (9%)
 Frame = +2

Query  485  LVESGRE--IAPIQF-------CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
            +++S +E  +AP+Q        C +DY D+ PC DP+   +       + ERHCP   E 
Sbjct  54   VIQSRKETAVAPLQIKSLAFPECSSDYQDYTPCTDPKRWRKYGNYRLSFMERHCPPLTER  113

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
              CL+PPP+GYK P+RWP+S  + ++ N+PY+ I ++K +Q W++
Sbjct  114  KQCLVPPPDGYKPPIRWPKSRDECWYRNVPYDWINNQKSNQHWLR  158



>ref|XP_002874627.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50886.1| dehydration-responsive family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=631

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 56/98 (57%), Gaps = 0/98 (0%)
 Frame = +2

Query  479  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  658
            + L E+ + I   + C     ++ PCED +   +  R M  YRERHCP   E   CLIPP
Sbjct  84   IELKETNQTIKYFEPCELSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPP  143

Query  659  PEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P  YK+P +WP+S    ++DN+P+ +++  K  Q W++
Sbjct  144  PPNYKIPFKWPQSRDYAWYDNIPHKELSVEKAVQNWIQ  181



>ref|XP_006307042.1| hypothetical protein CARUB_v10008629mg [Capsella rubella]
 gb|EOA39940.1| hypothetical protein CARUB_v10008629mg [Capsella rubella]
Length=602

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 58/96 (60%), Gaps = 7/96 (7%)
 Frame = +2

Query  506  IAPIQF-------CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPE  664
            ++PIQ        C +++ D+ PC DP+   +       + ERHCP  +E   CLIPPP+
Sbjct  65   VSPIQVKSVSFPECGSEFQDYTPCTDPKRWKKYGTHRLSFLERHCPAVYEKSECLIPPPD  124

Query  665  GYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            GYK P+RWP+S  + ++ N+PY+ I  +K +Q W+K
Sbjct  125  GYKPPIRWPKSREQCWYRNVPYDWINKQKSNQHWLK  160



>ref|NP_001065036.1| Os10g0510400 [Oryza sativa Japonica Group]
 gb|AAK84446.1|AC087192_7 unknown protein [Oryza sativa Japonica Group]
 gb|AAP54570.1| dehydration-responsive family protein, putative, expressed [Oryza 
sativa Japonica Group]
 gb|ABB47874.1| dehydration-responsive family protein, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF26950.1| Os10g0510400 [Oryza sativa Japonica Group]
 dbj|BAG93354.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE51256.1| hypothetical protein OsJ_32126 [Oryza sativa Japonica Group]
Length=634

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 73/134 (54%), Gaps = 10/134 (7%)
 Frame = +2

Query  401  TPLGDSLAASGRQALL--SGDSQQRSL------LVTLVESGREIA--PIQFCPADYVDHM  550
            T +G   AA+G+ + +   G + Q SL       ++L ++G E A  P   CP ++ ++ 
Sbjct  56   TKVGCDPAAAGQSSAVPSFGSASQESLDFEAHHQLSLDDTGAEAAVQPFPACPLNFSEYT  115

Query  551  PCEDPRINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPY  730
            PCED +   +  R M  YRERHCP   E   CLIP P  Y+ P +WP+S    + +N+P+
Sbjct  116  PCEDRKRGRRFERAMLVYRERHCPGKDEEIRCLIPAPPKYRTPFKWPQSRDFAWFNNIPH  175

Query  731  NKIADRKGHQGWMK  772
             +++  K  Q W++
Sbjct  176  KELSIEKAVQNWIQ  189



>ref|XP_008799998.1| PREDICTED: probable methyltransferase PMT20 isoform X1 [Phoenix 
dactylifera]
Length=598

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 64/105 (61%), Gaps = 9/105 (9%)
 Frame = +2

Query  485  LVESGRE--IAPIQF-------CPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHET  637
            +++S +E  +AP+Q        C +DY D+ PC DP+   +       + ERHCP   E 
Sbjct  54   VIQSRKETAVAPLQIKSLAFPECSSDYQDYTPCTDPKRWRKYGNYRLSFMERHCPPLTER  113

Query  638  PICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
              CL+PPP+GYK P+RWP+S  + ++ N+PY+ I ++K +Q W++
Sbjct  114  KQCLVPPPDGYKPPIRWPKSRDECWYRNVPYDWINNQKSNQHWLR  158



>ref|XP_010455441.1| PREDICTED: probable methyltransferase PMT17 [Camelina sativa]
Length=633

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 56/98 (57%), Gaps = 0/98 (0%)
 Frame = +2

Query  479  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  658
            + L E+ + I   + C     ++ PCED +   +  R M  YRERHCP   E   CLIPP
Sbjct  86   IDLKETNQTIKYFEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPP  145

Query  659  PEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P  YK+P +WP+S    ++DN+P+ +++  K  Q W++
Sbjct  146  PPNYKIPFKWPQSRDYAWYDNIPHKELSVEKAVQNWIQ  183



>ref|XP_010421961.1| PREDICTED: probable methyltransferase PMT17 [Camelina sativa]
Length=637

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 56/98 (57%), Gaps = 0/98 (0%)
 Frame = +2

Query  479  VTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIPP  658
            + L E+ + I   + C     ++ PCED +   +  R M  YRERHCP   E   CLIPP
Sbjct  86   IDLKETNQTIKYFEPCDLSLSEYTPCEDRQRGRRFDRNMMKYRERHCPSKDELLYCLIPP  145

Query  659  PEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            P  YK+P +WP+S    ++DN+P+ +++  K  Q W++
Sbjct  146  PPNYKIPFKWPQSRDYAWYDNIPHKELSVEKAVQNWIQ  183



>ref|XP_004982637.1| PREDICTED: probable methyltransferase PMT18-like isoform X1 [Setaria 
italica]
Length=642

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 61/114 (54%), Gaps = 1/114 (1%)
 Frame = +2

Query  431  GRQALLSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRE  610
            G   +L  D+  R L +   ++G  +     CP ++ ++ PCED     +  R M  YRE
Sbjct  84   GSGEVLDFDAHHR-LAINDTDAGAGLQQFPACPLNFSEYTPCEDRTRGRRFDRTMLVYRE  142

Query  611  RHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            RHCP   E   CLIP P GY+ P +WP+S    + +N+P+ +++  K  Q W++
Sbjct  143  RHCPGKDEQVRCLIPAPPGYRTPFKWPKSRDYAYFNNIPHKELSIEKAVQNWIQ  196



>gb|KHN11837.1| Putative methyltransferase PMT20 [Glycine soja]
Length=597

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 58/96 (60%), Gaps = 10/96 (10%)
 Frame = +2

Query  503  EIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYR----ERHCPLPHETPICLIPPPE  664
            ++ PI F  C  DY D+ PC DPR      R+   YR    ERHCP   E   CL+PPP+
Sbjct  65   QVKPISFPECSLDYQDYTPCTDPR----RWRKYGMYRLTLLERHCPSVFERKECLVPPPD  120

Query  665  GYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            GYK P+RWP+S  + ++ N+PY+ I ++K  Q W++
Sbjct  121  GYKPPIRWPKSRDECWYRNVPYDWINNQKSDQHWLR  156



>ref|XP_010277710.1| PREDICTED: probable methyltransferase PMT24 [Nelumbo nucifera]
Length=866

 Score = 82.0 bits (201),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 4/79 (5%)
 Frame = +2

Query  542  DHMPCEDPRINSQLSREMNYY--RERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFH  715
            D++PC D  +  +  R   +Y  RERHCP   E P CL+P PEGY+  ++WP+S  KI++
Sbjct  345  DYIPCLDNLLAIRKLRSTKHYEHRERHCP--EEAPTCLVPLPEGYRSSIKWPKSREKIWY  402

Query  716  DNMPYNKIADRKGHQGWMK  772
             N+P+ K+A+ KGHQ W+K
Sbjct  403  YNVPHTKLAEVKGHQNWVK  421



>ref|XP_003534313.1| PREDICTED: probable methyltransferase PMT20-like isoform X1 [Glycine 
max]
 ref|XP_006587634.1| PREDICTED: probable methyltransferase PMT20-like isoform X2 [Glycine 
max]
Length=597

 Score = 81.6 bits (200),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 41/96 (43%), Positives = 58/96 (60%), Gaps = 10/96 (10%)
 Frame = +2

Query  503  EIAPIQF--CPADYVDHMPCEDPRINSQLSREMNYYR----ERHCPLPHETPICLIPPPE  664
            ++ PI F  C  DY D+ PC DPR      R+   YR    ERHCP   E   CL+PPP+
Sbjct  65   QVKPISFPECSLDYQDYTPCTDPR----RWRKYGMYRLTLLERHCPSVFERKECLVPPPD  120

Query  665  GYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            GYK P+RWP+S  + ++ N+PY+ I ++K  Q W++
Sbjct  121  GYKPPIRWPKSRDECWYRNVPYDWINNQKSDQHWLR  156



>ref|XP_004982638.1| PREDICTED: probable methyltransferase PMT18-like isoform X2 [Setaria 
italica]
Length=638

 Score = 81.6 bits (200),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 61/114 (54%), Gaps = 1/114 (1%)
 Frame = +2

Query  431  GRQALLSGDSQQRSLLVTLVESGREIAPIQFCPADYVDHMPCEDPRINSQLSREMNYYRE  610
            G   +L  D+  R L +   ++G  +     CP ++ ++ PCED     +  R M  YRE
Sbjct  80   GSGEVLDFDAHHR-LAINDTDAGAGLQQFPACPLNFSEYTPCEDRTRGRRFDRTMLVYRE  138

Query  611  RHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
            RHCP   E   CLIP P GY+ P +WP+S    + +N+P+ +++  K  Q W++
Sbjct  139  RHCPGKDEQVRCLIPAPPGYRTPFKWPKSRDYAYFNNIPHKELSIEKAVQNWIQ  192



>emb|CDY48339.1| BnaA09g26820D [Brassica napus]
Length=756

 Score = 82.0 bits (201),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 57/78 (73%), Gaps = 3/78 (4%)
 Frame = +2

Query  542  DHMPCEDP-RINSQLSREMNYYRERHCPLPHETPICLIPPPEGYKVPVRWPESLHKIFHD  718
            D++PC D  +   +L+R+   +RERHCP   E+P CL+P PEGYK  ++WP+S  KI+++
Sbjct  232  DYIPCLDNWQAIRKLARKHYEHRERHCP--EESPTCLVPLPEGYKRSIKWPKSREKIWYN  289

Query  719  NMPYNKIADRKGHQGWMK  772
            N+P+ K+A+ KGHQ W+K
Sbjct  290  NVPHMKLAEVKGHQNWVK  307



>gb|KEH31563.1| methyltransferase PMT14-like protein, putative [Medicago truncatula]
Length=1599

 Score = 82.4 bits (202),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 38/99 (38%), Positives = 51/99 (52%), Gaps = 1/99 (1%)
 Frame = +2

Query  479  VTLVESGREIAPI-QFCPADYVDHMPCEDPRINSQLSREMNYYRERHCPLPHETPICLIP  655
            V +VE     A + + C   Y D+ PC++        RE   YRERHCP   E   CLIP
Sbjct  73   VEIVEQSEPKAKMFKACDVKYADYTPCQEQDRAMTFPRENMIYRERHCPPQEEKLRCLIP  132

Query  656  PPEGYKVPVRWPESLHKIFHDNMPYNKIADRKGHQGWMK  772
             PEGY  P  WP+S    ++ N+PY  +   K +Q W+K
Sbjct  133  APEGYTTPFPWPKSRDYAYYANVPYKHLTVEKANQNWVK  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1538697559425